F480446

General Info

Members Datasets Scaffolds Average Seq Length
778 421 1556 270

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2784746768|2785366704
Length 315
Sequence HAPPGSPEPDISEIDQNEASPSEAAHSEASPPEATDNGTGTAATPTSPVDLEPIVPASSRRTRIPRWLRRTTGPVLLLALWQLLSGTGVLTADVLASPGRIAQVAGDLIADGSLVSAMTTSLQRVAGGLLLGALVGTGLALVSGLFRIGEDIVDAPVQMLRTVPFVGLIPLFIIWFGIGEAPKIAIITLGVTFPLYLNIYAGIRGVDSQLIEAGESLGLSRWGLVRHVILPGALPGAMTGLRYSLGIAWLALVFAEQVNADSGIGFLMVQARDFLRTDVIVVCLIVYAFLGLLADFVVRSLERLLLQWRPTFTGR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
54 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
57 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
74 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
120 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
124 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
125 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
128 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
129 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
130 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
131 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
132 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
133 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
134 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
135 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
136 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
142 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
143 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
147 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
151 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
158 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
159 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
160 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
161 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
162 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
163 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
164 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
165 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
166 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
167 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
168 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
169 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
170 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
171 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
172 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
173 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
174 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
175 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
178 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
179 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
183 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
189 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
193 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
194 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
195 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
196 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
197 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
198 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
199 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
200 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
205 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
206 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
207 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
208 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
209 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
210 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
213 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
214 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
217 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
218 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
219 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
226 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
227 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
228 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
231 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
232 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
233 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
234 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
235 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
236 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
237 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
240 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
241 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
242 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
243 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
244 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
245 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
246 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
247 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
248 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
249 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
253 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
260 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
261 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
265 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
266 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
267 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
268 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
269 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
270 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
271 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
272 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
273 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
276 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
285 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
286 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
287 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
288 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
289 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
290 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
291 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
292 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
293 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
294 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
295 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
296 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
297 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
298 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
299 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
300 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
301 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
302 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
303 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
304 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
305 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
306 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
307 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
308 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
309 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
310 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
311 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
312 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
313 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
314 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
315 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
316 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
317 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
318 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
319 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
320 2506783011 Frankia datiscae Dg1 Isolate Nodule
321 2511231004 Pseudomonas sp. GM102 Isolate Nodule
322 2511231007 Pseudomonas sp. GM18 Isolate Nodule
323 2511231008 Pseudomonas sp. GM21 Isolate Nodule
324 2511231014 Pseudomonas sp. GM48 Isolate Nodule
325 2511231016 Pseudomonas sp. GM50 Isolate Nodule
326 2511231021 Pseudomonas sp. GM78 Isolate Nodule
327 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
328 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
329 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
330 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
331 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
332 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
333 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
334 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
335 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
336 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
337 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
338 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
339 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
340 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
341 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
342 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
343 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
344 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
345 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
346 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
347 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
348 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
349 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
350 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
351 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
352 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
353 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
354 2643221578 Streptomyces sp. Root63 Isolate Unclassified
355 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
356 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
357 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
358 2643221647 Streptomyces sp. Root369 Isolate Unclassified
359 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
360 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
361 2643221692 Nocardia sp. Root136 Isolate Unclassified
362 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
363 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
364 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
365 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
366 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
367 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
368 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
369 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
370 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
371 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
372 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
373 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
374 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
375 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
376 2849560528 Caulobacter zeae 410 Isolate Unclassified
377 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
378 2851153111 Caulobacter radicis 736 Isolate Unclassified
379 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
380 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
381 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
382 2862574272 Streptomyces sp. AcE210 Isolate Nodule
383 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
384 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
385 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
386 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
387 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
388 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
389 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
390 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
391 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
392 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
393 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
394 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
395 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
396 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
397 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
398 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
399 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
400 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
401 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
402 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
403 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
404 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
405 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
406 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
407 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
408 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
409 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
410 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
411 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
412 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
413 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
414 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
415 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
416 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
417 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
418 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
419 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
420 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
421 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.76
Metatranscriptomes 0
Isolates 13.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.4
Nodule 1.54
Rhizoplane 4.37
Rhizosphere 65.42
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3039297 2162886007 Bacteria 3638
2 JGI24739J22299_10064354 3300001989 Bacteria 1153
3 JGI25162J39368_1000054 3300002737 Bacteria 147779
4 JGI25163J39215_1000106 3300002771 Bacteria 35005
5 JGI25164J39214_1000029 3300002772 Bacteria 147779
6 JGI25406J46586_10002057 3300003203 Bacteria 9500
7 JGI25165J46597_1000111 3300003214 Bacteria 147779
8 rootH2_10025695 3300003320 Bacteria 4019
9 rootL2_10029067 3300003322 Bacteria 10650
10 rootL2_10158374 3300003322 Bacteria 1357
11 Ga0055526_1022180 3300003771 Bacteria 2172
12 Ga0055537_1003505 3300003773 Bacteria 4806
13 Ga0055524_1012948 3300003775 Bacteria 3174
14 Ga0055536_1000005 3300003781 Bacteria 383598
15 Ga0055536_1000734 3300003781 Bacteria 22052
16 Ga0055536_1006940 3300003781 Bacteria 5160
17 Ga0055536_1008111 3300003781 Bacteria 4576
18 Ga0055534_1011018 3300003784 Bacteria 1858
19 Ga0055528_1008429 3300003790 Bacteria 4418
20 Ga0055530_10000001 3300003791 Bacteria 383067
21 Ga0055530_10000066 3300003791 Bacteria 93405
22 Ga0055530_10000165 3300003791 Bacteria 60120
23 Ga0055530_10000222 3300003791 Bacteria 50412
24 Ga0055530_10039056 3300003791 Bacteria 1175
25 Ga0055540_1000186 3300003792 Bacteria 60120
26 Ga0055540_1000258 3300003792 Bacteria 47854
27 Ga0055531_10001339 3300003794 Bacteria 18391
28 Ga0055531_10003634 3300003794 Bacteria 9731
29 Ga0055531_10005696 3300003794 Bacteria 7228
30 Ga0065165_1001271 3300005262 Bacteria 28528
31 Ga0065714_10003126 3300005288 Bacteria 11417
32 Ga0065714_10009959 3300005288 Bacteria 3772
33 Ga0065714_10011828 3300005288 Bacteria 5184
34 Ga0065714_10064839 3300005288 Bacteria 17232
35 Ga0065704_10097097 3300005289 Bacteria 2409
36 Ga0065704_10097927 3300005289 Bacteria 2370
37 Ga0065712_10067982 3300005290 Bacteria 18146
38 Ga0070658_10001281 3300005327 Bacteria 21475
39 Ga0070666_10162510 3300005335 Bacteria 1561
40 Ga0070680_100011064 3300005336 Bacteria 6973
41 Ga0070682_100524627 3300005337 Unclassified 922
42 Ga0070660_100019870 3300005339 Bacteria 4928
43 Ga0070668_100002528 3300005347 Bacteria 13464
44 Ga0070668_100017490 3300005347 Bacteria 5374
45 Ga0070669_100001571 3300005353 Bacteria 16556
46 Ga0070669_100001764 3300005353 Bacteria 15594
47 Ga0070671_100003686 3300005355 Bacteria 12015
48 Ga0070671_100003780 3300005355 Bacteria 11876
49 Ga0070667_100020533 3300005367 Bacteria 5484
50 Ga0070667_100028263 3300005367 Bacteria 4668
51 Ga0070678_100039767 3300005456 Bacteria 3321
52 Ga0070681_10003845 3300005458 Bacteria 14121
53 Ga0070679_100007593 3300005530 Bacteria 10147
54 Ga0070697_100077656 3300005536 Bacteria 2732
55 Ga0070672_100374900 3300005543 Bacteria 1216
56 Ga0070665_100000107 3300005548 Bacteria 156048
57 Ga0070665_100008246 3300005548 Bacteria 10542
58 Ga0070665_100033770 3300005548 Bacteria 5146
59 Ga0068855_100005081 3300005563 Bacteria 16038
60 Ga0068855_100276610 3300005563 Bacteria 1866
61 Ga0068854_100072783 3300005578 Bacteria 2517
62 Ga0068856_100411476 3300005614 Bacteria 1372
63 Ga0068863_100018630 3300005841 Bacteria 6642
64 Ga0068860_100015006 3300005843 Bacteria 7571
65 Ga0068862_100000074 3300005844 Bacteria 118036
66 Ga0068862_100016576 3300005844 Bacteria 6136
67 Ga0081539_10000417 3300005985 Bacteria 90642
68 Ga0075363_100070972 3300006048 Bacteria 1892
69 Ga0075364_10005137 3300006051 Bacteria 7590
70 Ga0075364_10005211 3300006051 Bacteria 7545
71 Ga0075362_10019711 3300006177 Bacteria 2809
72 Ga0075369_10006670 3300006186 Bacteria 4376
73 Ga0075366_10143609 3300006195 Bacteria 1444
74 Ga0075370_10177081 3300006353 Bacteria 1255
75 Ga0068865_100244176 3300006881 Bacteria 1414
76 Ga0097620_100210162 3300006931 Bacteria 2032
77 Ga0079104_1000006 3300006946 Bacteria 396255
78 Ga0099826_10000572 3300006948 Bacteria 18513
79 Ga0105251_10000005 3300009011 Bacteria 259226
80 Ga0105251_10005637 3300009011 Bacteria 8135
81 Ga0105251_10030203 3300009011 Bacteria 2723
82 Ga0105251_10030612 3300009011 Bacteria 2700
83 Ga0105244_10001015 3300009036 Bacteria 23506
84 Ga0105244_10001477 3300009036 Bacteria 18965
85 Ga0105250_10004047 3300009092 Bacteria 6822
86 Ga0105250_10012357 3300009092 Bacteria 3526
87 Ga0105240_10014297 3300009093 Bacteria 10839
88 Ga0105247_10119490 3300009101 Bacteria 1706
89 Ga0105243_10000144 3300009148 Bacteria 81484
90 Ga0105243_10024932 3300009148 Bacteria 4566
91 Ga0105248_10003233 3300009177 Bacteria 18069
92 Ga0105248_10037790 3300009177 Bacteria 5403
93 Ga0105238_10012868 3300009551 Bacteria 8444
94 Ga0105249_10027254 3300009553 Bacteria 5156
95 Ga0105249_10160716 3300009553 Bacteria 2171
96 Ga0105239_10132598 3300010375 Bacteria 2772
97 Ga0105239_10811772 3300010375 Bacteria 1072
98 Ga0105246_10019373 3300011119 Bacteria 4347
99 Ga0105246_10049033 3300011119 Bacteria 2890
100 Ga0157371_10000063 3300013102 Bacteria 169490
101 Ga0157371_10000925 3300013102 Bacteria 32949
102 Ga0157370_10002160 3300013104 Bacteria 24009
103 Ga0157370_10030558 3300013104 Bacteria 5278
104 Ga0157370_10032695 3300013104 Bacteria 5078
105 Ga0157369_10227871 3300013105 Bacteria 1949
106 Ga0163162_10000551 3300013306 Bacteria 34607
107 Ga0163162_10031044 3300013306 Bacteria 5298
108 Ga0182008_10000785 3300014497 Bacteria 22221
109 Ga0182008_10001096 3300014497 Bacteria 18678
110 Ga0182006_1003571 3300015261 Bacteria 7926
111 Ga0182006_1006128 3300015261 Bacteria 5622
112 Ga0182006_1007784 3300015261 Bacteria 4885
113 Ga0182007_10000682 3300015262 Bacteria 19509
114 Ga0182007_10001650 3300015262 Bacteria 11813
115 Ga0182005_1015072 3300015265 Bacteria 2157
116 Ga0183367_1003 3300015688 Bacteria 814276
117 Ga0163161_10003171 3300017792 Bacteria 11599
118 Ga0213872_10159707 3300021361 Bacteria 981
119 Ga0213876_10161140 3300021384 Unclassified 1193
120 Ga0209760_100015 3300025207 Bacteria 176281
121 Ga0207427_100001 3300025231 Bacteria 1410763
122 Ga0209437_100003 3300025233 Bacteria 1517827
123 Ga0209026_1002402 3300025250 Bacteria 7062
124 Ga0209233_1000007 3300025261 Bacteria 1411234
125 Ga0209565_1000281 3300025263 Bacteria 50202
126 Ga0209673_1001574 3300025273 Bacteria 20330
127 Ga0209675_1000097 3300025291 Bacteria 131546
128 Ga0209675_1019109 3300025291 Bacteria 1896
129 Ga0209676_1000003 3300025292 Bacteria 1454178
130 Ga0209676_1000070 3300025292 Bacteria 312074
131 Ga0209676_1000673 3300025292 Bacteria 48566
132 Ga0209676_1000927 3300025292 Bacteria 36244
133 Ga0209676_1004357 3300025292 Bacteria 7923
134 Ga0209676_1021711 3300025292 Bacteria 2147
135 Ga0209676_1047271 3300025292 Bacteria 1158
136 Ga0209025_1013670 3300025294 Bacteria 5075
137 Ga0209564_1000557 3300025295 Bacteria 59834
138 Ga0209564_1019939 3300025295 Bacteria 2481
139 Ga0209758_1000608 3300025297 Bacteria 55483
140 Ga0209758_1001275 3300025297 Bacteria 31177
141 Ga0209758_1001477 3300025297 Bacteria 27508
142 Ga0209050_1000004 3300025298 Bacteria 1600040
143 Ga0209050_1000037 3300025298 Bacteria 415612
144 Ga0209050_1000038 3300025298 Bacteria 412635
145 Ga0209050_1000627 3300025298 Bacteria 55036
146 Ga0209050_1002783 3300025298 Bacteria 14009
147 Ga0209050_1011541 3300025298 Bacteria 4169
148 Ga0209050_1027233 3300025298 Bacteria 1889
149 Ga0209256_1001941 3300025299 Bacteria 18811
150 Ga0209256_1003017 3300025299 Bacteria 12452
151 Ga0209256_1013803 3300025299 Bacteria 2969
152 Ga0209051_1000006 3300025303 Bacteria 1015785
153 Ga0209051_1000040 3300025303 Bacteria 315055
154 Ga0209257_1000328 3300025304 Bacteria 99542
155 Ga0209257_1001043 3300025304 Bacteria 36902
156 Ga0209257_1001060 3300025304 Bacteria 36360
157 Ga0209257_1002314 3300025304 Bacteria 19259
158 Ga0209257_1009271 3300025304 Bacteria 5322
159 Ga0209257_1012736 3300025304 Bacteria 3842
160 Ga0207696_1003663 3300025711 Bacteria 6900
161 Ga0207696_1041113 3300025711 Bacteria 1352
162 Ga0207655_1003129 3300025728 Bacteria 12523
163 Ga0207713_1000036 3300025735 Bacteria 259717
164 Ga0207713_1001885 3300025735 Bacteria 15929
165 Ga0207713_1031618 3300025735 Bacteria 2336
166 Ga0207713_1045466 3300025735 Bacteria 1793
167 Ga0207710_10105809 3300025900 Bacteria 1331
168 Ga0207680_10137414 3300025903 Bacteria 1617
169 Ga0207705_10025961 3300025909 Bacteria 4180
170 Ga0207654_10068346 3300025911 Bacteria 2101
171 Ga0207707_10003543 3300025912 Bacteria 13814
172 Ga0207695_10012701 3300025913 Bacteria 10085
173 Ga0207660_10167993 3300025917 Bacteria 1696
174 Ga0207657_10281967 3300025919 Unclassified 1319
175 Ga0207652_10011650 3300025921 Bacteria 7094
176 Ga0207681_10001221 3300025923 Bacteria 16554
177 Ga0207681_10001397 3300025923 Bacteria 15603
178 Ga0207694_10007190 3300025924 Bacteria 8454
179 Ga0207644_10055190 3300025931 Bacteria 2863
180 Ga0207709_10001160 3300025935 Bacteria 19160
181 Ga0207709_10205008 3300025935 Bacteria 1411
182 Ga0207704_10185123 3300025938 Bacteria 1509
183 Ga0207711_10003235 3300025941 Bacteria 14198
184 Ga0207711_10017238 3300025941 Bacteria 6003
185 Ga0207711_10382345 3300025941 Bacteria 1306
186 Ga0207667_10021876 3300025949 Bacteria 7077
187 Ga0207712_10032850 3300025961 Bacteria 3504
188 Ga0207712_10146774 3300025961 Bacteria 1817
189 Ga0207668_10001443 3300025972 Bacteria 13995
190 Ga0207668_10006938 3300025972 Bacteria 6722
191 Ga0207658_10001032 3300025986 Bacteria 22661
192 Ga0207658_10092397 3300025986 Bacteria 2350
193 Ga0207702_10042525 3300026078 Bacteria 3812
194 Ga0207641_10003617 3300026088 Bacteria 13640
195 Ga0207683_10217077 3300026121 Bacteria 1742
196 Ga0209281_1000011 3300027111 Bacteria 695292
197 Ga0209371_1000609 3300027312 Bacteria 31984
198 Ga0268266_10000354 3300028379 Bacteria 70983
199 Ga0268266_10007811 3300028379 Bacteria 9588
200 Ga0268266_10009243 3300028379 Bacteria 8694
201 Ga0268266_10417546 3300028379 Bacteria 1271
202 Ga0268265_10000847 3300028380 Bacteria 28741
203 Ga0268265_10005338 3300028380 Bacteria 8804
204 Ga0268265_10097822 3300028380 Bacteria 2362
205 Ga0265319_1026094 3300028563 Bacteria 2085
206 Ga0265318_10000139 3300028577 Bacteria 66471
207 Ga0307517_10048414 3300028786 Bacteria 4374
208 Ga0307517_10074950 3300028786 Bacteria 2975
209 Ga0307515_10000524 3300028794 Bacteria 91311
210 Ga0307515_10027774 3300028794 Bacteria 9653
211 Ga0307515_10058201 3300028794 Bacteria 5571
212 Ga0268256_1000527 3300030500 Bacteria 31984
213 Ga0307511_10011009 3300030521 Bacteria 8931
214 Ga0307511_10037288 3300030521 Bacteria 4202
215 Ga0307511_10100046 3300030521 Bacteria 1909
216 Ga0307512_10006750 3300030522 Bacteria 11541
217 Ga0307512_10015575 3300030522 Bacteria 7039
218 Ga0307512_10040433 3300030522 Bacteria 3892
219 Ga0316177_1222324 3300030731 Bacteria 2013
220 Ga0265330_10003994 3300031235 Bacteria 7570
221 Ga0265332_10003516 3300031238 Bacteria 7534
222 Ga0265328_10002301 3300031239 Bacteria 8605
223 Ga0265320_10002481 3300031240 Bacteria 12829
224 Ga0265329_10000367 3300031242 Bacteria 23949
225 Ga0265339_10077377 3300031249 Bacteria 1763
226 Ga0265331_10004641 3300031250 Bacteria 8517
227 Ga0265327_10000175 3300031251 Bacteria 137193
228 Ga0265316_10008789 3300031344 Bacteria 9334
229 Ga0307513_10015813 3300031456 Bacteria 9134
230 Ga0307513_10103139 3300031456 Bacteria 2869
231 Ga0307509_10002942 3300031507 Bacteria 26804
232 Ga0307509_10003139 3300031507 Bacteria 25603
233 Ga0307508_10029395 3300031616 Bacteria 4968
234 Ga0307508_10049105 3300031616 Bacteria 3758
235 Ga0307508_10229675 3300031616 Bacteria 1454
236 Ga0307508_10241856 3300031616 Bacteria 1402
237 Ga0307514_10004958 3300031649 Bacteria 12072
238 Ga0265314_10013933 3300031711 Bacteria 6466
239 Ga0265342_10001175 3300031712 Bacteria 24900
240 Ga0307516_10006745 3300031730 Bacteria 13416
241 Ga0307518_10178376 3300031838 Bacteria 1439
242 Ga0307518_10186862 3300031838 Bacteria 1393
243 Ga0307412_10038740 3300031911 Bacteria 3072
244 Ga0307414_10440785 3300032004 Bacteria 1140
245 Ga0307507_10007410 3300033179 Bacteria 15995
246 Ga0307507_10193809 3300033179 Bacteria 1422
247 Ga0307510_10009355 3300033180 Bacteria 11671
248 Ga0307510_10024282 3300033180 Bacteria 7007
249 Ga0307510_10054411 3300033180 Bacteria 4192
250 Ga0307510_10058361 3300033180 Bacteria 3996
251 Ga0307510_10219888 3300033180 Bacteria 1412
252 Ga0395898_0002157 3300037466 Bacteria 24154
253 Ga0395901_0161915 3300038443 Bacteria 2350
254 Ga0436365_0466215 3300039437 Bacteria 7739
255 Ga0436361_0804027 3300039447 Bacteria 6492
256 Ga0436361_0989786 3300039447 Bacteria 1846
257 Ga0436363_1493638 3300039450 Bacteria 2636
258 Ga0439438_000200 3300041405 Bacteria 27336
259 Ga0439438_000450 3300041405 Bacteria 18562
260 Ga0439438_000666 3300041405 Bacteria 15441
261 Ga0439447_006761 3300041407 Bacteria 3688
262 Ga0439461_0009575 3300041410 Bacteria 1760
263 Ga0439466_0013030 3300041411 Bacteria 3050
264 Ga0451841_0680686 3300041498 Bacteria 1075
265 Ga0451851_0122701 3300041507 Bacteria 1141
266 Ga0451853_1601412 3300041512 Bacteria 2011
267 Ga0451853_3602439 3300041512 Bacteria 5479
268 Ga0439448_0008535 3300042005 Bacteria 3003
269 Ga0439449_0014725 3300042007 Bacteria 2939
270 Ga0439452_000115 3300042010 Bacteria 63101
271 Ga0439452_000826 3300042010 Bacteria 14386
272 Ga0439455_0037657 3300042012 Bacteria 1227
273 Ga0439456_000816 3300042013 Bacteria 6313
274 Ga0439463_000202 3300042016 Bacteria 16002
275 Ga0439463_026153 3300042016 Bacteria 1465
276 Ga0450900_006822 3300042136 Bacteria 1392
277 Ga0439446_0004310 3300042156 Bacteria 3601
278 Ga0439458_0004574 3300042157 Bacteria 3166
279 Ga0439435_0002850 3300042436 Bacteria 3505
280 Ga0466969_0015985 3300044656 Bacteria 3933
281 Ga0466972_0004929 3300044658 Bacteria 6699
282 Ga0466961_0012375 3300044693 Bacteria 5455
283 Ga0466960_0003455 3300044901 Bacteria 6079
284 Ga0495617_000044 3300046452 Bacteria 119709
285 Ga0495617_013499 3300046452 Bacteria 2781
286 Ga0495617_015757 3300046452 Bacteria 2558
287 Ga0495617_061724 3300046452 Bacteria 1239
288 Ga0495627_000008 3300046453 Bacteria 572150
289 Ga0495627_002624 3300046453 Bacteria 8462
290 Ga0495627_005481 3300046453 Bacteria 5111
291 Ga0495627_012240 3300046453 Bacteria 3052
292 Ga0495592_0020586 3300046454 Bacteria 5020
293 Ga0495603_0000009 3300046455 Bacteria 72869
294 Ga0495603_0009296 3300046455 Bacteria 5944
295 Ga0495603_0297721 3300046455 Bacteria 926
296 Ga0495590_0000698 3300046457 Bacteria 15366
297 Ga0495590_0002258 3300046457 Bacteria 8044
298 Ga0495591_000018 3300046458 Bacteria 232216
299 Ga0495591_000088 3300046458 Bacteria 102486
300 Ga0495591_000300 3300046458 Bacteria 45180
301 Ga0495591_010704 3300046458 Bacteria 3531
302 Ga0495629_0022313 3300046459 Bacteria 4513
303 Ga0495638_0000160 3300046460 Bacteria 105110
304 Ga0495638_0000589 3300046460 Bacteria 41015
305 Ga0495638_0004745 3300046460 Bacteria 10253
306 Ga0495638_0007339 3300046460 Bacteria 7916
307 Ga0495638_0010099 3300046460 Bacteria 6577
308 Ga0495638_0020681 3300046460 Bacteria 4345
309 Ga0495638_0035080 3300046460 Bacteria 3198
310 Ga0495638_0064881 3300046460 Bacteria 2249
311 Ga0495638_0092995 3300046460 Bacteria 1814
312 Ga0495638_0095347 3300046460 Bacteria 1787
313 Ga0495651_0021486 3300046462 Bacteria 5016
314 Ga0495653_0000002 3300046463 Bacteria 507262
315 Ga0495650_0000017 3300046471 Bacteria 542552
316 Ga0495650_0007765 3300046471 Bacteria 6382
317 Ga0495650_0010868 3300046471 Bacteria 5045
318 Ga0495605_0000067 3300046474 Bacteria 138871
319 Ga0495605_0000088 3300046474 Bacteria 119191
320 Ga0495605_0000158 3300046474 Bacteria 86829
321 Ga0495605_0000522 3300046474 Bacteria 32534
322 Ga0495605_0000806 3300046474 Bacteria 22409
323 Ga0495605_0004355 3300046474 Bacteria 8326
324 Ga0495605_0007282 3300046474 Bacteria 6285
325 Ga0495605_0012723 3300046474 Bacteria 4660
326 Ga0495605_0017337 3300046474 Bacteria 3880
327 Ga0495605_0023420 3300046474 Bacteria 3247
328 Ga0495605_0043272 3300046474 Bacteria 2233
329 Ga0495605_0069504 3300046474 Bacteria 1667
330 Ga0495605_0090255 3300046474 Bacteria 1421
331 Ga0495662_0000110 3300046476 Bacteria 30405
332 Ga0495664_0001686 3300046477 Bacteria 11750
333 Ga0495584_0000083 3300046491 Bacteria 66118
334 Ga0495584_0001678 3300046491 Bacteria 12983
335 Ga0495584_0002197 3300046491 Bacteria 11125
336 Ga0495584_0003188 3300046491 Bacteria 9116
337 Ga0495584_0015439 3300046491 Bacteria 3892
338 Ga0495584_0017141 3300046491 Bacteria 3691
339 Ga0495585_0000142 3300046492 Bacteria 79060
340 Ga0495585_0043610 3300046492 Bacteria 2507
341 Ga0495585_0085816 3300046492 Bacteria 1701
342 Ga0495585_0136201 3300046492 Bacteria 1289
343 Ga0495594_0001521 3300046499 Bacteria 12044
344 Ga0495594_0043677 3300046499 Bacteria 2457
345 Ga0495594_0151081 3300046499 Bacteria 1318
346 Ga0495596_0000089 3300046500 Bacteria 63864
347 Ga0495607_0000032 3300046501 Bacteria 153288
348 Ga0495607_0006881 3300046501 Bacteria 7930
349 Ga0495607_0010063 3300046501 Bacteria 6370
350 Ga0495607_0013334 3300046501 Bacteria 5389
351 Ga0495607_0021527 3300046501 Bacteria 4055
352 Ga0495607_0057620 3300046501 Bacteria 2225
353 Ga0495607_0087450 3300046501 Bacteria 1696
354 Ga0495607_0155298 3300046501 Bacteria 1167
355 Ga0495607_0175258 3300046501 Bacteria 1079
356 Ga0495583_0000135 3300046506 Bacteria 123916
357 Ga0495583_0000457 3300046506 Bacteria 60714
358 Ga0495583_0002118 3300046506 Bacteria 17775
359 Ga0495606_0000200 3300046507 Bacteria 104194
360 Ga0495606_0000545 3300046507 Bacteria 60465
361 Ga0495606_0000729 3300046507 Bacteria 50871
362 Ga0495606_0025101 3300046507 Bacteria 4276
363 Ga0495610_0000058 3300046512 Bacteria 137991
364 Ga0495610_0004442 3300046512 Bacteria 10365
365 Ga0495610_0005995 3300046512 Bacteria 8496
366 Ga0495610_0009917 3300046512 Bacteria 5959
367 Ga0495610_0010854 3300046512 Bacteria 5625
368 Ga0495610_0012925 3300046512 Bacteria 4989
369 Ga0495610_0019749 3300046512 Bacteria 3758
370 Ga0495610_0033846 3300046512 Bacteria 2637
371 Ga0495610_0074419 3300046512 Bacteria 1576
372 Ga0495616_0000031 3300046513 Bacteria 130957
373 Ga0495616_0000429 3300046513 Bacteria 32137
374 Ga0495618_0081775 3300046514 Bacteria 2063
375 Ga0495620_0000034 3300046515 Bacteria 117942
376 Ga0495620_0000207 3300046515 Bacteria 44260
377 Ga0495620_0001291 3300046515 Bacteria 15265
378 Ga0495620_0003917 3300046515 Bacteria 8483
379 Ga0495620_0008610 3300046515 Bacteria 5471
380 Ga0495620_0009072 3300046515 Bacteria 5308
381 Ga0495620_0048421 3300046515 Bacteria 1824
382 Ga0495628_0009638 3300046516 Bacteria 8239
383 Ga0495628_0229975 3300046516 Bacteria 1390
384 Ga0495631_0002052 3300046518 Bacteria 11733
385 Ga0495631_0007823 3300046518 Bacteria 5419
386 Ga0495632_0000495 3300046519 Bacteria 37144
387 Ga0495632_0000607 3300046519 Bacteria 33188
388 Ga0495632_0000748 3300046519 Bacteria 29283
389 Ga0495632_0003572 3300046519 Bacteria 10964
390 Ga0495632_0015353 3300046519 Bacteria 4299
391 Ga0495637_0007004 3300046520 Bacteria 5616
392 Ga0495637_0009342 3300046520 Bacteria 4785
393 Ga0495637_0012102 3300046520 Bacteria 4133
394 Ga0495637_0012438 3300046520 Bacteria 4069
395 Ga0495637_0013550 3300046520 Bacteria 3866
396 Ga0495637_0033500 3300046520 Bacteria 2255
397 Ga0495643_0005942 3300046522 Bacteria 8142
398 Ga0495643_0007143 3300046522 Bacteria 7244
399 Ga0495643_0011709 3300046522 Bacteria 5325
400 Ga0495644_0001087 3300046523 Bacteria 11262
401 Ga0495644_0004478 3300046523 Bacteria 5489
402 Ga0495644_0055487 3300046523 Bacteria 1489
403 Ga0495644_0059130 3300046523 Bacteria 1441
404 Ga0495648_0000239 3300046524 Bacteria 62900
405 Ga0495648_0001250 3300046524 Bacteria 25409
406 Ga0495648_0004517 3300046524 Bacteria 11863
407 Ga0495648_0013500 3300046524 Bacteria 6031
408 Ga0495648_0015275 3300046524 Bacteria 5584
409 Ga0495648_0021510 3300046524 Bacteria 4463
410 Ga0495663_0030146 3300046525 Bacteria 1606
411 Ga0495666_0012793 3300046526 Bacteria 4183
412 Ga0495642_0000187 3300046528 Bacteria 36703
413 Ga0495642_0092802 3300046528 Bacteria 1279
414 Ga0495654_0000012 3300046530 Bacteria 328997
415 Ga0495654_0000414 3300046530 Bacteria 36432
416 Ga0495654_0006197 3300046530 Bacteria 6822
417 Ga0495654_0021651 3300046530 Bacteria 3343
418 Ga0495654_0026580 3300046530 Bacteria 2974
419 Ga0495654_0028499 3300046530 Bacteria 2855
420 Ga0495654_0040591 3300046530 Bacteria 2318
421 Ga0495654_0076963 3300046530 Bacteria 1571
422 Ga0495654_0086774 3300046530 Bacteria 1458
423 Ga0495654_0087054 3300046530 Bacteria 1455
424 Ga0495586_0004586 3300046535 Bacteria 7385
425 Ga0495587_0019040 3300046536 Bacteria 4253
426 Ga0495609_0000147 3300046538 Bacteria 73010
427 Ga0495609_0000340 3300046538 Bacteria 41415
428 Ga0495609_0000477 3300046538 Bacteria 32285
429 Ga0495597_0000013 3300046542 Bacteria 203829
430 Ga0495597_0004857 3300046542 Bacteria 7245
431 Ga0495597_0012599 3300046542 Bacteria 4074
432 Ga0495597_0017766 3300046542 Bacteria 3342
433 Ga0495597_0030407 3300046542 Bacteria 2461
434 Ga0495597_0038360 3300046542 Bacteria 2147
435 Ga0495622_0017722 3300046557 Bacteria 3314
436 Ga0495633_0000316 3300046558 Bacteria 54818
437 Ga0495633_0000446 3300046558 Bacteria 42633
438 Ga0495633_0162372 3300046558 Bacteria 1031
439 Ga0495667_0179581 3300046559 Bacteria 1359
440 Ga0495668_0000087 3300046616 Bacteria 151819
441 Ga0495668_0000887 3300046616 Bacteria 33700
442 Ga0495668_0007406 3300046616 Bacteria 7017
443 Ga0495668_0022070 3300046616 Bacteria 3641
444 Ga0495668_0029381 3300046616 Bacteria 3106
445 Ga0495668_0032163 3300046616 Bacteria 2954
446 Ga0495668_0053332 3300046616 Bacteria 2235
447 Ga0495634_0031104 3300046642 Bacteria 3678
448 Ga0495611_0017900 3300046648 Bacteria 3036
449 Ga0495611_0155835 3300046648 Bacteria 1066
450 Ga0495625_0000081 3300046660 Bacteria 156254
451 Ga0495625_0000830 3300046660 Bacteria 42448
452 Ga0495625_0001558 3300046660 Bacteria 27293
453 Ga0495625_0012474 3300046660 Bacteria 6885
454 Ga0495625_0020841 3300046660 Bacteria 5054
455 Ga0495625_0022235 3300046660 Bacteria 4865
456 Ga0495625_0029266 3300046660 Bacteria 4122
457 Ga0495625_0072463 3300046660 Bacteria 2415
458 Ga0495625_0092267 3300046660 Bacteria 2092
459 Ga0495625_0113957 3300046660 Bacteria 1846
460 Ga0495625_0131976 3300046660 Bacteria 1691
461 Ga0495625_0137418 3300046660 Bacteria 1651
462 Ga0495625_0226307 3300046660 Bacteria 1223
463 Ga0495659_0008262 3300046664 Bacteria 3312
464 Ga0495661_0000078 3300046665 Bacteria 119097
465 Ga0495661_0000138 3300046665 Bacteria 85693
466 Ga0495661_0000513 3300046665 Bacteria 40214
467 Ga0495661_0002111 3300046665 Bacteria 15597
468 Ga0495661_0010828 3300046665 Bacteria 6203
469 Ga0495661_0177944 3300046665 Bacteria 1129
470 Ga0495588_0013345 3300046674 Bacteria 3913
471 Ga0495588_0033156 3300046674 Bacteria 2607
472 Ga0495588_0043085 3300046674 Bacteria 2308
473 Ga0495657_0000437 3300046675 Bacteria 38928
474 Ga0495599_0212034 3300046678 Bacteria 1187
475 Ga0495646_0000400 3300046680 Bacteria 22769
476 Ga0495613_0002753 3300046689 Bacteria 13204
477 Ga0495613_0085988 3300046689 Bacteria 2280
478 Ga0495671_0000052 3300046692 Bacteria 133684
479 Ga0495671_0014142 3300046692 Bacteria 4300
480 Ga0495671_0015686 3300046692 Bacteria 4054
481 Ga0495671_0026763 3300046692 Bacteria 2985
482 Ga0495671_0074428 3300046692 Bacteria 1666
483 Ga0495649_0000033 3300046694 Bacteria 136854
484 Ga0495649_0000106 3300046694 Bacteria 74615
485 Ga0495649_0000836 3300046694 Bacteria 24748
486 Ga0495649_0015712 3300046694 Bacteria 4304
487 Ga0495649_0023498 3300046694 Bacteria 3443
488 Ga0495649_0053335 3300046694 Bacteria 2189
489 Ga0495589_0000585 3300046794 Bacteria 24989
490 Ga0495589_0001063 3300046794 Bacteria 16487
491 Ga0495589_0002412 3300046794 Bacteria 10499
492 Ga0495589_0006602 3300046794 Bacteria 6113
493 Ga0495589_0010957 3300046794 Bacteria 4706
494 Ga0495660_0000873 3300046810 Bacteria 22251
495 Ga0495660_0001253 3300046810 Bacteria 17692
496 Ga0495660_0001366 3300046810 Bacteria 16808
497 Ga0495660_0002313 3300046810 Bacteria 12218
498 Ga0495660_0005067 3300046810 Bacteria 7916
499 Ga0495660_0017385 3300046810 Bacteria 4140
500 Ga0495660_0065403 3300046810 Bacteria 1941
501 Ga0495660_0078105 3300046810 Bacteria 1741
502 Ga0495604_0000673 3300047317 Bacteria 28933
503 Ga0495604_0009142 3300047317 Bacteria 7842
504 Ga0495636_0000221 3300047318 Bacteria 22484
505 Ga0495636_0020197 3300047318 Bacteria 2683
506 Ga0495636_0049029 3300047318 Bacteria 1766
507 Ga0495674_0170119 3300047319 Bacteria 1819
508 Ga0495672_0000032 3300047320 Bacteria 295356
509 Ga0495672_0001535 3300047320 Bacteria 22596
510 Ga0495672_0003990 3300047320 Bacteria 12347
511 Ga0495676_0002857 3300047321 Bacteria 15570
512 Ga0495676_0003781 3300047321 Bacteria 13756
513 Ga0495676_0004612 3300047321 Bacteria 12622
514 Ga0495676_0010737 3300047321 Bacteria 8289
515 Ga0495683_0000108 3300047323 Bacteria 84498
516 Ga0495683_0002624 3300047323 Bacteria 10750
517 Ga0495683_0002951 3300047323 Bacteria 10064
518 Ga0495683_0047214 3300047323 Bacteria 2161
519 Ga0495687_000572 3300047443 Bacteria 43367
520 Ga0495687_001130 3300047443 Bacteria 25900
521 Ga0495687_004181 3300047443 Bacteria 9913
522 Ga0495687_008146 3300047443 Bacteria 6044
523 Ga0495687_027803 3300047443 Bacteria 2641
524 Ga0495687_098775 3300047443 Bacteria 1100
525 Ga0495675_0000016 3300047444 Bacteria 129732
526 Ga0495679_000198 3300047446 Bacteria 53238
527 Ga0495679_001171 3300047446 Bacteria 15590
528 Ga0495679_003085 3300047446 Bacteria 8168
529 Ga0495679_013312 3300047446 Bacteria 3096
530 Ga0495685_041386 3300047447 Bacteria 1575
531 Ga0495673_0000190 3300047469 Bacteria 97539
532 Ga0495673_0000321 3300047469 Bacteria 61858
533 Ga0495673_0000997 3300047469 Bacteria 25163
534 Ga0495673_0003718 3300047469 Bacteria 9918
535 Ga0495673_0025675 3300047469 Bacteria 2824
536 Ga0495681_0000009 3300047470 Bacteria 205224
537 Ga0495681_0000257 3300047470 Bacteria 43264
538 Ga0495681_0000329 3300047470 Bacteria 37635
539 Ga0495681_0002219 3300047470 Bacteria 13986
540 Ga0495681_0003080 3300047470 Bacteria 11691
541 Ga0495681_0004335 3300047470 Bacteria 9705
542 Ga0495681_0004938 3300047470 Bacteria 9002
543 Ga0495681_0006935 3300047470 Bacteria 7341
544 Ga0495681_0008911 3300047470 Bacteria 6232
545 Ga0495681_0011173 3300047470 Bacteria 5372
546 Ga0495681_0013912 3300047470 Bacteria 4644
547 Ga0495681_0035562 3300047470 Bacteria 2472
548 Ga0495681_0159761 3300047470 Bacteria 939
549 Ga0495684_0023241 3300047471 Bacteria 4766
550 Ga0495686_0000633 3300047472 Bacteria 48475
551 Ga0495686_0025642 3300047472 Bacteria 3864
552 Ga0495686_0038730 3300047472 Bacteria 3048
553 Ga0495686_0071700 3300047472 Bacteria 2131
554 Ga0495686_0099087 3300047472 Bacteria 1760
555 Ga0495593_0002874 3300047673 Bacteria 10384
556 Ga0495602_0059408 3300048088 Bacteria 3338
557 Ga0495614_0007263 3300048089 Bacteria 4936
558 Ga0495626_0000015 3300048091 Bacteria 232238
559 Ga0495626_0000033 3300048091 Bacteria 184008
560 Ga0495626_0000720 3300048091 Bacteria 30946
561 Ga0495626_0009842 3300048091 Bacteria 5140
562 Ga0495626_0058064 3300048091 Bacteria 1769
563 Ga0496101_0323198 3300048904 Bacteria 1211
564 Ga0496102_0000613 3300048905 Bacteria 36995
565 Ga0496102_0043134 3300048905 Bacteria 4089
566 Ga0496103_0000163 3300048906 Bacteria 70387
567 Ga0496103_0009503 3300048906 Bacteria 5757
568 Ga0496104_0002224 3300048907 Bacteria 16745
569 Ga0496105_0003862 3300048908 Bacteria 11198
570 Ga0496106_0063172 3300048909 Bacteria 2813
571 Ga0496107_0000565 3300048910 Bacteria 20698
572 Ga0496111_0058777 3300048914 Bacteria 2784
573 Ga0496113_0000081 3300048916 Bacteria 42072
574 Ga0496115_0133558 3300048918 Bacteria 2046
575 Ga0496116_0000126 3300048919 Bacteria 160425
576 Ga0496116_0042961 3300048919 Bacteria 3083
577 Ga0496116_0080144 3300048919 Bacteria 2028
578 Ga0496116_0120560 3300048919 Bacteria 1519
579 Ga0496116_0182660 3300048919 Bacteria 1121
580 Ga0496117_0000623 3300048920 Bacteria 57364
581 Ga0496117_0027203 3300048920 Bacteria 4461
582 Ga0496118_0030117 3300048921 Bacteria 4537
583 Ga0496118_0037674 3300048921 Bacteria 3887
584 Ga0496118_0071815 3300048921 Bacteria 2489
585 Ga0496119_0004118 3300048922 Bacteria 14645
586 Ga0496119_0124169 3300048922 Bacteria 1415
587 Ga0496120_0004524 3300048923 Bacteria 11623
588 Ga0496120_0028051 3300048923 Bacteria 3456
589 Ga0496121_0000067 3300048924 Bacteria 261543
590 Ga0496121_0000142 3300048924 Bacteria 160072
591 Ga0496121_0001912 3300048924 Bacteria 33300
592 Ga0496121_0009885 3300048924 Bacteria 10872
593 Ga0496121_0019626 3300048924 Bacteria 6750
594 Ga0496121_0059414 3300048924 Bacteria 3152
595 Ga0496122_0001234 3300048925 Bacteria 43175
596 Ga0496122_0002287 3300048925 Bacteria 27682
597 Ga0496122_0005467 3300048925 Bacteria 15122
598 Ga0496122_0037935 3300048925 Bacteria 3869
599 Ga0496123_0000434 3300048926 Bacteria 75349
600 Ga0496123_0003785 3300048926 Bacteria 16568
601 Ga0496123_0009060 3300048926 Bacteria 9017
602 Ga0496123_0032276 3300048926 Bacteria 3795
603 Ga0496124_0000812 3300048927 Bacteria 50806
604 Ga0496124_0003614 3300048927 Bacteria 18779
605 Ga0496124_0068150 3300048927 Bacteria 2959
606 Ga0496125_0012848 3300048928 Bacteria 8274
607 Ga0496125_0185974 3300048928 Bacteria 1378
608 Ga0496125_0300067 3300048928 Bacteria 984
609 Ga0496125_0312175 3300048928 Bacteria 957
610 Ga0496126_0005438 3300048929 Bacteria 14523
611 Ga0496126_0107103 3300048929 Bacteria 2438
612 Ga0496126_0319170 3300048929 Bacteria 1277
613 Ga0495678_000081 3300049459 Bacteria 118700
614 Ga0495678_000583 3300049459 Bacteria 34467
615 Ga0495678_001014 3300049459 Bacteria 24007
616 Ga0495678_001228 3300049459 Bacteria 20891
617 Ga0495678_017299 3300049459 Bacteria 3271
618 Ga0495678_021074 3300049459 Bacteria 2875
619 Ga0495678_032827 3300049459 Bacteria 2148
620 Ga0495678_035943 3300049459 Bacteria 2027
621 Ga0495678_123412 3300049459 Bacteria 867
622 Ga0495682_0003421 3300049460 Bacteria 7058
623 Ga0495682_0013216 3300049460 Bacteria 3147
624 Ga0501032_0044735 3300049569 Bacteria 2996
625 Ga0501033_0066516 3300049570 Bacteria 2650
626 Ga0501043_0002520 3300049579 Bacteria 15482
627 Ga0501046_0055842 3300049580 Bacteria 3101
628 Ga0501047_0000342 3300049581 Bacteria 53140
629 Ga0501048_0355832 3300049582 Bacteria 1044
630 Ga0501070_0141038 3300049586 Bacteria 1990
631 Ga0501269_000034 3300049766 Bacteria 42532
632 Ga0501035_0029889 3300049822 Bacteria 4969
633 nmdc:mga03683_15022_c1 3300050489 Bacteria 2880
634 nmdc:mga03n38_109574_c1 3300050490 Bacteria 1343
635 nmdc:mga03n38_41862_c1 3300050490 Bacteria 1999
636 nmdc:mga00v17_51246_c1 3300050491 Bacteria 2510
637 nmdc:mga00v17_626_c1 3300050491 Bacteria 8462
638 nmdc:mga0k408_71943_c1 3300050493 Bacteria 2019
639 nmdc:mga07m45_62960_c1 3300050496 Bacteria 2103
640 nmdc:mga0sz30_6232_c1 3300050516 Bacteria 4422
641 Ga0500635_0000020 3300053080 Bacteria 110196
642 Ga0500578_0000234 3300053086 Bacteria 68455
643 Ga0500578_0215964 3300053086 Bacteria 1168
644 Ga0500643_048167 3300053087 Bacteria 1226
645 Ga0500644_0000189 3300053088 Bacteria 38264
646 Ga0500554_005865 3300053102 Bacteria 2715
647 Ga0500556_0001301 3300053104 Bacteria 11228
648 Ga0500556_0024836 3300053104 Bacteria 1973
649 Ga0500580_037832 3300053113 Bacteria 2047
650 Ga0500592_000148 3300053116 Bacteria 14211
651 Ga0500594_0000022 3300053118 Bacteria 54062
652 Ga0500607_000148 3300053121 Bacteria 59763
653 Ga0500607_048277 3300053121 Bacteria 2277
654 Ga0500618_000511 3300053125 Bacteria 24569
655 Ga0500642_0123100 3300053130 Bacteria 1214
656 Ga0500658_0050740 3300053134 Bacteria 1694
657 Ga0500559_0000005 3300053136 Bacteria 230231
658 Ga0500559_0001556 3300053136 Bacteria 12842
659 Ga0500564_000059 3300053138 Bacteria 29435
660 Ga0500568_0019338 3300053139 Bacteria 2962
661 Ga0500568_0019897 3300053139 Bacteria 2910
662 Ga0500600_0064882 3300053149 Bacteria 2022
663 Ga0500600_0172950 3300053149 Bacteria 1048
664 Ga0500616_0046069 3300053153 Bacteria 2319
665 Ga0500624_006724 3300053157 Bacteria 1563
666 Ga0500627_0000013 3300053158 Bacteria 136204
667 Ga0500634_0000350 3300053161 Bacteria 14729
668 Ga0500638_012935 3300053162 Bacteria 3757
669 Ga0500636_0000543 3300053177 Bacteria 20542
670 Ga0500611_015368 3300053727 Bacteria 1354
671 Ga0500645_004520 3300053730 Bacteria 5309
672 Ga0500645_008481 3300053730 Bacteria 3507
673 Ga0500645_016698 3300053730 Bacteria 2309
674 Ga0500609_000125 3300053731 Bacteria 10137
675 Ga0466962_0023165 3300061719 Bacteria 2985
676 2785366704 2784746768 Bacteria 10036182
677 2506864804 2506783011 Bacteria 5323186
678 2511253361 2511231004 Bacteria 6669789
679 2511269607 2511231007 Bacteria 6306603
680 2511278028 2511231008 Bacteria 6624100
681 2511311612 2511231014 Bacteria 6462302
682 2511324212 2511231016 Bacteria 6704427
683 2511359913 2511231021 Bacteria 7302637
684 2512326225 2512047018 Bacteria 6663241
685 2555668355 2554235341 Bacteria 6867980
686 2583792554 2582580891 Bacteria 6800976
687 2585149455 2582581279 Bacteria 4980720
688 2585306605 2582581313 Bacteria 10042643
689 2599327076 2599185155 Bacteria 5827168
690 2599355356 2599185160 Bacteria 6844013
691 2599360825 2599185161 Bacteria 6960462
692 2599367147 2599185162 Bacteria 6957254
693 2599373937 2599185163 Bacteria 6995158
694 2599380462 2599185164 Bacteria 6841688
695 2599386909 2599185165 Bacteria 6843250
696 2599392795 2599185166 Bacteria 6959206
697 2599404562 2599185168 Bacteria 6997636
698 2599462190 2599185181 Bacteria 6844519
699 2599466768 2599185182 Bacteria 6883168
700 2599490718 2599185186 Bacteria 6831633
701 2600021798 2599185316 Bacteria 6320029
702 2600030832 2599185317 Bacteria 6435722
703 2600075071 2599185325 Bacteria 6324919
704 2600214812 2599185356 Bacteria 6843884
705 2600360637 2600254930 Bacteria 6431253
706 2601774483 2600255313 Bacteria 6842543
707 2616693185 2616644814 Bacteria 11555299
708 2624491734 2623620446 Bacteria 6500345
709 2643819954 2643221560 Bacteria 4801179
710 2643835400 2643221563 Bacteria 4726935
711 2643905053 2643221578 Bacteria 9213798
712 2643942515 2643221587 Bacteria 7586415
713 2643999094 2643221598 Bacteria 4578346
714 2644056326 2643221608 Bacteria 4724829
715 2644263470 2643221647 Bacteria 10741251
716 2644403111 2643221673 Bacteria 9196637
717 2644429974 2643221677 Bacteria 7584031
718 2644514321 2643221692 Bacteria 7282860
719 2652544212 2651869719 Bacteria 6047974
720 2671097957 2667528171 Bacteria 6900659
721 2671126882 2667528176 Bacteria 6724917
722 2689992791 2687453743 Bacteria 8361025
723 2743737691 2740892503 Bacteria 6855563
724 2786667764 2786546132 Bacteria 10419719
725 2792462386 2791355048 Bacteria 5832535
726 2793981546 2791355406 Bacteria 11364898
727 2804849247 2802429296 Bacteria 7227771
728 2819703041 2818991464 Bacteria 6907494
729 2826585861 2826581358 Bacteria 5963467
730 2842850234 2842849001 Bacteria 5924277
731 2843748738 2843744320 Bacteria 5659202
732 2844668867 2844665904 Bacteria 6817974
733 2849565308 2849560528 Bacteria 5393480
734 2849578894 2849573788 Bacteria 5421256
735 2851156540 2851153111 Bacteria 5542585
736 2862181274 2862178590 Bacteria 8583590
737 2862290096 2862281513 Bacteria 9621493
738 2862292990 2862290372 Bacteria 7471434
739 2862580336 2862574272 Bacteria 10567477
740 2877683834 2877676314 Bacteria 9512378
741 2898330210 2898329390 Bacteria 5168154
742 2917072122 2917070673 Bacteria 6868303
743 2917736462 2917736166 Bacteria 9690793
744 2918502211 2918501144 Bacteria 8668083
745 2923156736 2923153595 Bacteria 6870622
746 2923588027 2923586266 Bacteria 6565975
747 2928961978 2928959182 Bacteria 4725774
748 2931374720 2931369376 Bacteria 6847892
749 2931401304 2931396565 Bacteria 7251677
750 2935354294 2935353572 Unclassified 6955622
751 2945963004 2945961074 Bacteria 7342064
752 2946052317 2946045630 Bacteria 8527308
753 2946065220 2946064051 Bacteria 8957905
754 2947232225 2947224130 Bacteria 9938529
755 2954008556 2954002825 Bacteria 9173742
756 2954389138 2954380949 Bacteria 10050426
757 2954673904 2954673503 Bacteria 9685905
758 2954690087 2954682443 Bacteria 9862841
759 2954699886 2954691527 Bacteria 10720516
760 2954702312 2954701450 Bacteria 10834262
761 2990093814 2990088156 Bacteria 6657676
762 3003002136 3002998708 Bacteria 11715108
763 3006394311 3006393351 Bacteria 6615579
764 3007396547 3007395558 Bacteria 6755444
765 637318717 637000220 Bacteria 7074893
766 8003323451 8003314358 Bacteria 10575343
767 8015690956 8015687852 Bacteria 6613826
768 8019770911 8019769354 Bacteria 6924660
769 8025413824 8025413630 Bacteria 7014048
770 8047900978 8047893842 Bacteria 11723082
771 8048134285 8048127548 Bacteria 11053136
772 8048357923 8048356638 Bacteria 11044339
773 8048377920 8048369669 Bacteria 11666822
774 8048387018 8048379754 Bacteria 11877923
775 8054163291 8054160619 Bacteria 7783213
776 8055774096 8055770955 Bacteria 6827675
777 8056178997 8056177738 Bacteria 6748268
778 8057803655 8057798959 Bacteria 6713499
779 SwRhRL2b_contig_3039297
780 JGI24739J22299_10064354
781 JGI25162J39368_1000054
782 JGI25163J39215_1000106
783 JGI25164J39214_1000029
784 JGI25406J46586_10002057
785 JGI25165J46597_1000111
786 rootH2_10025695
787 rootL2_10029067
788 rootL2_10158374
789 Ga0055526_1022180
790 Ga0055537_1003505
791 Ga0055524_1012948
792 Ga0055536_1000005
793 Ga0055536_1000734
794 Ga0055536_1006940
795 Ga0055536_1008111
796 Ga0055534_1011018
797 Ga0055528_1008429
798 Ga0055530_10000001
799 Ga0055530_10000066
800 Ga0055530_10000165
801 Ga0055530_10000222
802 Ga0055530_10039056
803 Ga0055540_1000186
804 Ga0055540_1000258
805 Ga0055531_10001339
806 Ga0055531_10003634
807 Ga0055531_10005696
808 Ga0065165_1001271
809 Ga0065714_10003126
810 Ga0065714_10009959
811 Ga0065714_10011828
812 Ga0065714_10064839
813 Ga0065704_10097097
814 Ga0065704_10097927
815 Ga0065712_10067982
816 Ga0070658_10001281
817 Ga0070666_10162510
818 Ga0070680_100011064
819 Ga0070682_100524627
820 Ga0070660_100019870
821 Ga0070668_100002528
822 Ga0070668_100017490
823 Ga0070669_100001571
824 Ga0070669_100001764
825 Ga0070671_100003686
826 Ga0070671_100003780
827 Ga0070667_100020533
828 Ga0070667_100028263
829 Ga0070678_100039767
830 Ga0070681_10003845
831 Ga0070679_100007593
832 Ga0070697_100077656
833 Ga0070672_100374900
834 Ga0070665_100000107
835 Ga0070665_100008246
836 Ga0070665_100033770
837 Ga0068855_100005081
838 Ga0068855_100276610
839 Ga0068854_100072783
840 Ga0068856_100411476
841 Ga0068863_100018630
842 Ga0068860_100015006
843 Ga0068862_100000074
844 Ga0068862_100016576
845 Ga0081539_10000417
846 Ga0075363_100070972
847 Ga0075364_10005137
848 Ga0075364_10005211
849 Ga0075362_10019711
850 Ga0075369_10006670
851 Ga0075366_10143609
852 Ga0075370_10177081
853 Ga0068865_100244176
854 Ga0097620_100210162
855 Ga0079104_1000006
856 Ga0099826_10000572
857 Ga0105251_10000005
858 Ga0105251_10005637
859 Ga0105251_10030203
860 Ga0105251_10030612
861 Ga0105244_10001015
862 Ga0105244_10001477
863 Ga0105250_10004047
864 Ga0105250_10012357
865 Ga0105240_10014297
866 Ga0105247_10119490
867 Ga0105243_10000144
868 Ga0105243_10024932
869 Ga0105248_10003233
870 Ga0105248_10037790
871 Ga0105238_10012868
872 Ga0105249_10027254
873 Ga0105249_10160716
874 Ga0105239_10132598
875 Ga0105239_10811772
876 Ga0105246_10019373
877 Ga0105246_10049033
878 Ga0157371_10000063
879 Ga0157371_10000925
880 Ga0157370_10002160
881 Ga0157370_10030558
882 Ga0157370_10032695
883 Ga0157369_10227871
884 Ga0163162_10000551
885 Ga0163162_10031044
886 Ga0182008_10000785
887 Ga0182008_10001096
888 Ga0182006_1003571
889 Ga0182006_1006128
890 Ga0182006_1007784
891 Ga0182007_10000682
892 Ga0182007_10001650
893 Ga0182005_1015072
894 Ga0183367_1003
895 Ga0163161_10003171
896 Ga0213872_10159707
897 Ga0213876_10161140
898 Ga0209760_100015
899 Ga0207427_100001
900 Ga0209437_100003
901 Ga0209026_1002402
902 Ga0209233_1000007
903 Ga0209565_1000281
904 Ga0209673_1001574
905 Ga0209675_1000097
906 Ga0209675_1019109
907 Ga0209676_1000003
908 Ga0209676_1000070
909 Ga0209676_1000673
910 Ga0209676_1000927
911 Ga0209676_1004357
912 Ga0209676_1021711
913 Ga0209676_1047271
914 Ga0209025_1013670
915 Ga0209564_1000557
916 Ga0209564_1019939
917 Ga0209758_1000608
918 Ga0209758_1001275
919 Ga0209758_1001477
920 Ga0209050_1000004
921 Ga0209050_1000037
922 Ga0209050_1000038
923 Ga0209050_1000627
924 Ga0209050_1002783
925 Ga0209050_1011541
926 Ga0209050_1027233
927 Ga0209256_1001941
928 Ga0209256_1003017
929 Ga0209256_1013803
930 Ga0209051_1000006
931 Ga0209051_1000040
932 Ga0209257_1000328
933 Ga0209257_1001043
934 Ga0209257_1001060
935 Ga0209257_1002314
936 Ga0209257_1009271
937 Ga0209257_1012736
938 Ga0207696_1003663
939 Ga0207696_1041113
940 Ga0207655_1003129
941 Ga0207713_1000036
942 Ga0207713_1001885
943 Ga0207713_1031618
944 Ga0207713_1045466
945 Ga0207710_10105809
946 Ga0207680_10137414
947 Ga0207705_10025961
948 Ga0207654_10068346
949 Ga0207707_10003543
950 Ga0207695_10012701
951 Ga0207660_10167993
952 Ga0207657_10281967
953 Ga0207652_10011650
954 Ga0207681_10001221
955 Ga0207681_10001397
956 Ga0207694_10007190
957 Ga0207644_10055190
958 Ga0207709_10001160
959 Ga0207709_10205008
960 Ga0207704_10185123
961 Ga0207711_10003235
962 Ga0207711_10017238
963 Ga0207711_10382345
964 Ga0207667_10021876
965 Ga0207712_10032850
966 Ga0207712_10146774
967 Ga0207668_10001443
968 Ga0207668_10006938
969 Ga0207658_10001032
970 Ga0207658_10092397
971 Ga0207702_10042525
972 Ga0207641_10003617
973 Ga0207683_10217077
974 Ga0209281_1000011
975 Ga0209371_1000609
976 Ga0268266_10000354
977 Ga0268266_10007811
978 Ga0268266_10009243
979 Ga0268266_10417546
980 Ga0268265_10000847
981 Ga0268265_10005338
982 Ga0268265_10097822
983 Ga0265319_1026094
984 Ga0265318_10000139
985 Ga0307517_10048414
986 Ga0307517_10074950
987 Ga0307515_10000524
988 Ga0307515_10027774
989 Ga0307515_10058201
990 Ga0268256_1000527
991 Ga0307511_10011009
992 Ga0307511_10037288
993 Ga0307511_10100046
994 Ga0307512_10006750
995 Ga0307512_10015575
996 Ga0307512_10040433
997 Ga0316177_1222324
998 Ga0265330_10003994
999 Ga0265332_10003516
1000 Ga0265328_10002301
1001 Ga0265320_10002481
1002 Ga0265329_10000367
1003 Ga0265339_10077377
1004 Ga0265331_10004641
1005 Ga0265327_10000175
1006 Ga0265316_10008789
1007 Ga0307513_10015813
1008 Ga0307513_10103139
1009 Ga0307509_10002942
1010 Ga0307509_10003139
1011 Ga0307508_10029395
1012 Ga0307508_10049105
1013 Ga0307508_10229675
1014 Ga0307508_10241856
1015 Ga0307514_10004958
1016 Ga0265314_10013933
1017 Ga0265342_10001175
1018 Ga0307516_10006745
1019 Ga0307518_10178376
1020 Ga0307518_10186862
1021 Ga0307412_10038740
1022 Ga0307414_10440785
1023 Ga0307507_10007410
1024 Ga0307507_10193809
1025 Ga0307510_10009355
1026 Ga0307510_10024282
1027 Ga0307510_10054411
1028 Ga0307510_10058361
1029 Ga0307510_10219888
1030 Ga0395898_0002157
1031 Ga0395901_0161915
1032 Ga0436365_0466215
1033 Ga0436361_0804027
1034 Ga0436361_0989786
1035 Ga0436363_1493638
1036 Ga0439438_000200
1037 Ga0439438_000450
1038 Ga0439438_000666
1039 Ga0439447_006761
1040 Ga0439461_0009575
1041 Ga0439466_0013030
1042 Ga0451841_0680686
1043 Ga0451851_0122701
1044 Ga0451853_1601412
1045 Ga0451853_3602439
1046 Ga0439448_0008535
1047 Ga0439449_0014725
1048 Ga0439452_000115
1049 Ga0439452_000826
1050 Ga0439455_0037657
1051 Ga0439456_000816
1052 Ga0439463_000202
1053 Ga0439463_026153
1054 Ga0450900_006822
1055 Ga0439446_0004310
1056 Ga0439458_0004574
1057 Ga0439435_0002850
1058 Ga0466969_0015985
1059 Ga0466972_0004929
1060 Ga0466961_0012375
1061 Ga0466960_0003455
1062 Ga0495617_000044
1063 Ga0495617_013499
1064 Ga0495617_015757
1065 Ga0495617_061724
1066 Ga0495627_000008
1067 Ga0495627_002624
1068 Ga0495627_005481
1069 Ga0495627_012240
1070 Ga0495592_0020586
1071 Ga0495603_0000009
1072 Ga0495603_0009296
1073 Ga0495603_0297721
1074 Ga0495590_0000698
1075 Ga0495590_0002258
1076 Ga0495591_000018
1077 Ga0495591_000088
1078 Ga0495591_000300
1079 Ga0495591_010704
1080 Ga0495629_0022313
1081 Ga0495638_0000160
1082 Ga0495638_0000589
1083 Ga0495638_0004745
1084 Ga0495638_0007339
1085 Ga0495638_0010099
1086 Ga0495638_0020681
1087 Ga0495638_0035080
1088 Ga0495638_0064881
1089 Ga0495638_0092995
1090 Ga0495638_0095347
1091 Ga0495651_0021486
1092 Ga0495653_0000002
1093 Ga0495650_0000017
1094 Ga0495650_0007765
1095 Ga0495650_0010868
1096 Ga0495605_0000067
1097 Ga0495605_0000088
1098 Ga0495605_0000158
1099 Ga0495605_0000522
1100 Ga0495605_0000806
1101 Ga0495605_0004355
1102 Ga0495605_0007282
1103 Ga0495605_0012723
1104 Ga0495605_0017337
1105 Ga0495605_0023420
1106 Ga0495605_0043272
1107 Ga0495605_0069504
1108 Ga0495605_0090255
1109 Ga0495662_0000110
1110 Ga0495664_0001686
1111 Ga0495584_0000083
1112 Ga0495584_0001678
1113 Ga0495584_0002197
1114 Ga0495584_0003188
1115 Ga0495584_0015439
1116 Ga0495584_0017141
1117 Ga0495585_0000142
1118 Ga0495585_0043610
1119 Ga0495585_0085816
1120 Ga0495585_0136201
1121 Ga0495594_0001521
1122 Ga0495594_0043677
1123 Ga0495594_0151081
1124 Ga0495596_0000089
1125 Ga0495607_0000032
1126 Ga0495607_0006881
1127 Ga0495607_0010063
1128 Ga0495607_0013334
1129 Ga0495607_0021527
1130 Ga0495607_0057620
1131 Ga0495607_0087450
1132 Ga0495607_0155298
1133 Ga0495607_0175258
1134 Ga0495583_0000135
1135 Ga0495583_0000457
1136 Ga0495583_0002118
1137 Ga0495606_0000200
1138 Ga0495606_0000545
1139 Ga0495606_0000729
1140 Ga0495606_0025101
1141 Ga0495610_0000058
1142 Ga0495610_0004442
1143 Ga0495610_0005995
1144 Ga0495610_0009917
1145 Ga0495610_0010854
1146 Ga0495610_0012925
1147 Ga0495610_0019749
1148 Ga0495610_0033846
1149 Ga0495610_0074419
1150 Ga0495616_0000031
1151 Ga0495616_0000429
1152 Ga0495618_0081775
1153 Ga0495620_0000034
1154 Ga0495620_0000207
1155 Ga0495620_0001291
1156 Ga0495620_0003917
1157 Ga0495620_0008610
1158 Ga0495620_0009072
1159 Ga0495620_0048421
1160 Ga0495628_0009638
1161 Ga0495628_0229975
1162 Ga0495631_0002052
1163 Ga0495631_0007823
1164 Ga0495632_0000495
1165 Ga0495632_0000607
1166 Ga0495632_0000748
1167 Ga0495632_0003572
1168 Ga0495632_0015353
1169 Ga0495637_0007004
1170 Ga0495637_0009342
1171 Ga0495637_0012102
1172 Ga0495637_0012438
1173 Ga0495637_0013550
1174 Ga0495637_0033500
1175 Ga0495643_0005942
1176 Ga0495643_0007143
1177 Ga0495643_0011709
1178 Ga0495644_0001087
1179 Ga0495644_0004478
1180 Ga0495644_0055487
1181 Ga0495644_0059130
1182 Ga0495648_0000239
1183 Ga0495648_0001250
1184 Ga0495648_0004517
1185 Ga0495648_0013500
1186 Ga0495648_0015275
1187 Ga0495648_0021510
1188 Ga0495663_0030146
1189 Ga0495666_0012793
1190 Ga0495642_0000187
1191 Ga0495642_0092802
1192 Ga0495654_0000012
1193 Ga0495654_0000414
1194 Ga0495654_0006197
1195 Ga0495654_0021651
1196 Ga0495654_0026580
1197 Ga0495654_0028499
1198 Ga0495654_0040591
1199 Ga0495654_0076963
1200 Ga0495654_0086774
1201 Ga0495654_0087054
1202 Ga0495586_0004586
1203 Ga0495587_0019040
1204 Ga0495609_0000147
1205 Ga0495609_0000340
1206 Ga0495609_0000477
1207 Ga0495597_0000013
1208 Ga0495597_0004857
1209 Ga0495597_0012599
1210 Ga0495597_0017766
1211 Ga0495597_0030407
1212 Ga0495597_0038360
1213 Ga0495622_0017722
1214 Ga0495633_0000316
1215 Ga0495633_0000446
1216 Ga0495633_0162372
1217 Ga0495667_0179581
1218 Ga0495668_0000087
1219 Ga0495668_0000887
1220 Ga0495668_0007406
1221 Ga0495668_0022070
1222 Ga0495668_0029381
1223 Ga0495668_0032163
1224 Ga0495668_0053332
1225 Ga0495634_0031104
1226 Ga0495611_0017900
1227 Ga0495611_0155835
1228 Ga0495625_0000081
1229 Ga0495625_0000830
1230 Ga0495625_0001558
1231 Ga0495625_0012474
1232 Ga0495625_0020841
1233 Ga0495625_0022235
1234 Ga0495625_0029266
1235 Ga0495625_0072463
1236 Ga0495625_0092267
1237 Ga0495625_0113957
1238 Ga0495625_0131976
1239 Ga0495625_0137418
1240 Ga0495625_0226307
1241 Ga0495659_0008262
1242 Ga0495661_0000078
1243 Ga0495661_0000138
1244 Ga0495661_0000513
1245 Ga0495661_0002111
1246 Ga0495661_0010828
1247 Ga0495661_0177944
1248 Ga0495588_0013345
1249 Ga0495588_0033156
1250 Ga0495588_0043085
1251 Ga0495657_0000437
1252 Ga0495599_0212034
1253 Ga0495646_0000400
1254 Ga0495613_0002753
1255 Ga0495613_0085988
1256 Ga0495671_0000052
1257 Ga0495671_0014142
1258 Ga0495671_0015686
1259 Ga0495671_0026763
1260 Ga0495671_0074428
1261 Ga0495649_0000033
1262 Ga0495649_0000106
1263 Ga0495649_0000836
1264 Ga0495649_0015712
1265 Ga0495649_0023498
1266 Ga0495649_0053335
1267 Ga0495589_0000585
1268 Ga0495589_0001063
1269 Ga0495589_0002412
1270 Ga0495589_0006602
1271 Ga0495589_0010957
1272 Ga0495660_0000873
1273 Ga0495660_0001253
1274 Ga0495660_0001366
1275 Ga0495660_0002313
1276 Ga0495660_0005067
1277 Ga0495660_0017385
1278 Ga0495660_0065403
1279 Ga0495660_0078105
1280 Ga0495604_0000673
1281 Ga0495604_0009142
1282 Ga0495636_0000221
1283 Ga0495636_0020197
1284 Ga0495636_0049029
1285 Ga0495674_0170119
1286 Ga0495672_0000032
1287 Ga0495672_0001535
1288 Ga0495672_0003990
1289 Ga0495676_0002857
1290 Ga0495676_0003781
1291 Ga0495676_0004612
1292 Ga0495676_0010737
1293 Ga0495683_0000108
1294 Ga0495683_0002624
1295 Ga0495683_0002951
1296 Ga0495683_0047214
1297 Ga0495687_000572
1298 Ga0495687_001130
1299 Ga0495687_004181
1300 Ga0495687_008146
1301 Ga0495687_027803
1302 Ga0495687_098775
1303 Ga0495675_0000016
1304 Ga0495679_000198
1305 Ga0495679_001171
1306 Ga0495679_003085
1307 Ga0495679_013312
1308 Ga0495685_041386
1309 Ga0495673_0000190
1310 Ga0495673_0000321
1311 Ga0495673_0000997
1312 Ga0495673_0003718
1313 Ga0495673_0025675
1314 Ga0495681_0000009
1315 Ga0495681_0000257
1316 Ga0495681_0000329
1317 Ga0495681_0002219
1318 Ga0495681_0003080
1319 Ga0495681_0004335
1320 Ga0495681_0004938
1321 Ga0495681_0006935
1322 Ga0495681_0008911
1323 Ga0495681_0011173
1324 Ga0495681_0013912
1325 Ga0495681_0035562
1326 Ga0495681_0159761
1327 Ga0495684_0023241
1328 Ga0495686_0000633
1329 Ga0495686_0025642
1330 Ga0495686_0038730
1331 Ga0495686_0071700
1332 Ga0495686_0099087
1333 Ga0495593_0002874
1334 Ga0495602_0059408
1335 Ga0495614_0007263
1336 Ga0495626_0000015
1337 Ga0495626_0000033
1338 Ga0495626_0000720
1339 Ga0495626_0009842
1340 Ga0495626_0058064
1341 Ga0496101_0323198
1342 Ga0496102_0000613
1343 Ga0496102_0043134
1344 Ga0496103_0000163
1345 Ga0496103_0009503
1346 Ga0496104_0002224
1347 Ga0496105_0003862
1348 Ga0496106_0063172
1349 Ga0496107_0000565
1350 Ga0496111_0058777
1351 Ga0496113_0000081
1352 Ga0496115_0133558
1353 Ga0496116_0000126
1354 Ga0496116_0042961
1355 Ga0496116_0080144
1356 Ga0496116_0120560
1357 Ga0496116_0182660
1358 Ga0496117_0000623
1359 Ga0496117_0027203
1360 Ga0496118_0030117
1361 Ga0496118_0037674
1362 Ga0496118_0071815
1363 Ga0496119_0004118
1364 Ga0496119_0124169
1365 Ga0496120_0004524
1366 Ga0496120_0028051
1367 Ga0496121_0000067
1368 Ga0496121_0000142
1369 Ga0496121_0001912
1370 Ga0496121_0009885
1371 Ga0496121_0019626
1372 Ga0496121_0059414
1373 Ga0496122_0001234
1374 Ga0496122_0002287
1375 Ga0496122_0005467
1376 Ga0496122_0037935
1377 Ga0496123_0000434
1378 Ga0496123_0003785
1379 Ga0496123_0009060
1380 Ga0496123_0032276
1381 Ga0496124_0000812
1382 Ga0496124_0003614
1383 Ga0496124_0068150
1384 Ga0496125_0012848
1385 Ga0496125_0185974
1386 Ga0496125_0300067
1387 Ga0496125_0312175
1388 Ga0496126_0005438
1389 Ga0496126_0107103
1390 Ga0496126_0319170
1391 Ga0495678_000081
1392 Ga0495678_000583
1393 Ga0495678_001014
1394 Ga0495678_001228
1395 Ga0495678_017299
1396 Ga0495678_021074
1397 Ga0495678_032827
1398 Ga0495678_035943
1399 Ga0495678_123412
1400 Ga0495682_0003421
1401 Ga0495682_0013216
1402 Ga0501032_0044735
1403 Ga0501033_0066516
1404 Ga0501043_0002520
1405 Ga0501046_0055842
1406 Ga0501047_0000342
1407 Ga0501048_0355832
1408 Ga0501070_0141038
1409 Ga0501269_000034
1410 Ga0501035_0029889
1411 nmdc:mga03683_15022_c1
1412 nmdc:mga03n38_109574_c1
1413 nmdc:mga03n38_41862_c1
1414 nmdc:mga00v17_51246_c1
1415 nmdc:mga00v17_626_c1
1416 nmdc:mga0k408_71943_c1
1417 nmdc:mga07m45_62960_c1
1418 nmdc:mga0sz30_6232_c1
1419 Ga0500635_0000020
1420 Ga0500578_0000234
1421 Ga0500578_0215964
1422 Ga0500643_048167
1423 Ga0500644_0000189
1424 Ga0500554_005865
1425 Ga0500556_0001301
1426 Ga0500556_0024836
1427 Ga0500580_037832
1428 Ga0500592_000148
1429 Ga0500594_0000022
1430 Ga0500607_000148
1431 Ga0500607_048277
1432 Ga0500618_000511
1433 Ga0500642_0123100
1434 Ga0500658_0050740
1435 Ga0500559_0000005
1436 Ga0500559_0001556
1437 Ga0500564_000059
1438 Ga0500568_0019338
1439 Ga0500568_0019897
1440 Ga0500600_0064882
1441 Ga0500600_0172950
1442 Ga0500616_0046069
1443 Ga0500624_006724
1444 Ga0500627_0000013
1445 Ga0500634_0000350
1446 Ga0500638_012935
1447 Ga0500636_0000543
1448 Ga0500611_015368
1449 Ga0500645_004520
1450 Ga0500645_008481
1451 Ga0500645_016698
1452 Ga0500609_000125
1453 Ga0466962_0023165
1454 2785366704
1455 2506864804
1456 2511253361
1457 2511269607
1458 2511278028
1459 2511311612
1460 2511324212
1461 2511359913
1462 2512326225
1463 2555668355
1464 2583792554
1465 2585149455
1466 2585306605
1467 2599327076
1468 2599355356
1469 2599360825
1470 2599367147
1471 2599373937
1472 2599380462
1473 2599386909
1474 2599392795
1475 2599404562
1476 2599462190
1477 2599466768
1478 2599490718
1479 2600021798
1480 2600030832
1481 2600075071
1482 2600214812
1483 2600360637
1484 2601774483
1485 2616693185
1486 2624491734
1487 2643819954
1488 2643835400
1489 2643905053
1490 2643942515
1491 2643999094
1492 2644056326
1493 2644263470
1494 2644403111
1495 2644429974
1496 2644514321
1497 2652544212
1498 2671097957
1499 2671126882
1500 2689992791
1501 2743737691
1502 2786667764
1503 2792462386
1504 2793981546
1505 2804849247
1506 2819703041
1507 2826585861
1508 2842850234
1509 2843748738
1510 2844668867
1511 2849565308
1512 2849578894
1513 2851156540
1514 2862181274
1515 2862290096
1516 2862292990
1517 2862580336
1518 2877683834
1519 2898330210
1520 2917072122
1521 2917736462
1522 2918502211
1523 2923156736
1524 2923588027
1525 2928961978
1526 2931374720
1527 2931401304
1528 2935354294
1529 2945963004
1530 2946052317
1531 2946065220
1532 2947232225
1533 2954008556
1534 2954389138
1535 2954673904
1536 2954690087
1537 2954699886
1538 2954702312
1539 2990093814
1540 3003002136
1541 3006394311
1542 3007396547
1543 637318717
1544 8003323451
1545 8015690956
1546 8019770911
1547 8025413824
1548 8047900978
1549 8048134285
1550 8048357923
1551 8048377920
1552 8048387018
1553 8054163291
1554 8055774096
1555 8056178997
1556 8057803655

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

115

307

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahd-assembly1.cif.gz_A opua (e190q) occluded 0.6563 84 253
7ahc-assembly1.cif.gz_B opua apo inward-facing 0.5348 15 247
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.5289 15 248
3dhw-assembly1.cif.gz_A crystal structure of methionine importer metni 0.5242 84 239
3dhw-assembly2.cif.gz_E crystal structure of methionine importer metni 0.5171 61 241
ID Description Score Start End Superfamily
af_P45767_178_390_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8761 124 251 1.10.3720.10
af_P0DP70_1_121_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.783 133 246 1.10.3720.10
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7821 87 255 1.10.3720.10
af_Q2G088_14_207_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7452 84 247 1.10.3720.10
af_P0DP70_1_121_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7395 133 246 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7J5DT53-F1-model_v4 ABC transporter permease subunit 0.9404 125 257 GO:0005886
GO:0055085
AF-A0A519YA77-F1-model_v4 deleted 0.9294 116 261
AF-A0A6N8QHZ2-F1-model_v4 deleted 0.9179 110 257
AF-A0A519YA77-F1-model_v4 deleted 0.9172 116 261
AF-A0A1H9AHU3-F1-model_v4 Sulfonate transport system permease protein 0.9141 107 255 GO:0005886
GO:0055085

Map