F480446
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 778 | 421 | 1556 | 270 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2784746768|2785366704 |
| Length | 315 |
| Sequence | HAPPGSPEPDISEIDQNEASPSEAAHSEASPPEATDNGTGTAATPTSPVDLEPIVPASSRRTRIPRWLRRTTGPVLLLALWQLLSGTGVLTADVLASPGRIAQVAGDLIADGSLVSAMTTSLQRVAGGLLLGALVGTGLALVSGLFRIGEDIVDAPVQMLRTVPFVGLIPLFIIWFGIGEAPKIAIITLGVTFPLYLNIYAGIRGVDSQLIEAGESLGLSRWGLVRHVILPGALPGAMTGLRYSLGIAWLALVFAEQVNADSGIGFLMVQARDFLRTDVIVVCLIVYAFLGLLADFVVRSLERLLLQWRPTFTGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 45 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 46 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 47 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 48 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 49 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 50 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 54 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 55 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 71 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 72 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 73 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 74 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 75 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 77 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 78 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 82 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 120 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 124 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 125 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 126 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 127 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 128 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 129 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 130 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 131 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 132 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 133 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 134 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 135 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 136 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 137 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 138 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 139 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 140 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 141 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 142 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 143 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 144 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 145 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 146 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 147 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 148 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 149 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 150 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 151 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 152 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 153 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 154 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 155 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 156 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 157 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 158 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 159 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 160 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 161 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 162 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 163 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 164 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 165 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 166 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 167 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 168 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 169 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 170 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 171 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 172 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 173 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 174 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 175 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 176 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 177 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 178 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 256 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 257 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 258 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 259 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 260 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 261 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 262 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 263 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 264 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 265 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 266 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 267 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 268 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 269 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 270 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 271 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 272 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 273 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 274 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 275 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 285 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 287 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 288 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 289 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 290 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 291 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 292 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 293 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 294 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 295 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 296 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 297 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 298 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 299 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 300 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 301 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 302 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 303 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 304 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 305 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 306 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 307 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 308 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 309 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 310 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 311 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 313 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 314 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 315 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 316 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 317 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 318 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 319 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 320 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 321 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 322 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 323 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 324 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 325 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 326 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 327 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 328 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 329 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 330 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 331 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 332 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 333 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 334 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 335 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 336 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 337 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 338 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 339 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 340 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 341 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 342 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 343 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 344 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 345 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 346 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 347 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 348 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 349 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 350 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 351 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 352 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 353 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 354 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 355 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 356 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 357 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 358 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 359 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 360 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 361 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 362 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 363 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 364 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 365 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 366 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 367 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 368 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 369 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 370 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 371 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 372 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 373 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 374 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 375 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 376 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 377 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 378 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 379 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 380 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 381 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 382 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 383 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 384 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 385 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 386 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 387 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 388 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 389 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 390 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 391 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 392 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 393 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 394 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 395 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 396 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 397 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 398 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 399 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 400 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 401 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 402 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 403 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 404 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 405 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 406 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 407 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 408 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 409 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 410 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 411 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 412 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 413 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 414 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 415 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 416 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 417 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 418 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 419 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 420 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 421 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.76 |
| Metatranscriptomes | 0 |
| Isolates | 13.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.4 |
| Nodule | 1.54 |
| Rhizoplane | 4.37 |
| Rhizosphere | 65.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3039297 | 2162886007 | Bacteria | 3638 |
| 2 | JGI24739J22299_10064354 | 3300001989 | Bacteria | 1153 |
| 3 | JGI25162J39368_1000054 | 3300002737 | Bacteria | 147779 |
| 4 | JGI25163J39215_1000106 | 3300002771 | Bacteria | 35005 |
| 5 | JGI25164J39214_1000029 | 3300002772 | Bacteria | 147779 |
| 6 | JGI25406J46586_10002057 | 3300003203 | Bacteria | 9500 |
| 7 | JGI25165J46597_1000111 | 3300003214 | Bacteria | 147779 |
| 8 | rootH2_10025695 | 3300003320 | Bacteria | 4019 |
| 9 | rootL2_10029067 | 3300003322 | Bacteria | 10650 |
| 10 | rootL2_10158374 | 3300003322 | Bacteria | 1357 |
| 11 | Ga0055526_1022180 | 3300003771 | Bacteria | 2172 |
| 12 | Ga0055537_1003505 | 3300003773 | Bacteria | 4806 |
| 13 | Ga0055524_1012948 | 3300003775 | Bacteria | 3174 |
| 14 | Ga0055536_1000005 | 3300003781 | Bacteria | 383598 |
| 15 | Ga0055536_1000734 | 3300003781 | Bacteria | 22052 |
| 16 | Ga0055536_1006940 | 3300003781 | Bacteria | 5160 |
| 17 | Ga0055536_1008111 | 3300003781 | Bacteria | 4576 |
| 18 | Ga0055534_1011018 | 3300003784 | Bacteria | 1858 |
| 19 | Ga0055528_1008429 | 3300003790 | Bacteria | 4418 |
| 20 | Ga0055530_10000001 | 3300003791 | Bacteria | 383067 |
| 21 | Ga0055530_10000066 | 3300003791 | Bacteria | 93405 |
| 22 | Ga0055530_10000165 | 3300003791 | Bacteria | 60120 |
| 23 | Ga0055530_10000222 | 3300003791 | Bacteria | 50412 |
| 24 | Ga0055530_10039056 | 3300003791 | Bacteria | 1175 |
| 25 | Ga0055540_1000186 | 3300003792 | Bacteria | 60120 |
| 26 | Ga0055540_1000258 | 3300003792 | Bacteria | 47854 |
| 27 | Ga0055531_10001339 | 3300003794 | Bacteria | 18391 |
| 28 | Ga0055531_10003634 | 3300003794 | Bacteria | 9731 |
| 29 | Ga0055531_10005696 | 3300003794 | Bacteria | 7228 |
| 30 | Ga0065165_1001271 | 3300005262 | Bacteria | 28528 |
| 31 | Ga0065714_10003126 | 3300005288 | Bacteria | 11417 |
| 32 | Ga0065714_10009959 | 3300005288 | Bacteria | 3772 |
| 33 | Ga0065714_10011828 | 3300005288 | Bacteria | 5184 |
| 34 | Ga0065714_10064839 | 3300005288 | Bacteria | 17232 |
| 35 | Ga0065704_10097097 | 3300005289 | Bacteria | 2409 |
| 36 | Ga0065704_10097927 | 3300005289 | Bacteria | 2370 |
| 37 | Ga0065712_10067982 | 3300005290 | Bacteria | 18146 |
| 38 | Ga0070658_10001281 | 3300005327 | Bacteria | 21475 |
| 39 | Ga0070666_10162510 | 3300005335 | Bacteria | 1561 |
| 40 | Ga0070680_100011064 | 3300005336 | Bacteria | 6973 |
| 41 | Ga0070682_100524627 | 3300005337 | Unclassified | 922 |
| 42 | Ga0070660_100019870 | 3300005339 | Bacteria | 4928 |
| 43 | Ga0070668_100002528 | 3300005347 | Bacteria | 13464 |
| 44 | Ga0070668_100017490 | 3300005347 | Bacteria | 5374 |
| 45 | Ga0070669_100001571 | 3300005353 | Bacteria | 16556 |
| 46 | Ga0070669_100001764 | 3300005353 | Bacteria | 15594 |
| 47 | Ga0070671_100003686 | 3300005355 | Bacteria | 12015 |
| 48 | Ga0070671_100003780 | 3300005355 | Bacteria | 11876 |
| 49 | Ga0070667_100020533 | 3300005367 | Bacteria | 5484 |
| 50 | Ga0070667_100028263 | 3300005367 | Bacteria | 4668 |
| 51 | Ga0070678_100039767 | 3300005456 | Bacteria | 3321 |
| 52 | Ga0070681_10003845 | 3300005458 | Bacteria | 14121 |
| 53 | Ga0070679_100007593 | 3300005530 | Bacteria | 10147 |
| 54 | Ga0070697_100077656 | 3300005536 | Bacteria | 2732 |
| 55 | Ga0070672_100374900 | 3300005543 | Bacteria | 1216 |
| 56 | Ga0070665_100000107 | 3300005548 | Bacteria | 156048 |
| 57 | Ga0070665_100008246 | 3300005548 | Bacteria | 10542 |
| 58 | Ga0070665_100033770 | 3300005548 | Bacteria | 5146 |
| 59 | Ga0068855_100005081 | 3300005563 | Bacteria | 16038 |
| 60 | Ga0068855_100276610 | 3300005563 | Bacteria | 1866 |
| 61 | Ga0068854_100072783 | 3300005578 | Bacteria | 2517 |
| 62 | Ga0068856_100411476 | 3300005614 | Bacteria | 1372 |
| 63 | Ga0068863_100018630 | 3300005841 | Bacteria | 6642 |
| 64 | Ga0068860_100015006 | 3300005843 | Bacteria | 7571 |
| 65 | Ga0068862_100000074 | 3300005844 | Bacteria | 118036 |
| 66 | Ga0068862_100016576 | 3300005844 | Bacteria | 6136 |
| 67 | Ga0081539_10000417 | 3300005985 | Bacteria | 90642 |
| 68 | Ga0075363_100070972 | 3300006048 | Bacteria | 1892 |
| 69 | Ga0075364_10005137 | 3300006051 | Bacteria | 7590 |
| 70 | Ga0075364_10005211 | 3300006051 | Bacteria | 7545 |
| 71 | Ga0075362_10019711 | 3300006177 | Bacteria | 2809 |
| 72 | Ga0075369_10006670 | 3300006186 | Bacteria | 4376 |
| 73 | Ga0075366_10143609 | 3300006195 | Bacteria | 1444 |
| 74 | Ga0075370_10177081 | 3300006353 | Bacteria | 1255 |
| 75 | Ga0068865_100244176 | 3300006881 | Bacteria | 1414 |
| 76 | Ga0097620_100210162 | 3300006931 | Bacteria | 2032 |
| 77 | Ga0079104_1000006 | 3300006946 | Bacteria | 396255 |
| 78 | Ga0099826_10000572 | 3300006948 | Bacteria | 18513 |
| 79 | Ga0105251_10000005 | 3300009011 | Bacteria | 259226 |
| 80 | Ga0105251_10005637 | 3300009011 | Bacteria | 8135 |
| 81 | Ga0105251_10030203 | 3300009011 | Bacteria | 2723 |
| 82 | Ga0105251_10030612 | 3300009011 | Bacteria | 2700 |
| 83 | Ga0105244_10001015 | 3300009036 | Bacteria | 23506 |
| 84 | Ga0105244_10001477 | 3300009036 | Bacteria | 18965 |
| 85 | Ga0105250_10004047 | 3300009092 | Bacteria | 6822 |
| 86 | Ga0105250_10012357 | 3300009092 | Bacteria | 3526 |
| 87 | Ga0105240_10014297 | 3300009093 | Bacteria | 10839 |
| 88 | Ga0105247_10119490 | 3300009101 | Bacteria | 1706 |
| 89 | Ga0105243_10000144 | 3300009148 | Bacteria | 81484 |
| 90 | Ga0105243_10024932 | 3300009148 | Bacteria | 4566 |
| 91 | Ga0105248_10003233 | 3300009177 | Bacteria | 18069 |
| 92 | Ga0105248_10037790 | 3300009177 | Bacteria | 5403 |
| 93 | Ga0105238_10012868 | 3300009551 | Bacteria | 8444 |
| 94 | Ga0105249_10027254 | 3300009553 | Bacteria | 5156 |
| 95 | Ga0105249_10160716 | 3300009553 | Bacteria | 2171 |
| 96 | Ga0105239_10132598 | 3300010375 | Bacteria | 2772 |
| 97 | Ga0105239_10811772 | 3300010375 | Bacteria | 1072 |
| 98 | Ga0105246_10019373 | 3300011119 | Bacteria | 4347 |
| 99 | Ga0105246_10049033 | 3300011119 | Bacteria | 2890 |
| 100 | Ga0157371_10000063 | 3300013102 | Bacteria | 169490 |
| 101 | Ga0157371_10000925 | 3300013102 | Bacteria | 32949 |
| 102 | Ga0157370_10002160 | 3300013104 | Bacteria | 24009 |
| 103 | Ga0157370_10030558 | 3300013104 | Bacteria | 5278 |
| 104 | Ga0157370_10032695 | 3300013104 | Bacteria | 5078 |
| 105 | Ga0157369_10227871 | 3300013105 | Bacteria | 1949 |
| 106 | Ga0163162_10000551 | 3300013306 | Bacteria | 34607 |
| 107 | Ga0163162_10031044 | 3300013306 | Bacteria | 5298 |
| 108 | Ga0182008_10000785 | 3300014497 | Bacteria | 22221 |
| 109 | Ga0182008_10001096 | 3300014497 | Bacteria | 18678 |
| 110 | Ga0182006_1003571 | 3300015261 | Bacteria | 7926 |
| 111 | Ga0182006_1006128 | 3300015261 | Bacteria | 5622 |
| 112 | Ga0182006_1007784 | 3300015261 | Bacteria | 4885 |
| 113 | Ga0182007_10000682 | 3300015262 | Bacteria | 19509 |
| 114 | Ga0182007_10001650 | 3300015262 | Bacteria | 11813 |
| 115 | Ga0182005_1015072 | 3300015265 | Bacteria | 2157 |
| 116 | Ga0183367_1003 | 3300015688 | Bacteria | 814276 |
| 117 | Ga0163161_10003171 | 3300017792 | Bacteria | 11599 |
| 118 | Ga0213872_10159707 | 3300021361 | Bacteria | 981 |
| 119 | Ga0213876_10161140 | 3300021384 | Unclassified | 1193 |
| 120 | Ga0209760_100015 | 3300025207 | Bacteria | 176281 |
| 121 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 122 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 123 | Ga0209026_1002402 | 3300025250 | Bacteria | 7062 |
| 124 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 125 | Ga0209565_1000281 | 3300025263 | Bacteria | 50202 |
| 126 | Ga0209673_1001574 | 3300025273 | Bacteria | 20330 |
| 127 | Ga0209675_1000097 | 3300025291 | Bacteria | 131546 |
| 128 | Ga0209675_1019109 | 3300025291 | Bacteria | 1896 |
| 129 | Ga0209676_1000003 | 3300025292 | Bacteria | 1454178 |
| 130 | Ga0209676_1000070 | 3300025292 | Bacteria | 312074 |
| 131 | Ga0209676_1000673 | 3300025292 | Bacteria | 48566 |
| 132 | Ga0209676_1000927 | 3300025292 | Bacteria | 36244 |
| 133 | Ga0209676_1004357 | 3300025292 | Bacteria | 7923 |
| 134 | Ga0209676_1021711 | 3300025292 | Bacteria | 2147 |
| 135 | Ga0209676_1047271 | 3300025292 | Bacteria | 1158 |
| 136 | Ga0209025_1013670 | 3300025294 | Bacteria | 5075 |
| 137 | Ga0209564_1000557 | 3300025295 | Bacteria | 59834 |
| 138 | Ga0209564_1019939 | 3300025295 | Bacteria | 2481 |
| 139 | Ga0209758_1000608 | 3300025297 | Bacteria | 55483 |
| 140 | Ga0209758_1001275 | 3300025297 | Bacteria | 31177 |
| 141 | Ga0209758_1001477 | 3300025297 | Bacteria | 27508 |
| 142 | Ga0209050_1000004 | 3300025298 | Bacteria | 1600040 |
| 143 | Ga0209050_1000037 | 3300025298 | Bacteria | 415612 |
| 144 | Ga0209050_1000038 | 3300025298 | Bacteria | 412635 |
| 145 | Ga0209050_1000627 | 3300025298 | Bacteria | 55036 |
| 146 | Ga0209050_1002783 | 3300025298 | Bacteria | 14009 |
| 147 | Ga0209050_1011541 | 3300025298 | Bacteria | 4169 |
| 148 | Ga0209050_1027233 | 3300025298 | Bacteria | 1889 |
| 149 | Ga0209256_1001941 | 3300025299 | Bacteria | 18811 |
| 150 | Ga0209256_1003017 | 3300025299 | Bacteria | 12452 |
| 151 | Ga0209256_1013803 | 3300025299 | Bacteria | 2969 |
| 152 | Ga0209051_1000006 | 3300025303 | Bacteria | 1015785 |
| 153 | Ga0209051_1000040 | 3300025303 | Bacteria | 315055 |
| 154 | Ga0209257_1000328 | 3300025304 | Bacteria | 99542 |
| 155 | Ga0209257_1001043 | 3300025304 | Bacteria | 36902 |
| 156 | Ga0209257_1001060 | 3300025304 | Bacteria | 36360 |
| 157 | Ga0209257_1002314 | 3300025304 | Bacteria | 19259 |
| 158 | Ga0209257_1009271 | 3300025304 | Bacteria | 5322 |
| 159 | Ga0209257_1012736 | 3300025304 | Bacteria | 3842 |
| 160 | Ga0207696_1003663 | 3300025711 | Bacteria | 6900 |
| 161 | Ga0207696_1041113 | 3300025711 | Bacteria | 1352 |
| 162 | Ga0207655_1003129 | 3300025728 | Bacteria | 12523 |
| 163 | Ga0207713_1000036 | 3300025735 | Bacteria | 259717 |
| 164 | Ga0207713_1001885 | 3300025735 | Bacteria | 15929 |
| 165 | Ga0207713_1031618 | 3300025735 | Bacteria | 2336 |
| 166 | Ga0207713_1045466 | 3300025735 | Bacteria | 1793 |
| 167 | Ga0207710_10105809 | 3300025900 | Bacteria | 1331 |
| 168 | Ga0207680_10137414 | 3300025903 | Bacteria | 1617 |
| 169 | Ga0207705_10025961 | 3300025909 | Bacteria | 4180 |
| 170 | Ga0207654_10068346 | 3300025911 | Bacteria | 2101 |
| 171 | Ga0207707_10003543 | 3300025912 | Bacteria | 13814 |
| 172 | Ga0207695_10012701 | 3300025913 | Bacteria | 10085 |
| 173 | Ga0207660_10167993 | 3300025917 | Bacteria | 1696 |
| 174 | Ga0207657_10281967 | 3300025919 | Unclassified | 1319 |
| 175 | Ga0207652_10011650 | 3300025921 | Bacteria | 7094 |
| 176 | Ga0207681_10001221 | 3300025923 | Bacteria | 16554 |
| 177 | Ga0207681_10001397 | 3300025923 | Bacteria | 15603 |
| 178 | Ga0207694_10007190 | 3300025924 | Bacteria | 8454 |
| 179 | Ga0207644_10055190 | 3300025931 | Bacteria | 2863 |
| 180 | Ga0207709_10001160 | 3300025935 | Bacteria | 19160 |
| 181 | Ga0207709_10205008 | 3300025935 | Bacteria | 1411 |
| 182 | Ga0207704_10185123 | 3300025938 | Bacteria | 1509 |
| 183 | Ga0207711_10003235 | 3300025941 | Bacteria | 14198 |
| 184 | Ga0207711_10017238 | 3300025941 | Bacteria | 6003 |
| 185 | Ga0207711_10382345 | 3300025941 | Bacteria | 1306 |
| 186 | Ga0207667_10021876 | 3300025949 | Bacteria | 7077 |
| 187 | Ga0207712_10032850 | 3300025961 | Bacteria | 3504 |
| 188 | Ga0207712_10146774 | 3300025961 | Bacteria | 1817 |
| 189 | Ga0207668_10001443 | 3300025972 | Bacteria | 13995 |
| 190 | Ga0207668_10006938 | 3300025972 | Bacteria | 6722 |
| 191 | Ga0207658_10001032 | 3300025986 | Bacteria | 22661 |
| 192 | Ga0207658_10092397 | 3300025986 | Bacteria | 2350 |
| 193 | Ga0207702_10042525 | 3300026078 | Bacteria | 3812 |
| 194 | Ga0207641_10003617 | 3300026088 | Bacteria | 13640 |
| 195 | Ga0207683_10217077 | 3300026121 | Bacteria | 1742 |
| 196 | Ga0209281_1000011 | 3300027111 | Bacteria | 695292 |
| 197 | Ga0209371_1000609 | 3300027312 | Bacteria | 31984 |
| 198 | Ga0268266_10000354 | 3300028379 | Bacteria | 70983 |
| 199 | Ga0268266_10007811 | 3300028379 | Bacteria | 9588 |
| 200 | Ga0268266_10009243 | 3300028379 | Bacteria | 8694 |
| 201 | Ga0268266_10417546 | 3300028379 | Bacteria | 1271 |
| 202 | Ga0268265_10000847 | 3300028380 | Bacteria | 28741 |
| 203 | Ga0268265_10005338 | 3300028380 | Bacteria | 8804 |
| 204 | Ga0268265_10097822 | 3300028380 | Bacteria | 2362 |
| 205 | Ga0265319_1026094 | 3300028563 | Bacteria | 2085 |
| 206 | Ga0265318_10000139 | 3300028577 | Bacteria | 66471 |
| 207 | Ga0307517_10048414 | 3300028786 | Bacteria | 4374 |
| 208 | Ga0307517_10074950 | 3300028786 | Bacteria | 2975 |
| 209 | Ga0307515_10000524 | 3300028794 | Bacteria | 91311 |
| 210 | Ga0307515_10027774 | 3300028794 | Bacteria | 9653 |
| 211 | Ga0307515_10058201 | 3300028794 | Bacteria | 5571 |
| 212 | Ga0268256_1000527 | 3300030500 | Bacteria | 31984 |
| 213 | Ga0307511_10011009 | 3300030521 | Bacteria | 8931 |
| 214 | Ga0307511_10037288 | 3300030521 | Bacteria | 4202 |
| 215 | Ga0307511_10100046 | 3300030521 | Bacteria | 1909 |
| 216 | Ga0307512_10006750 | 3300030522 | Bacteria | 11541 |
| 217 | Ga0307512_10015575 | 3300030522 | Bacteria | 7039 |
| 218 | Ga0307512_10040433 | 3300030522 | Bacteria | 3892 |
| 219 | Ga0316177_1222324 | 3300030731 | Bacteria | 2013 |
| 220 | Ga0265330_10003994 | 3300031235 | Bacteria | 7570 |
| 221 | Ga0265332_10003516 | 3300031238 | Bacteria | 7534 |
| 222 | Ga0265328_10002301 | 3300031239 | Bacteria | 8605 |
| 223 | Ga0265320_10002481 | 3300031240 | Bacteria | 12829 |
| 224 | Ga0265329_10000367 | 3300031242 | Bacteria | 23949 |
| 225 | Ga0265339_10077377 | 3300031249 | Bacteria | 1763 |
| 226 | Ga0265331_10004641 | 3300031250 | Bacteria | 8517 |
| 227 | Ga0265327_10000175 | 3300031251 | Bacteria | 137193 |
| 228 | Ga0265316_10008789 | 3300031344 | Bacteria | 9334 |
| 229 | Ga0307513_10015813 | 3300031456 | Bacteria | 9134 |
| 230 | Ga0307513_10103139 | 3300031456 | Bacteria | 2869 |
| 231 | Ga0307509_10002942 | 3300031507 | Bacteria | 26804 |
| 232 | Ga0307509_10003139 | 3300031507 | Bacteria | 25603 |
| 233 | Ga0307508_10029395 | 3300031616 | Bacteria | 4968 |
| 234 | Ga0307508_10049105 | 3300031616 | Bacteria | 3758 |
| 235 | Ga0307508_10229675 | 3300031616 | Bacteria | 1454 |
| 236 | Ga0307508_10241856 | 3300031616 | Bacteria | 1402 |
| 237 | Ga0307514_10004958 | 3300031649 | Bacteria | 12072 |
| 238 | Ga0265314_10013933 | 3300031711 | Bacteria | 6466 |
| 239 | Ga0265342_10001175 | 3300031712 | Bacteria | 24900 |
| 240 | Ga0307516_10006745 | 3300031730 | Bacteria | 13416 |
| 241 | Ga0307518_10178376 | 3300031838 | Bacteria | 1439 |
| 242 | Ga0307518_10186862 | 3300031838 | Bacteria | 1393 |
| 243 | Ga0307412_10038740 | 3300031911 | Bacteria | 3072 |
| 244 | Ga0307414_10440785 | 3300032004 | Bacteria | 1140 |
| 245 | Ga0307507_10007410 | 3300033179 | Bacteria | 15995 |
| 246 | Ga0307507_10193809 | 3300033179 | Bacteria | 1422 |
| 247 | Ga0307510_10009355 | 3300033180 | Bacteria | 11671 |
| 248 | Ga0307510_10024282 | 3300033180 | Bacteria | 7007 |
| 249 | Ga0307510_10054411 | 3300033180 | Bacteria | 4192 |
| 250 | Ga0307510_10058361 | 3300033180 | Bacteria | 3996 |
| 251 | Ga0307510_10219888 | 3300033180 | Bacteria | 1412 |
| 252 | Ga0395898_0002157 | 3300037466 | Bacteria | 24154 |
| 253 | Ga0395901_0161915 | 3300038443 | Bacteria | 2350 |
| 254 | Ga0436365_0466215 | 3300039437 | Bacteria | 7739 |
| 255 | Ga0436361_0804027 | 3300039447 | Bacteria | 6492 |
| 256 | Ga0436361_0989786 | 3300039447 | Bacteria | 1846 |
| 257 | Ga0436363_1493638 | 3300039450 | Bacteria | 2636 |
| 258 | Ga0439438_000200 | 3300041405 | Bacteria | 27336 |
| 259 | Ga0439438_000450 | 3300041405 | Bacteria | 18562 |
| 260 | Ga0439438_000666 | 3300041405 | Bacteria | 15441 |
| 261 | Ga0439447_006761 | 3300041407 | Bacteria | 3688 |
| 262 | Ga0439461_0009575 | 3300041410 | Bacteria | 1760 |
| 263 | Ga0439466_0013030 | 3300041411 | Bacteria | 3050 |
| 264 | Ga0451841_0680686 | 3300041498 | Bacteria | 1075 |
| 265 | Ga0451851_0122701 | 3300041507 | Bacteria | 1141 |
| 266 | Ga0451853_1601412 | 3300041512 | Bacteria | 2011 |
| 267 | Ga0451853_3602439 | 3300041512 | Bacteria | 5479 |
| 268 | Ga0439448_0008535 | 3300042005 | Bacteria | 3003 |
| 269 | Ga0439449_0014725 | 3300042007 | Bacteria | 2939 |
| 270 | Ga0439452_000115 | 3300042010 | Bacteria | 63101 |
| 271 | Ga0439452_000826 | 3300042010 | Bacteria | 14386 |
| 272 | Ga0439455_0037657 | 3300042012 | Bacteria | 1227 |
| 273 | Ga0439456_000816 | 3300042013 | Bacteria | 6313 |
| 274 | Ga0439463_000202 | 3300042016 | Bacteria | 16002 |
| 275 | Ga0439463_026153 | 3300042016 | Bacteria | 1465 |
| 276 | Ga0450900_006822 | 3300042136 | Bacteria | 1392 |
| 277 | Ga0439446_0004310 | 3300042156 | Bacteria | 3601 |
| 278 | Ga0439458_0004574 | 3300042157 | Bacteria | 3166 |
| 279 | Ga0439435_0002850 | 3300042436 | Bacteria | 3505 |
| 280 | Ga0466969_0015985 | 3300044656 | Bacteria | 3933 |
| 281 | Ga0466972_0004929 | 3300044658 | Bacteria | 6699 |
| 282 | Ga0466961_0012375 | 3300044693 | Bacteria | 5455 |
| 283 | Ga0466960_0003455 | 3300044901 | Bacteria | 6079 |
| 284 | Ga0495617_000044 | 3300046452 | Bacteria | 119709 |
| 285 | Ga0495617_013499 | 3300046452 | Bacteria | 2781 |
| 286 | Ga0495617_015757 | 3300046452 | Bacteria | 2558 |
| 287 | Ga0495617_061724 | 3300046452 | Bacteria | 1239 |
| 288 | Ga0495627_000008 | 3300046453 | Bacteria | 572150 |
| 289 | Ga0495627_002624 | 3300046453 | Bacteria | 8462 |
| 290 | Ga0495627_005481 | 3300046453 | Bacteria | 5111 |
| 291 | Ga0495627_012240 | 3300046453 | Bacteria | 3052 |
| 292 | Ga0495592_0020586 | 3300046454 | Bacteria | 5020 |
| 293 | Ga0495603_0000009 | 3300046455 | Bacteria | 72869 |
| 294 | Ga0495603_0009296 | 3300046455 | Bacteria | 5944 |
| 295 | Ga0495603_0297721 | 3300046455 | Bacteria | 926 |
| 296 | Ga0495590_0000698 | 3300046457 | Bacteria | 15366 |
| 297 | Ga0495590_0002258 | 3300046457 | Bacteria | 8044 |
| 298 | Ga0495591_000018 | 3300046458 | Bacteria | 232216 |
| 299 | Ga0495591_000088 | 3300046458 | Bacteria | 102486 |
| 300 | Ga0495591_000300 | 3300046458 | Bacteria | 45180 |
| 301 | Ga0495591_010704 | 3300046458 | Bacteria | 3531 |
| 302 | Ga0495629_0022313 | 3300046459 | Bacteria | 4513 |
| 303 | Ga0495638_0000160 | 3300046460 | Bacteria | 105110 |
| 304 | Ga0495638_0000589 | 3300046460 | Bacteria | 41015 |
| 305 | Ga0495638_0004745 | 3300046460 | Bacteria | 10253 |
| 306 | Ga0495638_0007339 | 3300046460 | Bacteria | 7916 |
| 307 | Ga0495638_0010099 | 3300046460 | Bacteria | 6577 |
| 308 | Ga0495638_0020681 | 3300046460 | Bacteria | 4345 |
| 309 | Ga0495638_0035080 | 3300046460 | Bacteria | 3198 |
| 310 | Ga0495638_0064881 | 3300046460 | Bacteria | 2249 |
| 311 | Ga0495638_0092995 | 3300046460 | Bacteria | 1814 |
| 312 | Ga0495638_0095347 | 3300046460 | Bacteria | 1787 |
| 313 | Ga0495651_0021486 | 3300046462 | Bacteria | 5016 |
| 314 | Ga0495653_0000002 | 3300046463 | Bacteria | 507262 |
| 315 | Ga0495650_0000017 | 3300046471 | Bacteria | 542552 |
| 316 | Ga0495650_0007765 | 3300046471 | Bacteria | 6382 |
| 317 | Ga0495650_0010868 | 3300046471 | Bacteria | 5045 |
| 318 | Ga0495605_0000067 | 3300046474 | Bacteria | 138871 |
| 319 | Ga0495605_0000088 | 3300046474 | Bacteria | 119191 |
| 320 | Ga0495605_0000158 | 3300046474 | Bacteria | 86829 |
| 321 | Ga0495605_0000522 | 3300046474 | Bacteria | 32534 |
| 322 | Ga0495605_0000806 | 3300046474 | Bacteria | 22409 |
| 323 | Ga0495605_0004355 | 3300046474 | Bacteria | 8326 |
| 324 | Ga0495605_0007282 | 3300046474 | Bacteria | 6285 |
| 325 | Ga0495605_0012723 | 3300046474 | Bacteria | 4660 |
| 326 | Ga0495605_0017337 | 3300046474 | Bacteria | 3880 |
| 327 | Ga0495605_0023420 | 3300046474 | Bacteria | 3247 |
| 328 | Ga0495605_0043272 | 3300046474 | Bacteria | 2233 |
| 329 | Ga0495605_0069504 | 3300046474 | Bacteria | 1667 |
| 330 | Ga0495605_0090255 | 3300046474 | Bacteria | 1421 |
| 331 | Ga0495662_0000110 | 3300046476 | Bacteria | 30405 |
| 332 | Ga0495664_0001686 | 3300046477 | Bacteria | 11750 |
| 333 | Ga0495584_0000083 | 3300046491 | Bacteria | 66118 |
| 334 | Ga0495584_0001678 | 3300046491 | Bacteria | 12983 |
| 335 | Ga0495584_0002197 | 3300046491 | Bacteria | 11125 |
| 336 | Ga0495584_0003188 | 3300046491 | Bacteria | 9116 |
| 337 | Ga0495584_0015439 | 3300046491 | Bacteria | 3892 |
| 338 | Ga0495584_0017141 | 3300046491 | Bacteria | 3691 |
| 339 | Ga0495585_0000142 | 3300046492 | Bacteria | 79060 |
| 340 | Ga0495585_0043610 | 3300046492 | Bacteria | 2507 |
| 341 | Ga0495585_0085816 | 3300046492 | Bacteria | 1701 |
| 342 | Ga0495585_0136201 | 3300046492 | Bacteria | 1289 |
| 343 | Ga0495594_0001521 | 3300046499 | Bacteria | 12044 |
| 344 | Ga0495594_0043677 | 3300046499 | Bacteria | 2457 |
| 345 | Ga0495594_0151081 | 3300046499 | Bacteria | 1318 |
| 346 | Ga0495596_0000089 | 3300046500 | Bacteria | 63864 |
| 347 | Ga0495607_0000032 | 3300046501 | Bacteria | 153288 |
| 348 | Ga0495607_0006881 | 3300046501 | Bacteria | 7930 |
| 349 | Ga0495607_0010063 | 3300046501 | Bacteria | 6370 |
| 350 | Ga0495607_0013334 | 3300046501 | Bacteria | 5389 |
| 351 | Ga0495607_0021527 | 3300046501 | Bacteria | 4055 |
| 352 | Ga0495607_0057620 | 3300046501 | Bacteria | 2225 |
| 353 | Ga0495607_0087450 | 3300046501 | Bacteria | 1696 |
| 354 | Ga0495607_0155298 | 3300046501 | Bacteria | 1167 |
| 355 | Ga0495607_0175258 | 3300046501 | Bacteria | 1079 |
| 356 | Ga0495583_0000135 | 3300046506 | Bacteria | 123916 |
| 357 | Ga0495583_0000457 | 3300046506 | Bacteria | 60714 |
| 358 | Ga0495583_0002118 | 3300046506 | Bacteria | 17775 |
| 359 | Ga0495606_0000200 | 3300046507 | Bacteria | 104194 |
| 360 | Ga0495606_0000545 | 3300046507 | Bacteria | 60465 |
| 361 | Ga0495606_0000729 | 3300046507 | Bacteria | 50871 |
| 362 | Ga0495606_0025101 | 3300046507 | Bacteria | 4276 |
| 363 | Ga0495610_0000058 | 3300046512 | Bacteria | 137991 |
| 364 | Ga0495610_0004442 | 3300046512 | Bacteria | 10365 |
| 365 | Ga0495610_0005995 | 3300046512 | Bacteria | 8496 |
| 366 | Ga0495610_0009917 | 3300046512 | Bacteria | 5959 |
| 367 | Ga0495610_0010854 | 3300046512 | Bacteria | 5625 |
| 368 | Ga0495610_0012925 | 3300046512 | Bacteria | 4989 |
| 369 | Ga0495610_0019749 | 3300046512 | Bacteria | 3758 |
| 370 | Ga0495610_0033846 | 3300046512 | Bacteria | 2637 |
| 371 | Ga0495610_0074419 | 3300046512 | Bacteria | 1576 |
| 372 | Ga0495616_0000031 | 3300046513 | Bacteria | 130957 |
| 373 | Ga0495616_0000429 | 3300046513 | Bacteria | 32137 |
| 374 | Ga0495618_0081775 | 3300046514 | Bacteria | 2063 |
| 375 | Ga0495620_0000034 | 3300046515 | Bacteria | 117942 |
| 376 | Ga0495620_0000207 | 3300046515 | Bacteria | 44260 |
| 377 | Ga0495620_0001291 | 3300046515 | Bacteria | 15265 |
| 378 | Ga0495620_0003917 | 3300046515 | Bacteria | 8483 |
| 379 | Ga0495620_0008610 | 3300046515 | Bacteria | 5471 |
| 380 | Ga0495620_0009072 | 3300046515 | Bacteria | 5308 |
| 381 | Ga0495620_0048421 | 3300046515 | Bacteria | 1824 |
| 382 | Ga0495628_0009638 | 3300046516 | Bacteria | 8239 |
| 383 | Ga0495628_0229975 | 3300046516 | Bacteria | 1390 |
| 384 | Ga0495631_0002052 | 3300046518 | Bacteria | 11733 |
| 385 | Ga0495631_0007823 | 3300046518 | Bacteria | 5419 |
| 386 | Ga0495632_0000495 | 3300046519 | Bacteria | 37144 |
| 387 | Ga0495632_0000607 | 3300046519 | Bacteria | 33188 |
| 388 | Ga0495632_0000748 | 3300046519 | Bacteria | 29283 |
| 389 | Ga0495632_0003572 | 3300046519 | Bacteria | 10964 |
| 390 | Ga0495632_0015353 | 3300046519 | Bacteria | 4299 |
| 391 | Ga0495637_0007004 | 3300046520 | Bacteria | 5616 |
| 392 | Ga0495637_0009342 | 3300046520 | Bacteria | 4785 |
| 393 | Ga0495637_0012102 | 3300046520 | Bacteria | 4133 |
| 394 | Ga0495637_0012438 | 3300046520 | Bacteria | 4069 |
| 395 | Ga0495637_0013550 | 3300046520 | Bacteria | 3866 |
| 396 | Ga0495637_0033500 | 3300046520 | Bacteria | 2255 |
| 397 | Ga0495643_0005942 | 3300046522 | Bacteria | 8142 |
| 398 | Ga0495643_0007143 | 3300046522 | Bacteria | 7244 |
| 399 | Ga0495643_0011709 | 3300046522 | Bacteria | 5325 |
| 400 | Ga0495644_0001087 | 3300046523 | Bacteria | 11262 |
| 401 | Ga0495644_0004478 | 3300046523 | Bacteria | 5489 |
| 402 | Ga0495644_0055487 | 3300046523 | Bacteria | 1489 |
| 403 | Ga0495644_0059130 | 3300046523 | Bacteria | 1441 |
| 404 | Ga0495648_0000239 | 3300046524 | Bacteria | 62900 |
| 405 | Ga0495648_0001250 | 3300046524 | Bacteria | 25409 |
| 406 | Ga0495648_0004517 | 3300046524 | Bacteria | 11863 |
| 407 | Ga0495648_0013500 | 3300046524 | Bacteria | 6031 |
| 408 | Ga0495648_0015275 | 3300046524 | Bacteria | 5584 |
| 409 | Ga0495648_0021510 | 3300046524 | Bacteria | 4463 |
| 410 | Ga0495663_0030146 | 3300046525 | Bacteria | 1606 |
| 411 | Ga0495666_0012793 | 3300046526 | Bacteria | 4183 |
| 412 | Ga0495642_0000187 | 3300046528 | Bacteria | 36703 |
| 413 | Ga0495642_0092802 | 3300046528 | Bacteria | 1279 |
| 414 | Ga0495654_0000012 | 3300046530 | Bacteria | 328997 |
| 415 | Ga0495654_0000414 | 3300046530 | Bacteria | 36432 |
| 416 | Ga0495654_0006197 | 3300046530 | Bacteria | 6822 |
| 417 | Ga0495654_0021651 | 3300046530 | Bacteria | 3343 |
| 418 | Ga0495654_0026580 | 3300046530 | Bacteria | 2974 |
| 419 | Ga0495654_0028499 | 3300046530 | Bacteria | 2855 |
| 420 | Ga0495654_0040591 | 3300046530 | Bacteria | 2318 |
| 421 | Ga0495654_0076963 | 3300046530 | Bacteria | 1571 |
| 422 | Ga0495654_0086774 | 3300046530 | Bacteria | 1458 |
| 423 | Ga0495654_0087054 | 3300046530 | Bacteria | 1455 |
| 424 | Ga0495586_0004586 | 3300046535 | Bacteria | 7385 |
| 425 | Ga0495587_0019040 | 3300046536 | Bacteria | 4253 |
| 426 | Ga0495609_0000147 | 3300046538 | Bacteria | 73010 |
| 427 | Ga0495609_0000340 | 3300046538 | Bacteria | 41415 |
| 428 | Ga0495609_0000477 | 3300046538 | Bacteria | 32285 |
| 429 | Ga0495597_0000013 | 3300046542 | Bacteria | 203829 |
| 430 | Ga0495597_0004857 | 3300046542 | Bacteria | 7245 |
| 431 | Ga0495597_0012599 | 3300046542 | Bacteria | 4074 |
| 432 | Ga0495597_0017766 | 3300046542 | Bacteria | 3342 |
| 433 | Ga0495597_0030407 | 3300046542 | Bacteria | 2461 |
| 434 | Ga0495597_0038360 | 3300046542 | Bacteria | 2147 |
| 435 | Ga0495622_0017722 | 3300046557 | Bacteria | 3314 |
| 436 | Ga0495633_0000316 | 3300046558 | Bacteria | 54818 |
| 437 | Ga0495633_0000446 | 3300046558 | Bacteria | 42633 |
| 438 | Ga0495633_0162372 | 3300046558 | Bacteria | 1031 |
| 439 | Ga0495667_0179581 | 3300046559 | Bacteria | 1359 |
| 440 | Ga0495668_0000087 | 3300046616 | Bacteria | 151819 |
| 441 | Ga0495668_0000887 | 3300046616 | Bacteria | 33700 |
| 442 | Ga0495668_0007406 | 3300046616 | Bacteria | 7017 |
| 443 | Ga0495668_0022070 | 3300046616 | Bacteria | 3641 |
| 444 | Ga0495668_0029381 | 3300046616 | Bacteria | 3106 |
| 445 | Ga0495668_0032163 | 3300046616 | Bacteria | 2954 |
| 446 | Ga0495668_0053332 | 3300046616 | Bacteria | 2235 |
| 447 | Ga0495634_0031104 | 3300046642 | Bacteria | 3678 |
| 448 | Ga0495611_0017900 | 3300046648 | Bacteria | 3036 |
| 449 | Ga0495611_0155835 | 3300046648 | Bacteria | 1066 |
| 450 | Ga0495625_0000081 | 3300046660 | Bacteria | 156254 |
| 451 | Ga0495625_0000830 | 3300046660 | Bacteria | 42448 |
| 452 | Ga0495625_0001558 | 3300046660 | Bacteria | 27293 |
| 453 | Ga0495625_0012474 | 3300046660 | Bacteria | 6885 |
| 454 | Ga0495625_0020841 | 3300046660 | Bacteria | 5054 |
| 455 | Ga0495625_0022235 | 3300046660 | Bacteria | 4865 |
| 456 | Ga0495625_0029266 | 3300046660 | Bacteria | 4122 |
| 457 | Ga0495625_0072463 | 3300046660 | Bacteria | 2415 |
| 458 | Ga0495625_0092267 | 3300046660 | Bacteria | 2092 |
| 459 | Ga0495625_0113957 | 3300046660 | Bacteria | 1846 |
| 460 | Ga0495625_0131976 | 3300046660 | Bacteria | 1691 |
| 461 | Ga0495625_0137418 | 3300046660 | Bacteria | 1651 |
| 462 | Ga0495625_0226307 | 3300046660 | Bacteria | 1223 |
| 463 | Ga0495659_0008262 | 3300046664 | Bacteria | 3312 |
| 464 | Ga0495661_0000078 | 3300046665 | Bacteria | 119097 |
| 465 | Ga0495661_0000138 | 3300046665 | Bacteria | 85693 |
| 466 | Ga0495661_0000513 | 3300046665 | Bacteria | 40214 |
| 467 | Ga0495661_0002111 | 3300046665 | Bacteria | 15597 |
| 468 | Ga0495661_0010828 | 3300046665 | Bacteria | 6203 |
| 469 | Ga0495661_0177944 | 3300046665 | Bacteria | 1129 |
| 470 | Ga0495588_0013345 | 3300046674 | Bacteria | 3913 |
| 471 | Ga0495588_0033156 | 3300046674 | Bacteria | 2607 |
| 472 | Ga0495588_0043085 | 3300046674 | Bacteria | 2308 |
| 473 | Ga0495657_0000437 | 3300046675 | Bacteria | 38928 |
| 474 | Ga0495599_0212034 | 3300046678 | Bacteria | 1187 |
| 475 | Ga0495646_0000400 | 3300046680 | Bacteria | 22769 |
| 476 | Ga0495613_0002753 | 3300046689 | Bacteria | 13204 |
| 477 | Ga0495613_0085988 | 3300046689 | Bacteria | 2280 |
| 478 | Ga0495671_0000052 | 3300046692 | Bacteria | 133684 |
| 479 | Ga0495671_0014142 | 3300046692 | Bacteria | 4300 |
| 480 | Ga0495671_0015686 | 3300046692 | Bacteria | 4054 |
| 481 | Ga0495671_0026763 | 3300046692 | Bacteria | 2985 |
| 482 | Ga0495671_0074428 | 3300046692 | Bacteria | 1666 |
| 483 | Ga0495649_0000033 | 3300046694 | Bacteria | 136854 |
| 484 | Ga0495649_0000106 | 3300046694 | Bacteria | 74615 |
| 485 | Ga0495649_0000836 | 3300046694 | Bacteria | 24748 |
| 486 | Ga0495649_0015712 | 3300046694 | Bacteria | 4304 |
| 487 | Ga0495649_0023498 | 3300046694 | Bacteria | 3443 |
| 488 | Ga0495649_0053335 | 3300046694 | Bacteria | 2189 |
| 489 | Ga0495589_0000585 | 3300046794 | Bacteria | 24989 |
| 490 | Ga0495589_0001063 | 3300046794 | Bacteria | 16487 |
| 491 | Ga0495589_0002412 | 3300046794 | Bacteria | 10499 |
| 492 | Ga0495589_0006602 | 3300046794 | Bacteria | 6113 |
| 493 | Ga0495589_0010957 | 3300046794 | Bacteria | 4706 |
| 494 | Ga0495660_0000873 | 3300046810 | Bacteria | 22251 |
| 495 | Ga0495660_0001253 | 3300046810 | Bacteria | 17692 |
| 496 | Ga0495660_0001366 | 3300046810 | Bacteria | 16808 |
| 497 | Ga0495660_0002313 | 3300046810 | Bacteria | 12218 |
| 498 | Ga0495660_0005067 | 3300046810 | Bacteria | 7916 |
| 499 | Ga0495660_0017385 | 3300046810 | Bacteria | 4140 |
| 500 | Ga0495660_0065403 | 3300046810 | Bacteria | 1941 |
| 501 | Ga0495660_0078105 | 3300046810 | Bacteria | 1741 |
| 502 | Ga0495604_0000673 | 3300047317 | Bacteria | 28933 |
| 503 | Ga0495604_0009142 | 3300047317 | Bacteria | 7842 |
| 504 | Ga0495636_0000221 | 3300047318 | Bacteria | 22484 |
| 505 | Ga0495636_0020197 | 3300047318 | Bacteria | 2683 |
| 506 | Ga0495636_0049029 | 3300047318 | Bacteria | 1766 |
| 507 | Ga0495674_0170119 | 3300047319 | Bacteria | 1819 |
| 508 | Ga0495672_0000032 | 3300047320 | Bacteria | 295356 |
| 509 | Ga0495672_0001535 | 3300047320 | Bacteria | 22596 |
| 510 | Ga0495672_0003990 | 3300047320 | Bacteria | 12347 |
| 511 | Ga0495676_0002857 | 3300047321 | Bacteria | 15570 |
| 512 | Ga0495676_0003781 | 3300047321 | Bacteria | 13756 |
| 513 | Ga0495676_0004612 | 3300047321 | Bacteria | 12622 |
| 514 | Ga0495676_0010737 | 3300047321 | Bacteria | 8289 |
| 515 | Ga0495683_0000108 | 3300047323 | Bacteria | 84498 |
| 516 | Ga0495683_0002624 | 3300047323 | Bacteria | 10750 |
| 517 | Ga0495683_0002951 | 3300047323 | Bacteria | 10064 |
| 518 | Ga0495683_0047214 | 3300047323 | Bacteria | 2161 |
| 519 | Ga0495687_000572 | 3300047443 | Bacteria | 43367 |
| 520 | Ga0495687_001130 | 3300047443 | Bacteria | 25900 |
| 521 | Ga0495687_004181 | 3300047443 | Bacteria | 9913 |
| 522 | Ga0495687_008146 | 3300047443 | Bacteria | 6044 |
| 523 | Ga0495687_027803 | 3300047443 | Bacteria | 2641 |
| 524 | Ga0495687_098775 | 3300047443 | Bacteria | 1100 |
| 525 | Ga0495675_0000016 | 3300047444 | Bacteria | 129732 |
| 526 | Ga0495679_000198 | 3300047446 | Bacteria | 53238 |
| 527 | Ga0495679_001171 | 3300047446 | Bacteria | 15590 |
| 528 | Ga0495679_003085 | 3300047446 | Bacteria | 8168 |
| 529 | Ga0495679_013312 | 3300047446 | Bacteria | 3096 |
| 530 | Ga0495685_041386 | 3300047447 | Bacteria | 1575 |
| 531 | Ga0495673_0000190 | 3300047469 | Bacteria | 97539 |
| 532 | Ga0495673_0000321 | 3300047469 | Bacteria | 61858 |
| 533 | Ga0495673_0000997 | 3300047469 | Bacteria | 25163 |
| 534 | Ga0495673_0003718 | 3300047469 | Bacteria | 9918 |
| 535 | Ga0495673_0025675 | 3300047469 | Bacteria | 2824 |
| 536 | Ga0495681_0000009 | 3300047470 | Bacteria | 205224 |
| 537 | Ga0495681_0000257 | 3300047470 | Bacteria | 43264 |
| 538 | Ga0495681_0000329 | 3300047470 | Bacteria | 37635 |
| 539 | Ga0495681_0002219 | 3300047470 | Bacteria | 13986 |
| 540 | Ga0495681_0003080 | 3300047470 | Bacteria | 11691 |
| 541 | Ga0495681_0004335 | 3300047470 | Bacteria | 9705 |
| 542 | Ga0495681_0004938 | 3300047470 | Bacteria | 9002 |
| 543 | Ga0495681_0006935 | 3300047470 | Bacteria | 7341 |
| 544 | Ga0495681_0008911 | 3300047470 | Bacteria | 6232 |
| 545 | Ga0495681_0011173 | 3300047470 | Bacteria | 5372 |
| 546 | Ga0495681_0013912 | 3300047470 | Bacteria | 4644 |
| 547 | Ga0495681_0035562 | 3300047470 | Bacteria | 2472 |
| 548 | Ga0495681_0159761 | 3300047470 | Bacteria | 939 |
| 549 | Ga0495684_0023241 | 3300047471 | Bacteria | 4766 |
| 550 | Ga0495686_0000633 | 3300047472 | Bacteria | 48475 |
| 551 | Ga0495686_0025642 | 3300047472 | Bacteria | 3864 |
| 552 | Ga0495686_0038730 | 3300047472 | Bacteria | 3048 |
| 553 | Ga0495686_0071700 | 3300047472 | Bacteria | 2131 |
| 554 | Ga0495686_0099087 | 3300047472 | Bacteria | 1760 |
| 555 | Ga0495593_0002874 | 3300047673 | Bacteria | 10384 |
| 556 | Ga0495602_0059408 | 3300048088 | Bacteria | 3338 |
| 557 | Ga0495614_0007263 | 3300048089 | Bacteria | 4936 |
| 558 | Ga0495626_0000015 | 3300048091 | Bacteria | 232238 |
| 559 | Ga0495626_0000033 | 3300048091 | Bacteria | 184008 |
| 560 | Ga0495626_0000720 | 3300048091 | Bacteria | 30946 |
| 561 | Ga0495626_0009842 | 3300048091 | Bacteria | 5140 |
| 562 | Ga0495626_0058064 | 3300048091 | Bacteria | 1769 |
| 563 | Ga0496101_0323198 | 3300048904 | Bacteria | 1211 |
| 564 | Ga0496102_0000613 | 3300048905 | Bacteria | 36995 |
| 565 | Ga0496102_0043134 | 3300048905 | Bacteria | 4089 |
| 566 | Ga0496103_0000163 | 3300048906 | Bacteria | 70387 |
| 567 | Ga0496103_0009503 | 3300048906 | Bacteria | 5757 |
| 568 | Ga0496104_0002224 | 3300048907 | Bacteria | 16745 |
| 569 | Ga0496105_0003862 | 3300048908 | Bacteria | 11198 |
| 570 | Ga0496106_0063172 | 3300048909 | Bacteria | 2813 |
| 571 | Ga0496107_0000565 | 3300048910 | Bacteria | 20698 |
| 572 | Ga0496111_0058777 | 3300048914 | Bacteria | 2784 |
| 573 | Ga0496113_0000081 | 3300048916 | Bacteria | 42072 |
| 574 | Ga0496115_0133558 | 3300048918 | Bacteria | 2046 |
| 575 | Ga0496116_0000126 | 3300048919 | Bacteria | 160425 |
| 576 | Ga0496116_0042961 | 3300048919 | Bacteria | 3083 |
| 577 | Ga0496116_0080144 | 3300048919 | Bacteria | 2028 |
| 578 | Ga0496116_0120560 | 3300048919 | Bacteria | 1519 |
| 579 | Ga0496116_0182660 | 3300048919 | Bacteria | 1121 |
| 580 | Ga0496117_0000623 | 3300048920 | Bacteria | 57364 |
| 581 | Ga0496117_0027203 | 3300048920 | Bacteria | 4461 |
| 582 | Ga0496118_0030117 | 3300048921 | Bacteria | 4537 |
| 583 | Ga0496118_0037674 | 3300048921 | Bacteria | 3887 |
| 584 | Ga0496118_0071815 | 3300048921 | Bacteria | 2489 |
| 585 | Ga0496119_0004118 | 3300048922 | Bacteria | 14645 |
| 586 | Ga0496119_0124169 | 3300048922 | Bacteria | 1415 |
| 587 | Ga0496120_0004524 | 3300048923 | Bacteria | 11623 |
| 588 | Ga0496120_0028051 | 3300048923 | Bacteria | 3456 |
| 589 | Ga0496121_0000067 | 3300048924 | Bacteria | 261543 |
| 590 | Ga0496121_0000142 | 3300048924 | Bacteria | 160072 |
| 591 | Ga0496121_0001912 | 3300048924 | Bacteria | 33300 |
| 592 | Ga0496121_0009885 | 3300048924 | Bacteria | 10872 |
| 593 | Ga0496121_0019626 | 3300048924 | Bacteria | 6750 |
| 594 | Ga0496121_0059414 | 3300048924 | Bacteria | 3152 |
| 595 | Ga0496122_0001234 | 3300048925 | Bacteria | 43175 |
| 596 | Ga0496122_0002287 | 3300048925 | Bacteria | 27682 |
| 597 | Ga0496122_0005467 | 3300048925 | Bacteria | 15122 |
| 598 | Ga0496122_0037935 | 3300048925 | Bacteria | 3869 |
| 599 | Ga0496123_0000434 | 3300048926 | Bacteria | 75349 |
| 600 | Ga0496123_0003785 | 3300048926 | Bacteria | 16568 |
| 601 | Ga0496123_0009060 | 3300048926 | Bacteria | 9017 |
| 602 | Ga0496123_0032276 | 3300048926 | Bacteria | 3795 |
| 603 | Ga0496124_0000812 | 3300048927 | Bacteria | 50806 |
| 604 | Ga0496124_0003614 | 3300048927 | Bacteria | 18779 |
| 605 | Ga0496124_0068150 | 3300048927 | Bacteria | 2959 |
| 606 | Ga0496125_0012848 | 3300048928 | Bacteria | 8274 |
| 607 | Ga0496125_0185974 | 3300048928 | Bacteria | 1378 |
| 608 | Ga0496125_0300067 | 3300048928 | Bacteria | 984 |
| 609 | Ga0496125_0312175 | 3300048928 | Bacteria | 957 |
| 610 | Ga0496126_0005438 | 3300048929 | Bacteria | 14523 |
| 611 | Ga0496126_0107103 | 3300048929 | Bacteria | 2438 |
| 612 | Ga0496126_0319170 | 3300048929 | Bacteria | 1277 |
| 613 | Ga0495678_000081 | 3300049459 | Bacteria | 118700 |
| 614 | Ga0495678_000583 | 3300049459 | Bacteria | 34467 |
| 615 | Ga0495678_001014 | 3300049459 | Bacteria | 24007 |
| 616 | Ga0495678_001228 | 3300049459 | Bacteria | 20891 |
| 617 | Ga0495678_017299 | 3300049459 | Bacteria | 3271 |
| 618 | Ga0495678_021074 | 3300049459 | Bacteria | 2875 |
| 619 | Ga0495678_032827 | 3300049459 | Bacteria | 2148 |
| 620 | Ga0495678_035943 | 3300049459 | Bacteria | 2027 |
| 621 | Ga0495678_123412 | 3300049459 | Bacteria | 867 |
| 622 | Ga0495682_0003421 | 3300049460 | Bacteria | 7058 |
| 623 | Ga0495682_0013216 | 3300049460 | Bacteria | 3147 |
| 624 | Ga0501032_0044735 | 3300049569 | Bacteria | 2996 |
| 625 | Ga0501033_0066516 | 3300049570 | Bacteria | 2650 |
| 626 | Ga0501043_0002520 | 3300049579 | Bacteria | 15482 |
| 627 | Ga0501046_0055842 | 3300049580 | Bacteria | 3101 |
| 628 | Ga0501047_0000342 | 3300049581 | Bacteria | 53140 |
| 629 | Ga0501048_0355832 | 3300049582 | Bacteria | 1044 |
| 630 | Ga0501070_0141038 | 3300049586 | Bacteria | 1990 |
| 631 | Ga0501269_000034 | 3300049766 | Bacteria | 42532 |
| 632 | Ga0501035_0029889 | 3300049822 | Bacteria | 4969 |
| 633 | nmdc:mga03683_15022_c1 | 3300050489 | Bacteria | 2880 |
| 634 | nmdc:mga03n38_109574_c1 | 3300050490 | Bacteria | 1343 |
| 635 | nmdc:mga03n38_41862_c1 | 3300050490 | Bacteria | 1999 |
| 636 | nmdc:mga00v17_51246_c1 | 3300050491 | Bacteria | 2510 |
| 637 | nmdc:mga00v17_626_c1 | 3300050491 | Bacteria | 8462 |
| 638 | nmdc:mga0k408_71943_c1 | 3300050493 | Bacteria | 2019 |
| 639 | nmdc:mga07m45_62960_c1 | 3300050496 | Bacteria | 2103 |
| 640 | nmdc:mga0sz30_6232_c1 | 3300050516 | Bacteria | 4422 |
| 641 | Ga0500635_0000020 | 3300053080 | Bacteria | 110196 |
| 642 | Ga0500578_0000234 | 3300053086 | Bacteria | 68455 |
| 643 | Ga0500578_0215964 | 3300053086 | Bacteria | 1168 |
| 644 | Ga0500643_048167 | 3300053087 | Bacteria | 1226 |
| 645 | Ga0500644_0000189 | 3300053088 | Bacteria | 38264 |
| 646 | Ga0500554_005865 | 3300053102 | Bacteria | 2715 |
| 647 | Ga0500556_0001301 | 3300053104 | Bacteria | 11228 |
| 648 | Ga0500556_0024836 | 3300053104 | Bacteria | 1973 |
| 649 | Ga0500580_037832 | 3300053113 | Bacteria | 2047 |
| 650 | Ga0500592_000148 | 3300053116 | Bacteria | 14211 |
| 651 | Ga0500594_0000022 | 3300053118 | Bacteria | 54062 |
| 652 | Ga0500607_000148 | 3300053121 | Bacteria | 59763 |
| 653 | Ga0500607_048277 | 3300053121 | Bacteria | 2277 |
| 654 | Ga0500618_000511 | 3300053125 | Bacteria | 24569 |
| 655 | Ga0500642_0123100 | 3300053130 | Bacteria | 1214 |
| 656 | Ga0500658_0050740 | 3300053134 | Bacteria | 1694 |
| 657 | Ga0500559_0000005 | 3300053136 | Bacteria | 230231 |
| 658 | Ga0500559_0001556 | 3300053136 | Bacteria | 12842 |
| 659 | Ga0500564_000059 | 3300053138 | Bacteria | 29435 |
| 660 | Ga0500568_0019338 | 3300053139 | Bacteria | 2962 |
| 661 | Ga0500568_0019897 | 3300053139 | Bacteria | 2910 |
| 662 | Ga0500600_0064882 | 3300053149 | Bacteria | 2022 |
| 663 | Ga0500600_0172950 | 3300053149 | Bacteria | 1048 |
| 664 | Ga0500616_0046069 | 3300053153 | Bacteria | 2319 |
| 665 | Ga0500624_006724 | 3300053157 | Bacteria | 1563 |
| 666 | Ga0500627_0000013 | 3300053158 | Bacteria | 136204 |
| 667 | Ga0500634_0000350 | 3300053161 | Bacteria | 14729 |
| 668 | Ga0500638_012935 | 3300053162 | Bacteria | 3757 |
| 669 | Ga0500636_0000543 | 3300053177 | Bacteria | 20542 |
| 670 | Ga0500611_015368 | 3300053727 | Bacteria | 1354 |
| 671 | Ga0500645_004520 | 3300053730 | Bacteria | 5309 |
| 672 | Ga0500645_008481 | 3300053730 | Bacteria | 3507 |
| 673 | Ga0500645_016698 | 3300053730 | Bacteria | 2309 |
| 674 | Ga0500609_000125 | 3300053731 | Bacteria | 10137 |
| 675 | Ga0466962_0023165 | 3300061719 | Bacteria | 2985 |
| 676 | 2785366704 | 2784746768 | Bacteria | 10036182 |
| 677 | 2506864804 | 2506783011 | Bacteria | 5323186 |
| 678 | 2511253361 | 2511231004 | Bacteria | 6669789 |
| 679 | 2511269607 | 2511231007 | Bacteria | 6306603 |
| 680 | 2511278028 | 2511231008 | Bacteria | 6624100 |
| 681 | 2511311612 | 2511231014 | Bacteria | 6462302 |
| 682 | 2511324212 | 2511231016 | Bacteria | 6704427 |
| 683 | 2511359913 | 2511231021 | Bacteria | 7302637 |
| 684 | 2512326225 | 2512047018 | Bacteria | 6663241 |
| 685 | 2555668355 | 2554235341 | Bacteria | 6867980 |
| 686 | 2583792554 | 2582580891 | Bacteria | 6800976 |
| 687 | 2585149455 | 2582581279 | Bacteria | 4980720 |
| 688 | 2585306605 | 2582581313 | Bacteria | 10042643 |
| 689 | 2599327076 | 2599185155 | Bacteria | 5827168 |
| 690 | 2599355356 | 2599185160 | Bacteria | 6844013 |
| 691 | 2599360825 | 2599185161 | Bacteria | 6960462 |
| 692 | 2599367147 | 2599185162 | Bacteria | 6957254 |
| 693 | 2599373937 | 2599185163 | Bacteria | 6995158 |
| 694 | 2599380462 | 2599185164 | Bacteria | 6841688 |
| 695 | 2599386909 | 2599185165 | Bacteria | 6843250 |
| 696 | 2599392795 | 2599185166 | Bacteria | 6959206 |
| 697 | 2599404562 | 2599185168 | Bacteria | 6997636 |
| 698 | 2599462190 | 2599185181 | Bacteria | 6844519 |
| 699 | 2599466768 | 2599185182 | Bacteria | 6883168 |
| 700 | 2599490718 | 2599185186 | Bacteria | 6831633 |
| 701 | 2600021798 | 2599185316 | Bacteria | 6320029 |
| 702 | 2600030832 | 2599185317 | Bacteria | 6435722 |
| 703 | 2600075071 | 2599185325 | Bacteria | 6324919 |
| 704 | 2600214812 | 2599185356 | Bacteria | 6843884 |
| 705 | 2600360637 | 2600254930 | Bacteria | 6431253 |
| 706 | 2601774483 | 2600255313 | Bacteria | 6842543 |
| 707 | 2616693185 | 2616644814 | Bacteria | 11555299 |
| 708 | 2624491734 | 2623620446 | Bacteria | 6500345 |
| 709 | 2643819954 | 2643221560 | Bacteria | 4801179 |
| 710 | 2643835400 | 2643221563 | Bacteria | 4726935 |
| 711 | 2643905053 | 2643221578 | Bacteria | 9213798 |
| 712 | 2643942515 | 2643221587 | Bacteria | 7586415 |
| 713 | 2643999094 | 2643221598 | Bacteria | 4578346 |
| 714 | 2644056326 | 2643221608 | Bacteria | 4724829 |
| 715 | 2644263470 | 2643221647 | Bacteria | 10741251 |
| 716 | 2644403111 | 2643221673 | Bacteria | 9196637 |
| 717 | 2644429974 | 2643221677 | Bacteria | 7584031 |
| 718 | 2644514321 | 2643221692 | Bacteria | 7282860 |
| 719 | 2652544212 | 2651869719 | Bacteria | 6047974 |
| 720 | 2671097957 | 2667528171 | Bacteria | 6900659 |
| 721 | 2671126882 | 2667528176 | Bacteria | 6724917 |
| 722 | 2689992791 | 2687453743 | Bacteria | 8361025 |
| 723 | 2743737691 | 2740892503 | Bacteria | 6855563 |
| 724 | 2786667764 | 2786546132 | Bacteria | 10419719 |
| 725 | 2792462386 | 2791355048 | Bacteria | 5832535 |
| 726 | 2793981546 | 2791355406 | Bacteria | 11364898 |
| 727 | 2804849247 | 2802429296 | Bacteria | 7227771 |
| 728 | 2819703041 | 2818991464 | Bacteria | 6907494 |
| 729 | 2826585861 | 2826581358 | Bacteria | 5963467 |
| 730 | 2842850234 | 2842849001 | Bacteria | 5924277 |
| 731 | 2843748738 | 2843744320 | Bacteria | 5659202 |
| 732 | 2844668867 | 2844665904 | Bacteria | 6817974 |
| 733 | 2849565308 | 2849560528 | Bacteria | 5393480 |
| 734 | 2849578894 | 2849573788 | Bacteria | 5421256 |
| 735 | 2851156540 | 2851153111 | Bacteria | 5542585 |
| 736 | 2862181274 | 2862178590 | Bacteria | 8583590 |
| 737 | 2862290096 | 2862281513 | Bacteria | 9621493 |
| 738 | 2862292990 | 2862290372 | Bacteria | 7471434 |
| 739 | 2862580336 | 2862574272 | Bacteria | 10567477 |
| 740 | 2877683834 | 2877676314 | Bacteria | 9512378 |
| 741 | 2898330210 | 2898329390 | Bacteria | 5168154 |
| 742 | 2917072122 | 2917070673 | Bacteria | 6868303 |
| 743 | 2917736462 | 2917736166 | Bacteria | 9690793 |
| 744 | 2918502211 | 2918501144 | Bacteria | 8668083 |
| 745 | 2923156736 | 2923153595 | Bacteria | 6870622 |
| 746 | 2923588027 | 2923586266 | Bacteria | 6565975 |
| 747 | 2928961978 | 2928959182 | Bacteria | 4725774 |
| 748 | 2931374720 | 2931369376 | Bacteria | 6847892 |
| 749 | 2931401304 | 2931396565 | Bacteria | 7251677 |
| 750 | 2935354294 | 2935353572 | Unclassified | 6955622 |
| 751 | 2945963004 | 2945961074 | Bacteria | 7342064 |
| 752 | 2946052317 | 2946045630 | Bacteria | 8527308 |
| 753 | 2946065220 | 2946064051 | Bacteria | 8957905 |
| 754 | 2947232225 | 2947224130 | Bacteria | 9938529 |
| 755 | 2954008556 | 2954002825 | Bacteria | 9173742 |
| 756 | 2954389138 | 2954380949 | Bacteria | 10050426 |
| 757 | 2954673904 | 2954673503 | Bacteria | 9685905 |
| 758 | 2954690087 | 2954682443 | Bacteria | 9862841 |
| 759 | 2954699886 | 2954691527 | Bacteria | 10720516 |
| 760 | 2954702312 | 2954701450 | Bacteria | 10834262 |
| 761 | 2990093814 | 2990088156 | Bacteria | 6657676 |
| 762 | 3003002136 | 3002998708 | Bacteria | 11715108 |
| 763 | 3006394311 | 3006393351 | Bacteria | 6615579 |
| 764 | 3007396547 | 3007395558 | Bacteria | 6755444 |
| 765 | 637318717 | 637000220 | Bacteria | 7074893 |
| 766 | 8003323451 | 8003314358 | Bacteria | 10575343 |
| 767 | 8015690956 | 8015687852 | Bacteria | 6613826 |
| 768 | 8019770911 | 8019769354 | Bacteria | 6924660 |
| 769 | 8025413824 | 8025413630 | Bacteria | 7014048 |
| 770 | 8047900978 | 8047893842 | Bacteria | 11723082 |
| 771 | 8048134285 | 8048127548 | Bacteria | 11053136 |
| 772 | 8048357923 | 8048356638 | Bacteria | 11044339 |
| 773 | 8048377920 | 8048369669 | Bacteria | 11666822 |
| 774 | 8048387018 | 8048379754 | Bacteria | 11877923 |
| 775 | 8054163291 | 8054160619 | Bacteria | 7783213 |
| 776 | 8055774096 | 8055770955 | Bacteria | 6827675 |
| 777 | 8056178997 | 8056177738 | Bacteria | 6748268 |
| 778 | 8057803655 | 8057798959 | Bacteria | 6713499 |
| 779 | SwRhRL2b_contig_3039297 | |||
| 780 | JGI24739J22299_10064354 | |||
| 781 | JGI25162J39368_1000054 | |||
| 782 | JGI25163J39215_1000106 | |||
| 783 | JGI25164J39214_1000029 | |||
| 784 | JGI25406J46586_10002057 | |||
| 785 | JGI25165J46597_1000111 | |||
| 786 | rootH2_10025695 | |||
| 787 | rootL2_10029067 | |||
| 788 | rootL2_10158374 | |||
| 789 | Ga0055526_1022180 | |||
| 790 | Ga0055537_1003505 | |||
| 791 | Ga0055524_1012948 | |||
| 792 | Ga0055536_1000005 | |||
| 793 | Ga0055536_1000734 | |||
| 794 | Ga0055536_1006940 | |||
| 795 | Ga0055536_1008111 | |||
| 796 | Ga0055534_1011018 | |||
| 797 | Ga0055528_1008429 | |||
| 798 | Ga0055530_10000001 | |||
| 799 | Ga0055530_10000066 | |||
| 800 | Ga0055530_10000165 | |||
| 801 | Ga0055530_10000222 | |||
| 802 | Ga0055530_10039056 | |||
| 803 | Ga0055540_1000186 | |||
| 804 | Ga0055540_1000258 | |||
| 805 | Ga0055531_10001339 | |||
| 806 | Ga0055531_10003634 | |||
| 807 | Ga0055531_10005696 | |||
| 808 | Ga0065165_1001271 | |||
| 809 | Ga0065714_10003126 | |||
| 810 | Ga0065714_10009959 | |||
| 811 | Ga0065714_10011828 | |||
| 812 | Ga0065714_10064839 | |||
| 813 | Ga0065704_10097097 | |||
| 814 | Ga0065704_10097927 | |||
| 815 | Ga0065712_10067982 | |||
| 816 | Ga0070658_10001281 | |||
| 817 | Ga0070666_10162510 | |||
| 818 | Ga0070680_100011064 | |||
| 819 | Ga0070682_100524627 | |||
| 820 | Ga0070660_100019870 | |||
| 821 | Ga0070668_100002528 | |||
| 822 | Ga0070668_100017490 | |||
| 823 | Ga0070669_100001571 | |||
| 824 | Ga0070669_100001764 | |||
| 825 | Ga0070671_100003686 | |||
| 826 | Ga0070671_100003780 | |||
| 827 | Ga0070667_100020533 | |||
| 828 | Ga0070667_100028263 | |||
| 829 | Ga0070678_100039767 | |||
| 830 | Ga0070681_10003845 | |||
| 831 | Ga0070679_100007593 | |||
| 832 | Ga0070697_100077656 | |||
| 833 | Ga0070672_100374900 | |||
| 834 | Ga0070665_100000107 | |||
| 835 | Ga0070665_100008246 | |||
| 836 | Ga0070665_100033770 | |||
| 837 | Ga0068855_100005081 | |||
| 838 | Ga0068855_100276610 | |||
| 839 | Ga0068854_100072783 | |||
| 840 | Ga0068856_100411476 | |||
| 841 | Ga0068863_100018630 | |||
| 842 | Ga0068860_100015006 | |||
| 843 | Ga0068862_100000074 | |||
| 844 | Ga0068862_100016576 | |||
| 845 | Ga0081539_10000417 | |||
| 846 | Ga0075363_100070972 | |||
| 847 | Ga0075364_10005137 | |||
| 848 | Ga0075364_10005211 | |||
| 849 | Ga0075362_10019711 | |||
| 850 | Ga0075369_10006670 | |||
| 851 | Ga0075366_10143609 | |||
| 852 | Ga0075370_10177081 | |||
| 853 | Ga0068865_100244176 | |||
| 854 | Ga0097620_100210162 | |||
| 855 | Ga0079104_1000006 | |||
| 856 | Ga0099826_10000572 | |||
| 857 | Ga0105251_10000005 | |||
| 858 | Ga0105251_10005637 | |||
| 859 | Ga0105251_10030203 | |||
| 860 | Ga0105251_10030612 | |||
| 861 | Ga0105244_10001015 | |||
| 862 | Ga0105244_10001477 | |||
| 863 | Ga0105250_10004047 | |||
| 864 | Ga0105250_10012357 | |||
| 865 | Ga0105240_10014297 | |||
| 866 | Ga0105247_10119490 | |||
| 867 | Ga0105243_10000144 | |||
| 868 | Ga0105243_10024932 | |||
| 869 | Ga0105248_10003233 | |||
| 870 | Ga0105248_10037790 | |||
| 871 | Ga0105238_10012868 | |||
| 872 | Ga0105249_10027254 | |||
| 873 | Ga0105249_10160716 | |||
| 874 | Ga0105239_10132598 | |||
| 875 | Ga0105239_10811772 | |||
| 876 | Ga0105246_10019373 | |||
| 877 | Ga0105246_10049033 | |||
| 878 | Ga0157371_10000063 | |||
| 879 | Ga0157371_10000925 | |||
| 880 | Ga0157370_10002160 | |||
| 881 | Ga0157370_10030558 | |||
| 882 | Ga0157370_10032695 | |||
| 883 | Ga0157369_10227871 | |||
| 884 | Ga0163162_10000551 | |||
| 885 | Ga0163162_10031044 | |||
| 886 | Ga0182008_10000785 | |||
| 887 | Ga0182008_10001096 | |||
| 888 | Ga0182006_1003571 | |||
| 889 | Ga0182006_1006128 | |||
| 890 | Ga0182006_1007784 | |||
| 891 | Ga0182007_10000682 | |||
| 892 | Ga0182007_10001650 | |||
| 893 | Ga0182005_1015072 | |||
| 894 | Ga0183367_1003 | |||
| 895 | Ga0163161_10003171 | |||
| 896 | Ga0213872_10159707 | |||
| 897 | Ga0213876_10161140 | |||
| 898 | Ga0209760_100015 | |||
| 899 | Ga0207427_100001 | |||
| 900 | Ga0209437_100003 | |||
| 901 | Ga0209026_1002402 | |||
| 902 | Ga0209233_1000007 | |||
| 903 | Ga0209565_1000281 | |||
| 904 | Ga0209673_1001574 | |||
| 905 | Ga0209675_1000097 | |||
| 906 | Ga0209675_1019109 | |||
| 907 | Ga0209676_1000003 | |||
| 908 | Ga0209676_1000070 | |||
| 909 | Ga0209676_1000673 | |||
| 910 | Ga0209676_1000927 | |||
| 911 | Ga0209676_1004357 | |||
| 912 | Ga0209676_1021711 | |||
| 913 | Ga0209676_1047271 | |||
| 914 | Ga0209025_1013670 | |||
| 915 | Ga0209564_1000557 | |||
| 916 | Ga0209564_1019939 | |||
| 917 | Ga0209758_1000608 | |||
| 918 | Ga0209758_1001275 | |||
| 919 | Ga0209758_1001477 | |||
| 920 | Ga0209050_1000004 | |||
| 921 | Ga0209050_1000037 | |||
| 922 | Ga0209050_1000038 | |||
| 923 | Ga0209050_1000627 | |||
| 924 | Ga0209050_1002783 | |||
| 925 | Ga0209050_1011541 | |||
| 926 | Ga0209050_1027233 | |||
| 927 | Ga0209256_1001941 | |||
| 928 | Ga0209256_1003017 | |||
| 929 | Ga0209256_1013803 | |||
| 930 | Ga0209051_1000006 | |||
| 931 | Ga0209051_1000040 | |||
| 932 | Ga0209257_1000328 | |||
| 933 | Ga0209257_1001043 | |||
| 934 | Ga0209257_1001060 | |||
| 935 | Ga0209257_1002314 | |||
| 936 | Ga0209257_1009271 | |||
| 937 | Ga0209257_1012736 | |||
| 938 | Ga0207696_1003663 | |||
| 939 | Ga0207696_1041113 | |||
| 940 | Ga0207655_1003129 | |||
| 941 | Ga0207713_1000036 | |||
| 942 | Ga0207713_1001885 | |||
| 943 | Ga0207713_1031618 | |||
| 944 | Ga0207713_1045466 | |||
| 945 | Ga0207710_10105809 | |||
| 946 | Ga0207680_10137414 | |||
| 947 | Ga0207705_10025961 | |||
| 948 | Ga0207654_10068346 | |||
| 949 | Ga0207707_10003543 | |||
| 950 | Ga0207695_10012701 | |||
| 951 | Ga0207660_10167993 | |||
| 952 | Ga0207657_10281967 | |||
| 953 | Ga0207652_10011650 | |||
| 954 | Ga0207681_10001221 | |||
| 955 | Ga0207681_10001397 | |||
| 956 | Ga0207694_10007190 | |||
| 957 | Ga0207644_10055190 | |||
| 958 | Ga0207709_10001160 | |||
| 959 | Ga0207709_10205008 | |||
| 960 | Ga0207704_10185123 | |||
| 961 | Ga0207711_10003235 | |||
| 962 | Ga0207711_10017238 | |||
| 963 | Ga0207711_10382345 | |||
| 964 | Ga0207667_10021876 | |||
| 965 | Ga0207712_10032850 | |||
| 966 | Ga0207712_10146774 | |||
| 967 | Ga0207668_10001443 | |||
| 968 | Ga0207668_10006938 | |||
| 969 | Ga0207658_10001032 | |||
| 970 | Ga0207658_10092397 | |||
| 971 | Ga0207702_10042525 | |||
| 972 | Ga0207641_10003617 | |||
| 973 | Ga0207683_10217077 | |||
| 974 | Ga0209281_1000011 | |||
| 975 | Ga0209371_1000609 | |||
| 976 | Ga0268266_10000354 | |||
| 977 | Ga0268266_10007811 | |||
| 978 | Ga0268266_10009243 | |||
| 979 | Ga0268266_10417546 | |||
| 980 | Ga0268265_10000847 | |||
| 981 | Ga0268265_10005338 | |||
| 982 | Ga0268265_10097822 | |||
| 983 | Ga0265319_1026094 | |||
| 984 | Ga0265318_10000139 | |||
| 985 | Ga0307517_10048414 | |||
| 986 | Ga0307517_10074950 | |||
| 987 | Ga0307515_10000524 | |||
| 988 | Ga0307515_10027774 | |||
| 989 | Ga0307515_10058201 | |||
| 990 | Ga0268256_1000527 | |||
| 991 | Ga0307511_10011009 | |||
| 992 | Ga0307511_10037288 | |||
| 993 | Ga0307511_10100046 | |||
| 994 | Ga0307512_10006750 | |||
| 995 | Ga0307512_10015575 | |||
| 996 | Ga0307512_10040433 | |||
| 997 | Ga0316177_1222324 | |||
| 998 | Ga0265330_10003994 | |||
| 999 | Ga0265332_10003516 | |||
| 1000 | Ga0265328_10002301 | |||
| 1001 | Ga0265320_10002481 | |||
| 1002 | Ga0265329_10000367 | |||
| 1003 | Ga0265339_10077377 | |||
| 1004 | Ga0265331_10004641 | |||
| 1005 | Ga0265327_10000175 | |||
| 1006 | Ga0265316_10008789 | |||
| 1007 | Ga0307513_10015813 | |||
| 1008 | Ga0307513_10103139 | |||
| 1009 | Ga0307509_10002942 | |||
| 1010 | Ga0307509_10003139 | |||
| 1011 | Ga0307508_10029395 | |||
| 1012 | Ga0307508_10049105 | |||
| 1013 | Ga0307508_10229675 | |||
| 1014 | Ga0307508_10241856 | |||
| 1015 | Ga0307514_10004958 | |||
| 1016 | Ga0265314_10013933 | |||
| 1017 | Ga0265342_10001175 | |||
| 1018 | Ga0307516_10006745 | |||
| 1019 | Ga0307518_10178376 | |||
| 1020 | Ga0307518_10186862 | |||
| 1021 | Ga0307412_10038740 | |||
| 1022 | Ga0307414_10440785 | |||
| 1023 | Ga0307507_10007410 | |||
| 1024 | Ga0307507_10193809 | |||
| 1025 | Ga0307510_10009355 | |||
| 1026 | Ga0307510_10024282 | |||
| 1027 | Ga0307510_10054411 | |||
| 1028 | Ga0307510_10058361 | |||
| 1029 | Ga0307510_10219888 | |||
| 1030 | Ga0395898_0002157 | |||
| 1031 | Ga0395901_0161915 | |||
| 1032 | Ga0436365_0466215 | |||
| 1033 | Ga0436361_0804027 | |||
| 1034 | Ga0436361_0989786 | |||
| 1035 | Ga0436363_1493638 | |||
| 1036 | Ga0439438_000200 | |||
| 1037 | Ga0439438_000450 | |||
| 1038 | Ga0439438_000666 | |||
| 1039 | Ga0439447_006761 | |||
| 1040 | Ga0439461_0009575 | |||
| 1041 | Ga0439466_0013030 | |||
| 1042 | Ga0451841_0680686 | |||
| 1043 | Ga0451851_0122701 | |||
| 1044 | Ga0451853_1601412 | |||
| 1045 | Ga0451853_3602439 | |||
| 1046 | Ga0439448_0008535 | |||
| 1047 | Ga0439449_0014725 | |||
| 1048 | Ga0439452_000115 | |||
| 1049 | Ga0439452_000826 | |||
| 1050 | Ga0439455_0037657 | |||
| 1051 | Ga0439456_000816 | |||
| 1052 | Ga0439463_000202 | |||
| 1053 | Ga0439463_026153 | |||
| 1054 | Ga0450900_006822 | |||
| 1055 | Ga0439446_0004310 | |||
| 1056 | Ga0439458_0004574 | |||
| 1057 | Ga0439435_0002850 | |||
| 1058 | Ga0466969_0015985 | |||
| 1059 | Ga0466972_0004929 | |||
| 1060 | Ga0466961_0012375 | |||
| 1061 | Ga0466960_0003455 | |||
| 1062 | Ga0495617_000044 | |||
| 1063 | Ga0495617_013499 | |||
| 1064 | Ga0495617_015757 | |||
| 1065 | Ga0495617_061724 | |||
| 1066 | Ga0495627_000008 | |||
| 1067 | Ga0495627_002624 | |||
| 1068 | Ga0495627_005481 | |||
| 1069 | Ga0495627_012240 | |||
| 1070 | Ga0495592_0020586 | |||
| 1071 | Ga0495603_0000009 | |||
| 1072 | Ga0495603_0009296 | |||
| 1073 | Ga0495603_0297721 | |||
| 1074 | Ga0495590_0000698 | |||
| 1075 | Ga0495590_0002258 | |||
| 1076 | Ga0495591_000018 | |||
| 1077 | Ga0495591_000088 | |||
| 1078 | Ga0495591_000300 | |||
| 1079 | Ga0495591_010704 | |||
| 1080 | Ga0495629_0022313 | |||
| 1081 | Ga0495638_0000160 | |||
| 1082 | Ga0495638_0000589 | |||
| 1083 | Ga0495638_0004745 | |||
| 1084 | Ga0495638_0007339 | |||
| 1085 | Ga0495638_0010099 | |||
| 1086 | Ga0495638_0020681 | |||
| 1087 | Ga0495638_0035080 | |||
| 1088 | Ga0495638_0064881 | |||
| 1089 | Ga0495638_0092995 | |||
| 1090 | Ga0495638_0095347 | |||
| 1091 | Ga0495651_0021486 | |||
| 1092 | Ga0495653_0000002 | |||
| 1093 | Ga0495650_0000017 | |||
| 1094 | Ga0495650_0007765 | |||
| 1095 | Ga0495650_0010868 | |||
| 1096 | Ga0495605_0000067 | |||
| 1097 | Ga0495605_0000088 | |||
| 1098 | Ga0495605_0000158 | |||
| 1099 | Ga0495605_0000522 | |||
| 1100 | Ga0495605_0000806 | |||
| 1101 | Ga0495605_0004355 | |||
| 1102 | Ga0495605_0007282 | |||
| 1103 | Ga0495605_0012723 | |||
| 1104 | Ga0495605_0017337 | |||
| 1105 | Ga0495605_0023420 | |||
| 1106 | Ga0495605_0043272 | |||
| 1107 | Ga0495605_0069504 | |||
| 1108 | Ga0495605_0090255 | |||
| 1109 | Ga0495662_0000110 | |||
| 1110 | Ga0495664_0001686 | |||
| 1111 | Ga0495584_0000083 | |||
| 1112 | Ga0495584_0001678 | |||
| 1113 | Ga0495584_0002197 | |||
| 1114 | Ga0495584_0003188 | |||
| 1115 | Ga0495584_0015439 | |||
| 1116 | Ga0495584_0017141 | |||
| 1117 | Ga0495585_0000142 | |||
| 1118 | Ga0495585_0043610 | |||
| 1119 | Ga0495585_0085816 | |||
| 1120 | Ga0495585_0136201 | |||
| 1121 | Ga0495594_0001521 | |||
| 1122 | Ga0495594_0043677 | |||
| 1123 | Ga0495594_0151081 | |||
| 1124 | Ga0495596_0000089 | |||
| 1125 | Ga0495607_0000032 | |||
| 1126 | Ga0495607_0006881 | |||
| 1127 | Ga0495607_0010063 | |||
| 1128 | Ga0495607_0013334 | |||
| 1129 | Ga0495607_0021527 | |||
| 1130 | Ga0495607_0057620 | |||
| 1131 | Ga0495607_0087450 | |||
| 1132 | Ga0495607_0155298 | |||
| 1133 | Ga0495607_0175258 | |||
| 1134 | Ga0495583_0000135 | |||
| 1135 | Ga0495583_0000457 | |||
| 1136 | Ga0495583_0002118 | |||
| 1137 | Ga0495606_0000200 | |||
| 1138 | Ga0495606_0000545 | |||
| 1139 | Ga0495606_0000729 | |||
| 1140 | Ga0495606_0025101 | |||
| 1141 | Ga0495610_0000058 | |||
| 1142 | Ga0495610_0004442 | |||
| 1143 | Ga0495610_0005995 | |||
| 1144 | Ga0495610_0009917 | |||
| 1145 | Ga0495610_0010854 | |||
| 1146 | Ga0495610_0012925 | |||
| 1147 | Ga0495610_0019749 | |||
| 1148 | Ga0495610_0033846 | |||
| 1149 | Ga0495610_0074419 | |||
| 1150 | Ga0495616_0000031 | |||
| 1151 | Ga0495616_0000429 | |||
| 1152 | Ga0495618_0081775 | |||
| 1153 | Ga0495620_0000034 | |||
| 1154 | Ga0495620_0000207 | |||
| 1155 | Ga0495620_0001291 | |||
| 1156 | Ga0495620_0003917 | |||
| 1157 | Ga0495620_0008610 | |||
| 1158 | Ga0495620_0009072 | |||
| 1159 | Ga0495620_0048421 | |||
| 1160 | Ga0495628_0009638 | |||
| 1161 | Ga0495628_0229975 | |||
| 1162 | Ga0495631_0002052 | |||
| 1163 | Ga0495631_0007823 | |||
| 1164 | Ga0495632_0000495 | |||
| 1165 | Ga0495632_0000607 | |||
| 1166 | Ga0495632_0000748 | |||
| 1167 | Ga0495632_0003572 | |||
| 1168 | Ga0495632_0015353 | |||
| 1169 | Ga0495637_0007004 | |||
| 1170 | Ga0495637_0009342 | |||
| 1171 | Ga0495637_0012102 | |||
| 1172 | Ga0495637_0012438 | |||
| 1173 | Ga0495637_0013550 | |||
| 1174 | Ga0495637_0033500 | |||
| 1175 | Ga0495643_0005942 | |||
| 1176 | Ga0495643_0007143 | |||
| 1177 | Ga0495643_0011709 | |||
| 1178 | Ga0495644_0001087 | |||
| 1179 | Ga0495644_0004478 | |||
| 1180 | Ga0495644_0055487 | |||
| 1181 | Ga0495644_0059130 | |||
| 1182 | Ga0495648_0000239 | |||
| 1183 | Ga0495648_0001250 | |||
| 1184 | Ga0495648_0004517 | |||
| 1185 | Ga0495648_0013500 | |||
| 1186 | Ga0495648_0015275 | |||
| 1187 | Ga0495648_0021510 | |||
| 1188 | Ga0495663_0030146 | |||
| 1189 | Ga0495666_0012793 | |||
| 1190 | Ga0495642_0000187 | |||
| 1191 | Ga0495642_0092802 | |||
| 1192 | Ga0495654_0000012 | |||
| 1193 | Ga0495654_0000414 | |||
| 1194 | Ga0495654_0006197 | |||
| 1195 | Ga0495654_0021651 | |||
| 1196 | Ga0495654_0026580 | |||
| 1197 | Ga0495654_0028499 | |||
| 1198 | Ga0495654_0040591 | |||
| 1199 | Ga0495654_0076963 | |||
| 1200 | Ga0495654_0086774 | |||
| 1201 | Ga0495654_0087054 | |||
| 1202 | Ga0495586_0004586 | |||
| 1203 | Ga0495587_0019040 | |||
| 1204 | Ga0495609_0000147 | |||
| 1205 | Ga0495609_0000340 | |||
| 1206 | Ga0495609_0000477 | |||
| 1207 | Ga0495597_0000013 | |||
| 1208 | Ga0495597_0004857 | |||
| 1209 | Ga0495597_0012599 | |||
| 1210 | Ga0495597_0017766 | |||
| 1211 | Ga0495597_0030407 | |||
| 1212 | Ga0495597_0038360 | |||
| 1213 | Ga0495622_0017722 | |||
| 1214 | Ga0495633_0000316 | |||
| 1215 | Ga0495633_0000446 | |||
| 1216 | Ga0495633_0162372 | |||
| 1217 | Ga0495667_0179581 | |||
| 1218 | Ga0495668_0000087 | |||
| 1219 | Ga0495668_0000887 | |||
| 1220 | Ga0495668_0007406 | |||
| 1221 | Ga0495668_0022070 | |||
| 1222 | Ga0495668_0029381 | |||
| 1223 | Ga0495668_0032163 | |||
| 1224 | Ga0495668_0053332 | |||
| 1225 | Ga0495634_0031104 | |||
| 1226 | Ga0495611_0017900 | |||
| 1227 | Ga0495611_0155835 | |||
| 1228 | Ga0495625_0000081 | |||
| 1229 | Ga0495625_0000830 | |||
| 1230 | Ga0495625_0001558 | |||
| 1231 | Ga0495625_0012474 | |||
| 1232 | Ga0495625_0020841 | |||
| 1233 | Ga0495625_0022235 | |||
| 1234 | Ga0495625_0029266 | |||
| 1235 | Ga0495625_0072463 | |||
| 1236 | Ga0495625_0092267 | |||
| 1237 | Ga0495625_0113957 | |||
| 1238 | Ga0495625_0131976 | |||
| 1239 | Ga0495625_0137418 | |||
| 1240 | Ga0495625_0226307 | |||
| 1241 | Ga0495659_0008262 | |||
| 1242 | Ga0495661_0000078 | |||
| 1243 | Ga0495661_0000138 | |||
| 1244 | Ga0495661_0000513 | |||
| 1245 | Ga0495661_0002111 | |||
| 1246 | Ga0495661_0010828 | |||
| 1247 | Ga0495661_0177944 | |||
| 1248 | Ga0495588_0013345 | |||
| 1249 | Ga0495588_0033156 | |||
| 1250 | Ga0495588_0043085 | |||
| 1251 | Ga0495657_0000437 | |||
| 1252 | Ga0495599_0212034 | |||
| 1253 | Ga0495646_0000400 | |||
| 1254 | Ga0495613_0002753 | |||
| 1255 | Ga0495613_0085988 | |||
| 1256 | Ga0495671_0000052 | |||
| 1257 | Ga0495671_0014142 | |||
| 1258 | Ga0495671_0015686 | |||
| 1259 | Ga0495671_0026763 | |||
| 1260 | Ga0495671_0074428 | |||
| 1261 | Ga0495649_0000033 | |||
| 1262 | Ga0495649_0000106 | |||
| 1263 | Ga0495649_0000836 | |||
| 1264 | Ga0495649_0015712 | |||
| 1265 | Ga0495649_0023498 | |||
| 1266 | Ga0495649_0053335 | |||
| 1267 | Ga0495589_0000585 | |||
| 1268 | Ga0495589_0001063 | |||
| 1269 | Ga0495589_0002412 | |||
| 1270 | Ga0495589_0006602 | |||
| 1271 | Ga0495589_0010957 | |||
| 1272 | Ga0495660_0000873 | |||
| 1273 | Ga0495660_0001253 | |||
| 1274 | Ga0495660_0001366 | |||
| 1275 | Ga0495660_0002313 | |||
| 1276 | Ga0495660_0005067 | |||
| 1277 | Ga0495660_0017385 | |||
| 1278 | Ga0495660_0065403 | |||
| 1279 | Ga0495660_0078105 | |||
| 1280 | Ga0495604_0000673 | |||
| 1281 | Ga0495604_0009142 | |||
| 1282 | Ga0495636_0000221 | |||
| 1283 | Ga0495636_0020197 | |||
| 1284 | Ga0495636_0049029 | |||
| 1285 | Ga0495674_0170119 | |||
| 1286 | Ga0495672_0000032 | |||
| 1287 | Ga0495672_0001535 | |||
| 1288 | Ga0495672_0003990 | |||
| 1289 | Ga0495676_0002857 | |||
| 1290 | Ga0495676_0003781 | |||
| 1291 | Ga0495676_0004612 | |||
| 1292 | Ga0495676_0010737 | |||
| 1293 | Ga0495683_0000108 | |||
| 1294 | Ga0495683_0002624 | |||
| 1295 | Ga0495683_0002951 | |||
| 1296 | Ga0495683_0047214 | |||
| 1297 | Ga0495687_000572 | |||
| 1298 | Ga0495687_001130 | |||
| 1299 | Ga0495687_004181 | |||
| 1300 | Ga0495687_008146 | |||
| 1301 | Ga0495687_027803 | |||
| 1302 | Ga0495687_098775 | |||
| 1303 | Ga0495675_0000016 | |||
| 1304 | Ga0495679_000198 | |||
| 1305 | Ga0495679_001171 | |||
| 1306 | Ga0495679_003085 | |||
| 1307 | Ga0495679_013312 | |||
| 1308 | Ga0495685_041386 | |||
| 1309 | Ga0495673_0000190 | |||
| 1310 | Ga0495673_0000321 | |||
| 1311 | Ga0495673_0000997 | |||
| 1312 | Ga0495673_0003718 | |||
| 1313 | Ga0495673_0025675 | |||
| 1314 | Ga0495681_0000009 | |||
| 1315 | Ga0495681_0000257 | |||
| 1316 | Ga0495681_0000329 | |||
| 1317 | Ga0495681_0002219 | |||
| 1318 | Ga0495681_0003080 | |||
| 1319 | Ga0495681_0004335 | |||
| 1320 | Ga0495681_0004938 | |||
| 1321 | Ga0495681_0006935 | |||
| 1322 | Ga0495681_0008911 | |||
| 1323 | Ga0495681_0011173 | |||
| 1324 | Ga0495681_0013912 | |||
| 1325 | Ga0495681_0035562 | |||
| 1326 | Ga0495681_0159761 | |||
| 1327 | Ga0495684_0023241 | |||
| 1328 | Ga0495686_0000633 | |||
| 1329 | Ga0495686_0025642 | |||
| 1330 | Ga0495686_0038730 | |||
| 1331 | Ga0495686_0071700 | |||
| 1332 | Ga0495686_0099087 | |||
| 1333 | Ga0495593_0002874 | |||
| 1334 | Ga0495602_0059408 | |||
| 1335 | Ga0495614_0007263 | |||
| 1336 | Ga0495626_0000015 | |||
| 1337 | Ga0495626_0000033 | |||
| 1338 | Ga0495626_0000720 | |||
| 1339 | Ga0495626_0009842 | |||
| 1340 | Ga0495626_0058064 | |||
| 1341 | Ga0496101_0323198 | |||
| 1342 | Ga0496102_0000613 | |||
| 1343 | Ga0496102_0043134 | |||
| 1344 | Ga0496103_0000163 | |||
| 1345 | Ga0496103_0009503 | |||
| 1346 | Ga0496104_0002224 | |||
| 1347 | Ga0496105_0003862 | |||
| 1348 | Ga0496106_0063172 | |||
| 1349 | Ga0496107_0000565 | |||
| 1350 | Ga0496111_0058777 | |||
| 1351 | Ga0496113_0000081 | |||
| 1352 | Ga0496115_0133558 | |||
| 1353 | Ga0496116_0000126 | |||
| 1354 | Ga0496116_0042961 | |||
| 1355 | Ga0496116_0080144 | |||
| 1356 | Ga0496116_0120560 | |||
| 1357 | Ga0496116_0182660 | |||
| 1358 | Ga0496117_0000623 | |||
| 1359 | Ga0496117_0027203 | |||
| 1360 | Ga0496118_0030117 | |||
| 1361 | Ga0496118_0037674 | |||
| 1362 | Ga0496118_0071815 | |||
| 1363 | Ga0496119_0004118 | |||
| 1364 | Ga0496119_0124169 | |||
| 1365 | Ga0496120_0004524 | |||
| 1366 | Ga0496120_0028051 | |||
| 1367 | Ga0496121_0000067 | |||
| 1368 | Ga0496121_0000142 | |||
| 1369 | Ga0496121_0001912 | |||
| 1370 | Ga0496121_0009885 | |||
| 1371 | Ga0496121_0019626 | |||
| 1372 | Ga0496121_0059414 | |||
| 1373 | Ga0496122_0001234 | |||
| 1374 | Ga0496122_0002287 | |||
| 1375 | Ga0496122_0005467 | |||
| 1376 | Ga0496122_0037935 | |||
| 1377 | Ga0496123_0000434 | |||
| 1378 | Ga0496123_0003785 | |||
| 1379 | Ga0496123_0009060 | |||
| 1380 | Ga0496123_0032276 | |||
| 1381 | Ga0496124_0000812 | |||
| 1382 | Ga0496124_0003614 | |||
| 1383 | Ga0496124_0068150 | |||
| 1384 | Ga0496125_0012848 | |||
| 1385 | Ga0496125_0185974 | |||
| 1386 | Ga0496125_0300067 | |||
| 1387 | Ga0496125_0312175 | |||
| 1388 | Ga0496126_0005438 | |||
| 1389 | Ga0496126_0107103 | |||
| 1390 | Ga0496126_0319170 | |||
| 1391 | Ga0495678_000081 | |||
| 1392 | Ga0495678_000583 | |||
| 1393 | Ga0495678_001014 | |||
| 1394 | Ga0495678_001228 | |||
| 1395 | Ga0495678_017299 | |||
| 1396 | Ga0495678_021074 | |||
| 1397 | Ga0495678_032827 | |||
| 1398 | Ga0495678_035943 | |||
| 1399 | Ga0495678_123412 | |||
| 1400 | Ga0495682_0003421 | |||
| 1401 | Ga0495682_0013216 | |||
| 1402 | Ga0501032_0044735 | |||
| 1403 | Ga0501033_0066516 | |||
| 1404 | Ga0501043_0002520 | |||
| 1405 | Ga0501046_0055842 | |||
| 1406 | Ga0501047_0000342 | |||
| 1407 | Ga0501048_0355832 | |||
| 1408 | Ga0501070_0141038 | |||
| 1409 | Ga0501269_000034 | |||
| 1410 | Ga0501035_0029889 | |||
| 1411 | nmdc:mga03683_15022_c1 | |||
| 1412 | nmdc:mga03n38_109574_c1 | |||
| 1413 | nmdc:mga03n38_41862_c1 | |||
| 1414 | nmdc:mga00v17_51246_c1 | |||
| 1415 | nmdc:mga00v17_626_c1 | |||
| 1416 | nmdc:mga0k408_71943_c1 | |||
| 1417 | nmdc:mga07m45_62960_c1 | |||
| 1418 | nmdc:mga0sz30_6232_c1 | |||
| 1419 | Ga0500635_0000020 | |||
| 1420 | Ga0500578_0000234 | |||
| 1421 | Ga0500578_0215964 | |||
| 1422 | Ga0500643_048167 | |||
| 1423 | Ga0500644_0000189 | |||
| 1424 | Ga0500554_005865 | |||
| 1425 | Ga0500556_0001301 | |||
| 1426 | Ga0500556_0024836 | |||
| 1427 | Ga0500580_037832 | |||
| 1428 | Ga0500592_000148 | |||
| 1429 | Ga0500594_0000022 | |||
| 1430 | Ga0500607_000148 | |||
| 1431 | Ga0500607_048277 | |||
| 1432 | Ga0500618_000511 | |||
| 1433 | Ga0500642_0123100 | |||
| 1434 | Ga0500658_0050740 | |||
| 1435 | Ga0500559_0000005 | |||
| 1436 | Ga0500559_0001556 | |||
| 1437 | Ga0500564_000059 | |||
| 1438 | Ga0500568_0019338 | |||
| 1439 | Ga0500568_0019897 | |||
| 1440 | Ga0500600_0064882 | |||
| 1441 | Ga0500600_0172950 | |||
| 1442 | Ga0500616_0046069 | |||
| 1443 | Ga0500624_006724 | |||
| 1444 | Ga0500627_0000013 | |||
| 1445 | Ga0500634_0000350 | |||
| 1446 | Ga0500638_012935 | |||
| 1447 | Ga0500636_0000543 | |||
| 1448 | Ga0500611_015368 | |||
| 1449 | Ga0500645_004520 | |||
| 1450 | Ga0500645_008481 | |||
| 1451 | Ga0500645_016698 | |||
| 1452 | Ga0500609_000125 | |||
| 1453 | Ga0466962_0023165 | |||
| 1454 | 2785366704 | |||
| 1455 | 2506864804 | |||
| 1456 | 2511253361 | |||
| 1457 | 2511269607 | |||
| 1458 | 2511278028 | |||
| 1459 | 2511311612 | |||
| 1460 | 2511324212 | |||
| 1461 | 2511359913 | |||
| 1462 | 2512326225 | |||
| 1463 | 2555668355 | |||
| 1464 | 2583792554 | |||
| 1465 | 2585149455 | |||
| 1466 | 2585306605 | |||
| 1467 | 2599327076 | |||
| 1468 | 2599355356 | |||
| 1469 | 2599360825 | |||
| 1470 | 2599367147 | |||
| 1471 | 2599373937 | |||
| 1472 | 2599380462 | |||
| 1473 | 2599386909 | |||
| 1474 | 2599392795 | |||
| 1475 | 2599404562 | |||
| 1476 | 2599462190 | |||
| 1477 | 2599466768 | |||
| 1478 | 2599490718 | |||
| 1479 | 2600021798 | |||
| 1480 | 2600030832 | |||
| 1481 | 2600075071 | |||
| 1482 | 2600214812 | |||
| 1483 | 2600360637 | |||
| 1484 | 2601774483 | |||
| 1485 | 2616693185 | |||
| 1486 | 2624491734 | |||
| 1487 | 2643819954 | |||
| 1488 | 2643835400 | |||
| 1489 | 2643905053 | |||
| 1490 | 2643942515 | |||
| 1491 | 2643999094 | |||
| 1492 | 2644056326 | |||
| 1493 | 2644263470 | |||
| 1494 | 2644403111 | |||
| 1495 | 2644429974 | |||
| 1496 | 2644514321 | |||
| 1497 | 2652544212 | |||
| 1498 | 2671097957 | |||
| 1499 | 2671126882 | |||
| 1500 | 2689992791 | |||
| 1501 | 2743737691 | |||
| 1502 | 2786667764 | |||
| 1503 | 2792462386 | |||
| 1504 | 2793981546 | |||
| 1505 | 2804849247 | |||
| 1506 | 2819703041 | |||
| 1507 | 2826585861 | |||
| 1508 | 2842850234 | |||
| 1509 | 2843748738 | |||
| 1510 | 2844668867 | |||
| 1511 | 2849565308 | |||
| 1512 | 2849578894 | |||
| 1513 | 2851156540 | |||
| 1514 | 2862181274 | |||
| 1515 | 2862290096 | |||
| 1516 | 2862292990 | |||
| 1517 | 2862580336 | |||
| 1518 | 2877683834 | |||
| 1519 | 2898330210 | |||
| 1520 | 2917072122 | |||
| 1521 | 2917736462 | |||
| 1522 | 2918502211 | |||
| 1523 | 2923156736 | |||
| 1524 | 2923588027 | |||
| 1525 | 2928961978 | |||
| 1526 | 2931374720 | |||
| 1527 | 2931401304 | |||
| 1528 | 2935354294 | |||
| 1529 | 2945963004 | |||
| 1530 | 2946052317 | |||
| 1531 | 2946065220 | |||
| 1532 | 2947232225 | |||
| 1533 | 2954008556 | |||
| 1534 | 2954389138 | |||
| 1535 | 2954673904 | |||
| 1536 | 2954690087 | |||
| 1537 | 2954699886 | |||
| 1538 | 2954702312 | |||
| 1539 | 2990093814 | |||
| 1540 | 3003002136 | |||
| 1541 | 3006394311 | |||
| 1542 | 3007396547 | |||
| 1543 | 637318717 | |||
| 1544 | 8003323451 | |||
| 1545 | 8015690956 | |||
| 1546 | 8019770911 | |||
| 1547 | 8025413824 | |||
| 1548 | 8047900978 | |||
| 1549 | 8048134285 | |||
| 1550 | 8048357923 | |||
| 1551 | 8048377920 | |||
| 1552 | 8048387018 | |||
| 1553 | 8054163291 | |||
| 1554 | 8055774096 | |||
| 1555 | 8056178997 | |||
| 1556 | 8057803655 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
115
307
0.94
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ahd-assembly1.cif.gz_A | opua (e190q) occluded | 0.6563 | 84 | 253 |
| 7ahc-assembly1.cif.gz_B | opua apo inward-facing | 0.5348 | 15 | 247 |
| 7ahh-assembly1.cif.gz_B | opua inhibited inward-facing, sbd docked | 0.5289 | 15 | 248 |
| 3dhw-assembly1.cif.gz_A | crystal structure of methionine importer metni | 0.5242 | 84 | 239 |
| 3dhw-assembly2.cif.gz_E | crystal structure of methionine importer metni | 0.5171 | 61 | 241 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P45767_178_390_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8761 | 124 | 251 | 1.10.3720.10 |
| af_P0DP70_1_121_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.783 | 133 | 246 | 1.10.3720.10 |
| af_Q2G1I4_54_251_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7821 | 87 | 255 | 1.10.3720.10 |
| af_Q2G088_14_207_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7452 | 84 | 247 | 1.10.3720.10 |
| af_P0DP70_1_121_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7395 | 133 | 246 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J5DT53-F1-model_v4 | ABC transporter permease subunit | 0.9404 | 125 | 257 |
GO:0005886
GO:0055085 |
| AF-A0A519YA77-F1-model_v4 | deleted | 0.9294 | 116 | 261 |
|
| AF-A0A6N8QHZ2-F1-model_v4 | deleted | 0.9179 | 110 | 257 |
|
| AF-A0A519YA77-F1-model_v4 | deleted | 0.9172 | 116 | 261 |
|
| AF-A0A1H9AHU3-F1-model_v4 | Sulfonate transport system permease protein | 0.9141 | 107 | 255 |
GO:0005886
GO:0055085 |