F480462
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 779 | 394 | 770 | 179 |
Family's Representative Sequence
| Representative Sequence | 3300007265|Ga0099794_10024884|Ga0099794_100248841 |
| Length | 206 |
| Sequence | LSHESNDPIGTHSGIDSARSTPKPAAFLDRDGVINHDDGYMGTHHRIRWMPNAAKAIRRLNEAGYFVFLFTNQSGVARGFFTEDDLGALHDWMRTELTTQGAVIDDIRYCPHHPAGSVAGYLEDHHWRKPSPGMILDLMQHWPVRHEGSFVIGDRPTDIEAAEAAGLPGFLFAGGDLDAFVADVVMQTRASQPTALPTPPPQRGKE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 3 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 4 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 5 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 6 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 7 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 8 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 9 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 10 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 14 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 83 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 161 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 162 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 164 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 166 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 167 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 170 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 171 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 173 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 174 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 175 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 176 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 178 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 179 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 180 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 181 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 182 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 183 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 187 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 188 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 190 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 194 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 197 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 198 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 201 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 204 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 205 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 206 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 207 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 208 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 209 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 210 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 213 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 214 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 215 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 216 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 289 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 290 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 291 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 292 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 293 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 294 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 297 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 298 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 299 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 300 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 301 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 302 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 303 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 304 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 305 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 306 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 307 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 308 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 309 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 310 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 311 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 312 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 313 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 341 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 342 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 345 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 348 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 351 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 352 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 353 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 354 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 355 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 356 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 357 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 358 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 359 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 360 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 361 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 362 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 363 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 364 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 365 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 366 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 367 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 368 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 369 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 370 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 372 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 373 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 374 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 375 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 376 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 377 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 378 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 379 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 380 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 381 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 382 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 383 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 384 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 385 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 386 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 387 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 388 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 389 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 390 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 391 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 392 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 394 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.72 |
| Metatranscriptomes | 0.13 |
| Isolates | 1.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.91 |
| Nodule | 0.51 |
| Rhizoplane | 7.06 |
| Rhizosphere | 71.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10015408 | 3300001979 | Bacteria | 2792 |
| 2 | JGI24737J22298_10009425 | 3300001990 | Bacteria | 3248 |
| 3 | JGI25406J46586_10000014 | 3300003203 | Bacteria | 93855 |
| 4 | JGI25406J46586_10001807 | 3300003203 | Bacteria | 10044 |
| 5 | rootL2_10109221 | 3300003322 | Bacteria | 1037 |
| 6 | JGI25404J52841_10006804 | 3300003659 | Bacteria | 2400 |
| 7 | JGI25405J52794_10008955 | 3300003911 | Bacteria | 1881 |
| 8 | Ga0070658_10200182 | 3300005327 | Bacteria | 1685 |
| 9 | Ga0070658_10368769 | 3300005327 | Bacteria | 1231 |
| 10 | Ga0070676_10291953 | 3300005328 | Bacteria | 1102 |
| 11 | Ga0070683_100266630 | 3300005329 | Bacteria | 1629 |
| 12 | Ga0070683_100383800 | 3300005329 | Bacteria | 1339 |
| 13 | Ga0070690_100457252 | 3300005330 | Bacteria | 948 |
| 14 | Ga0068869_101241321 | 3300005334 | Bacteria | 656 |
| 15 | Ga0070680_100057871 | 3300005336 | Bacteria | 3170 |
| 16 | Ga0070680_100090984 | 3300005336 | Bacteria | 2526 |
| 17 | Ga0070680_100408720 | 3300005336 | Bacteria | 1157 |
| 18 | Ga0070680_100752286 | 3300005336 | Bacteria | 839 |
| 19 | Ga0068868_100197195 | 3300005338 | Bacteria | 1677 |
| 20 | Ga0070660_100020298 | 3300005339 | Bacteria | 4881 |
| 21 | Ga0070661_100073144 | 3300005344 | Bacteria | 2523 |
| 22 | Ga0070661_100389421 | 3300005344 | Bacteria | 1100 |
| 23 | Ga0070668_100875625 | 3300005347 | Bacteria | 801 |
| 24 | Ga0070671_100340295 | 3300005355 | Bacteria | 1280 |
| 25 | Ga0070674_100252219 | 3300005356 | Bacteria | 1386 |
| 26 | Ga0070674_101095979 | 3300005356 | Bacteria | 703 |
| 27 | Ga0070659_100257443 | 3300005366 | Bacteria | 1448 |
| 28 | Ga0070659_100495453 | 3300005366 | Bacteria | 1041 |
| 29 | Ga0070667_100685174 | 3300005367 | Bacteria | 948 |
| 30 | Ga0070667_101129865 | 3300005367 | Bacteria | 733 |
| 31 | Ga0070709_10043109 | 3300005434 | Bacteria | 2789 |
| 32 | Ga0070709_10174059 | 3300005434 | Bacteria | 1506 |
| 33 | Ga0070714_100545111 | 3300005435 | Bacteria | 1110 |
| 34 | Ga0070714_100610696 | 3300005435 | Bacteria | 1048 |
| 35 | Ga0070714_101040822 | 3300005435 | Bacteria | 797 |
| 36 | Ga0070713_100027160 | 3300005436 | Bacteria | 4503 |
| 37 | Ga0070713_100888636 | 3300005436 | Bacteria | 857 |
| 38 | Ga0070710_10004247 | 3300005437 | Bacteria | 6791 |
| 39 | Ga0070711_100074878 | 3300005439 | Bacteria | 2395 |
| 40 | Ga0070711_100122929 | 3300005439 | Bacteria | 1922 |
| 41 | Ga0070711_100140551 | 3300005439 | Bacteria | 1810 |
| 42 | Ga0070711_100141421 | 3300005439 | Bacteria | 1805 |
| 43 | Ga0070711_100177188 | 3300005439 | Bacteria | 1629 |
| 44 | Ga0070711_100477546 | 3300005439 | Bacteria | 1024 |
| 45 | Ga0070700_101023494 | 3300005441 | Bacteria | 680 |
| 46 | Ga0070708_100024183 | 3300005445 | Bacteria | 5176 |
| 47 | Ga0070663_100152007 | 3300005455 | Bacteria | 1776 |
| 48 | Ga0070663_100364737 | 3300005455 | Bacteria | 1173 |
| 49 | Ga0070678_100023118 | 3300005456 | Bacteria | 4136 |
| 50 | Ga0070681_10006786 | 3300005458 | Bacteria | 11141 |
| 51 | Ga0070681_10029384 | 3300005458 | Bacteria | 5520 |
| 52 | Ga0070681_10032454 | 3300005458 | Bacteria | 5241 |
| 53 | Ga0070681_10147281 | 3300005458 | Bacteria | 2283 |
| 54 | Ga0070681_10759283 | 3300005458 | Bacteria | 886 |
| 55 | Ga0070681_10796442 | 3300005458 | Bacteria | 862 |
| 56 | Ga0068867_100169379 | 3300005459 | Bacteria | 1729 |
| 57 | Ga0070706_100958057 | 3300005467 | Bacteria | 790 |
| 58 | Ga0070707_100059117 | 3300005468 | Bacteria | 3677 |
| 59 | Ga0070698_100165606 | 3300005471 | Bacteria | 2154 |
| 60 | Ga0070698_100897763 | 3300005471 | Bacteria | 832 |
| 61 | Ga0070699_100344373 | 3300005518 | Bacteria | 1342 |
| 62 | Ga0070679_100822211 | 3300005530 | Bacteria | 872 |
| 63 | Ga0070679_101074049 | 3300005530 | Bacteria | 749 |
| 64 | Ga0070684_100691310 | 3300005535 | Bacteria | 951 |
| 65 | Ga0070697_100099202 | 3300005536 | Bacteria | 2418 |
| 66 | Ga0068853_100010165 | 3300005539 | Bacteria | 7603 |
| 67 | Ga0068853_100116651 | 3300005539 | Bacteria | 2377 |
| 68 | Ga0068853_100405406 | 3300005539 | Bacteria | 1277 |
| 69 | Ga0068853_100435914 | 3300005539 | Bacteria | 1231 |
| 70 | Ga0068853_101263809 | 3300005539 | Bacteria | 713 |
| 71 | Ga0070672_100191424 | 3300005543 | Bacteria | 1708 |
| 72 | Ga0070665_100259573 | 3300005548 | Bacteria | 1739 |
| 73 | Ga0070665_100504618 | 3300005548 | Bacteria | 1221 |
| 74 | Ga0070665_100572884 | 3300005548 | Bacteria | 1142 |
| 75 | Ga0068855_100013119 | 3300005563 | Bacteria | 9993 |
| 76 | Ga0068855_100257410 | 3300005563 | Bacteria | 1945 |
| 77 | Ga0068855_100360971 | 3300005563 | Bacteria | 1598 |
| 78 | Ga0068855_100362031 | 3300005563 | Bacteria | 1596 |
| 79 | Ga0068855_100577460 | 3300005563 | Bacteria | 1214 |
| 80 | Ga0070664_100092913 | 3300005564 | Bacteria | 2613 |
| 81 | Ga0070664_100756355 | 3300005564 | Bacteria | 907 |
| 82 | Ga0068857_100002370 | 3300005577 | Bacteria | 15359 |
| 83 | Ga0068857_100540558 | 3300005577 | Bacteria | 1097 |
| 84 | Ga0068857_100678751 | 3300005577 | Bacteria | 978 |
| 85 | Ga0068854_100028344 | 3300005578 | Bacteria | 3868 |
| 86 | Ga0068854_100036291 | 3300005578 | Bacteria | 3455 |
| 87 | Ga0068854_100483442 | 3300005578 | Bacteria | 1040 |
| 88 | Ga0068856_100036605 | 3300005614 | Bacteria | 4811 |
| 89 | Ga0068852_101174225 | 3300005616 | Bacteria | 788 |
| 90 | Ga0068859_100494907 | 3300005617 | Bacteria | 1318 |
| 91 | Ga0068859_100585114 | 3300005617 | Bacteria | 1210 |
| 92 | Ga0068864_100273824 | 3300005618 | Bacteria | 1574 |
| 93 | Ga0068864_100344036 | 3300005618 | Bacteria | 1406 |
| 94 | Ga0068866_10220657 | 3300005718 | Bacteria | 1144 |
| 95 | Ga0068861_100167359 | 3300005719 | Bacteria | 1819 |
| 96 | Ga0068851_10144894 | 3300005834 | Bacteria | 1294 |
| 97 | Ga0068870_10386536 | 3300005840 | Bacteria | 907 |
| 98 | Ga0068858_100205400 | 3300005842 | Bacteria | 1864 |
| 99 | Ga0068858_100672324 | 3300005842 | Bacteria | 1007 |
| 100 | Ga0068860_100004618 | 3300005843 | Bacteria | 14062 |
| 101 | Ga0068860_100666207 | 3300005843 | Bacteria | 1049 |
| 102 | Ga0068862_100730675 | 3300005844 | Bacteria | 961 |
| 103 | Ga0081455_10002315 | 3300005937 | Bacteria | 22718 |
| 104 | Ga0081455_10003763 | 3300005937 | Bacteria | 17325 |
| 105 | Ga0081455_10352661 | 3300005937 | Bacteria | 1037 |
| 106 | Ga0081540_1014288 | 3300005983 | Bacteria | 5097 |
| 107 | Ga0081540_1014350 | 3300005983 | Bacteria | 5078 |
| 108 | Ga0081540_1015322 | 3300005983 | Bacteria | 4858 |
| 109 | Ga0081540_1017198 | 3300005983 | Bacteria | 4485 |
| 110 | Ga0081540_1031008 | 3300005983 | Bacteria | 2949 |
| 111 | Ga0081540_1038336 | 3300005983 | Bacteria | 2527 |
| 112 | Ga0081540_1060524 | 3300005983 | Bacteria | 1811 |
| 113 | Ga0081540_1212145 | 3300005983 | Bacteria | 695 |
| 114 | Ga0081539_10000008 | 3300005985 | Bacteria | 525071 |
| 115 | Ga0081539_10016204 | 3300005985 | Bacteria | 5344 |
| 116 | Ga0070717_10043944 | 3300006028 | Bacteria | 3648 |
| 117 | Ga0070717_10386243 | 3300006028 | Bacteria | 1256 |
| 118 | Ga0070717_10738688 | 3300006028 | Bacteria | 895 |
| 119 | Ga0075365_10160284 | 3300006038 | Bacteria | 1567 |
| 120 | Ga0075365_10177483 | 3300006038 | Bacteria | 1488 |
| 121 | Ga0075365_10406909 | 3300006038 | Bacteria | 960 |
| 122 | Ga0075363_100160701 | 3300006048 | Bacteria | 1272 |
| 123 | Ga0075364_10383598 | 3300006051 | Bacteria | 958 |
| 124 | Ga0070715_10144201 | 3300006163 | Bacteria | 1160 |
| 125 | Ga0070716_100355041 | 3300006173 | Bacteria | 1039 |
| 126 | Ga0070712_100263013 | 3300006175 | Bacteria | 1383 |
| 127 | Ga0070712_100378652 | 3300006175 | Bacteria | 1164 |
| 128 | Ga0070712_100599220 | 3300006175 | Bacteria | 932 |
| 129 | Ga0075367_10070814 | 3300006178 | Bacteria | 2097 |
| 130 | Ga0075366_10311351 | 3300006195 | Bacteria | 964 |
| 131 | Ga0097621_100329091 | 3300006237 | Bacteria | 1355 |
| 132 | Ga0068871_100159211 | 3300006358 | Bacteria | 1930 |
| 133 | Ga0075434_100803792 | 3300006871 | Bacteria | 957 |
| 134 | Ga0068865_100051469 | 3300006881 | Bacteria | 2851 |
| 135 | Ga0097620_100494922 | 3300006931 | Bacteria | 1318 |
| 136 | Ga0097620_100585103 | 3300006931 | Bacteria | 1210 |
| 137 | Ga0099794_10024884 | 3300007265 | Bacteria | 2752 |
| 138 | Ga0099794_10069744 | 3300007265 | Bacteria | 1720 |
| 139 | Ga0099794_10073600 | 3300007265 | Bacteria | 1677 |
| 140 | Ga0099794_10080765 | 3300007265 | Bacteria | 1603 |
| 141 | Ga0099795_10052596 | 3300007788 | Bacteria | 1488 |
| 142 | Ga0099795_10169340 | 3300007788 | Bacteria | 906 |
| 143 | Ga0099795_10186248 | 3300007788 | Bacteria | 869 |
| 144 | Ga0099795_10201647 | 3300007788 | Bacteria | 839 |
| 145 | Ga0105240_10014285 | 3300009093 | Bacteria | 10844 |
| 146 | Ga0105240_10020795 | 3300009093 | Bacteria | 8741 |
| 147 | Ga0105240_10033625 | 3300009093 | Bacteria | 6621 |
| 148 | Ga0105240_10191760 | 3300009093 | Bacteria | 2403 |
| 149 | Ga0105240_10415609 | 3300009093 | Bacteria | 1512 |
| 150 | Ga0105240_10541275 | 3300009093 | Bacteria | 1289 |
| 151 | Ga0111539_10102681 | 3300009094 | Bacteria | 3356 |
| 152 | Ga0105245_10443341 | 3300009098 | Bacteria | 1305 |
| 153 | Ga0105245_10492386 | 3300009098 | Bacteria | 1241 |
| 154 | Ga0105245_10545874 | 3300009098 | Bacteria | 1181 |
| 155 | Ga0105247_10021726 | 3300009101 | Bacteria | 3861 |
| 156 | Ga0105247_10056534 | 3300009101 | Bacteria | 2423 |
| 157 | Ga0105247_10185345 | 3300009101 | Bacteria | 1391 |
| 158 | Ga0105243_10158878 | 3300009148 | Bacteria | 1947 |
| 159 | Ga0105243_10235850 | 3300009148 | Bacteria | 1625 |
| 160 | Ga0105241_10004158 | 3300009174 | Bacteria | 10689 |
| 161 | Ga0105242_10112239 | 3300009176 | Bacteria | 2326 |
| 162 | Ga0105248_10096619 | 3300009177 | Bacteria | 3328 |
| 163 | Ga0105237_10027598 | 3300009545 | Bacteria | 5792 |
| 164 | Ga0105237_10135809 | 3300009545 | Bacteria | 2454 |
| 165 | Ga0105237_10164830 | 3300009545 | Bacteria | 2215 |
| 166 | Ga0105237_10264685 | 3300009545 | Bacteria | 1722 |
| 167 | Ga0105237_10327752 | 3300009545 | Bacteria | 1535 |
| 168 | Ga0105238_10002076 | 3300009551 | Bacteria | 20251 |
| 169 | Ga0105238_10013191 | 3300009551 | Bacteria | 8340 |
| 170 | Ga0105238_10019168 | 3300009551 | Bacteria | 6969 |
| 171 | Ga0105238_10472932 | 3300009551 | Bacteria | 1252 |
| 172 | Ga0105238_10507345 | 3300009551 | Bacteria | 1208 |
| 173 | Ga0105238_10558455 | 3300009551 | Bacteria | 1150 |
| 174 | Ga0105238_10707661 | 3300009551 | Bacteria | 1019 |
| 175 | Ga0099796_10053153 | 3300010159 | Bacteria | 1412 |
| 176 | Ga0105239_10010188 | 3300010375 | Bacteria | 10530 |
| 177 | Ga0105239_10023344 | 3300010375 | Bacteria | 6812 |
| 178 | Ga0105239_10296202 | 3300010375 | Bacteria | 1822 |
| 179 | Ga0105239_10328771 | 3300010375 | Bacteria | 1724 |
| 180 | Ga0105239_10335961 | 3300010375 | Bacteria | 1705 |
| 181 | Ga0105239_11131709 | 3300010375 | Bacteria | 901 |
| 182 | Ga0105246_10289005 | 3300011119 | Bacteria | 1318 |
| 183 | Ga0157371_10148352 | 3300013102 | Bacteria | 1672 |
| 184 | Ga0157370_10021137 | 3300013104 | Bacteria | 6489 |
| 185 | Ga0157370_10326090 | 3300013104 | Bacteria | 1416 |
| 186 | Ga0157369_10681669 | 3300013105 | Bacteria | 1059 |
| 187 | Ga0157374_10131445 | 3300013296 | Bacteria | 2423 |
| 188 | Ga0157374_10555674 | 3300013296 | Bacteria | 1156 |
| 189 | Ga0157378_10008253 | 3300013297 | Bacteria | 9081 |
| 190 | Ga0157378_10412335 | 3300013297 | Bacteria | 1333 |
| 191 | Ga0157378_11049931 | 3300013297 | Bacteria | 850 |
| 192 | Ga0163162_10188063 | 3300013306 | Bacteria | 2192 |
| 193 | Ga0163162_10844259 | 3300013306 | Bacteria | 1031 |
| 194 | Ga0163162_10924559 | 3300013306 | Bacteria | 984 |
| 195 | Ga0157372_11515383 | 3300013307 | Bacteria | 772 |
| 196 | Ga0157375_10148202 | 3300013308 | Bacteria | 2479 |
| 197 | Ga0157375_11491018 | 3300013308 | Bacteria | 798 |
| 198 | Ga0157380_10130340 | 3300014326 | Bacteria | 2144 |
| 199 | Ga0157380_10521753 | 3300014326 | Bacteria | 1159 |
| 200 | Ga0157377_10159048 | 3300014745 | Bacteria | 1403 |
| 201 | Ga0157379_10077545 | 3300014968 | Bacteria | 2975 |
| 202 | Ga0157379_10782536 | 3300014968 | Bacteria | 900 |
| 203 | Ga0157376_10197216 | 3300014969 | Bacteria | 1850 |
| 204 | Ga0157376_11038579 | 3300014969 | Bacteria | 843 |
| 205 | Ga0163161_11295032 | 3300017792 | Bacteria | 633 |
| 206 | Ga0209564_1000468 | 3300025295 | Bacteria | 67696 |
| 207 | Ga0209758_1006960 | 3300025297 | Bacteria | 7882 |
| 208 | Ga0207656_10050024 | 3300025321 | Bacteria | 1804 |
| 209 | Ga0207692_10023057 | 3300025898 | Bacteria | 2874 |
| 210 | Ga0207692_10402236 | 3300025898 | Bacteria | 854 |
| 211 | Ga0207710_10032279 | 3300025900 | Bacteria | 2293 |
| 212 | Ga0207710_10073353 | 3300025900 | Bacteria | 1574 |
| 213 | Ga0207647_10000586 | 3300025904 | Bacteria | 28285 |
| 214 | Ga0207685_10253640 | 3300025905 | Bacteria | 852 |
| 215 | Ga0207699_10360891 | 3300025906 | Bacteria | 1027 |
| 216 | Ga0207643_10248204 | 3300025908 | Bacteria | 1096 |
| 217 | Ga0207705_10344440 | 3300025909 | Bacteria | 1147 |
| 218 | Ga0207705_10346885 | 3300025909 | Bacteria | 1143 |
| 219 | Ga0207654_10001537 | 3300025911 | Bacteria | 12141 |
| 220 | Ga0207707_10054640 | 3300025912 | Bacteria | 3476 |
| 221 | Ga0207707_10077728 | 3300025912 | Bacteria | 2897 |
| 222 | Ga0207707_10126135 | 3300025912 | Bacteria | 2238 |
| 223 | Ga0207707_10164097 | 3300025912 | Bacteria | 1942 |
| 224 | Ga0207707_10232317 | 3300025912 | Bacteria | 1604 |
| 225 | Ga0207695_10001321 | 3300025913 | Bacteria | 42037 |
| 226 | Ga0207695_10615981 | 3300025913 | Bacteria | 967 |
| 227 | Ga0207695_11011674 | 3300025913 | Bacteria | 711 |
| 228 | Ga0207671_10108412 | 3300025914 | Bacteria | 2111 |
| 229 | Ga0207671_10154249 | 3300025914 | Bacteria | 1776 |
| 230 | Ga0207671_10325787 | 3300025914 | Bacteria | 1216 |
| 231 | Ga0207671_10435166 | 3300025914 | Bacteria | 1044 |
| 232 | Ga0207671_10499420 | 3300025914 | Bacteria | 970 |
| 233 | Ga0207671_10592267 | 3300025914 | Bacteria | 884 |
| 234 | Ga0207693_10018324 | 3300025915 | Bacteria | 5578 |
| 235 | Ga0207693_10090304 | 3300025915 | Bacteria | 2401 |
| 236 | Ga0207663_10346697 | 3300025916 | Bacteria | 1123 |
| 237 | Ga0207663_10426678 | 3300025916 | Bacteria | 1019 |
| 238 | Ga0207663_10773625 | 3300025916 | Bacteria | 763 |
| 239 | Ga0207660_10029269 | 3300025917 | Bacteria | 3775 |
| 240 | Ga0207660_10237211 | 3300025917 | Bacteria | 1436 |
| 241 | Ga0207660_10378056 | 3300025917 | Bacteria | 1138 |
| 242 | Ga0207657_10003884 | 3300025919 | Bacteria | 15854 |
| 243 | Ga0207649_10087684 | 3300025920 | Bacteria | 2031 |
| 244 | Ga0207649_10943099 | 3300025920 | Bacteria | 678 |
| 245 | Ga0207652_10032549 | 3300025921 | Bacteria | 4385 |
| 246 | Ga0207652_10069342 | 3300025921 | Bacteria | 3061 |
| 247 | Ga0207652_10461987 | 3300025921 | Bacteria | 1144 |
| 248 | Ga0207646_10060246 | 3300025922 | Bacteria | 3390 |
| 249 | Ga0207694_10000135 | 3300025924 | Bacteria | 75715 |
| 250 | Ga0207694_10032236 | 3300025924 | Bacteria | 4009 |
| 251 | Ga0207687_10738855 | 3300025927 | Bacteria | 837 |
| 252 | Ga0207700_10006639 | 3300025928 | Bacteria | 7013 |
| 253 | Ga0207700_10208295 | 3300025928 | Bacteria | 1651 |
| 254 | Ga0207700_10297755 | 3300025928 | Bacteria | 1392 |
| 255 | Ga0207664_10270999 | 3300025929 | Bacteria | 1487 |
| 256 | Ga0207664_10293479 | 3300025929 | Bacteria | 1429 |
| 257 | Ga0207664_10551585 | 3300025929 | Bacteria | 1034 |
| 258 | Ga0207664_10779213 | 3300025929 | Bacteria | 860 |
| 259 | Ga0207690_10249888 | 3300025932 | Bacteria | 1369 |
| 260 | Ga0207690_10368005 | 3300025932 | Bacteria | 1140 |
| 261 | Ga0207709_10638910 | 3300025935 | Bacteria | 846 |
| 262 | Ga0207669_10174358 | 3300025937 | Bacteria | 1534 |
| 263 | Ga0207704_10073231 | 3300025938 | Bacteria | 2181 |
| 264 | Ga0207704_10115511 | 3300025938 | Bacteria | 1824 |
| 265 | Ga0207665_10135423 | 3300025939 | Bacteria | 1752 |
| 266 | Ga0207665_10191612 | 3300025939 | Bacteria | 1486 |
| 267 | Ga0207665_10579014 | 3300025939 | Bacteria | 875 |
| 268 | Ga0207665_10688216 | 3300025939 | Bacteria | 803 |
| 269 | Ga0207661_11506968 | 3300025944 | Bacteria | 616 |
| 270 | Ga0207667_10011574 | 3300025949 | Bacteria | 10243 |
| 271 | Ga0207667_10039549 | 3300025949 | Bacteria | 5026 |
| 272 | Ga0207667_10208124 | 3300025949 | Bacteria | 2005 |
| 273 | Ga0207667_10617995 | 3300025949 | Bacteria | 1091 |
| 274 | Ga0207640_10011594 | 3300025981 | Bacteria | 4995 |
| 275 | Ga0207640_10256926 | 3300025981 | Bacteria | 1359 |
| 276 | Ga0207640_10588737 | 3300025981 | Bacteria | 940 |
| 277 | Ga0207658_10295834 | 3300025986 | Bacteria | 1393 |
| 278 | Ga0207658_11131862 | 3300025986 | Bacteria | 715 |
| 279 | Ga0207703_10357255 | 3300026035 | Bacteria | 1346 |
| 280 | Ga0207703_10574425 | 3300026035 | Bacteria | 1065 |
| 281 | Ga0207639_10090411 | 3300026041 | Bacteria | 2448 |
| 282 | Ga0207639_10188444 | 3300026041 | Bacteria | 1760 |
| 283 | Ga0207639_10539091 | 3300026041 | Bacteria | 1070 |
| 284 | Ga0207639_11294189 | 3300026041 | Bacteria | 684 |
| 285 | Ga0207678_10033115 | 3300026067 | Bacteria | 4503 |
| 286 | Ga0207678_10090606 | 3300026067 | Bacteria | 2613 |
| 287 | Ga0207678_10206682 | 3300026067 | Bacteria | 1679 |
| 288 | Ga0207678_10482957 | 3300026067 | Bacteria | 1079 |
| 289 | Ga0207708_10839615 | 3300026075 | Bacteria | 793 |
| 290 | Ga0207702_10000026 | 3300026078 | Bacteria | 186067 |
| 291 | Ga0207702_10025557 | 3300026078 | Bacteria | 4902 |
| 292 | Ga0207702_10152318 | 3300026078 | Bacteria | 2104 |
| 293 | Ga0207702_10215943 | 3300026078 | Bacteria | 1785 |
| 294 | Ga0207702_10569058 | 3300026078 | Bacteria | 1110 |
| 295 | Ga0207702_11196162 | 3300026078 | Bacteria | 754 |
| 296 | Ga0207648_10415890 | 3300026089 | Bacteria | 1220 |
| 297 | Ga0207674_10010401 | 3300026116 | Bacteria | 10541 |
| 298 | Ga0207674_10050495 | 3300026116 | Bacteria | 4248 |
| 299 | Ga0207674_10748389 | 3300026116 | Bacteria | 943 |
| 300 | Ga0207675_100081038 | 3300026118 | Bacteria | 3043 |
| 301 | Ga0207683_10029994 | 3300026121 | Bacteria | 4711 |
| 302 | Ga0207698_10603567 | 3300026142 | Bacteria | 1082 |
| 303 | Ga0207698_10605940 | 3300026142 | Bacteria | 1080 |
| 304 | Ga0209179_1017557 | 3300027512 | Bacteria | 1357 |
| 305 | Ga0209588_1032828 | 3300027671 | Bacteria | 1664 |
| 306 | Ga0209588_1103361 | 3300027671 | Bacteria | 916 |
| 307 | Ga0207428_10119177 | 3300027907 | Bacteria | 2025 |
| 308 | Ga0268266_10211015 | 3300028379 | Bacteria | 1781 |
| 309 | Ga0268266_10221116 | 3300028379 | Bacteria | 1741 |
| 310 | Ga0268266_10483770 | 3300028379 | Bacteria | 1180 |
| 311 | Ga0268266_10560944 | 3300028379 | Bacteria | 1095 |
| 312 | Ga0268266_11683244 | 3300028379 | Bacteria | 610 |
| 313 | Ga0268265_10775534 | 3300028380 | Bacteria | 932 |
| 314 | Ga0268264_10001711 | 3300028381 | Bacteria | 20230 |
| 315 | Ga0268264_10516765 | 3300028381 | Bacteria | 1167 |
| 316 | Ga0265337_1004498 | 3300028556 | Bacteria | 5770 |
| 317 | Ga0265326_10068355 | 3300028558 | Bacteria | 1004 |
| 318 | Ga0265334_10151694 | 3300028573 | Bacteria | 817 |
| 319 | Ga0265323_10005809 | 3300028653 | Bacteria | 5220 |
| 320 | Ga0265336_10000701 | 3300028666 | Bacteria | 17786 |
| 321 | Ga0307517_10000315 | 3300028786 | Bacteria | 84020 |
| 322 | Ga0307515_10044290 | 3300028794 | Bacteria | 6879 |
| 323 | Ga0265338_10000207 | 3300028800 | Bacteria | 110193 |
| 324 | Ga0265324_10010437 | 3300029957 | Bacteria | 3580 |
| 325 | Ga0307511_10063099 | 3300030521 | Bacteria | 2803 |
| 326 | Ga0265325_10251751 | 3300031241 | Bacteria | 800 |
| 327 | Ga0265339_10002131 | 3300031249 | Bacteria | 14425 |
| 328 | Ga0265339_10056328 | 3300031249 | Bacteria | 2129 |
| 329 | Ga0307513_10707252 | 3300031456 | Bacteria | 713 |
| 330 | Ga0307513_10779275 | 3300031456 | Bacteria | 662 |
| 331 | Ga0307509_10239085 | 3300031507 | Bacteria | 1610 |
| 332 | Ga0307508_10245703 | 3300031616 | Bacteria | 1386 |
| 333 | Ga0307508_10298787 | 3300031616 | Bacteria | 1203 |
| 334 | Ga0307508_10325595 | 3300031616 | Bacteria | 1128 |
| 335 | Ga0307508_10520957 | 3300031616 | Bacteria | 785 |
| 336 | Ga0307516_10011958 | 3300031730 | Bacteria | 9386 |
| 337 | Ga0307516_10134449 | 3300031730 | Bacteria | 2249 |
| 338 | Ga0307516_10213157 | 3300031730 | Bacteria | 1644 |
| 339 | Ga0307516_10468538 | 3300031730 | Bacteria | 915 |
| 340 | Ga0307516_10481807 | 3300031730 | Bacteria | 895 |
| 341 | Ga0307405_10173423 | 3300031731 | Bacteria | 1541 |
| 342 | Ga0307518_10345779 | 3300031838 | Bacteria | 870 |
| 343 | Ga0307412_10112683 | 3300031911 | Bacteria | 1945 |
| 344 | Ga0307416_101430599 | 3300032002 | Bacteria | 797 |
| 345 | Ga0307415_101229870 | 3300032126 | Bacteria | 707 |
| 346 | Ga0307507_10108194 | 3300033179 | Bacteria | 2287 |
| 347 | Ga0307510_10055327 | 3300033180 | Bacteria | 4145 |
| 348 | Ga0307510_10106440 | 3300033180 | Bacteria | 2568 |
| 349 | Ga0307510_10282433 | 3300033180 | Bacteria | 1130 |
| 350 | Ga0307510_10320212 | 3300033180 | Bacteria | 1008 |
| 351 | Ga0373959_0059673 | 3300034820 | Bacteria | 842 |
| 352 | Ga0373923_0036398 | 3300035111 | Bacteria | 2009 |
| 353 | Ga0373932_0158852 | 3300035112 | Bacteria | 781 |
| 354 | Ga0373936_0045330 | 3300035113 | Bacteria | 1771 |
| 355 | Ga0373954_0020726 | 3300035118 | Bacteria | 2975 |
| 356 | Ga0373954_0037043 | 3300035118 | Bacteria | 2266 |
| 357 | Ga0373954_0185217 | 3300035118 | Bacteria | 1021 |
| 358 | Ga0373956_0043042 | 3300035119 | Bacteria | 2009 |
| 359 | Ga0373956_0075773 | 3300035119 | Bacteria | 1539 |
| 360 | Ga0373957_0015182 | 3300035120 | Bacteria | 2647 |
| 361 | Ga0373943_0057167 | 3300035170 | Bacteria | 1938 |
| 362 | Ga0373943_0070257 | 3300035170 | Bacteria | 1772 |
| 363 | Ga0373943_0282805 | 3300035170 | Bacteria | 938 |
| 364 | Ga0373946_0025116 | 3300035171 | Bacteria | 2342 |
| 365 | Ga0373955_0052678 | 3300035172 | Bacteria | 2220 |
| 366 | Ga0373955_0493790 | 3300035172 | Bacteria | 747 |
| 367 | Ga0373924_0009645 | 3300035410 | Bacteria | 3545 |
| 368 | Ga0373924_0023745 | 3300035410 | Bacteria | 2410 |
| 369 | Ga0373931_0006466 | 3300035691 | Bacteria | 5478 |
| 370 | Ga0373931_0446653 | 3300035691 | Bacteria | 826 |
| 371 | Ga0373931_0799926 | 3300035691 | Bacteria | 628 |
| 372 | Ga0373935_0003292 | 3300035692 | Bacteria | 9345 |
| 373 | Ga0373935_0081515 | 3300035692 | Bacteria | 2104 |
| 374 | Ga0373935_0135059 | 3300035692 | Bacteria | 1661 |
| 375 | Ga0373927_0009017 | 3300035695 | Bacteria | 6698 |
| 376 | Ga0373927_0021578 | 3300035695 | Bacteria | 4220 |
| 377 | Ga0373927_0046752 | 3300035695 | Bacteria | 2799 |
| 378 | Ga0373927_0077805 | 3300035695 | Bacteria | 2149 |
| 379 | Ga0373927_0832224 | 3300035695 | Bacteria | 609 |
| 380 | Ga0373933_0000020 | 3300035724 | Bacteria | 97124 |
| 381 | Ga0373933_0043400 | 3300035724 | Bacteria | 2660 |
| 382 | Ga0373947_0002978 | 3300035725 | Bacteria | 10104 |
| 383 | Ga0373947_0044955 | 3300035725 | Bacteria | 2642 |
| 384 | Ga0373937_0223275 | 3300036401 | Bacteria | 1773 |
| 385 | Ga0372808_015490 | 3300036459 | Bacteria | 1090 |
| 386 | Ga0373925_0017528 | 3300037068 | Bacteria | 5192 |
| 387 | Ga0373925_0039385 | 3300037068 | Bacteria | 3497 |
| 388 | Ga0373925_0186996 | 3300037068 | Bacteria | 1642 |
| 389 | Ga0373925_0383341 | 3300037068 | Bacteria | 1145 |
| 390 | Ga0373925_0655911 | 3300037068 | Bacteria | 865 |
| 391 | Ga0395900_0678959 | 3300037418 | Bacteria | 965 |
| 392 | Ga0395898_0555431 | 3300037466 | Bacteria | 1090 |
| 393 | Ga0395901_0437061 | 3300038443 | Bacteria | 1340 |
| 394 | Ga0436365_0678448 | 3300039437 | Bacteria | 816 |
| 395 | Ga0436365_1606465 | 3300039437 | Bacteria | 1613 |
| 396 | Ga0436360_0219222 | 3300039438 | Bacteria | 2392 |
| 397 | Ga0436360_0489238 | 3300039438 | Bacteria | 701 |
| 398 | Ga0436360_1269431 | 3300039438 | Bacteria | 4155 |
| 399 | Ga0436361_0031890 | 3300039447 | Bacteria | 5404 |
| 400 | Ga0436361_0433577 | 3300039447 | Bacteria | 1059 |
| 401 | Ga0436361_0453191 | 3300039447 | Bacteria | 1427 |
| 402 | Ga0436361_1092805 | 3300039447 | Bacteria | 688 |
| 403 | Ga0436363_0770554 | 3300039450 | Bacteria | 958 |
| 404 | Ga0436363_1433138 | 3300039450 | Bacteria | 1335 |
| 405 | Ga0436363_1613900 | 3300039450 | Bacteria | 1297 |
| 406 | Ga0436362_0656309 | 3300039453 | Bacteria | 3434 |
| 407 | Ga0451793_0199320 | 3300041452 | Bacteria | 816 |
| 408 | Ga0451793_0932724 | 3300041452 | Bacteria | 781 |
| 409 | Ga0451793_1842940 | 3300041452 | Bacteria | 1003 |
| 410 | Ga0451807_0693661 | 3300041486 | Bacteria | 663 |
| 411 | Ga0451843_0275340 | 3300041509 | Bacteria | 612 |
| 412 | Ga0466957_0944783 | 3300044842 | Bacteria | 617 |
| 413 | Ga0466957_1047243 | 3300044842 | Bacteria | 587 |
| 414 | Ga0466959_0220792 | 3300045049 | Bacteria | 1314 |
| 415 | Ga0466967_0249043 | 3300045976 | Bacteria | 1697 |
| 416 | Ga0495617_137042 | 3300046452 | Bacteria | 783 |
| 417 | Ga0495592_0007751 | 3300046454 | Bacteria | 8045 |
| 418 | Ga0495592_0026319 | 3300046454 | Bacteria | 4411 |
| 419 | Ga0495603_0002560 | 3300046455 | Bacteria | 10719 |
| 420 | Ga0495603_0031707 | 3300046455 | Bacteria | 3182 |
| 421 | Ga0495603_0058714 | 3300046455 | Bacteria | 2274 |
| 422 | Ga0495603_0306700 | 3300046455 | Bacteria | 912 |
| 423 | Ga0495603_0410336 | 3300046455 | Bacteria | 776 |
| 424 | Ga0495590_0249967 | 3300046457 | Bacteria | 660 |
| 425 | Ga0495590_0313476 | 3300046457 | Bacteria | 592 |
| 426 | Ga0495629_0000466 | 3300046459 | Bacteria | 33891 |
| 427 | Ga0495629_0069952 | 3300046459 | Bacteria | 2449 |
| 428 | Ga0495638_0050843 | 3300046460 | Bacteria | 2587 |
| 429 | Ga0495638_0114634 | 3300046460 | Bacteria | 1598 |
| 430 | Ga0495638_0209871 | 3300046460 | Bacteria | 1094 |
| 431 | Ga0495641_0004267 | 3300046461 | Bacteria | 10208 |
| 432 | Ga0495641_0299467 | 3300046461 | Bacteria | 725 |
| 433 | Ga0495653_0064356 | 3300046463 | Bacteria | 2763 |
| 434 | Ga0495653_0505556 | 3300046463 | Bacteria | 753 |
| 435 | Ga0495580_0003213 | 3300046472 | Bacteria | 13987 |
| 436 | Ga0495582_0005205 | 3300046473 | Bacteria | 7280 |
| 437 | Ga0495605_0208194 | 3300046474 | Bacteria | 850 |
| 438 | Ga0495639_0004249 | 3300046475 | Bacteria | 6148 |
| 439 | Ga0495639_0412299 | 3300046475 | Bacteria | 683 |
| 440 | Ga0495639_0413845 | 3300046475 | Bacteria | 682 |
| 441 | Ga0495662_0000863 | 3300046476 | Bacteria | 14796 |
| 442 | Ga0495664_0003491 | 3300046477 | Bacteria | 8561 |
| 443 | Ga0495664_0060800 | 3300046477 | Bacteria | 2249 |
| 444 | Ga0495584_0122688 | 3300046491 | Bacteria | 1316 |
| 445 | Ga0495585_0089891 | 3300046492 | Bacteria | 1655 |
| 446 | Ga0495585_0155080 | 3300046492 | Bacteria | 1192 |
| 447 | Ga0495594_0001496 | 3300046499 | Bacteria | 12118 |
| 448 | Ga0495607_0355768 | 3300046501 | Bacteria | 675 |
| 449 | Ga0495583_0022492 | 3300046506 | Bacteria | 3215 |
| 450 | Ga0495606_0005431 | 3300046507 | Bacteria | 12209 |
| 451 | Ga0495606_0317717 | 3300046507 | Bacteria | 838 |
| 452 | Ga0495608_0017296 | 3300046511 | Bacteria | 4988 |
| 453 | Ga0495608_0096090 | 3300046511 | Bacteria | 1914 |
| 454 | Ga0495610_0049434 | 3300046512 | Bacteria | 2059 |
| 455 | Ga0495618_0051675 | 3300046514 | Bacteria | 2597 |
| 456 | Ga0495628_0037940 | 3300046516 | Bacteria | 3860 |
| 457 | Ga0495631_0100949 | 3300046518 | Bacteria | 1242 |
| 458 | Ga0495632_0299573 | 3300046519 | Bacteria | 713 |
| 459 | Ga0495644_0110312 | 3300046523 | Bacteria | 1044 |
| 460 | Ga0495644_0114149 | 3300046523 | Bacteria | 1026 |
| 461 | Ga0495644_0140288 | 3300046523 | Bacteria | 923 |
| 462 | Ga0495648_0006468 | 3300046524 | Bacteria | 9559 |
| 463 | Ga0495648_0014905 | 3300046524 | Bacteria | 5663 |
| 464 | Ga0495652_0032128 | 3300046529 | Bacteria | 4591 |
| 465 | Ga0495652_0570552 | 3300046529 | Bacteria | 775 |
| 466 | Ga0495665_0003348 | 3300046531 | Bacteria | 8690 |
| 467 | Ga0495665_0241446 | 3300046531 | Bacteria | 931 |
| 468 | Ga0495640_0009300 | 3300046533 | Bacteria | 7656 |
| 469 | Ga0495640_0046057 | 3300046533 | Bacteria | 3024 |
| 470 | Ga0495640_0315396 | 3300046533 | Bacteria | 969 |
| 471 | Ga0495640_0457773 | 3300046533 | Bacteria | 779 |
| 472 | Ga0495586_0043265 | 3300046535 | Bacteria | 2426 |
| 473 | Ga0495587_0525231 | 3300046536 | Bacteria | 654 |
| 474 | Ga0495645_0006879 | 3300046543 | Bacteria | 7905 |
| 475 | Ga0495622_0002009 | 3300046557 | Bacteria | 9951 |
| 476 | Ga0495622_0246915 | 3300046557 | Bacteria | 786 |
| 477 | Ga0495622_0267449 | 3300046557 | Bacteria | 750 |
| 478 | Ga0495667_0048853 | 3300046559 | Bacteria | 2793 |
| 479 | Ga0495667_0101418 | 3300046559 | Bacteria | 1862 |
| 480 | Ga0495667_0119440 | 3300046559 | Bacteria | 1702 |
| 481 | Ga0495656_0064344 | 3300046615 | Bacteria | 1610 |
| 482 | Ga0495656_0272161 | 3300046615 | Bacteria | 861 |
| 483 | Ga0495668_0348610 | 3300046616 | Bacteria | 813 |
| 484 | Ga0495668_0405527 | 3300046616 | Bacteria | 749 |
| 485 | Ga0495634_0006673 | 3300046642 | Bacteria | 8749 |
| 486 | Ga0495634_0039716 | 3300046642 | Bacteria | 3203 |
| 487 | Ga0495634_0591184 | 3300046642 | Bacteria | 645 |
| 488 | Ga0495611_0317539 | 3300046648 | Bacteria | 717 |
| 489 | Ga0495625_0084673 | 3300046660 | Bacteria | 2202 |
| 490 | Ga0495625_0138161 | 3300046660 | Bacteria | 1646 |
| 491 | Ga0495625_0395515 | 3300046660 | Bacteria | 864 |
| 492 | Ga0495635_0003606 | 3300046663 | Bacteria | 10723 |
| 493 | Ga0495635_0081266 | 3300046663 | Bacteria | 2217 |
| 494 | Ga0495661_0313609 | 3300046665 | Bacteria | 781 |
| 495 | Ga0495588_0168280 | 3300046674 | Bacteria | 1159 |
| 496 | Ga0495657_0048496 | 3300046675 | Bacteria | 2864 |
| 497 | Ga0495657_0161401 | 3300046675 | Bacteria | 1387 |
| 498 | Ga0495599_0016796 | 3300046678 | Bacteria | 4546 |
| 499 | Ga0495599_0054003 | 3300046678 | Bacteria | 2517 |
| 500 | Ga0495623_0088937 | 3300046679 | Bacteria | 1900 |
| 501 | Ga0495646_0018039 | 3300046680 | Bacteria | 4469 |
| 502 | Ga0495646_0044240 | 3300046680 | Bacteria | 2723 |
| 503 | Ga0495647_0000907 | 3300046681 | Bacteria | 8886 |
| 504 | Ga0495647_0170632 | 3300046681 | Bacteria | 942 |
| 505 | Ga0495658_0054738 | 3300046683 | Bacteria | 2271 |
| 506 | Ga0495658_0201760 | 3300046683 | Bacteria | 1240 |
| 507 | Ga0495658_0237628 | 3300046683 | Bacteria | 1144 |
| 508 | Ga0495658_0662183 | 3300046683 | Bacteria | 669 |
| 509 | Ga0495669_0061007 | 3300046684 | Bacteria | 1706 |
| 510 | Ga0495669_0188962 | 3300046684 | Bacteria | 983 |
| 511 | Ga0495613_0016321 | 3300046689 | Bacteria | 5534 |
| 512 | Ga0495613_0042165 | 3300046689 | Bacteria | 3378 |
| 513 | Ga0495624_0011061 | 3300046690 | Bacteria | 6211 |
| 514 | Ga0495670_0003592 | 3300046691 | Bacteria | 7613 |
| 515 | Ga0495670_0427405 | 3300046691 | Bacteria | 717 |
| 516 | Ga0495670_0542933 | 3300046691 | Bacteria | 632 |
| 517 | Ga0495671_0259480 | 3300046692 | Bacteria | 838 |
| 518 | Ga0495589_0240831 | 3300046794 | Bacteria | 847 |
| 519 | Ga0495589_0399429 | 3300046794 | Bacteria | 631 |
| 520 | Ga0495600_0016731 | 3300046809 | Bacteria | 4660 |
| 521 | Ga0495604_0033676 | 3300047317 | Bacteria | 4054 |
| 522 | Ga0495674_0044597 | 3300047319 | Bacteria | 3941 |
| 523 | Ga0495674_0458341 | 3300047319 | Bacteria | 1024 |
| 524 | Ga0495672_0023455 | 3300047320 | Bacteria | 3993 |
| 525 | Ga0495672_0165631 | 3300047320 | Bacteria | 1132 |
| 526 | Ga0495672_0255739 | 3300047320 | Bacteria | 848 |
| 527 | Ga0495676_0027465 | 3300047321 | Bacteria | 4878 |
| 528 | Ga0495680_0021899 | 3300047322 | Bacteria | 5340 |
| 529 | Ga0495680_0188495 | 3300047322 | Bacteria | 1485 |
| 530 | Ga0495680_0675205 | 3300047322 | Bacteria | 684 |
| 531 | Ga0495675_0059117 | 3300047444 | Bacteria | 2430 |
| 532 | Ga0495685_115833 | 3300047447 | Bacteria | 881 |
| 533 | Ga0495673_0018684 | 3300047469 | Bacteria | 3490 |
| 534 | Ga0495673_0178718 | 3300047469 | Bacteria | 805 |
| 535 | Ga0495681_0091868 | 3300047470 | Bacteria | 1339 |
| 536 | Ga0495684_0033784 | 3300047471 | Bacteria | 3924 |
| 537 | Ga0495684_0102492 | 3300047471 | Bacteria | 2163 |
| 538 | Ga0495686_0213697 | 3300047472 | Bacteria | 1101 |
| 539 | Ga0495686_0266140 | 3300047472 | Bacteria | 958 |
| 540 | Ga0495686_0280007 | 3300047472 | Bacteria | 927 |
| 541 | Ga0495593_0000621 | 3300047673 | Bacteria | 20271 |
| 542 | Ga0495593_0111065 | 3300047673 | Bacteria | 1400 |
| 543 | Ga0495602_0052398 | 3300048088 | Bacteria | 3624 |
| 544 | Ga0496100_0086180 | 3300048903 | Bacteria | 2133 |
| 545 | Ga0496100_0101098 | 3300048903 | Bacteria | 1987 |
| 546 | Ga0496100_0159052 | 3300048903 | Bacteria | 1618 |
| 547 | Ga0496101_0075822 | 3300048904 | Bacteria | 2476 |
| 548 | Ga0496101_0248394 | 3300048904 | Bacteria | 1386 |
| 549 | Ga0496102_0281245 | 3300048905 | Bacteria | 1568 |
| 550 | Ga0496102_0319757 | 3300048905 | Bacteria | 1462 |
| 551 | Ga0496102_0339425 | 3300048905 | Bacteria | 1415 |
| 552 | Ga0496102_0860421 | 3300048905 | Bacteria | 829 |
| 553 | Ga0496102_0909584 | 3300048905 | Bacteria | 801 |
| 554 | Ga0496102_1123320 | 3300048905 | Bacteria | 706 |
| 555 | Ga0496103_0119376 | 3300048906 | Bacteria | 1679 |
| 556 | Ga0496104_0038665 | 3300048907 | Bacteria | 4465 |
| 557 | Ga0496104_0076944 | 3300048907 | Bacteria | 3178 |
| 558 | Ga0496104_0300870 | 3300048907 | Bacteria | 1516 |
| 559 | Ga0496104_0770192 | 3300048907 | Bacteria | 869 |
| 560 | Ga0496105_0043842 | 3300048908 | Bacteria | 3689 |
| 561 | Ga0496105_0346829 | 3300048908 | Bacteria | 1186 |
| 562 | Ga0496106_0047038 | 3300048909 | Bacteria | 3245 |
| 563 | Ga0496106_0102587 | 3300048909 | Bacteria | 2219 |
| 564 | Ga0496106_0239412 | 3300048909 | Bacteria | 1450 |
| 565 | Ga0496106_0246173 | 3300048909 | Bacteria | 1429 |
| 566 | Ga0496107_0035789 | 3300048910 | Bacteria | 3560 |
| 567 | Ga0496107_0094385 | 3300048910 | Bacteria | 2189 |
| 568 | Ga0496107_0249764 | 3300048910 | Bacteria | 1320 |
| 569 | Ga0496107_0377630 | 3300048910 | Bacteria | 1054 |
| 570 | Ga0496108_0146426 | 3300048911 | Bacteria | 2036 |
| 571 | Ga0496108_0282757 | 3300048911 | Bacteria | 1444 |
| 572 | Ga0496108_0300594 | 3300048911 | Bacteria | 1398 |
| 573 | Ga0496109_0011681 | 3300048912 | Bacteria | 7552 |
| 574 | Ga0496109_0166779 | 3300048912 | Bacteria | 2065 |
| 575 | Ga0496109_0507086 | 3300048912 | Bacteria | 1139 |
| 576 | Ga0496110_0380973 | 3300048913 | Bacteria | 1285 |
| 577 | Ga0496110_0632340 | 3300048913 | Bacteria | 969 |
| 578 | Ga0496110_0712911 | 3300048913 | Bacteria | 905 |
| 579 | Ga0496111_0129328 | 3300048914 | Bacteria | 1868 |
| 580 | Ga0496111_0227189 | 3300048914 | Bacteria | 1386 |
| 581 | Ga0496112_0000008 | 3300048915 | Bacteria | 310323 |
| 582 | Ga0496112_0007690 | 3300048915 | Bacteria | 9587 |
| 583 | Ga0496112_0143844 | 3300048915 | Bacteria | 2353 |
| 584 | Ga0496112_0171249 | 3300048915 | Bacteria | 2136 |
| 585 | Ga0496112_0246438 | 3300048915 | Bacteria | 1738 |
| 586 | Ga0496113_0883047 | 3300048916 | Bacteria | 708 |
| 587 | Ga0496113_1063936 | 3300048916 | Bacteria | 635 |
| 588 | Ga0496114_0212855 | 3300048917 | Bacteria | 1695 |
| 589 | Ga0496114_0262686 | 3300048917 | Bacteria | 1520 |
| 590 | Ga0496115_0094912 | 3300048918 | Bacteria | 2441 |
| 591 | Ga0496115_0105859 | 3300048918 | Bacteria | 2309 |
| 592 | Ga0496115_0286475 | 3300048918 | Bacteria | 1352 |
| 593 | Ga0496115_0340566 | 3300048918 | Bacteria | 1224 |
| 594 | Ga0496116_0003779 | 3300048919 | Bacteria | 14802 |
| 595 | Ga0496116_0202340 | 3300048919 | Bacteria | 1038 |
| 596 | Ga0496117_0018912 | 3300048920 | Bacteria | 5682 |
| 597 | Ga0496117_0188632 | 3300048920 | Bacteria | 1177 |
| 598 | Ga0496118_0090018 | 3300048921 | Bacteria | 2116 |
| 599 | Ga0496118_0106071 | 3300048921 | Bacteria | 1881 |
| 600 | Ga0496118_0121942 | 3300048921 | Bacteria | 1697 |
| 601 | Ga0496118_0147250 | 3300048921 | Bacteria | 1480 |
| 602 | Ga0496119_0111484 | 3300048922 | Bacteria | 1518 |
| 603 | Ga0496119_0141579 | 3300048922 | Bacteria | 1298 |
| 604 | Ga0496119_0294137 | 3300048922 | Bacteria | 803 |
| 605 | Ga0496120_0135515 | 3300048923 | Bacteria | 1256 |
| 606 | Ga0496120_0197665 | 3300048923 | Bacteria | 975 |
| 607 | Ga0496121_0000774 | 3300048924 | Bacteria | 58528 |
| 608 | Ga0496121_0002381 | 3300048924 | Bacteria | 28889 |
| 609 | Ga0496121_0002382 | 3300048924 | Bacteria | 28853 |
| 610 | Ga0496121_0027414 | 3300048924 | Bacteria | 5332 |
| 611 | Ga0496121_0080838 | 3300048924 | Bacteria | 2574 |
| 612 | Ga0496121_0197642 | 3300048924 | Bacteria | 1436 |
| 613 | Ga0496121_0751645 | 3300048924 | Bacteria | 580 |
| 614 | Ga0496122_0065666 | 3300048925 | Bacteria | 2629 |
| 615 | Ga0496122_0146220 | 3300048925 | Bacteria | 1468 |
| 616 | Ga0496123_0020811 | 3300048926 | Bacteria | 5118 |
| 617 | Ga0496123_0054544 | 3300048926 | Bacteria | 2630 |
| 618 | Ga0496123_0184562 | 3300048926 | Bacteria | 1085 |
| 619 | Ga0496124_0053613 | 3300048927 | Bacteria | 3417 |
| 620 | Ga0496124_0134440 | 3300048927 | Bacteria | 1960 |
| 621 | Ga0496124_0144855 | 3300048927 | Bacteria | 1871 |
| 622 | Ga0496125_0000063 | 3300048928 | Bacteria | 250260 |
| 623 | Ga0496125_0010926 | 3300048928 | Bacteria | 9129 |
| 624 | Ga0496125_0057173 | 3300048928 | Bacteria | 3161 |
| 625 | Ga0496125_0121490 | 3300048928 | Bacteria | 1862 |
| 626 | Ga0496125_0303996 | 3300048928 | Bacteria | 976 |
| 627 | Ga0496126_0006620 | 3300048929 | Bacteria | 12897 |
| 628 | Ga0496126_0101796 | 3300048929 | Bacteria | 2512 |
| 629 | Ga0496126_0101879 | 3300048929 | Bacteria | 2511 |
| 630 | Ga0496126_0151614 | 3300048929 | Bacteria | 1986 |
| 631 | Ga0496126_0160381 | 3300048929 | Bacteria | 1922 |
| 632 | Ga0496126_0214149 | 3300048929 | Bacteria | 1621 |
| 633 | Ga0496126_0437753 | 3300048929 | Bacteria | 1054 |
| 634 | Ga0496126_0707662 | 3300048929 | Bacteria | 782 |
| 635 | Ga0496126_0722284 | 3300048929 | Bacteria | 772 |
| 636 | Ga0495678_207430 | 3300049459 | Bacteria | 601 |
| 637 | Ga0501031_0001938 | 3300049568 | Bacteria | 13042 |
| 638 | Ga0501031_0006046 | 3300049568 | Bacteria | 7900 |
| 639 | Ga0501032_0000244 | 3300049569 | Bacteria | 45114 |
| 640 | Ga0501032_0004101 | 3300049569 | Bacteria | 11038 |
| 641 | Ga0501032_0164724 | 3300049569 | Bacteria | 1455 |
| 642 | Ga0501033_0000951 | 3300049570 | Bacteria | 26299 |
| 643 | Ga0501033_0001501 | 3300049570 | Bacteria | 20667 |
| 644 | Ga0501034_0171980 | 3300049571 | Bacteria | 2133 |
| 645 | Ga0501036_0007992 | 3300049572 | Bacteria | 8656 |
| 646 | Ga0501036_0017775 | 3300049572 | Bacteria | 5954 |
| 647 | Ga0501037_0000139 | 3300049573 | Bacteria | 67890 |
| 648 | Ga0501037_0002392 | 3300049573 | Bacteria | 13546 |
| 649 | Ga0501038_0000404 | 3300049574 | Bacteria | 37454 |
| 650 | Ga0501038_0002970 | 3300049574 | Bacteria | 15808 |
| 651 | Ga0501039_0000323 | 3300049575 | Bacteria | 34020 |
| 652 | Ga0501039_0055409 | 3300049575 | Bacteria | 3070 |
| 653 | Ga0501042_0150433 | 3300049578 | Bacteria | 1678 |
| 654 | Ga0501042_0393897 | 3300049578 | Bacteria | 1003 |
| 655 | Ga0501043_0000021 | 3300049579 | Bacteria | 155025 |
| 656 | Ga0501043_0000959 | 3300049579 | Bacteria | 25541 |
| 657 | Ga0501046_0004069 | 3300049580 | Bacteria | 13339 |
| 658 | Ga0501046_0089880 | 3300049580 | Bacteria | 2363 |
| 659 | Ga0501047_0046547 | 3300049581 | Bacteria | 4192 |
| 660 | Ga0501048_0014297 | 3300049582 | Bacteria | 5878 |
| 661 | Ga0501067_0023708 | 3300049583 | Bacteria | 3401 |
| 662 | Ga0501068_0006769 | 3300049584 | Bacteria | 6332 |
| 663 | Ga0501068_0132025 | 3300049584 | Bacteria | 1562 |
| 664 | Ga0501069_0027611 | 3300049585 | Bacteria | 3110 |
| 665 | Ga0501070_0003487 | 3300049586 | Bacteria | 13644 |
| 666 | Ga0501070_0182566 | 3300049586 | Bacteria | 1726 |
| 667 | Ga0501071_0313106 | 3300049587 | Bacteria | 1191 |
| 668 | Ga0501071_0515936 | 3300049587 | Bacteria | 917 |
| 669 | Ga0501072_0002290 | 3300049588 | Bacteria | 14329 |
| 670 | Ga0501073_0000726 | 3300049589 | Bacteria | 23280 |
| 671 | Ga0501073_0052853 | 3300049589 | Bacteria | 2844 |
| 672 | Ga0501074_0002972 | 3300049590 | Bacteria | 11915 |
| 673 | Ga0501074_0452410 | 3300049590 | Bacteria | 910 |
| 674 | Ga0501079_0013190 | 3300049741 | Bacteria | 6301 |
| 675 | Ga0501079_0699027 | 3300049741 | Bacteria | 798 |
| 676 | Ga0501080_0011392 | 3300049742 | Bacteria | 8146 |
| 677 | Ga0501080_0105981 | 3300049742 | Bacteria | 2606 |
| 678 | Ga0501083_0126905 | 3300049744 | Bacteria | 1672 |
| 679 | Ga0501035_0000090 | 3300049822 | Bacteria | 112445 |
| 680 | Ga0501035_0016159 | 3300049822 | Bacteria | 6886 |
| 681 | Ga0501035_0734703 | 3300049822 | Bacteria | 793 |
| 682 | Ga0501044_0009643 | 3300049823 | Bacteria | 10506 |
| 683 | Ga0501044_0131480 | 3300049823 | Bacteria | 2497 |
| 684 | nmdc:mga0yw44_155797_c1 | 3300050492 | Bacteria | 1493 |
| 685 | nmdc:mga0yw44_377368_c1 | 3300050492 | Bacteria | 957 |
| 686 | nmdc:mga06z11_50134_c1 | 3300050494 | Bacteria | 2132 |
| 687 | nmdc:mga08y16_151181_c1 | 3300050511 | Bacteria | 2413 |
| 688 | nmdc:mga0n895_759733_c1 | 3300050512 | Bacteria | 962 |
| 689 | nmdc:mga0sz30_23148_c1 | 3300050516 | Bacteria | 2525 |
| 690 | nmdc:mga0sz30_41072_c1 | 3300050516 | Bacteria | 1944 |
| 691 | Ga0495601_0109327 | 3300053077 | Bacteria | 1789 |
| 692 | Ga0495601_0137052 | 3300053077 | Bacteria | 1596 |
| 693 | Ga0495601_0168844 | 3300053077 | Bacteria | 1430 |
| 694 | Ga0495601_0288435 | 3300053077 | Bacteria | 1070 |
| 695 | Ga0495612_0019291 | 3300053078 | Bacteria | 2731 |
| 696 | Ga0500635_0001465 | 3300053080 | Bacteria | 5671 |
| 697 | Ga0495595_0006425 | 3300053084 | Bacteria | 4793 |
| 698 | Ga0495619_0201267 | 3300053085 | Bacteria | 1379 |
| 699 | Ga0495619_0565158 | 3300053085 | Bacteria | 780 |
| 700 | Ga0500643_015959 | 3300053087 | Bacteria | 2561 |
| 701 | Ga0500643_051154 | 3300053087 | Bacteria | 1180 |
| 702 | Ga0500581_112648 | 3300053089 | Bacteria | 1323 |
| 703 | Ga0500647_0168317 | 3300053091 | Bacteria | 1013 |
| 704 | Ga0500583_0490957 | 3300053092 | Bacteria | 578 |
| 705 | Ga0500651_0063529 | 3300053093 | Bacteria | 2304 |
| 706 | Ga0500651_0275514 | 3300053093 | Bacteria | 972 |
| 707 | Ga0500651_0311600 | 3300053093 | Bacteria | 901 |
| 708 | Ga0500566_0000153 | 3300053094 | Bacteria | 35620 |
| 709 | Ga0500566_0001073 | 3300053094 | Bacteria | 15835 |
| 710 | Ga0500566_0060893 | 3300053094 | Bacteria | 2137 |
| 711 | Ga0500640_007920 | 3300053095 | Bacteria | 4170 |
| 712 | Ga0500641_0013221 | 3300053096 | Bacteria | 3030 |
| 713 | Ga0500554_000472 | 3300053102 | Bacteria | 8375 |
| 714 | Ga0500555_086926 | 3300053103 | Bacteria | 807 |
| 715 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 716 | Ga0500569_100001 | 3300053109 | Bacteria | 949 |
| 717 | Ga0500572_003966 | 3300053111 | Bacteria | 3362 |
| 718 | Ga0500591_016088 | 3300053115 | Bacteria | 3603 |
| 719 | Ga0500593_140370 | 3300053117 | Bacteria | 952 |
| 720 | Ga0500594_0028348 | 3300053118 | Bacteria | 1456 |
| 721 | Ga0500595_000321 | 3300053119 | Bacteria | 31508 |
| 722 | Ga0500595_009962 | 3300053119 | Bacteria | 3802 |
| 723 | Ga0500595_078815 | 3300053119 | Bacteria | 967 |
| 724 | Ga0500597_243328 | 3300053120 | Bacteria | 739 |
| 725 | Ga0500607_057905 | 3300053121 | Bacteria | 2041 |
| 726 | Ga0500608_013340 | 3300053122 | Bacteria | 3640 |
| 727 | Ga0500608_075897 | 3300053122 | Bacteria | 1593 |
| 728 | Ga0500618_003074 | 3300053125 | Bacteria | 5909 |
| 729 | Ga0500642_0000026 | 3300053130 | Bacteria | 127731 |
| 730 | Ga0500642_0293108 | 3300053130 | Bacteria | 736 |
| 731 | Ga0500652_030196 | 3300053131 | Bacteria | 2118 |
| 732 | Ga0500559_0009672 | 3300053136 | Bacteria | 4163 |
| 733 | Ga0500559_0024281 | 3300053136 | Bacteria | 2578 |
| 734 | Ga0500559_0210783 | 3300053136 | Bacteria | 916 |
| 735 | Ga0500568_0000922 | 3300053139 | Bacteria | 20296 |
| 736 | Ga0500577_0000121 | 3300053142 | Bacteria | 18893 |
| 737 | Ga0500577_0018030 | 3300053142 | Bacteria | 2261 |
| 738 | Ga0500586_000745 | 3300053145 | Bacteria | 6659 |
| 739 | Ga0500588_0084418 | 3300053146 | Bacteria | 1069 |
| 740 | Ga0500590_076907 | 3300053148 | Bacteria | 1648 |
| 741 | Ga0500603_000152 | 3300053150 | Bacteria | 16988 |
| 742 | Ga0500603_002170 | 3300053150 | Bacteria | 4333 |
| 743 | Ga0500603_022909 | 3300053150 | Bacteria | 1551 |
| 744 | Ga0500616_0000031 | 3300053153 | Bacteria | 415013 |
| 745 | Ga0500616_0023186 | 3300053153 | Bacteria | 3459 |
| 746 | Ga0500620_046688 | 3300053155 | Bacteria | 1440 |
| 747 | Ga0500622_0000994 | 3300053156 | Bacteria | 23922 |
| 748 | Ga0500627_0025163 | 3300053158 | Bacteria | 2443 |
| 749 | Ga0500633_0065887 | 3300053160 | Bacteria | 1284 |
| 750 | Ga0500634_0107321 | 3300053161 | Bacteria | 1385 |
| 751 | Ga0500638_000125 | 3300053162 | Bacteria | 14917 |
| 752 | Ga0500638_048424 | 3300053162 | Bacteria | 2056 |
| 753 | Ga0500639_101620 | 3300053163 | Bacteria | 1414 |
| 754 | Ga0500636_0004153 | 3300053177 | Bacteria | 8194 |
| 755 | Ga0500636_0026285 | 3300053177 | Bacteria | 3441 |
| 756 | Ga0500636_0066235 | 3300053177 | Bacteria | 2100 |
| 757 | Ga0500636_0083215 | 3300053177 | Bacteria | 1841 |
| 758 | Ga0500636_0139133 | 3300053177 | Bacteria | 1345 |
| 759 | Ga0500637_0000264 | 3300053178 | Bacteria | 19641 |
| 760 | Ga0500637_0115433 | 3300053178 | Bacteria | 1557 |
| 761 | Ga0500637_0133318 | 3300053178 | Bacteria | 1439 |
| 762 | Ga0500637_0221990 | 3300053178 | Bacteria | 1068 |
| 763 | Ga0500637_0302452 | 3300053178 | Bacteria | 871 |
| 764 | Ga0500637_0313305 | 3300053178 | Bacteria | 851 |
| 765 | Ga0500657_080710 | 3300053728 | Bacteria | 1398 |
| 766 | Ga0500596_002955 | 3300053735 | Bacteria | 3289 |
| 767 | Ga0500596_038798 | 3300053735 | Bacteria | 755 |
| 768 | Ga0501084_0034233 | 3300054114 | Bacteria | 4248 |
| 769 | Ga0500661_003016 | 3300055283 | Bacteria | 3162 |
| 770 | Ga0500661_059323 | 3300055283 | Bacteria | 690 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300017792 | Ga0163161_11295032 | Ga0163161_112950321 | 162 |
| 2 | iso_pu_bacteria | 2508501128 | 2509152935 | 162 |
| 3 | 3300005548 | Ga0070665_100504618 | Ga0070665_1005046182 | 165 |
| 4 | 3300028379 | Ga0268266_10483770 | Ga0268266_104837702 | 165 |
| 5 | 3300046615 | Ga0495656_0272161 | Ga0495656_0272161_261_779 | 165 |
| 6 | 3300047320 | Ga0495672_0255739 | Ga0495672_0255739_113_637 | 165 |
| 7 | iso_pu_bacteria | 2643221651 | 2644287598 | 165 |
| 8 | 3300005467 | Ga0070706_100958057 | Ga0070706_1009580572 | 166 |
| 9 | 3300005471 | Ga0070698_100165606 | Ga0070698_1001656062 | 166 |
| 10 | 3300005577 | Ga0068857_100678751 | Ga0068857_1006787512 | 166 |
| 11 | 3300009545 | Ga0105237_10327752 | Ga0105237_103277522 | 166 |
| 12 | 3300025914 | Ga0207671_10592267 | Ga0207671_105922672 | 166 |
| 13 | 3300026116 | Ga0207674_10748389 | Ga0207674_107483892 | 166 |
| 14 | 3300045976 | Ga0466967_0249043 | Ga0466967_0249043_115_645 | 166 |
| 15 | 3300005367 | Ga0070667_101129865 | Ga0070667_1011298651 | 167 |
| 16 | 3300005434 | Ga0070709_10043109 | Ga0070709_100431093 | 167 |
| 17 | 3300005434 | Ga0070709_10174059 | Ga0070709_101740592 | 167 |
| 18 | 3300005435 | Ga0070714_100545111 | Ga0070714_1005451112 | 167 |
| 19 | 3300005436 | Ga0070713_100027160 | Ga0070713_1000271604 | 167 |
| 20 | 3300005437 | Ga0070710_10004247 | Ga0070710_100042472 | 167 |
| 21 | 3300005439 | Ga0070711_100074878 | Ga0070711_1000748782 | 167 |
| 22 | 3300005439 | Ga0070711_100140551 | Ga0070711_1001405512 | 167 |
| 23 | 3300005439 | Ga0070711_100177188 | Ga0070711_1001771882 | 167 |
| 24 | 3300005458 | Ga0070681_10029384 | Ga0070681_100293842 | 167 |
| 25 | 3300005471 | Ga0070698_100897763 | Ga0070698_1008977631 | 167 |
| 26 | 3300005539 | Ga0068853_101263809 | Ga0068853_1012638091 | 167 |
| 27 | 3300005548 | Ga0070665_100259573 | Ga0070665_1002595731 | 167 |
| 28 | 3300005983 | Ga0081540_1014350 | Ga0081540_10143505 | 167 |
| 29 | 3300005983 | Ga0081540_1038336 | Ga0081540_10383362 | 167 |
| 30 | 3300006028 | Ga0070717_10043944 | Ga0070717_100439442 | 167 |
| 31 | 3300006028 | Ga0070717_10386243 | Ga0070717_103862432 | 167 |
| 32 | 3300006028 | Ga0070717_10738688 | Ga0070717_107386881 | 167 |
| 33 | 3300006038 | Ga0075365_10160284 | Ga0075365_101602842 | 167 |
| 34 | 3300006038 | Ga0075365_10177483 | Ga0075365_101774832 | 167 |
| 35 | 3300006051 | Ga0075364_10383598 | Ga0075364_103835982 | 167 |
| 36 | 3300006163 | Ga0070715_10144201 | Ga0070715_101442011 | 167 |
| 37 | 3300006175 | Ga0070712_100378652 | Ga0070712_1003786522 | 167 |
| 38 | 3300006175 | Ga0070712_100599220 | Ga0070712_1005992202 | 167 |
| 39 | 3300006178 | Ga0075367_10070814 | Ga0075367_100708142 | 167 |
| 40 | 3300009098 | Ga0105245_10492386 | Ga0105245_104923862 | 167 |
| 41 | 3300009177 | Ga0105248_10096619 | Ga0105248_100966195 | 167 |
| 42 | 3300009551 | Ga0105238_10558455 | Ga0105238_105584552 | 167 |
| 43 | 3300010375 | Ga0105239_11131709 | Ga0105239_111317092 | 167 |
| 44 | 3300013297 | Ga0157378_10008253 | Ga0157378_100082536 | 167 |
| 45 | 3300025898 | Ga0207692_10023057 | Ga0207692_100230573 | 167 |
| 46 | 3300025898 | Ga0207692_10402236 | Ga0207692_104022362 | 167 |
| 47 | 3300025905 | Ga0207685_10253640 | Ga0207685_102536402 | 167 |
| 48 | 3300025906 | Ga0207699_10360891 | Ga0207699_103608911 | 167 |
| 49 | 3300025912 | Ga0207707_10126135 | Ga0207707_101261353 | 167 |
| 50 | 3300025916 | Ga0207663_10346697 | Ga0207663_103466971 | 167 |
| 51 | 3300025916 | Ga0207663_10426678 | Ga0207663_104266781 | 167 |
| 52 | 3300025928 | Ga0207700_10006639 | Ga0207700_100066393 | 167 |
| 53 | 3300025928 | Ga0207700_10208295 | Ga0207700_102082952 | 167 |
| 54 | 3300025929 | Ga0207664_10270999 | Ga0207664_102709992 | 167 |
| 55 | 3300025929 | Ga0207664_10551585 | Ga0207664_105515852 | 167 |
| 56 | 3300025939 | Ga0207665_10135423 | Ga0207665_101354232 | 167 |
| 57 | 3300025986 | Ga0207658_11131862 | Ga0207658_111318622 | 167 |
| 58 | 3300026035 | Ga0207703_10574425 | Ga0207703_105744252 | 167 |
| 59 | 3300026067 | Ga0207678_10090606 | Ga0207678_100906061 | 167 |
| 60 | 3300031616 | Ga0307508_10298787 | Ga0307508_102987872 | 167 |
| 61 | 3300031730 | Ga0307516_10011958 | Ga0307516_100119587 | 167 |
| 62 | 3300031730 | Ga0307516_10134449 | Ga0307516_101344492 | 167 |
| 63 | 3300031911 | Ga0307412_10112683 | Ga0307412_101126832 | 167 |
| 64 | 3300033180 | Ga0307510_10055327 | Ga0307510_100553275 | 167 |
| 65 | 3300046460 | Ga0495638_0050843 | Ga0495638_0050843_991_1521 | 167 |
| 66 | 3300046460 | Ga0495638_0209871 | Ga0495638_0209871_491_1021 | 167 |
| 67 | 3300046506 | Ga0495583_0022492 | Ga0495583_0022492_772_1302 | 167 |
| 68 | 3300046512 | Ga0495610_0049434 | Ga0495610_0049434_809_1339 | 167 |
| 69 | 3300046519 | Ga0495632_0299573 | Ga0495632_0299573_157_687 | 167 |
| 70 | 3300046524 | Ga0495648_0006468 | Ga0495648_0006468_1192_1722 | 167 |
| 71 | 3300046660 | Ga0495625_0084673 | Ga0495625_0084673_1576_2115 | 167 |
| 72 | 3300046665 | Ga0495661_0313609 | Ga0495661_0313609_65_595 | 167 |
| 73 | 3300046691 | Ga0495670_0003592 | Ga0495670_0003592_3830_4360 | 167 |
| 74 | 3300046692 | Ga0495671_0259480 | Ga0495671_0259480_285_815 | 167 |
| 75 | 3300046794 | Ga0495589_0240831 | Ga0495589_0240831_186_716 | 167 |
| 76 | 3300047320 | Ga0495672_0165631 | Ga0495672_0165631_237_767 | 167 |
| 77 | 3300047470 | Ga0495681_0091868 | Ga0495681_0091868_405_935 | 167 |
| 78 | 3300047472 | Ga0495686_0213697 | Ga0495686_0213697_73_603 | 167 |
| 79 | 3300048905 | Ga0496102_0860421 | Ga0496102_0860421_17_547 | 167 |
| 80 | 3300048909 | Ga0496106_0239412 | Ga0496106_0239412_828_1358 | 167 |
| 81 | 3300048919 | Ga0496116_0003779 | Ga0496116_0003779_3077_3607 | 167 |
| 82 | 3300048920 | Ga0496117_0018912 | Ga0496117_0018912_1328_1858 | 167 |
| 83 | 3300048921 | Ga0496118_0090018 | Ga0496118_0090018_1037_1567 | 167 |
| 84 | 3300048921 | Ga0496118_0106071 | Ga0496118_0106071_713_1243 | 167 |
| 85 | 3300048921 | Ga0496118_0147250 | Ga0496118_0147250_810_1340 | 167 |
| 86 | 3300048922 | Ga0496119_0141579 | Ga0496119_0141579_193_723 | 167 |
| 87 | 3300048922 | Ga0496119_0294137 | Ga0496119_0294137_150_683 | 167 |
| 88 | 3300048923 | Ga0496120_0135515 | Ga0496120_0135515_533_1063 | 167 |
| 89 | 3300048924 | Ga0496121_0080838 | Ga0496121_0080838_764_1294 | 167 |
| 90 | 3300048925 | Ga0496122_0065666 | Ga0496122_0065666_1646_2179 | 167 |
| 91 | 3300048926 | Ga0496123_0020811 | Ga0496123_0020811_1232_1762 | 167 |
| 92 | 3300048926 | Ga0496123_0184562 | Ga0496123_0184562_285_815 | 167 |
| 93 | 3300048927 | Ga0496124_0134440 | Ga0496124_0134440_676_1206 | 167 |
| 94 | 3300048927 | Ga0496124_0144855 | Ga0496124_0144855_1029_1556 | 167 |
| 95 | 3300048928 | Ga0496125_0000063 | Ga0496125_0000063_209467_210000 | 167 |
| 96 | 3300048928 | Ga0496125_0010926 | Ga0496125_0010926_371_904 | 167 |
| 97 | 3300048928 | Ga0496125_0057173 | Ga0496125_0057173_1513_2043 | 167 |
| 98 | 3300048928 | Ga0496125_0121490 | Ga0496125_0121490_303_833 | 167 |
| 99 | 3300048929 | Ga0496126_0101796 | Ga0496126_0101796_977_1507 | 167 |
| 100 | 3300048929 | Ga0496126_0160381 | Ga0496126_0160381_1099_1626 | 167 |
| 101 | 3300049459 | Ga0495678_207430 | Ga0495678_207430_35_565 | 167 |
| 102 | 3300050492 | nmdc:mga0yw44_155797_c1 | nmdc:mga0yw44_155797_c1_248_778 | 167 |
| 103 | 3300050494 | nmdc:mga06z11_50134_c1 | nmdc:mga06z11_50134_c1_570_1100 | 167 |
| 104 | 3300050516 | nmdc:mga0sz30_23148_c1 | nmdc:mga0sz30_23148_c1_449_979 | 167 |
| 105 | 3300053087 | Ga0500643_015959 | Ga0500643_015959_741_1271 | 167 |
| 106 | 3300053089 | Ga0500581_112648 | Ga0500581_112648_549_1079 | 167 |
| 107 | 3300053093 | Ga0500651_0063529 | Ga0500651_0063529_460_1002 | 167 |
| 108 | 3300053093 | Ga0500651_0311600 | Ga0500651_0311600_121_651 | 167 |
| 109 | 3300053094 | Ga0500566_0001073 | Ga0500566_0001073_6425_6955 | 167 |
| 110 | 3300053096 | Ga0500641_0013221 | Ga0500641_0013221_2215_2745 | 167 |
| 111 | 3300053103 | Ga0500555_086926 | Ga0500555_086926_183_713 | 167 |
| 112 | 3300053104 | Ga0500556_0000002 | Ga0500556_0000002_20454_20984 | 167 |
| 113 | 3300053109 | Ga0500569_100001 | Ga0500569_100001_100_630 | 167 |
| 114 | 3300053117 | Ga0500593_140370 | Ga0500593_140370_388_918 | 167 |
| 115 | 3300053118 | Ga0500594_0028348 | Ga0500594_0028348_663_1193 | 167 |
| 116 | 3300053121 | Ga0500607_057905 | Ga0500607_057905_412_942 | 167 |
| 117 | 3300053122 | Ga0500608_013340 | Ga0500608_013340_514_1044 | 167 |
| 118 | 3300053125 | Ga0500618_003074 | Ga0500618_003074_5344_5874 | 167 |
| 119 | 3300053130 | Ga0500642_0000026 | Ga0500642_0000026_30014_30544 | 167 |
| 120 | 3300053131 | Ga0500652_030196 | Ga0500652_030196_1254_1784 | 167 |
| 121 | 3300053136 | Ga0500559_0024281 | Ga0500559_0024281_1012_1542 | 167 |
| 122 | 3300053136 | Ga0500559_0210783 | Ga0500559_0210783_354_887 | 167 |
| 123 | 3300053139 | Ga0500568_0000922 | Ga0500568_0000922_18658_19188 | 167 |
| 124 | 3300053142 | Ga0500577_0018030 | Ga0500577_0018030_985_1515 | 167 |
| 125 | 3300053145 | Ga0500586_000745 | Ga0500586_000745_5650_6180 | 167 |
| 126 | 3300053146 | Ga0500588_0084418 | Ga0500588_0084418_262_792 | 167 |
| 127 | 3300053148 | Ga0500590_076907 | Ga0500590_076907_335_865 | 167 |
| 128 | 3300053153 | Ga0500616_0000031 | Ga0500616_0000031_127724_128254 | 167 |
| 129 | 3300053156 | Ga0500622_0000994 | Ga0500622_0000994_12270_12800 | 167 |
| 130 | 3300053158 | Ga0500627_0025163 | Ga0500627_0025163_616_1146 | 167 |
| 131 | 3300053160 | Ga0500633_0065887 | Ga0500633_0065887_251_781 | 167 |
| 132 | 3300053177 | Ga0500636_0004153 | Ga0500636_0004153_7154_7684 | 167 |
| 133 | 3300053178 | Ga0500637_0115433 | Ga0500637_0115433_903_1433 | 167 |
| 134 | iso_pu_bacteria | 2513237102 | 2513702802 | 167 |
| 135 | iso_pu_bacteria | 2602042107 | 2603861357 | 167 |
| 136 | iso_pu_bacteria | 2857524615 | 2857530128 | 167 |
| 137 | iso_pu_bacteria | 2893066018 | 2893071741 | 167 |
| 138 | iso_pu_bacteria | 2919073203 | 2919076869 | 167 |
| 139 | iso_pu_bacteria | 8019648815 | 8019656214 | 167 |
| 140 | 3300003203 | JGI25406J46586_10000014 | JGI25406J46586_1000001451 | 168 |
| 141 | 3300005327 | Ga0070658_10200182 | Ga0070658_102001822 | 168 |
| 142 | 3300005334 | Ga0068869_101241321 | Ga0068869_1012413211 | 168 |
| 143 | 3300005336 | Ga0070680_100090984 | Ga0070680_1000909843 | 168 |
| 144 | 3300005336 | Ga0070680_100752286 | Ga0070680_1007522862 | 168 |
| 145 | 3300005347 | Ga0070668_100875625 | Ga0070668_1008756252 | 168 |
| 146 | 3300005356 | Ga0070674_100252219 | Ga0070674_1002522192 | 168 |
| 147 | 3300005366 | Ga0070659_100495453 | Ga0070659_1004954532 | 168 |
| 148 | 3300005458 | Ga0070681_10032454 | Ga0070681_100324542 | 168 |
| 149 | 3300005459 | Ga0068867_100169379 | Ga0068867_1001693792 | 168 |
| 150 | 3300005530 | Ga0070679_100822211 | Ga0070679_1008222111 | 168 |
| 151 | 3300005530 | Ga0070679_101074049 | Ga0070679_1010740491 | 168 |
| 152 | 3300005539 | Ga0068853_100435914 | Ga0068853_1004359142 | 168 |
| 153 | 3300005563 | Ga0068855_100257410 | Ga0068855_1002574102 | 168 |
| 154 | 3300005577 | Ga0068857_100540558 | Ga0068857_1005405581 | 168 |
| 155 | 3300005718 | Ga0068866_10220657 | Ga0068866_102206572 | 168 |
| 156 | 3300005719 | Ga0068861_100167359 | Ga0068861_1001673592 | 168 |
| 157 | 3300005844 | Ga0068862_100730675 | Ga0068862_1007306752 | 168 |
| 158 | 3300005985 | Ga0081539_10000008 | Ga0081539_10000008193 | 168 |
| 159 | 3300007788 | Ga0099795_10052596 | Ga0099795_100525962 | 168 |
| 160 | 3300009093 | Ga0105240_10033625 | Ga0105240_100336257 | 168 |
| 161 | 3300009094 | Ga0111539_10102681 | Ga0111539_101026812 | 168 |
| 162 | 3300009098 | Ga0105245_10545874 | Ga0105245_105458742 | 168 |
| 163 | 3300009148 | Ga0105243_10158878 | Ga0105243_101588782 | 168 |
| 164 | 3300013104 | Ga0157370_10021137 | Ga0157370_100211372 | 168 |
| 165 | 3300013306 | Ga0163162_10924559 | Ga0163162_109245592 | 168 |
| 166 | 3300013308 | Ga0157375_11491018 | Ga0157375_114910182 | 168 |
| 167 | 3300014326 | Ga0157380_10521753 | Ga0157380_105217532 | 168 |
| 168 | 3300025297 | Ga0209758_1006960 | Ga0209758_10069603 | 168 |
| 169 | 3300025909 | Ga0207705_10344440 | Ga0207705_103444402 | 168 |
| 170 | 3300025912 | Ga0207707_10232317 | Ga0207707_102323172 | 168 |
| 171 | 3300025917 | Ga0207660_10378056 | Ga0207660_103780562 | 168 |
| 172 | 3300025927 | Ga0207687_10738855 | Ga0207687_107388552 | 168 |
| 173 | 3300025929 | Ga0207664_10779213 | Ga0207664_107792132 | 168 |
| 174 | 3300025935 | Ga0207709_10638910 | Ga0207709_106389102 | 168 |
| 175 | 3300025937 | Ga0207669_10174358 | Ga0207669_101743582 | 168 |
| 176 | 3300025949 | Ga0207667_10208124 | Ga0207667_102081242 | 168 |
| 177 | 3300026067 | Ga0207678_10482957 | Ga0207678_104829572 | 168 |
| 178 | 3300026078 | Ga0207702_10215943 | Ga0207702_102159432 | 168 |
| 179 | 3300026118 | Ga0207675_100081038 | Ga0207675_1000810383 | 168 |
| 180 | 3300027907 | Ga0207428_10119177 | Ga0207428_101191772 | 168 |
| 181 | 3300028380 | Ga0268265_10775534 | Ga0268265_107755342 | 168 |
| 182 | 3300030521 | Ga0307511_10063099 | Ga0307511_100630993 | 168 |
| 183 | 3300031249 | Ga0265339_10002131 | Ga0265339_100021317 | 168 |
| 184 | 3300031507 | Ga0307509_10239085 | Ga0307509_102390852 | 168 |
| 185 | 3300031616 | Ga0307508_10325595 | Ga0307508_103255952 | 168 |
| 186 | 3300031730 | Ga0307516_10481807 | Ga0307516_104818072 | 168 |
| 187 | 3300033179 | Ga0307507_10108194 | Ga0307507_101081942 | 168 |
| 188 | 3300033180 | Ga0307510_10320212 | Ga0307510_103202122 | 168 |
| 189 | 3300035113 | Ga0373936_0045330 | Ga0373936_0045330_1021_1542 | 168 |
| 190 | 3300035691 | Ga0373931_0446653 | Ga0373931_0446653_28_558 | 168 |
| 191 | 3300035695 | Ga0373927_0046752 | Ga0373927_0046752_2057_2608 | 168 |
| 192 | 3300036459 | Ga0372808_015490 | Ga0372808_015490_442_972 | 168 |
| 193 | 3300037068 | Ga0373925_0186996 | Ga0373925_0186996_186_737 | 168 |
| 194 | 3300037466 | Ga0395898_0555431 | Ga0395898_0555431_329_868 | 168 |
| 195 | 3300038443 | Ga0395901_0437061 | Ga0395901_0437061_317_856 | 168 |
| 196 | 3300039450 | Ga0436363_0770554 | Ga0436363_0770554_55_585 | 168 |
| 197 | 3300041452 | Ga0451793_0932724 | Ga0451793_0932724_111_647 | 168 |
| 198 | 3300046452 | Ga0495617_137042 | Ga0495617_137042_89_619 | 168 |
| 199 | 3300046455 | Ga0495603_0306700 | Ga0495603_0306700_177_707 | 168 |
| 200 | 3300046457 | Ga0495590_0249967 | Ga0495590_0249967_112_642 | 168 |
| 201 | 3300046457 | Ga0495590_0313476 | Ga0495590_0313476_49_579 | 168 |
| 202 | 3300046474 | Ga0495605_0208194 | Ga0495605_0208194_197_727 | 168 |
| 203 | 3300046491 | Ga0495584_0122688 | Ga0495584_0122688_646_1176 | 168 |
| 204 | 3300046492 | Ga0495585_0155080 | Ga0495585_0155080_502_1032 | 168 |
| 205 | 3300046507 | Ga0495606_0005431 | Ga0495606_0005431_5998_6522 | 168 |
| 206 | 3300046518 | Ga0495631_0100949 | Ga0495631_0100949_193_723 | 168 |
| 207 | 3300046523 | Ga0495644_0110312 | Ga0495644_0110312_350_880 | 168 |
| 208 | 3300046523 | Ga0495644_0114149 | Ga0495644_0114149_301_843 | 168 |
| 209 | 3300046523 | Ga0495644_0140288 | Ga0495644_0140288_181_711 | 168 |
| 210 | 3300046533 | Ga0495640_0457773 | Ga0495640_0457773_29_580 | 168 |
| 211 | 3300046536 | Ga0495587_0525231 | Ga0495587_0525231_97_630 | 168 |
| 212 | 3300046557 | Ga0495622_0267449 | Ga0495622_0267449_137_667 | 168 |
| 213 | 3300046616 | Ga0495668_0348610 | Ga0495668_0348610_227_757 | 168 |
| 214 | 3300046642 | Ga0495634_0591184 | Ga0495634_0591184_52_603 | 168 |
| 215 | 3300046648 | Ga0495611_0317539 | Ga0495611_0317539_110_640 | 168 |
| 216 | 3300046660 | Ga0495625_0395515 | Ga0495625_0395515_199_729 | 168 |
| 217 | 3300046683 | Ga0495658_0237628 | Ga0495658_0237628_285_836 | 168 |
| 218 | 3300046691 | Ga0495670_0542933 | Ga0495670_0542933_90_620 | 168 |
| 219 | 3300047322 | Ga0495680_0188495 | Ga0495680_0188495_858_1409 | 168 |
| 220 | 3300047322 | Ga0495680_0675205 | Ga0495680_0675205_20_550 | 168 |
| 221 | 3300047447 | Ga0495685_115833 | Ga0495685_115833_26_550 | 168 |
| 222 | 3300047469 | Ga0495673_0178718 | Ga0495673_0178718_10_540 | 168 |
| 223 | 3300047472 | Ga0495686_0266140 | Ga0495686_0266140_167_697 | 168 |
| 224 | 3300048904 | Ga0496101_0248394 | Ga0496101_0248394_196_726 | 168 |
| 225 | 3300048915 | Ga0496112_0000008 | Ga0496112_0000008_278768_279292 | 168 |
| 226 | 3300048929 | Ga0496126_0437753 | Ga0496126_0437753_208_738 | 168 |
| 227 | 3300048929 | Ga0496126_0707662 | Ga0496126_0707662_31_546 | 168 |
| 228 | 3300050511 | nmdc:mga08y16_151181_c1 | nmdc:mga08y16_151181_c1_1464_1994 | 168 |
| 229 | 3300053093 | Ga0500651_0275514 | Ga0500651_0275514_102_653 | 168 |
| 230 | 3300053094 | Ga0500566_0000153 | Ga0500566_0000153_81_614 | 168 |
| 231 | 3300053095 | Ga0500640_007920 | Ga0500640_007920_849_1382 | 168 |
| 232 | 3300053111 | Ga0500572_003966 | Ga0500572_003966_2647_3180 | 168 |
| 233 | 3300053115 | Ga0500591_016088 | Ga0500591_016088_511_1044 | 168 |
| 234 | 3300053119 | Ga0500595_078815 | Ga0500595_078815_124_675 | 168 |
| 235 | 3300053120 | Ga0500597_243328 | Ga0500597_243328_162_713 | 168 |
| 236 | 3300053122 | Ga0500608_075897 | Ga0500608_075897_181_714 | 168 |
| 237 | 3300053136 | Ga0500559_0009672 | Ga0500559_0009672_1090_1623 | 168 |
| 238 | 3300053142 | Ga0500577_0000121 | Ga0500577_0000121_13871_14401 | 168 |
| 239 | 3300053150 | Ga0500603_002170 | Ga0500603_002170_2783_3316 | 168 |
| 240 | 3300053150 | Ga0500603_022909 | Ga0500603_022909_778_1329 | 168 |
| 241 | 3300053153 | Ga0500616_0023186 | Ga0500616_0023186_2313_2831 | 168 |
| 242 | 3300053162 | Ga0500638_048424 | Ga0500638_048424_883_1416 | 168 |
| 243 | 3300053177 | Ga0500636_0026285 | Ga0500636_0026285_169_705 | 168 |
| 244 | 3300053177 | Ga0500636_0083215 | Ga0500636_0083215_704_1255 | 168 |
| 245 | 3300053178 | Ga0500637_0221990 | Ga0500637_0221990_225_758 | 168 |
| 246 | 3300053178 | Ga0500637_0302452 | Ga0500637_0302452_31_582 | 168 |
| 247 | 3300053178 | Ga0500637_0313305 | Ga0500637_0313305_141_677 | 168 |
| 248 | 3300053735 | Ga0500596_002955 | Ga0500596_002955_1833_2366 | 168 |
| 249 | 3300055283 | Ga0500661_059323 | Ga0500661_059323_132_665 | 168 |
| 250 | 3300005329 | Ga0070683_100383800 | Ga0070683_1003838002 | 169 |
| 251 | 3300005336 | Ga0070680_100057871 | Ga0070680_1000578713 | 169 |
| 252 | 3300005338 | Ga0068868_100197195 | Ga0068868_1001971952 | 169 |
| 253 | 3300005355 | Ga0070671_100340295 | Ga0070671_1003402952 | 169 |
| 254 | 3300005436 | Ga0070713_100888636 | Ga0070713_1008886362 | 169 |
| 255 | 3300005439 | Ga0070711_100477546 | Ga0070711_1004775462 | 169 |
| 256 | 3300005441 | Ga0070700_101023494 | Ga0070700_1010234941 | 169 |
| 257 | 3300005455 | Ga0070663_100152007 | Ga0070663_1001520072 | 169 |
| 258 | 3300005458 | Ga0070681_10147281 | Ga0070681_101472812 | 169 |
| 259 | 3300005535 | Ga0070684_100691310 | Ga0070684_1006913102 | 169 |
| 260 | 3300005548 | Ga0070665_100572884 | Ga0070665_1005728842 | 169 |
| 261 | 3300005564 | Ga0070664_100092913 | Ga0070664_1000929132 | 169 |
| 262 | 3300005618 | Ga0068864_100273824 | Ga0068864_1002738242 | 169 |
| 263 | 3300005840 | Ga0068870_10386536 | Ga0068870_103865362 | 169 |
| 264 | 3300005937 | Ga0081455_10352661 | Ga0081455_103526612 | 169 |
| 265 | 3300006237 | Ga0097621_100329091 | Ga0097621_1003290912 | 169 |
| 266 | 3300009093 | Ga0105240_10541275 | Ga0105240_105412752 | 169 |
| 267 | 3300009098 | Ga0105245_10443341 | Ga0105245_104433411 | 169 |
| 268 | 3300009101 | Ga0105247_10185345 | Ga0105247_101853452 | 169 |
| 269 | 3300009551 | Ga0105238_10472932 | Ga0105238_104729322 | 169 |
| 270 | 3300010375 | Ga0105239_10335961 | Ga0105239_103359612 | 169 |
| 271 | 3300011119 | Ga0105246_10289005 | Ga0105246_102890052 | 169 |
| 272 | 3300013296 | Ga0157374_10555674 | Ga0157374_105556742 | 169 |
| 273 | 3300013297 | Ga0157378_10412335 | Ga0157378_104123353 | 169 |
| 274 | 3300013297 | Ga0157378_11049931 | Ga0157378_110499312 | 169 |
| 275 | 3300013306 | Ga0163162_10188063 | Ga0163162_101880632 | 169 |
| 276 | 3300014745 | Ga0157377_10159048 | Ga0157377_101590482 | 169 |
| 277 | 3300014969 | Ga0157376_11038579 | Ga0157376_110385792 | 169 |
| 278 | 3300025908 | Ga0207643_10248204 | Ga0207643_102482042 | 169 |
| 279 | 3300025912 | Ga0207707_10164097 | Ga0207707_101640972 | 169 |
| 280 | 3300025913 | Ga0207695_11011674 | Ga0207695_110116741 | 169 |
| 281 | 3300025916 | Ga0207663_10773625 | Ga0207663_107736252 | 169 |
| 282 | 3300025917 | Ga0207660_10237211 | Ga0207660_102372112 | 169 |
| 283 | 3300025921 | Ga0207652_10032549 | Ga0207652_100325493 | 169 |
| 284 | 3300025938 | Ga0207704_10115511 | Ga0207704_101155112 | 169 |
| 285 | 3300026041 | Ga0207639_10539091 | Ga0207639_105390912 | 169 |
| 286 | 3300026067 | Ga0207678_10206682 | Ga0207678_102066822 | 169 |
| 287 | 3300028379 | Ga0268266_11683244 | Ga0268266_116832441 | 169 |
| 288 | 3300032126 | Ga0307415_101229870 | Ga0307415_1012298701 | 169 |
| 289 | 3300039438 | Ga0436360_0219222 | Ga0436360_0219222_964_1497 | 169 |
| 290 | 3300039447 | Ga0436361_1092805 | Ga0436361_1092805_143_676 | 169 |
| 291 | 3300039450 | Ga0436363_1433138 | Ga0436363_1433138_772_1302 | 169 |
| 292 | 3300044842 | Ga0466957_1047243 | Ga0466957_1047243_22_555 | 169 |
| 293 | 3300045049 | Ga0466959_0220792 | Ga0466959_0220792_65_598 | 169 |
| 294 | 3300046557 | Ga0495622_0246915 | Ga0495622_0246915_43_582 | 169 |
| 295 | 3300046684 | Ga0495669_0061007 | Ga0495669_0061007_303_830 | 169 |
| 296 | 3300048903 | Ga0496100_0086180 | Ga0496100_0086180_665_1192 | 169 |
| 297 | 3300048904 | Ga0496101_0075822 | Ga0496101_0075822_375_902 | 169 |
| 298 | 3300048905 | Ga0496102_0281245 | Ga0496102_0281245_448_975 | 169 |
| 299 | 3300048905 | Ga0496102_0319757 | Ga0496102_0319757_340_879 | 169 |
| 300 | 3300048907 | Ga0496104_0076944 | Ga0496104_0076944_721_1248 | 169 |
| 301 | 3300048907 | Ga0496104_0300870 | Ga0496104_0300870_530_1069 | 169 |
| 302 | 3300048908 | Ga0496105_0043842 | Ga0496105_0043842_2121_2648 | 169 |
| 303 | 3300048909 | Ga0496106_0047038 | Ga0496106_0047038_324_863 | 169 |
| 304 | 3300048909 | Ga0496106_0246173 | Ga0496106_0246173_499_1026 | 169 |
| 305 | 3300048910 | Ga0496107_0094385 | Ga0496107_0094385_613_1140 | 169 |
| 306 | 3300048911 | Ga0496108_0146426 | Ga0496108_0146426_1236_1775 | 169 |
| 307 | 3300048911 | Ga0496108_0282757 | Ga0496108_0282757_271_798 | 169 |
| 308 | 3300048912 | Ga0496109_0011681 | Ga0496109_0011681_6502_7041 | 169 |
| 309 | 3300048912 | Ga0496109_0166779 | Ga0496109_0166779_460_987 | 169 |
| 310 | 3300048913 | Ga0496110_0632340 | Ga0496110_0632340_172_699 | 169 |
| 311 | 3300048914 | Ga0496111_0129328 | Ga0496111_0129328_476_1003 | 169 |
| 312 | 3300048915 | Ga0496112_0246438 | Ga0496112_0246438_756_1283 | 169 |
| 313 | 3300048916 | Ga0496113_1063936 | Ga0496113_1063936_97_624 | 169 |
| 314 | 3300048918 | Ga0496115_0105859 | Ga0496115_0105859_636_1163 | 169 |
| 315 | 3300048918 | Ga0496115_0340566 | Ga0496115_0340566_371_910 | 169 |
| 316 | 3300048924 | Ga0496121_0027414 | Ga0496121_0027414_461_985 | 169 |
| 317 | 3300050516 | nmdc:mga0sz30_41072_c1 | nmdc:mga0sz30_41072_c1_411_941 | 169 |
| 318 | 3300053087 | Ga0500643_051154 | Ga0500643_051154_501_1016 | 169 |
| 319 | 3300053094 | Ga0500566_0060893 | Ga0500566_0060893_1340_1870 | 169 |
| 320 | 3300053119 | Ga0500595_000321 | Ga0500595_000321_15885_16415 | 169 |
| 321 | 3300053162 | Ga0500638_000125 | Ga0500638_000125_704_1234 | 169 |
| 322 | 3300053178 | Ga0500637_0000264 | Ga0500637_0000264_13623_14153 | 169 |
| 323 | 3300055283 | Ga0500661_003016 | Ga0500661_003016_2015_2545 | 169 |
| 324 | 3300003203 | JGI25406J46586_10001807 | JGI25406J46586_100018076 | 170 |
| 325 | 3300003322 | rootL2_10109221 | rootL2_101092212 | 170 |
| 326 | 3300003659 | JGI25404J52841_10006804 | JGI25404J52841_100068042 | 170 |
| 327 | 3300003911 | JGI25405J52794_10008955 | JGI25405J52794_100089552 | 170 |
| 328 | 3300005327 | Ga0070658_10368769 | Ga0070658_103687692 | 170 |
| 329 | 3300005328 | Ga0070676_10291953 | Ga0070676_102919531 | 170 |
| 330 | 3300005329 | Ga0070683_100266630 | Ga0070683_1002666303 | 170 |
| 331 | 3300005330 | Ga0070690_100457252 | Ga0070690_1004572521 | 170 |
| 332 | 3300005336 | Ga0070680_100408720 | Ga0070680_1004087202 | 170 |
| 333 | 3300005339 | Ga0070660_100020298 | Ga0070660_1000202982 | 170 |
| 334 | 3300005344 | Ga0070661_100073144 | Ga0070661_1000731443 | 170 |
| 335 | 3300005344 | Ga0070661_100389421 | Ga0070661_1003894212 | 170 |
| 336 | 3300005356 | Ga0070674_101095979 | Ga0070674_1010959791 | 170 |
| 337 | 3300005366 | Ga0070659_100257443 | Ga0070659_1002574432 | 170 |
| 338 | 3300005367 | Ga0070667_100685174 | Ga0070667_1006851742 | 170 |
| 339 | 3300005435 | Ga0070714_100610696 | Ga0070714_1006106961 | 170 |
| 340 | 3300005435 | Ga0070714_101040822 | Ga0070714_1010408222 | 170 |
| 341 | 3300005439 | Ga0070711_100122929 | Ga0070711_1001229292 | 170 |
| 342 | 3300005445 | Ga0070708_100024183 | Ga0070708_1000241835 | 170 |
| 343 | 3300005456 | Ga0070678_100023118 | Ga0070678_1000231183 | 170 |
| 344 | 3300005458 | Ga0070681_10759283 | Ga0070681_107592832 | 170 |
| 345 | 3300005458 | Ga0070681_10796442 | Ga0070681_107964422 | 170 |
| 346 | 3300005468 | Ga0070707_100059117 | Ga0070707_1000591173 | 170 |
| 347 | 3300005518 | Ga0070699_100344373 | Ga0070699_1003443732 | 170 |
| 348 | 3300005536 | Ga0070697_100099202 | Ga0070697_1000992022 | 170 |
| 349 | 3300005539 | Ga0068853_100116651 | Ga0068853_1001166513 | 170 |
| 350 | 3300005539 | Ga0068853_100405406 | Ga0068853_1004054062 | 170 |
| 351 | 3300005543 | Ga0070672_100191424 | Ga0070672_1001914242 | 170 |
| 352 | 3300005563 | Ga0068855_100362031 | Ga0068855_1003620312 | 170 |
| 353 | 3300005564 | Ga0070664_100756355 | Ga0070664_1007563552 | 170 |
| 354 | 3300005578 | Ga0068854_100483442 | Ga0068854_1004834422 | 170 |
| 355 | 3300005617 | Ga0068859_100494907 | Ga0068859_1004949072 | 170 |
| 356 | 3300005617 | Ga0068859_100585114 | Ga0068859_1005851142 | 170 |
| 357 | 3300005618 | Ga0068864_100344036 | Ga0068864_1003440362 | 170 |
| 358 | 3300005834 | Ga0068851_10144894 | Ga0068851_101448942 | 170 |
| 359 | 3300005842 | Ga0068858_100205400 | Ga0068858_1002054003 | 170 |
| 360 | 3300005842 | Ga0068858_100672324 | Ga0068858_1006723242 | 170 |
| 361 | 3300005843 | Ga0068860_100666207 | Ga0068860_1006662072 | 170 |
| 362 | 3300005937 | Ga0081455_10002315 | Ga0081455_100023158 | 170 |
| 363 | 3300005937 | Ga0081455_10003763 | Ga0081455_100037634 | 170 |
| 364 | 3300005983 | Ga0081540_1014288 | Ga0081540_10142884 | 170 |
| 365 | 3300005983 | Ga0081540_1015322 | Ga0081540_10153224 | 170 |
| 366 | 3300005983 | Ga0081540_1017198 | Ga0081540_10171984 | 170 |
| 367 | 3300005983 | Ga0081540_1031008 | Ga0081540_10310083 | 170 |
| 368 | 3300005983 | Ga0081540_1060524 | Ga0081540_10605241 | 170 |
| 369 | 3300005983 | Ga0081540_1212145 | Ga0081540_12121452 | 170 |
| 370 | 3300005985 | Ga0081539_10016204 | Ga0081539_100162044 | 170 |
| 371 | 3300006038 | Ga0075365_10406909 | Ga0075365_104069092 | 170 |
| 372 | 3300006048 | Ga0075363_100160701 | Ga0075363_1001607012 | 170 |
| 373 | 3300006173 | Ga0070716_100355041 | Ga0070716_1003550412 | 170 |
| 374 | 3300006175 | Ga0070712_100263013 | Ga0070712_1002630131 | 170 |
| 375 | 3300006195 | Ga0075366_10311351 | Ga0075366_103113512 | 170 |
| 376 | 3300006358 | Ga0068871_100159211 | Ga0068871_1001592112 | 170 |
| 377 | 3300006881 | Ga0068865_100051469 | Ga0068865_1000514693 | 170 |
| 378 | 3300006931 | Ga0097620_100494922 | Ga0097620_1004949222 | 170 |
| 379 | 3300006931 | Ga0097620_100585103 | Ga0097620_1005851032 | 170 |
| 380 | 3300007265 | Ga0099794_10024884 | Ga0099794_100248841 | 170 |
| 381 | 3300007265 | Ga0099794_10069744 | Ga0099794_100697443 | 170 |
| 382 | 3300007265 | Ga0099794_10073600 | Ga0099794_100736002 | 170 |
| 383 | 3300007265 | Ga0099794_10080765 | Ga0099794_100807653 | 170 |
| 384 | 3300007788 | Ga0099795_10169340 | Ga0099795_101693401 | 170 |
| 385 | 3300007788 | Ga0099795_10186248 | Ga0099795_101862482 | 170 |
| 386 | 3300007788 | Ga0099795_10201647 | Ga0099795_102016472 | 170 |
| 387 | 3300009093 | Ga0105240_10191760 | Ga0105240_101917603 | 170 |
| 388 | 3300009093 | Ga0105240_10415609 | Ga0105240_104156092 | 170 |
| 389 | 3300009101 | Ga0105247_10021726 | Ga0105247_100217264 | 170 |
| 390 | 3300009101 | Ga0105247_10056534 | Ga0105247_100565345 | 170 |
| 391 | 3300009148 | Ga0105243_10235850 | Ga0105243_102358503 | 170 |
| 392 | 3300009176 | Ga0105242_10112239 | Ga0105242_101122394 | 170 |
| 393 | 3300009545 | Ga0105237_10135809 | Ga0105237_101358092 | 170 |
| 394 | 3300009545 | Ga0105237_10264685 | Ga0105237_102646852 | 170 |
| 395 | 3300009551 | Ga0105238_10507345 | Ga0105238_105073452 | 170 |
| 396 | 3300010159 | Ga0099796_10053153 | Ga0099796_100531532 | 170 |
| 397 | 3300010375 | Ga0105239_10296202 | Ga0105239_102962022 | 170 |
| 398 | 3300013104 | Ga0157370_10326090 | Ga0157370_103260902 | 170 |
| 399 | 3300013105 | Ga0157369_10681669 | Ga0157369_106816691 | 170 |
| 400 | 3300013306 | Ga0163162_10844259 | Ga0163162_108442591 | 170 |
| 401 | 3300013307 | Ga0157372_11515383 | Ga0157372_115153832 | 170 |
| 402 | 3300013308 | Ga0157375_10148202 | Ga0157375_101482022 | 170 |
| 403 | 3300014326 | Ga0157380_10130340 | Ga0157380_101303403 | 170 |
| 404 | 3300014968 | Ga0157379_10077545 | Ga0157379_100775452 | 170 |
| 405 | 3300014968 | Ga0157379_10782536 | Ga0157379_107825362 | 170 |
| 406 | 3300014969 | Ga0157376_10197216 | Ga0157376_101972162 | 170 |
| 407 | 3300025321 | Ga0207656_10050024 | Ga0207656_100500242 | 170 |
| 408 | 3300025900 | Ga0207710_10032279 | Ga0207710_100322792 | 170 |
| 409 | 3300025900 | Ga0207710_10073353 | Ga0207710_100733531 | 170 |
| 410 | 3300025909 | Ga0207705_10346885 | Ga0207705_103468852 | 170 |
| 411 | 3300025912 | Ga0207707_10054640 | Ga0207707_100546403 | 170 |
| 412 | 3300025913 | Ga0207695_10615981 | Ga0207695_106159812 | 170 |
| 413 | 3300025914 | Ga0207671_10325787 | Ga0207671_103257872 | 170 |
| 414 | 3300025914 | Ga0207671_10435166 | Ga0207671_104351662 | 170 |
| 415 | 3300025915 | Ga0207693_10018324 | Ga0207693_100183244 | 170 |
| 416 | 3300025915 | Ga0207693_10090304 | Ga0207693_100903042 | 170 |
| 417 | 3300025917 | Ga0207660_10029269 | Ga0207660_100292693 | 170 |
| 418 | 3300025919 | Ga0207657_10003884 | Ga0207657_1000388412 | 170 |
| 419 | 3300025920 | Ga0207649_10087684 | Ga0207649_100876842 | 170 |
| 420 | 3300025920 | Ga0207649_10943099 | Ga0207649_109430991 | 170 |
| 421 | 3300025921 | Ga0207652_10069342 | Ga0207652_100693424 | 170 |
| 422 | 3300025921 | Ga0207652_10461987 | Ga0207652_104619872 | 170 |
| 423 | 3300025922 | Ga0207646_10060246 | Ga0207646_100602463 | 170 |
| 424 | 3300025924 | Ga0207694_10032236 | Ga0207694_100322362 | 170 |
| 425 | 3300025928 | Ga0207700_10297755 | Ga0207700_102977552 | 170 |
| 426 | 3300025929 | Ga0207664_10293479 | Ga0207664_102934793 | 170 |
| 427 | 3300025932 | Ga0207690_10249888 | Ga0207690_102498882 | 170 |
| 428 | 3300025938 | Ga0207704_10073231 | Ga0207704_100732313 | 170 |
| 429 | 3300025939 | Ga0207665_10191612 | Ga0207665_101916122 | 170 |
| 430 | 3300025939 | Ga0207665_10579014 | Ga0207665_105790141 | 170 |
| 431 | 3300025939 | Ga0207665_10688216 | Ga0207665_106882162 | 170 |
| 432 | 3300025949 | Ga0207667_10617995 | Ga0207667_106179952 | 170 |
| 433 | 3300025981 | Ga0207640_10588737 | Ga0207640_105887372 | 170 |
| 434 | 3300025986 | Ga0207658_10295834 | Ga0207658_102958341 | 170 |
| 435 | 3300026035 | Ga0207703_10357255 | Ga0207703_103572551 | 170 |
| 436 | 3300026041 | Ga0207639_10090411 | Ga0207639_100904112 | 170 |
| 437 | 3300026075 | Ga0207708_10839615 | Ga0207708_108396152 | 170 |
| 438 | 3300026078 | Ga0207702_10152318 | Ga0207702_101523183 | 170 |
| 439 | 3300026078 | Ga0207702_10569058 | Ga0207702_105690582 | 170 |
| 440 | 3300026078 | Ga0207702_11196162 | Ga0207702_111961621 | 170 |
| 441 | 3300026089 | Ga0207648_10415890 | Ga0207648_104158901 | 170 |
| 442 | 3300026116 | Ga0207674_10010401 | Ga0207674_100104012 | 170 |
| 443 | 3300026121 | Ga0207683_10029994 | Ga0207683_100299944 | 170 |
| 444 | 3300026142 | Ga0207698_10605940 | Ga0207698_106059402 | 170 |
| 445 | 3300027512 | Ga0209179_1017557 | Ga0209179_10175571 | 170 |
| 446 | 3300027671 | Ga0209588_1032828 | Ga0209588_10328282 | 170 |
| 447 | 3300027671 | Ga0209588_1103361 | Ga0209588_11033611 | 170 |
| 448 | 3300028379 | Ga0268266_10211015 | Ga0268266_102110152 | 170 |
| 449 | 3300028379 | Ga0268266_10560944 | Ga0268266_105609442 | 170 |
| 450 | 3300028381 | Ga0268264_10516765 | Ga0268264_105167652 | 170 |
| 451 | 3300028556 | Ga0265337_1004498 | Ga0265337_10044982 | 170 |
| 452 | 3300028558 | Ga0265326_10068355 | Ga0265326_100683552 | 170 |
| 453 | 3300028573 | Ga0265334_10151694 | Ga0265334_101516942 | 170 |
| 454 | 3300028653 | Ga0265323_10005809 | Ga0265323_100058095 | 170 |
| 455 | 3300028666 | Ga0265336_10000701 | Ga0265336_100007015 | 170 |
| 456 | 3300028786 | Ga0307517_10000315 | Ga0307517_1000031525 | 170 |
| 457 | 3300028794 | Ga0307515_10044290 | Ga0307515_100442902 | 170 |
| 458 | 3300028800 | Ga0265338_10000207 | Ga0265338_100002075 | 170 |
| 459 | 3300029957 | Ga0265324_10010437 | Ga0265324_100104373 | 170 |
| 460 | 3300031241 | Ga0265325_10251751 | Ga0265325_102517512 | 170 |
| 461 | 3300031249 | Ga0265339_10056328 | Ga0265339_100563282 | 170 |
| 462 | 3300031456 | Ga0307513_10707252 | Ga0307513_107072522 | 170 |
| 463 | 3300031456 | Ga0307513_10779275 | Ga0307513_107792752 | 170 |
| 464 | 3300031616 | Ga0307508_10245703 | Ga0307508_102457032 | 170 |
| 465 | 3300031616 | Ga0307508_10520957 | Ga0307508_105209572 | 170 |
| 466 | 3300031730 | Ga0307516_10468538 | Ga0307516_104685382 | 170 |
| 467 | 3300031731 | Ga0307405_10173423 | Ga0307405_101734232 | 170 |
| 468 | 3300032002 | Ga0307416_101430599 | Ga0307416_1014305992 | 170 |
| 469 | 3300033180 | Ga0307510_10106440 | Ga0307510_101064402 | 170 |
| 470 | 3300033180 | Ga0307510_10282433 | Ga0307510_102824332 | 170 |
| 471 | 3300034820 | Ga0373959_0059673 | Ga0373959_0059673_227_760 | 170 |
| 472 | 3300035111 | Ga0373923_0036398 | Ga0373923_0036398_427_969 | 170 |
| 473 | 3300035112 | Ga0373932_0158852 | Ga0373932_0158852_13_555 | 170 |
| 474 | 3300035118 | Ga0373954_0020726 | Ga0373954_0020726_1857_2399 | 170 |
| 475 | 3300035118 | Ga0373954_0037043 | Ga0373954_0037043_1610_2224 | 170 |
| 476 | 3300035118 | Ga0373954_0185217 | Ga0373954_0185217_328_870 | 170 |
| 477 | 3300035119 | Ga0373956_0043042 | Ga0373956_0043042_428_970 | 170 |
| 478 | 3300035119 | Ga0373956_0075773 | Ga0373956_0075773_731_1345 | 170 |
| 479 | 3300035120 | Ga0373957_0015182 | Ga0373957_0015182_1845_2387 | 170 |
| 480 | 3300035170 | Ga0373943_0057167 | Ga0373943_0057167_144_686 | 170 |
| 481 | 3300035170 | Ga0373943_0070257 | Ga0373943_0070257_615_1229 | 170 |
| 482 | 3300035170 | Ga0373943_0282805 | Ga0373943_0282805_205_747 | 170 |
| 483 | 3300035171 | Ga0373946_0025116 | Ga0373946_0025116_802_1344 | 170 |
| 484 | 3300035172 | Ga0373955_0052678 | Ga0373955_0052678_718_1260 | 170 |
| 485 | 3300035172 | Ga0373955_0493790 | Ga0373955_0493790_12_596 | 170 |
| 486 | 3300035410 | Ga0373924_0009645 | Ga0373924_0009645_936_1478 | 170 |
| 487 | 3300035410 | Ga0373924_0023745 | Ga0373924_0023745_1060_1602 | 170 |
| 488 | 3300035691 | Ga0373931_0006466 | Ga0373931_0006466_1392_1934 | 170 |
| 489 | 3300035691 | Ga0373931_0799926 | Ga0373931_0799926_53_577 | 170 |
| 490 | 3300035692 | Ga0373935_0003292 | Ga0373935_0003292_1819_2433 | 170 |
| 491 | 3300035692 | Ga0373935_0081515 | Ga0373935_0081515_752_1294 | 170 |
| 492 | 3300035692 | Ga0373935_0135059 | Ga0373935_0135059_1010_1552 | 170 |
| 493 | 3300035695 | Ga0373927_0009017 | Ga0373927_0009017_3939_4481 | 170 |
| 494 | 3300035695 | Ga0373927_0021578 | Ga0373927_0021578_1499_2041 | 170 |
| 495 | 3300035695 | Ga0373927_0077805 | Ga0373927_0077805_1503_2045 | 170 |
| 496 | 3300035724 | Ga0373933_0000020 | Ga0373933_0000020_93221_93763 | 170 |
| 497 | 3300035724 | Ga0373933_0043400 | Ga0373933_0043400_549_1091 | 170 |
| 498 | 3300035725 | Ga0373947_0002978 | Ga0373947_0002978_1585_2199 | 170 |
| 499 | 3300035725 | Ga0373947_0044955 | Ga0373947_0044955_1488_2030 | 170 |
| 500 | 3300036401 | Ga0373937_0223275 | Ga0373937_0223275_761_1303 | 170 |
| 501 | 3300037068 | Ga0373925_0017528 | Ga0373925_0017528_1488_2102 | 170 |
| 502 | 3300037068 | Ga0373925_0039385 | Ga0373925_0039385_2110_2652 | 170 |
| 503 | 3300037068 | Ga0373925_0383341 | Ga0373925_0383341_548_1090 | 170 |
| 504 | 3300037068 | Ga0373925_0655911 | Ga0373925_0655911_134_658 | 170 |
| 505 | 3300037418 | Ga0395900_0678959 | Ga0395900_0678959_322_864 | 170 |
| 506 | 3300039437 | Ga0436365_0678448 | Ga0436365_0678448_11_538 | 170 |
| 507 | 3300039438 | Ga0436360_0489238 | Ga0436360_0489238_93_629 | 170 |
| 508 | 3300039438 | Ga0436360_1269431 | Ga0436360_1269431_3386_3958 | 170 |
| 509 | 3300039447 | Ga0436361_0031890 | Ga0436361_0031890_1849_2385 | 170 |
| 510 | 3300039447 | Ga0436361_0433577 | Ga0436361_0433577_449_1021 | 170 |
| 511 | 3300039447 | Ga0436361_0453191 | Ga0436361_0453191_233_808 | 170 |
| 512 | 3300039453 | Ga0436362_0656309 | Ga0436362_0656309_374_946 | 170 |
| 513 | 3300041452 | Ga0451793_0199320 | Ga0451793_0199320_20_562 | 170 |
| 514 | 3300041452 | Ga0451793_1842940 | Ga0451793_1842940_454_993 | 170 |
| 515 | 3300044842 | Ga0466957_0944783 | Ga0466957_0944783_61_591 | 170 |
| 516 | 3300046454 | Ga0495592_0007751 | Ga0495592_0007751_1896_2510 | 170 |
| 517 | 3300046454 | Ga0495592_0026319 | Ga0495592_0026319_2806_3348 | 170 |
| 518 | 3300046455 | Ga0495603_0002560 | Ga0495603_0002560_3076_3690 | 170 |
| 519 | 3300046455 | Ga0495603_0031707 | Ga0495603_0031707_1268_1810 | 170 |
| 520 | 3300046455 | Ga0495603_0058714 | Ga0495603_0058714_1486_2028 | 170 |
| 521 | 3300046455 | Ga0495603_0410336 | Ga0495603_0410336_16_558 | 170 |
| 522 | 3300046459 | Ga0495629_0000466 | Ga0495629_0000466_20200_20814 | 170 |
| 523 | 3300046459 | Ga0495629_0069952 | Ga0495629_0069952_718_1260 | 170 |
| 524 | 3300046460 | Ga0495638_0114634 | Ga0495638_0114634_1037_1588 | 170 |
| 525 | 3300046461 | Ga0495641_0004267 | Ga0495641_0004267_9356_9970 | 170 |
| 526 | 3300046461 | Ga0495641_0299467 | Ga0495641_0299467_18_560 | 170 |
| 527 | 3300046463 | Ga0495653_0064356 | Ga0495653_0064356_1933_2475 | 170 |
| 528 | 3300046463 | Ga0495653_0505556 | Ga0495653_0505556_53_595 | 170 |
| 529 | 3300046472 | Ga0495580_0003213 | Ga0495580_0003213_9739_10353 | 170 |
| 530 | 3300046473 | Ga0495582_0005205 | Ga0495582_0005205_1567_2181 | 170 |
| 531 | 3300046475 | Ga0495639_0004249 | Ga0495639_0004249_1456_2070 | 170 |
| 532 | 3300046475 | Ga0495639_0412299 | Ga0495639_0412299_56_598 | 170 |
| 533 | 3300046475 | Ga0495639_0413845 | Ga0495639_0413845_57_581 | 170 |
| 534 | 3300046476 | Ga0495662_0000863 | Ga0495662_0000863_9514_10128 | 170 |
| 535 | 3300046477 | Ga0495664_0003491 | Ga0495664_0003491_3869_4483 | 170 |
| 536 | 3300046477 | Ga0495664_0060800 | Ga0495664_0060800_1597_2139 | 170 |
| 537 | 3300046492 | Ga0495585_0089891 | Ga0495585_0089891_250_789 | 170 |
| 538 | 3300046499 | Ga0495594_0001496 | Ga0495594_0001496_10177_10791 | 170 |
| 539 | 3300046507 | Ga0495606_0317717 | Ga0495606_0317717_55_600 | 170 |
| 540 | 3300046511 | Ga0495608_0017296 | Ga0495608_0017296_3890_4432 | 170 |
| 541 | 3300046511 | Ga0495608_0096090 | Ga0495608_0096090_802_1416 | 170 |
| 542 | 3300046514 | Ga0495618_0051675 | Ga0495618_0051675_219_761 | 170 |
| 543 | 3300046516 | Ga0495628_0037940 | Ga0495628_0037940_2288_2830 | 170 |
| 544 | 3300046529 | Ga0495652_0032128 | Ga0495652_0032128_1990_2532 | 170 |
| 545 | 3300046529 | Ga0495652_0570552 | Ga0495652_0570552_135_677 | 170 |
| 546 | 3300046531 | Ga0495665_0003348 | Ga0495665_0003348_6367_6981 | 170 |
| 547 | 3300046531 | Ga0495665_0241446 | Ga0495665_0241446_339_881 | 170 |
| 548 | 3300046533 | Ga0495640_0009300 | Ga0495640_0009300_297_911 | 170 |
| 549 | 3300046533 | Ga0495640_0046057 | Ga0495640_0046057_220_762 | 170 |
| 550 | 3300046533 | Ga0495640_0315396 | Ga0495640_0315396_261_803 | 170 |
| 551 | 3300046535 | Ga0495586_0043265 | Ga0495586_0043265_878_1420 | 170 |
| 552 | 3300046543 | Ga0495645_0006879 | Ga0495645_0006879_4008_4550 | 170 |
| 553 | 3300046557 | Ga0495622_0002009 | Ga0495622_0002009_3460_4074 | 170 |
| 554 | 3300046559 | Ga0495667_0048853 | Ga0495667_0048853_471_1013 | 170 |
| 555 | 3300046559 | Ga0495667_0101418 | Ga0495667_0101418_467_1081 | 170 |
| 556 | 3300046559 | Ga0495667_0119440 | Ga0495667_0119440_513_1055 | 170 |
| 557 | 3300046615 | Ga0495656_0064344 | Ga0495656_0064344_487_1026 | 170 |
| 558 | 3300046616 | Ga0495668_0405527 | Ga0495668_0405527_144_689 | 170 |
| 559 | 3300046642 | Ga0495634_0006673 | Ga0495634_0006673_6332_6946 | 170 |
| 560 | 3300046642 | Ga0495634_0039716 | Ga0495634_0039716_351_893 | 170 |
| 561 | 3300046663 | Ga0495635_0003606 | Ga0495635_0003606_7206_7820 | 170 |
| 562 | 3300046663 | Ga0495635_0081266 | Ga0495635_0081266_1006_1548 | 170 |
| 563 | 3300046674 | Ga0495588_0168280 | Ga0495588_0168280_413_952 | 170 |
| 564 | 3300046675 | Ga0495657_0048496 | Ga0495657_0048496_1668_2210 | 170 |
| 565 | 3300046675 | Ga0495657_0161401 | Ga0495657_0161401_376_990 | 170 |
| 566 | 3300046678 | Ga0495599_0016796 | Ga0495599_0016796_2175_2717 | 170 |
| 567 | 3300046678 | Ga0495599_0054003 | Ga0495599_0054003_964_1578 | 170 |
| 568 | 3300046679 | Ga0495623_0088937 | Ga0495623_0088937_983_1525 | 170 |
| 569 | 3300046680 | Ga0495646_0018039 | Ga0495646_0018039_591_1133 | 170 |
| 570 | 3300046680 | Ga0495646_0044240 | Ga0495646_0044240_441_1055 | 170 |
| 571 | 3300046681 | Ga0495647_0000907 | Ga0495647_0000907_3665_4279 | 170 |
| 572 | 3300046683 | Ga0495658_0054738 | Ga0495658_0054738_1120_1734 | 170 |
| 573 | 3300046683 | Ga0495658_0201760 | Ga0495658_0201760_476_1018 | 170 |
| 574 | 3300046683 | Ga0495658_0662183 | Ga0495658_0662183_73_615 | 170 |
| 575 | 3300046684 | Ga0495669_0188962 | Ga0495669_0188962_166_705 | 170 |
| 576 | 3300046689 | Ga0495613_0016321 | Ga0495613_0016321_120_734 | 170 |
| 577 | 3300046689 | Ga0495613_0042165 | Ga0495613_0042165_1158_1700 | 170 |
| 578 | 3300046690 | Ga0495624_0011061 | Ga0495624_0011061_1407_2021 | 170 |
| 579 | 3300046691 | Ga0495670_0427405 | Ga0495670_0427405_50_589 | 170 |
| 580 | 3300046794 | Ga0495589_0399429 | Ga0495589_0399429_36_578 | 170 |
| 581 | 3300046809 | Ga0495600_0016731 | Ga0495600_0016731_3088_3630 | 170 |
| 582 | 3300047317 | Ga0495604_0033676 | Ga0495604_0033676_1773_2315 | 170 |
| 583 | 3300047319 | Ga0495674_0044597 | Ga0495674_0044597_1109_1651 | 170 |
| 584 | 3300047319 | Ga0495674_0458341 | Ga0495674_0458341_204_746 | 170 |
| 585 | 3300047320 | Ga0495672_0023455 | Ga0495672_0023455_789_1340 | 170 |
| 586 | 3300047321 | Ga0495676_0027465 | Ga0495676_0027465_4009_4623 | 170 |
| 587 | 3300047322 | Ga0495680_0021899 | Ga0495680_0021899_1755_2297 | 170 |
| 588 | 3300047444 | Ga0495675_0059117 | Ga0495675_0059117_235_777 | 170 |
| 589 | 3300047469 | Ga0495673_0018684 | Ga0495673_0018684_1900_2457 | 170 |
| 590 | 3300047471 | Ga0495684_0033784 | Ga0495684_0033784_2425_3039 | 170 |
| 591 | 3300047471 | Ga0495684_0102492 | Ga0495684_0102492_1234_1776 | 170 |
| 592 | 3300047673 | Ga0495593_0000621 | Ga0495593_0000621_7343_7957 | 170 |
| 593 | 3300047673 | Ga0495593_0111065 | Ga0495593_0111065_759_1301 | 170 |
| 594 | 3300048088 | Ga0495602_0052398 | Ga0495602_0052398_2003_2545 | 170 |
| 595 | 3300048903 | Ga0496100_0101098 | Ga0496100_0101098_745_1287 | 170 |
| 596 | 3300048903 | Ga0496100_0159052 | Ga0496100_0159052_848_1390 | 170 |
| 597 | 3300048905 | Ga0496102_0339425 | Ga0496102_0339425_126_668 | 170 |
| 598 | 3300048905 | Ga0496102_0909584 | Ga0496102_0909584_156_698 | 170 |
| 599 | 3300048905 | Ga0496102_1123320 | Ga0496102_1123320_99_641 | 170 |
| 600 | 3300048906 | Ga0496103_0119376 | Ga0496103_0119376_98_640 | 170 |
| 601 | 3300048907 | Ga0496104_0038665 | Ga0496104_0038665_3400_3942 | 170 |
| 602 | 3300048907 | Ga0496104_0770192 | Ga0496104_0770192_56_598 | 170 |
| 603 | 3300048908 | Ga0496105_0346829 | Ga0496105_0346829_461_1003 | 170 |
| 604 | 3300048909 | Ga0496106_0102587 | Ga0496106_0102587_1205_1747 | 170 |
| 605 | 3300048910 | Ga0496107_0035789 | Ga0496107_0035789_982_1503 | 170 |
| 606 | 3300048910 | Ga0496107_0249764 | Ga0496107_0249764_417_959 | 170 |
| 607 | 3300048910 | Ga0496107_0377630 | Ga0496107_0377630_378_920 | 170 |
| 608 | 3300048911 | Ga0496108_0300594 | Ga0496108_0300594_346_888 | 170 |
| 609 | 3300048912 | Ga0496109_0507086 | Ga0496109_0507086_377_919 | 170 |
| 610 | 3300048913 | Ga0496110_0380973 | Ga0496110_0380973_508_1050 | 170 |
| 611 | 3300048913 | Ga0496110_0712911 | Ga0496110_0712911_101_643 | 170 |
| 612 | 3300048914 | Ga0496111_0227189 | Ga0496111_0227189_308_832 | 170 |
| 613 | 3300048915 | Ga0496112_0007690 | Ga0496112_0007690_4869_5411 | 170 |
| 614 | 3300048915 | Ga0496112_0143844 | Ga0496112_0143844_1255_1797 | 170 |
| 615 | 3300048915 | Ga0496112_0171249 | Ga0496112_0171249_37_579 | 170 |
| 616 | 3300048916 | Ga0496113_0883047 | Ga0496113_0883047_28_570 | 170 |
| 617 | 3300048917 | Ga0496114_0212855 | Ga0496114_0212855_464_1006 | 170 |
| 618 | 3300048917 | Ga0496114_0262686 | Ga0496114_0262686_291_845 | 170 |
| 619 | 3300048918 | Ga0496115_0094912 | Ga0496115_0094912_1755_2297 | 170 |
| 620 | 3300048918 | Ga0496115_0286475 | Ga0496115_0286475_33_575 | 170 |
| 621 | 3300048919 | Ga0496116_0202340 | Ga0496116_0202340_40_582 | 170 |
| 622 | 3300048920 | Ga0496117_0188632 | Ga0496117_0188632_143_685 | 170 |
| 623 | 3300048921 | Ga0496118_0121942 | Ga0496118_0121942_853_1395 | 170 |
| 624 | 3300048922 | Ga0496119_0111484 | Ga0496119_0111484_59_601 | 170 |
| 625 | 3300048924 | Ga0496121_0000774 | Ga0496121_0000774_17239_17781 | 170 |
| 626 | 3300048924 | Ga0496121_0002381 | Ga0496121_0002381_20904_21446 | 170 |
| 627 | 3300048924 | Ga0496121_0002382 | Ga0496121_0002382_23062_23583 | 170 |
| 628 | 3300048924 | Ga0496121_0751645 | Ga0496121_0751645_11_541 | 170 |
| 629 | 3300048929 | Ga0496126_0006620 | Ga0496126_0006620_4785_5306 | 170 |
| 630 | 3300048929 | Ga0496126_0101879 | Ga0496126_0101879_369_911 | 170 |
| 631 | 3300048929 | Ga0496126_0151614 | Ga0496126_0151614_227_769 | 170 |
| 632 | 3300049568 | Ga0501031_0001938 | Ga0501031_0001938_1274_1828 | 170 |
| 633 | 3300049569 | Ga0501032_0004101 | Ga0501032_0004101_8799_9353 | 170 |
| 634 | 3300049570 | Ga0501033_0000951 | Ga0501033_0000951_2160_2714 | 170 |
| 635 | 3300049571 | Ga0501034_0171980 | Ga0501034_0171980_1039_1593 | 170 |
| 636 | 3300049572 | Ga0501036_0017775 | Ga0501036_0017775_1676_2230 | 170 |
| 637 | 3300049573 | Ga0501037_0002392 | Ga0501037_0002392_6658_7212 | 170 |
| 638 | 3300049574 | Ga0501038_0002970 | Ga0501038_0002970_2861_3415 | 170 |
| 639 | 3300049575 | Ga0501039_0055409 | Ga0501039_0055409_39_593 | 170 |
| 640 | 3300049578 | Ga0501042_0150433 | Ga0501042_0150433_154_708 | 170 |
| 641 | 3300049579 | Ga0501043_0000959 | Ga0501043_0000959_12873_13427 | 170 |
| 642 | 3300049584 | Ga0501068_0132025 | Ga0501068_0132025_324_878 | 170 |
| 643 | 3300049587 | Ga0501071_0515936 | Ga0501071_0515936_168_722 | 170 |
| 644 | 3300049741 | Ga0501079_0699027 | Ga0501079_0699027_134_688 | 170 |
| 645 | 3300049742 | Ga0501080_0105981 | Ga0501080_0105981_1557_2111 | 170 |
| 646 | 3300049822 | Ga0501035_0016159 | Ga0501035_0016159_3632_4186 | 170 |
| 647 | 3300049822 | Ga0501035_0734703 | Ga0501035_0734703_184_717 | 170 |
| 648 | 3300049823 | Ga0501044_0131480 | Ga0501044_0131480_30_584 | 170 |
| 649 | 3300050492 | nmdc:mga0yw44_377368_c1 | nmdc:mga0yw44_377368_c1_67_609 | 170 |
| 650 | 3300053077 | Ga0495601_0109327 | Ga0495601_0109327_439_981 | 170 |
| 651 | 3300053077 | Ga0495601_0137052 | Ga0495601_0137052_580_1122 | 170 |
| 652 | 3300053077 | Ga0495601_0168844 | Ga0495601_0168844_254_796 | 170 |
| 653 | 3300053077 | Ga0495601_0288435 | Ga0495601_0288435_280_894 | 170 |
| 654 | 3300053078 | Ga0495612_0019291 | Ga0495612_0019291_977_1519 | 170 |
| 655 | 3300053080 | Ga0500635_0001465 | Ga0500635_0001465_1651_2193 | 170 |
| 656 | 3300053084 | Ga0495595_0006425 | Ga0495595_0006425_2784_3326 | 170 |
| 657 | 3300053085 | Ga0495619_0201267 | Ga0495619_0201267_306_920 | 170 |
| 658 | 3300053085 | Ga0495619_0565158 | Ga0495619_0565158_124_663 | 170 |
| 659 | 3300053091 | Ga0500647_0168317 | Ga0500647_0168317_424_957 | 170 |
| 660 | 3300053092 | Ga0500583_0490957 | Ga0500583_0490957_15_557 | 170 |
| 661 | 3300053102 | Ga0500554_000472 | Ga0500554_000472_1285_1827 | 170 |
| 662 | 3300053119 | Ga0500595_009962 | Ga0500595_009962_3030_3572 | 170 |
| 663 | 3300053130 | Ga0500642_0293108 | Ga0500642_0293108_156_698 | 170 |
| 664 | 3300053150 | Ga0500603_000152 | Ga0500603_000152_6142_6684 | 170 |
| 665 | 3300053155 | Ga0500620_046688 | Ga0500620_046688_506_1048 | 170 |
| 666 | 3300053161 | Ga0500634_0107321 | Ga0500634_0107321_595_1122 | 170 |
| 667 | 3300053178 | Ga0500637_0133318 | Ga0500637_0133318_317_859 | 170 |
| 668 | iso_pu_bacteria | 2513237141 | 2513893848 | 170 |
| 669 | 3300005439 | Ga0070711_100141421 | Ga0070711_1001414213 | 171 |
| 670 | 3300005458 | Ga0070681_10006786 | Ga0070681_100067863 | 171 |
| 671 | 3300005563 | Ga0068855_100360971 | Ga0068855_1003609713 | 171 |
| 672 | 3300005843 | Ga0068860_100004618 | Ga0068860_1000046185 | 171 |
| 673 | 3300006871 | Ga0075434_100803792 | Ga0075434_1008037922 | 171 |
| 674 | 3300009545 | Ga0105237_10027598 | Ga0105237_100275985 | 171 |
| 675 | 3300009551 | Ga0105238_10013191 | Ga0105238_100131913 | 171 |
| 676 | 3300009551 | Ga0105238_10707661 | Ga0105238_107076612 | 171 |
| 677 | 3300010375 | Ga0105239_10023344 | Ga0105239_100233447 | 171 |
| 678 | 3300013102 | Ga0157371_10148352 | Ga0157371_101483523 | 171 |
| 679 | 3300013296 | Ga0157374_10131445 | Ga0157374_101314453 | 171 |
| 680 | 3300025295 | Ga0209564_1000468 | Ga0209564_100046848 | 171 |
| 681 | 3300025912 | Ga0207707_10077728 | Ga0207707_100777284 | 171 |
| 682 | 3300025914 | Ga0207671_10108412 | Ga0207671_101084122 | 171 |
| 683 | 3300025914 | Ga0207671_10499420 | Ga0207671_104994202 | 171 |
| 684 | 3300025944 | Ga0207661_11506968 | Ga0207661_115069681 | 171 |
| 685 | 3300026041 | Ga0207639_10188444 | Ga0207639_101884442 | 171 |
| 686 | 3300028379 | Ga0268266_10221116 | Ga0268266_102211162 | 171 |
| 687 | 3300028381 | Ga0268264_10001711 | Ga0268264_1000171112 | 171 |
| 688 | 3300031730 | Ga0307516_10213157 | Ga0307516_102131572 | 171 |
| 689 | 3300031838 | Ga0307518_10345779 | Ga0307518_103457791 | 171 |
| 690 | 3300039437 | Ga0436365_1606465 | Ga0436365_1606465_461_991 | 171 |
| 691 | 3300041486 | Ga0451807_0693661 | Ga0451807_0693661_91_636 | 171 |
| 692 | 3300041509 | Ga0451843_0275340 | Ga0451843_0275340_19_567 | 171 |
| 693 | 3300046501 | Ga0495607_0355768 | Ga0495607_0355768_36_578 | 171 |
| 694 | 3300046524 | Ga0495648_0014905 | Ga0495648_0014905_4168_4743 | 171 |
| 695 | 3300046660 | Ga0495625_0138161 | Ga0495625_0138161_125_676 | 171 |
| 696 | 3300046681 | Ga0495647_0170632 | Ga0495647_0170632_53_595 | 171 |
| 697 | 3300048923 | Ga0496120_0197665 | Ga0496120_0197665_394_927 | 171 |
| 698 | 3300048924 | Ga0496121_0197642 | Ga0496121_0197642_370_918 | 171 |
| 699 | 3300048925 | Ga0496122_0146220 | Ga0496122_0146220_553_1086 | 171 |
| 700 | 3300048926 | Ga0496123_0054544 | Ga0496123_0054544_1569_2102 | 171 |
| 701 | 3300048927 | Ga0496124_0053613 | Ga0496124_0053613_2591_3124 | 171 |
| 702 | 3300048928 | Ga0496125_0303996 | Ga0496125_0303996_110_658 | 171 |
| 703 | 3300048929 | Ga0496126_0214149 | Ga0496126_0214149_742_1275 | 171 |
| 704 | 3300048929 | Ga0496126_0722284 | Ga0496126_0722284_62_610 | 171 |
| 705 | 3300049568 | Ga0501031_0006046 | Ga0501031_0006046_4700_5245 | 171 |
| 706 | 3300049569 | Ga0501032_0000244 | Ga0501032_0000244_8013_8558 | 171 |
| 707 | 3300049569 | Ga0501032_0164724 | Ga0501032_0164724_163_693 | 171 |
| 708 | 3300049570 | Ga0501033_0001501 | Ga0501033_0001501_12654_13199 | 171 |
| 709 | 3300049572 | Ga0501036_0007992 | Ga0501036_0007992_243_788 | 171 |
| 710 | 3300049573 | Ga0501037_0000139 | Ga0501037_0000139_59723_60268 | 171 |
| 711 | 3300049574 | Ga0501038_0000404 | Ga0501038_0000404_7730_8275 | 171 |
| 712 | 3300049575 | Ga0501039_0000323 | Ga0501039_0000323_26826_27371 | 171 |
| 713 | 3300049578 | Ga0501042_0393897 | Ga0501042_0393897_73_618 | 171 |
| 714 | 3300049579 | Ga0501043_0000021 | Ga0501043_0000021_153249_153794 | 171 |
| 715 | 3300049580 | Ga0501046_0004069 | Ga0501046_0004069_5411_5956 | 171 |
| 716 | 3300049580 | Ga0501046_0089880 | Ga0501046_0089880_1744_2274 | 171 |
| 717 | 3300049581 | Ga0501047_0046547 | Ga0501047_0046547_69_599 | 171 |
| 718 | 3300049582 | Ga0501048_0014297 | Ga0501048_0014297_604_1149 | 171 |
| 719 | 3300049583 | Ga0501067_0023708 | Ga0501067_0023708_217_762 | 171 |
| 720 | 3300049584 | Ga0501068_0006769 | Ga0501068_0006769_1743_2288 | 171 |
| 721 | 3300049585 | Ga0501069_0027611 | Ga0501069_0027611_32_577 | 171 |
| 722 | 3300049586 | Ga0501070_0003487 | Ga0501070_0003487_1953_2498 | 171 |
| 723 | 3300049586 | Ga0501070_0182566 | Ga0501070_0182566_100_630 | 171 |
| 724 | 3300049587 | Ga0501071_0313106 | Ga0501071_0313106_448_993 | 171 |
| 725 | 3300049588 | Ga0501072_0002290 | Ga0501072_0002290_7290_7835 | 171 |
| 726 | 3300049589 | Ga0501073_0000726 | Ga0501073_0000726_11955_12500 | 171 |
| 727 | 3300049589 | Ga0501073_0052853 | Ga0501073_0052853_1485_2015 | 171 |
| 728 | 3300049590 | Ga0501074_0002972 | Ga0501074_0002972_6307_6852 | 171 |
| 729 | 3300049590 | Ga0501074_0452410 | Ga0501074_0452410_240_770 | 171 |
| 730 | 3300049741 | Ga0501079_0013190 | Ga0501079_0013190_2746_3291 | 171 |
| 731 | 3300049742 | Ga0501080_0011392 | Ga0501080_0011392_6403_6933 | 171 |
| 732 | 3300049744 | Ga0501083_0126905 | Ga0501083_0126905_1040_1585 | 171 |
| 733 | 3300049822 | Ga0501035_0000090 | Ga0501035_0000090_105518_106063 | 171 |
| 734 | 3300049823 | Ga0501044_0009643 | Ga0501044_0009643_3299_3829 | 171 |
| 735 | 3300050512 | nmdc:mga0n895_759733_c1 | nmdc:mga0n895_759733_c1_381_908 | 171 |
| 736 | 3300053163 | Ga0500639_101620 | Ga0500639_101620_430_978 | 171 |
| 737 | 3300053177 | Ga0500636_0066235 | Ga0500636_0066235_746_1294 | 171 |
| 738 | 3300053177 | Ga0500636_0139133 | Ga0500636_0139133_75_623 | 171 |
| 739 | 3300053728 | Ga0500657_080710 | Ga0500657_080710_274_822 | 171 |
| 740 | 3300053735 | Ga0500596_038798 | Ga0500596_038798_176_724 | 171 |
| 741 | 3300054114 | Ga0501084_0034233 | Ga0501084_0034233_1995_2540 | 171 |
| 742 | 3300035695 | Ga0373927_0832224 | Ga0373927_0832224_34_567 | 172 |
| 743 | 3300047472 | Ga0495686_0280007 | Ga0495686_0280007_230_778 | 172 |
| 744 | 3300039450 | Ga0436363_1613900 | Ga0436363_1613900_485_1024 | 173 |
| 745 | 3300001979 | JGI24740J21852_10015408 | JGI24740J21852_100154082 | 175 |
| 746 | 3300001990 | JGI24737J22298_10009425 | JGI24737J22298_100094253 | 175 |
| 747 | 3300005455 | Ga0070663_100364737 | Ga0070663_1003647372 | 175 |
| 748 | 3300005539 | Ga0068853_100010165 | Ga0068853_1000101656 | 175 |
| 749 | 3300005563 | Ga0068855_100013119 | Ga0068855_1000131197 | 175 |
| 750 | 3300005563 | Ga0068855_100577460 | Ga0068855_1005774603 | 175 |
| 751 | 3300005577 | Ga0068857_100002370 | Ga0068857_1000023705 | 175 |
| 752 | 3300005578 | Ga0068854_100028344 | Ga0068854_1000283445 | 175 |
| 753 | 3300005578 | Ga0068854_100036291 | Ga0068854_1000362911 | 175 |
| 754 | 3300005614 | Ga0068856_100036605 | Ga0068856_1000366053 | 175 |
| 755 | 3300005616 | Ga0068852_101174225 | Ga0068852_1011742251 | 175 |
| 756 | 3300009093 | Ga0105240_10014285 | Ga0105240_100142855 | 175 |
| 757 | 3300009093 | Ga0105240_10020795 | Ga0105240_100207958 | 175 |
| 758 | 3300009174 | Ga0105241_10004158 | Ga0105241_100041588 | 175 |
| 759 | 3300009545 | Ga0105237_10164830 | Ga0105237_101648302 | 175 |
| 760 | 3300009551 | Ga0105238_10002076 | Ga0105238_1000207616 | 175 |
| 761 | 3300009551 | Ga0105238_10019168 | Ga0105238_100191685 | 175 |
| 762 | 3300010375 | Ga0105239_10010188 | Ga0105239_100101888 | 175 |
| 763 | 3300010375 | Ga0105239_10328771 | Ga0105239_103287713 | 175 |
| 764 | 3300025904 | Ga0207647_10000586 | Ga0207647_1000058611 | 175 |
| 765 | 3300025911 | Ga0207654_10001537 | Ga0207654_100015377 | 175 |
| 766 | 3300025913 | Ga0207695_10001321 | Ga0207695_100013218 | 175 |
| 767 | 3300025914 | Ga0207671_10154249 | Ga0207671_101542492 | 175 |
| 768 | 3300025924 | Ga0207694_10000135 | Ga0207694_1000013534 | 175 |
| 769 | 3300025932 | Ga0207690_10368005 | Ga0207690_103680052 | 175 |
| 770 | 3300025949 | Ga0207667_10011574 | Ga0207667_100115745 | 175 |
| 771 | 3300025949 | Ga0207667_10039549 | Ga0207667_100395492 | 175 |
| 772 | 3300025981 | Ga0207640_10011594 | Ga0207640_100115942 | 175 |
| 773 | 3300025981 | Ga0207640_10256926 | Ga0207640_102569262 | 175 |
| 774 | 3300026041 | Ga0207639_11294189 | Ga0207639_112941892 | 175 |
| 775 | 3300026067 | Ga0207678_10033115 | Ga0207678_100331155 | 175 |
| 776 | 3300026078 | Ga0207702_10000026 | Ga0207702_10000026138 | 175 |
| 777 | 3300026078 | Ga0207702_10025557 | Ga0207702_100255572 | 175 |
| 778 | 3300026116 | Ga0207674_10050495 | Ga0207674_100504953 | 175 |
| 779 | 3300026142 | Ga0207698_10603567 | Ga0207698_106035673 | 175 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3l8f-assembly1.cif.gz_A | crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from e. coli complexed with magnesium and phosphate | 0.9163 | 9 | 171 |
| 2o2x-assembly1.cif.gz_A | crystal structure of a putative had-like phosphatase (mll2559) from mesorhizobium loti at 1.50 a resolution | 0.8899 | 1 | 174 |
| 3l8h-assembly4.cif.gz_D | crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from b. bronchiseptica complexed with magnesium and phosphate | 0.8831 | 11 | 175 |
| 2o2x-assembly1.cif.gz_A | crystal structure of a putative had-like phosphatase (mll2559) from mesorhizobium loti at 1.50 a resolution | 0.8805 | 1 | 174 |
| 2fpu-assembly1.cif.gz_A | crystal structure of the n-terminal domain of e.coli hisb- complex with histidinol | 0.8669 | 9 | 159 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WMV3_2_164_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8861 | 9 | 162 | 3.40.50.1000 |
| 2fpuA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8669 | 9 | 159 | 3.40.50.1000 |
| 2o2xA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8627 | 1 | 174 | 3.40.50.1000 |
| 3l8gA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8587 | 9 | 175 | 3.40.50.1000 |
| 3l8hD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.856 | 12 | 175 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A515KN55-F1-model_v4 | D,D-heptose 1,7-bisphosphate phosphatase (EC 3.1.3.-) | 0.9998 | 8 | 175 |
GO:0005737
GO:0005975 GO:0016791 GO:0046872 |
| AF-A0A090N6S3-F1-model_v4 | D,D-heptose 1,7-bisphosphate phosphatase | 0.9958 | 37 | 175 |
GO:0005737
GO:0005975 GO:0016791 GO:0046872 |
| AF-A0A1I4PES2-F1-model_v4 | D,D-heptose 1,7-bisphosphate phosphatase (EC 3.1.3.-) | 0.9944 | 9 | 175 |
GO:0005737
GO:0005975 GO:0016791 GO:0046872 |
| AF-A0A366FT82-F1-model_v4 | D,D-heptose 1,7-bisphosphate phosphatase | 0.9938 | 9 | 167 |
GO:0005737
GO:0005975 GO:0009058 GO:0016791 |
| AF-A0A554UAN5-F1-model_v4 | deleted | 0.993 | 13 | 175 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar