F480462

General Info

Members Datasets Scaffolds Average Seq Length
779 394 770 179

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10024884|Ga0099794_100248841
Length 206
Sequence LSHESNDPIGTHSGIDSARSTPKPAAFLDRDGVINHDDGYMGTHHRIRWMPNAAKAIRRLNEAGYFVFLFTNQSGVARGFFTEDDLGALHDWMRTELTTQGAVIDDIRYCPHHPAGSVAGYLEDHHWRKPSPGMILDLMQHWPVRHEGSFVIGDRPTDIEAAEAAGLPGFLFAGGDLDAFVADVVMQTRASQPTALPTPPPQRGKE

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
3 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
4 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
5 2643221651 Afipia sp. Root123D2 Isolate Unclassified
6 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
7 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
8 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
161 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
162 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
163 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
164 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
165 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
169 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
170 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
171 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
174 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
175 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
182 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
183 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
184 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
186 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
188 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
189 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
207 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
210 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
211 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
212 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
222 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
230 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
231 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
232 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
233 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
234 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
235 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
236 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
237 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
238 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
241 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
242 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
243 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
244 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
245 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
246 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
247 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
248 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
249 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
250 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
251 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
252 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
253 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
254 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
255 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
256 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
257 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
258 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
259 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
260 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
261 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
262 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
263 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
264 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
267 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
268 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
269 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
270 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
271 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
275 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
276 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
277 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
278 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
279 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
280 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
281 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
282 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
283 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
284 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
285 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
286 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
287 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
293 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
294 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
295 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
296 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
297 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
298 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
299 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
300 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
301 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
302 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
303 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
304 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
305 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
306 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
307 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
308 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
309 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
310 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
311 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
312 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
313 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
314 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
328 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
329 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
330 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
331 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
332 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
333 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
334 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
335 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
336 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
337 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
338 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
340 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
341 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
342 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
343 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
344 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
345 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
346 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
347 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
348 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
349 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
350 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
351 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
352 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
353 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
354 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
355 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
356 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
357 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
358 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
359 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
360 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
361 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
362 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
363 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
364 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
365 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
366 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
367 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
368 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
369 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
370 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
371 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
372 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
373 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
374 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
375 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
376 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
377 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
378 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
379 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
380 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
381 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
382 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
383 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
384 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
385 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
386 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
387 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
388 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
389 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
390 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
391 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
392 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
393 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
394 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 0.13
Isolates 1.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.91
Nodule 0.51
Rhizoplane 7.06
Rhizosphere 71.89
Stem 0
Stem Tuber 0
Unclassified 9.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10015408 3300001979 Bacteria 2792
2 JGI24737J22298_10009425 3300001990 Bacteria 3248
3 JGI25406J46586_10000014 3300003203 Bacteria 93855
4 JGI25406J46586_10001807 3300003203 Bacteria 10044
5 rootL2_10109221 3300003322 Bacteria 1037
6 JGI25404J52841_10006804 3300003659 Bacteria 2400
7 JGI25405J52794_10008955 3300003911 Bacteria 1881
8 Ga0070658_10200182 3300005327 Bacteria 1685
9 Ga0070658_10368769 3300005327 Bacteria 1231
10 Ga0070676_10291953 3300005328 Bacteria 1102
11 Ga0070683_100266630 3300005329 Bacteria 1629
12 Ga0070683_100383800 3300005329 Bacteria 1339
13 Ga0070690_100457252 3300005330 Bacteria 948
14 Ga0068869_101241321 3300005334 Bacteria 656
15 Ga0070680_100057871 3300005336 Bacteria 3170
16 Ga0070680_100090984 3300005336 Bacteria 2526
17 Ga0070680_100408720 3300005336 Bacteria 1157
18 Ga0070680_100752286 3300005336 Bacteria 839
19 Ga0068868_100197195 3300005338 Bacteria 1677
20 Ga0070660_100020298 3300005339 Bacteria 4881
21 Ga0070661_100073144 3300005344 Bacteria 2523
22 Ga0070661_100389421 3300005344 Bacteria 1100
23 Ga0070668_100875625 3300005347 Bacteria 801
24 Ga0070671_100340295 3300005355 Bacteria 1280
25 Ga0070674_100252219 3300005356 Bacteria 1386
26 Ga0070674_101095979 3300005356 Bacteria 703
27 Ga0070659_100257443 3300005366 Bacteria 1448
28 Ga0070659_100495453 3300005366 Bacteria 1041
29 Ga0070667_100685174 3300005367 Bacteria 948
30 Ga0070667_101129865 3300005367 Bacteria 733
31 Ga0070709_10043109 3300005434 Bacteria 2789
32 Ga0070709_10174059 3300005434 Bacteria 1506
33 Ga0070714_100545111 3300005435 Bacteria 1110
34 Ga0070714_100610696 3300005435 Bacteria 1048
35 Ga0070714_101040822 3300005435 Bacteria 797
36 Ga0070713_100027160 3300005436 Bacteria 4503
37 Ga0070713_100888636 3300005436 Bacteria 857
38 Ga0070710_10004247 3300005437 Bacteria 6791
39 Ga0070711_100074878 3300005439 Bacteria 2395
40 Ga0070711_100122929 3300005439 Bacteria 1922
41 Ga0070711_100140551 3300005439 Bacteria 1810
42 Ga0070711_100141421 3300005439 Bacteria 1805
43 Ga0070711_100177188 3300005439 Bacteria 1629
44 Ga0070711_100477546 3300005439 Bacteria 1024
45 Ga0070700_101023494 3300005441 Bacteria 680
46 Ga0070708_100024183 3300005445 Bacteria 5176
47 Ga0070663_100152007 3300005455 Bacteria 1776
48 Ga0070663_100364737 3300005455 Bacteria 1173
49 Ga0070678_100023118 3300005456 Bacteria 4136
50 Ga0070681_10006786 3300005458 Bacteria 11141
51 Ga0070681_10029384 3300005458 Bacteria 5520
52 Ga0070681_10032454 3300005458 Bacteria 5241
53 Ga0070681_10147281 3300005458 Bacteria 2283
54 Ga0070681_10759283 3300005458 Bacteria 886
55 Ga0070681_10796442 3300005458 Bacteria 862
56 Ga0068867_100169379 3300005459 Bacteria 1729
57 Ga0070706_100958057 3300005467 Bacteria 790
58 Ga0070707_100059117 3300005468 Bacteria 3677
59 Ga0070698_100165606 3300005471 Bacteria 2154
60 Ga0070698_100897763 3300005471 Bacteria 832
61 Ga0070699_100344373 3300005518 Bacteria 1342
62 Ga0070679_100822211 3300005530 Bacteria 872
63 Ga0070679_101074049 3300005530 Bacteria 749
64 Ga0070684_100691310 3300005535 Bacteria 951
65 Ga0070697_100099202 3300005536 Bacteria 2418
66 Ga0068853_100010165 3300005539 Bacteria 7603
67 Ga0068853_100116651 3300005539 Bacteria 2377
68 Ga0068853_100405406 3300005539 Bacteria 1277
69 Ga0068853_100435914 3300005539 Bacteria 1231
70 Ga0068853_101263809 3300005539 Bacteria 713
71 Ga0070672_100191424 3300005543 Bacteria 1708
72 Ga0070665_100259573 3300005548 Bacteria 1739
73 Ga0070665_100504618 3300005548 Bacteria 1221
74 Ga0070665_100572884 3300005548 Bacteria 1142
75 Ga0068855_100013119 3300005563 Bacteria 9993
76 Ga0068855_100257410 3300005563 Bacteria 1945
77 Ga0068855_100360971 3300005563 Bacteria 1598
78 Ga0068855_100362031 3300005563 Bacteria 1596
79 Ga0068855_100577460 3300005563 Bacteria 1214
80 Ga0070664_100092913 3300005564 Bacteria 2613
81 Ga0070664_100756355 3300005564 Bacteria 907
82 Ga0068857_100002370 3300005577 Bacteria 15359
83 Ga0068857_100540558 3300005577 Bacteria 1097
84 Ga0068857_100678751 3300005577 Bacteria 978
85 Ga0068854_100028344 3300005578 Bacteria 3868
86 Ga0068854_100036291 3300005578 Bacteria 3455
87 Ga0068854_100483442 3300005578 Bacteria 1040
88 Ga0068856_100036605 3300005614 Bacteria 4811
89 Ga0068852_101174225 3300005616 Bacteria 788
90 Ga0068859_100494907 3300005617 Bacteria 1318
91 Ga0068859_100585114 3300005617 Bacteria 1210
92 Ga0068864_100273824 3300005618 Bacteria 1574
93 Ga0068864_100344036 3300005618 Bacteria 1406
94 Ga0068866_10220657 3300005718 Bacteria 1144
95 Ga0068861_100167359 3300005719 Bacteria 1819
96 Ga0068851_10144894 3300005834 Bacteria 1294
97 Ga0068870_10386536 3300005840 Bacteria 907
98 Ga0068858_100205400 3300005842 Bacteria 1864
99 Ga0068858_100672324 3300005842 Bacteria 1007
100 Ga0068860_100004618 3300005843 Bacteria 14062
101 Ga0068860_100666207 3300005843 Bacteria 1049
102 Ga0068862_100730675 3300005844 Bacteria 961
103 Ga0081455_10002315 3300005937 Bacteria 22718
104 Ga0081455_10003763 3300005937 Bacteria 17325
105 Ga0081455_10352661 3300005937 Bacteria 1037
106 Ga0081540_1014288 3300005983 Bacteria 5097
107 Ga0081540_1014350 3300005983 Bacteria 5078
108 Ga0081540_1015322 3300005983 Bacteria 4858
109 Ga0081540_1017198 3300005983 Bacteria 4485
110 Ga0081540_1031008 3300005983 Bacteria 2949
111 Ga0081540_1038336 3300005983 Bacteria 2527
112 Ga0081540_1060524 3300005983 Bacteria 1811
113 Ga0081540_1212145 3300005983 Bacteria 695
114 Ga0081539_10000008 3300005985 Bacteria 525071
115 Ga0081539_10016204 3300005985 Bacteria 5344
116 Ga0070717_10043944 3300006028 Bacteria 3648
117 Ga0070717_10386243 3300006028 Bacteria 1256
118 Ga0070717_10738688 3300006028 Bacteria 895
119 Ga0075365_10160284 3300006038 Bacteria 1567
120 Ga0075365_10177483 3300006038 Bacteria 1488
121 Ga0075365_10406909 3300006038 Bacteria 960
122 Ga0075363_100160701 3300006048 Bacteria 1272
123 Ga0075364_10383598 3300006051 Bacteria 958
124 Ga0070715_10144201 3300006163 Bacteria 1160
125 Ga0070716_100355041 3300006173 Bacteria 1039
126 Ga0070712_100263013 3300006175 Bacteria 1383
127 Ga0070712_100378652 3300006175 Bacteria 1164
128 Ga0070712_100599220 3300006175 Bacteria 932
129 Ga0075367_10070814 3300006178 Bacteria 2097
130 Ga0075366_10311351 3300006195 Bacteria 964
131 Ga0097621_100329091 3300006237 Bacteria 1355
132 Ga0068871_100159211 3300006358 Bacteria 1930
133 Ga0075434_100803792 3300006871 Bacteria 957
134 Ga0068865_100051469 3300006881 Bacteria 2851
135 Ga0097620_100494922 3300006931 Bacteria 1318
136 Ga0097620_100585103 3300006931 Bacteria 1210
137 Ga0099794_10024884 3300007265 Bacteria 2752
138 Ga0099794_10069744 3300007265 Bacteria 1720
139 Ga0099794_10073600 3300007265 Bacteria 1677
140 Ga0099794_10080765 3300007265 Bacteria 1603
141 Ga0099795_10052596 3300007788 Bacteria 1488
142 Ga0099795_10169340 3300007788 Bacteria 906
143 Ga0099795_10186248 3300007788 Bacteria 869
144 Ga0099795_10201647 3300007788 Bacteria 839
145 Ga0105240_10014285 3300009093 Bacteria 10844
146 Ga0105240_10020795 3300009093 Bacteria 8741
147 Ga0105240_10033625 3300009093 Bacteria 6621
148 Ga0105240_10191760 3300009093 Bacteria 2403
149 Ga0105240_10415609 3300009093 Bacteria 1512
150 Ga0105240_10541275 3300009093 Bacteria 1289
151 Ga0111539_10102681 3300009094 Bacteria 3356
152 Ga0105245_10443341 3300009098 Bacteria 1305
153 Ga0105245_10492386 3300009098 Bacteria 1241
154 Ga0105245_10545874 3300009098 Bacteria 1181
155 Ga0105247_10021726 3300009101 Bacteria 3861
156 Ga0105247_10056534 3300009101 Bacteria 2423
157 Ga0105247_10185345 3300009101 Bacteria 1391
158 Ga0105243_10158878 3300009148 Bacteria 1947
159 Ga0105243_10235850 3300009148 Bacteria 1625
160 Ga0105241_10004158 3300009174 Bacteria 10689
161 Ga0105242_10112239 3300009176 Bacteria 2326
162 Ga0105248_10096619 3300009177 Bacteria 3328
163 Ga0105237_10027598 3300009545 Bacteria 5792
164 Ga0105237_10135809 3300009545 Bacteria 2454
165 Ga0105237_10164830 3300009545 Bacteria 2215
166 Ga0105237_10264685 3300009545 Bacteria 1722
167 Ga0105237_10327752 3300009545 Bacteria 1535
168 Ga0105238_10002076 3300009551 Bacteria 20251
169 Ga0105238_10013191 3300009551 Bacteria 8340
170 Ga0105238_10019168 3300009551 Bacteria 6969
171 Ga0105238_10472932 3300009551 Bacteria 1252
172 Ga0105238_10507345 3300009551 Bacteria 1208
173 Ga0105238_10558455 3300009551 Bacteria 1150
174 Ga0105238_10707661 3300009551 Bacteria 1019
175 Ga0099796_10053153 3300010159 Bacteria 1412
176 Ga0105239_10010188 3300010375 Bacteria 10530
177 Ga0105239_10023344 3300010375 Bacteria 6812
178 Ga0105239_10296202 3300010375 Bacteria 1822
179 Ga0105239_10328771 3300010375 Bacteria 1724
180 Ga0105239_10335961 3300010375 Bacteria 1705
181 Ga0105239_11131709 3300010375 Bacteria 901
182 Ga0105246_10289005 3300011119 Bacteria 1318
183 Ga0157371_10148352 3300013102 Bacteria 1672
184 Ga0157370_10021137 3300013104 Bacteria 6489
185 Ga0157370_10326090 3300013104 Bacteria 1416
186 Ga0157369_10681669 3300013105 Bacteria 1059
187 Ga0157374_10131445 3300013296 Bacteria 2423
188 Ga0157374_10555674 3300013296 Bacteria 1156
189 Ga0157378_10008253 3300013297 Bacteria 9081
190 Ga0157378_10412335 3300013297 Bacteria 1333
191 Ga0157378_11049931 3300013297 Bacteria 850
192 Ga0163162_10188063 3300013306 Bacteria 2192
193 Ga0163162_10844259 3300013306 Bacteria 1031
194 Ga0163162_10924559 3300013306 Bacteria 984
195 Ga0157372_11515383 3300013307 Bacteria 772
196 Ga0157375_10148202 3300013308 Bacteria 2479
197 Ga0157375_11491018 3300013308 Bacteria 798
198 Ga0157380_10130340 3300014326 Bacteria 2144
199 Ga0157380_10521753 3300014326 Bacteria 1159
200 Ga0157377_10159048 3300014745 Bacteria 1403
201 Ga0157379_10077545 3300014968 Bacteria 2975
202 Ga0157379_10782536 3300014968 Bacteria 900
203 Ga0157376_10197216 3300014969 Bacteria 1850
204 Ga0157376_11038579 3300014969 Bacteria 843
205 Ga0163161_11295032 3300017792 Bacteria 633
206 Ga0209564_1000468 3300025295 Bacteria 67696
207 Ga0209758_1006960 3300025297 Bacteria 7882
208 Ga0207656_10050024 3300025321 Bacteria 1804
209 Ga0207692_10023057 3300025898 Bacteria 2874
210 Ga0207692_10402236 3300025898 Bacteria 854
211 Ga0207710_10032279 3300025900 Bacteria 2293
212 Ga0207710_10073353 3300025900 Bacteria 1574
213 Ga0207647_10000586 3300025904 Bacteria 28285
214 Ga0207685_10253640 3300025905 Bacteria 852
215 Ga0207699_10360891 3300025906 Bacteria 1027
216 Ga0207643_10248204 3300025908 Bacteria 1096
217 Ga0207705_10344440 3300025909 Bacteria 1147
218 Ga0207705_10346885 3300025909 Bacteria 1143
219 Ga0207654_10001537 3300025911 Bacteria 12141
220 Ga0207707_10054640 3300025912 Bacteria 3476
221 Ga0207707_10077728 3300025912 Bacteria 2897
222 Ga0207707_10126135 3300025912 Bacteria 2238
223 Ga0207707_10164097 3300025912 Bacteria 1942
224 Ga0207707_10232317 3300025912 Bacteria 1604
225 Ga0207695_10001321 3300025913 Bacteria 42037
226 Ga0207695_10615981 3300025913 Bacteria 967
227 Ga0207695_11011674 3300025913 Bacteria 711
228 Ga0207671_10108412 3300025914 Bacteria 2111
229 Ga0207671_10154249 3300025914 Bacteria 1776
230 Ga0207671_10325787 3300025914 Bacteria 1216
231 Ga0207671_10435166 3300025914 Bacteria 1044
232 Ga0207671_10499420 3300025914 Bacteria 970
233 Ga0207671_10592267 3300025914 Bacteria 884
234 Ga0207693_10018324 3300025915 Bacteria 5578
235 Ga0207693_10090304 3300025915 Bacteria 2401
236 Ga0207663_10346697 3300025916 Bacteria 1123
237 Ga0207663_10426678 3300025916 Bacteria 1019
238 Ga0207663_10773625 3300025916 Bacteria 763
239 Ga0207660_10029269 3300025917 Bacteria 3775
240 Ga0207660_10237211 3300025917 Bacteria 1436
241 Ga0207660_10378056 3300025917 Bacteria 1138
242 Ga0207657_10003884 3300025919 Bacteria 15854
243 Ga0207649_10087684 3300025920 Bacteria 2031
244 Ga0207649_10943099 3300025920 Bacteria 678
245 Ga0207652_10032549 3300025921 Bacteria 4385
246 Ga0207652_10069342 3300025921 Bacteria 3061
247 Ga0207652_10461987 3300025921 Bacteria 1144
248 Ga0207646_10060246 3300025922 Bacteria 3390
249 Ga0207694_10000135 3300025924 Bacteria 75715
250 Ga0207694_10032236 3300025924 Bacteria 4009
251 Ga0207687_10738855 3300025927 Bacteria 837
252 Ga0207700_10006639 3300025928 Bacteria 7013
253 Ga0207700_10208295 3300025928 Bacteria 1651
254 Ga0207700_10297755 3300025928 Bacteria 1392
255 Ga0207664_10270999 3300025929 Bacteria 1487
256 Ga0207664_10293479 3300025929 Bacteria 1429
257 Ga0207664_10551585 3300025929 Bacteria 1034
258 Ga0207664_10779213 3300025929 Bacteria 860
259 Ga0207690_10249888 3300025932 Bacteria 1369
260 Ga0207690_10368005 3300025932 Bacteria 1140
261 Ga0207709_10638910 3300025935 Bacteria 846
262 Ga0207669_10174358 3300025937 Bacteria 1534
263 Ga0207704_10073231 3300025938 Bacteria 2181
264 Ga0207704_10115511 3300025938 Bacteria 1824
265 Ga0207665_10135423 3300025939 Bacteria 1752
266 Ga0207665_10191612 3300025939 Bacteria 1486
267 Ga0207665_10579014 3300025939 Bacteria 875
268 Ga0207665_10688216 3300025939 Bacteria 803
269 Ga0207661_11506968 3300025944 Bacteria 616
270 Ga0207667_10011574 3300025949 Bacteria 10243
271 Ga0207667_10039549 3300025949 Bacteria 5026
272 Ga0207667_10208124 3300025949 Bacteria 2005
273 Ga0207667_10617995 3300025949 Bacteria 1091
274 Ga0207640_10011594 3300025981 Bacteria 4995
275 Ga0207640_10256926 3300025981 Bacteria 1359
276 Ga0207640_10588737 3300025981 Bacteria 940
277 Ga0207658_10295834 3300025986 Bacteria 1393
278 Ga0207658_11131862 3300025986 Bacteria 715
279 Ga0207703_10357255 3300026035 Bacteria 1346
280 Ga0207703_10574425 3300026035 Bacteria 1065
281 Ga0207639_10090411 3300026041 Bacteria 2448
282 Ga0207639_10188444 3300026041 Bacteria 1760
283 Ga0207639_10539091 3300026041 Bacteria 1070
284 Ga0207639_11294189 3300026041 Bacteria 684
285 Ga0207678_10033115 3300026067 Bacteria 4503
286 Ga0207678_10090606 3300026067 Bacteria 2613
287 Ga0207678_10206682 3300026067 Bacteria 1679
288 Ga0207678_10482957 3300026067 Bacteria 1079
289 Ga0207708_10839615 3300026075 Bacteria 793
290 Ga0207702_10000026 3300026078 Bacteria 186067
291 Ga0207702_10025557 3300026078 Bacteria 4902
292 Ga0207702_10152318 3300026078 Bacteria 2104
293 Ga0207702_10215943 3300026078 Bacteria 1785
294 Ga0207702_10569058 3300026078 Bacteria 1110
295 Ga0207702_11196162 3300026078 Bacteria 754
296 Ga0207648_10415890 3300026089 Bacteria 1220
297 Ga0207674_10010401 3300026116 Bacteria 10541
298 Ga0207674_10050495 3300026116 Bacteria 4248
299 Ga0207674_10748389 3300026116 Bacteria 943
300 Ga0207675_100081038 3300026118 Bacteria 3043
301 Ga0207683_10029994 3300026121 Bacteria 4711
302 Ga0207698_10603567 3300026142 Bacteria 1082
303 Ga0207698_10605940 3300026142 Bacteria 1080
304 Ga0209179_1017557 3300027512 Bacteria 1357
305 Ga0209588_1032828 3300027671 Bacteria 1664
306 Ga0209588_1103361 3300027671 Bacteria 916
307 Ga0207428_10119177 3300027907 Bacteria 2025
308 Ga0268266_10211015 3300028379 Bacteria 1781
309 Ga0268266_10221116 3300028379 Bacteria 1741
310 Ga0268266_10483770 3300028379 Bacteria 1180
311 Ga0268266_10560944 3300028379 Bacteria 1095
312 Ga0268266_11683244 3300028379 Bacteria 610
313 Ga0268265_10775534 3300028380 Bacteria 932
314 Ga0268264_10001711 3300028381 Bacteria 20230
315 Ga0268264_10516765 3300028381 Bacteria 1167
316 Ga0265337_1004498 3300028556 Bacteria 5770
317 Ga0265326_10068355 3300028558 Bacteria 1004
318 Ga0265334_10151694 3300028573 Bacteria 817
319 Ga0265323_10005809 3300028653 Bacteria 5220
320 Ga0265336_10000701 3300028666 Bacteria 17786
321 Ga0307517_10000315 3300028786 Bacteria 84020
322 Ga0307515_10044290 3300028794 Bacteria 6879
323 Ga0265338_10000207 3300028800 Bacteria 110193
324 Ga0265324_10010437 3300029957 Bacteria 3580
325 Ga0307511_10063099 3300030521 Bacteria 2803
326 Ga0265325_10251751 3300031241 Bacteria 800
327 Ga0265339_10002131 3300031249 Bacteria 14425
328 Ga0265339_10056328 3300031249 Bacteria 2129
329 Ga0307513_10707252 3300031456 Bacteria 713
330 Ga0307513_10779275 3300031456 Bacteria 662
331 Ga0307509_10239085 3300031507 Bacteria 1610
332 Ga0307508_10245703 3300031616 Bacteria 1386
333 Ga0307508_10298787 3300031616 Bacteria 1203
334 Ga0307508_10325595 3300031616 Bacteria 1128
335 Ga0307508_10520957 3300031616 Bacteria 785
336 Ga0307516_10011958 3300031730 Bacteria 9386
337 Ga0307516_10134449 3300031730 Bacteria 2249
338 Ga0307516_10213157 3300031730 Bacteria 1644
339 Ga0307516_10468538 3300031730 Bacteria 915
340 Ga0307516_10481807 3300031730 Bacteria 895
341 Ga0307405_10173423 3300031731 Bacteria 1541
342 Ga0307518_10345779 3300031838 Bacteria 870
343 Ga0307412_10112683 3300031911 Bacteria 1945
344 Ga0307416_101430599 3300032002 Bacteria 797
345 Ga0307415_101229870 3300032126 Bacteria 707
346 Ga0307507_10108194 3300033179 Bacteria 2287
347 Ga0307510_10055327 3300033180 Bacteria 4145
348 Ga0307510_10106440 3300033180 Bacteria 2568
349 Ga0307510_10282433 3300033180 Bacteria 1130
350 Ga0307510_10320212 3300033180 Bacteria 1008
351 Ga0373959_0059673 3300034820 Bacteria 842
352 Ga0373923_0036398 3300035111 Bacteria 2009
353 Ga0373932_0158852 3300035112 Bacteria 781
354 Ga0373936_0045330 3300035113 Bacteria 1771
355 Ga0373954_0020726 3300035118 Bacteria 2975
356 Ga0373954_0037043 3300035118 Bacteria 2266
357 Ga0373954_0185217 3300035118 Bacteria 1021
358 Ga0373956_0043042 3300035119 Bacteria 2009
359 Ga0373956_0075773 3300035119 Bacteria 1539
360 Ga0373957_0015182 3300035120 Bacteria 2647
361 Ga0373943_0057167 3300035170 Bacteria 1938
362 Ga0373943_0070257 3300035170 Bacteria 1772
363 Ga0373943_0282805 3300035170 Bacteria 938
364 Ga0373946_0025116 3300035171 Bacteria 2342
365 Ga0373955_0052678 3300035172 Bacteria 2220
366 Ga0373955_0493790 3300035172 Bacteria 747
367 Ga0373924_0009645 3300035410 Bacteria 3545
368 Ga0373924_0023745 3300035410 Bacteria 2410
369 Ga0373931_0006466 3300035691 Bacteria 5478
370 Ga0373931_0446653 3300035691 Bacteria 826
371 Ga0373931_0799926 3300035691 Bacteria 628
372 Ga0373935_0003292 3300035692 Bacteria 9345
373 Ga0373935_0081515 3300035692 Bacteria 2104
374 Ga0373935_0135059 3300035692 Bacteria 1661
375 Ga0373927_0009017 3300035695 Bacteria 6698
376 Ga0373927_0021578 3300035695 Bacteria 4220
377 Ga0373927_0046752 3300035695 Bacteria 2799
378 Ga0373927_0077805 3300035695 Bacteria 2149
379 Ga0373927_0832224 3300035695 Bacteria 609
380 Ga0373933_0000020 3300035724 Bacteria 97124
381 Ga0373933_0043400 3300035724 Bacteria 2660
382 Ga0373947_0002978 3300035725 Bacteria 10104
383 Ga0373947_0044955 3300035725 Bacteria 2642
384 Ga0373937_0223275 3300036401 Bacteria 1773
385 Ga0372808_015490 3300036459 Bacteria 1090
386 Ga0373925_0017528 3300037068 Bacteria 5192
387 Ga0373925_0039385 3300037068 Bacteria 3497
388 Ga0373925_0186996 3300037068 Bacteria 1642
389 Ga0373925_0383341 3300037068 Bacteria 1145
390 Ga0373925_0655911 3300037068 Bacteria 865
391 Ga0395900_0678959 3300037418 Bacteria 965
392 Ga0395898_0555431 3300037466 Bacteria 1090
393 Ga0395901_0437061 3300038443 Bacteria 1340
394 Ga0436365_0678448 3300039437 Bacteria 816
395 Ga0436365_1606465 3300039437 Bacteria 1613
396 Ga0436360_0219222 3300039438 Bacteria 2392
397 Ga0436360_0489238 3300039438 Bacteria 701
398 Ga0436360_1269431 3300039438 Bacteria 4155
399 Ga0436361_0031890 3300039447 Bacteria 5404
400 Ga0436361_0433577 3300039447 Bacteria 1059
401 Ga0436361_0453191 3300039447 Bacteria 1427
402 Ga0436361_1092805 3300039447 Bacteria 688
403 Ga0436363_0770554 3300039450 Bacteria 958
404 Ga0436363_1433138 3300039450 Bacteria 1335
405 Ga0436363_1613900 3300039450 Bacteria 1297
406 Ga0436362_0656309 3300039453 Bacteria 3434
407 Ga0451793_0199320 3300041452 Bacteria 816
408 Ga0451793_0932724 3300041452 Bacteria 781
409 Ga0451793_1842940 3300041452 Bacteria 1003
410 Ga0451807_0693661 3300041486 Bacteria 663
411 Ga0451843_0275340 3300041509 Bacteria 612
412 Ga0466957_0944783 3300044842 Bacteria 617
413 Ga0466957_1047243 3300044842 Bacteria 587
414 Ga0466959_0220792 3300045049 Bacteria 1314
415 Ga0466967_0249043 3300045976 Bacteria 1697
416 Ga0495617_137042 3300046452 Bacteria 783
417 Ga0495592_0007751 3300046454 Bacteria 8045
418 Ga0495592_0026319 3300046454 Bacteria 4411
419 Ga0495603_0002560 3300046455 Bacteria 10719
420 Ga0495603_0031707 3300046455 Bacteria 3182
421 Ga0495603_0058714 3300046455 Bacteria 2274
422 Ga0495603_0306700 3300046455 Bacteria 912
423 Ga0495603_0410336 3300046455 Bacteria 776
424 Ga0495590_0249967 3300046457 Bacteria 660
425 Ga0495590_0313476 3300046457 Bacteria 592
426 Ga0495629_0000466 3300046459 Bacteria 33891
427 Ga0495629_0069952 3300046459 Bacteria 2449
428 Ga0495638_0050843 3300046460 Bacteria 2587
429 Ga0495638_0114634 3300046460 Bacteria 1598
430 Ga0495638_0209871 3300046460 Bacteria 1094
431 Ga0495641_0004267 3300046461 Bacteria 10208
432 Ga0495641_0299467 3300046461 Bacteria 725
433 Ga0495653_0064356 3300046463 Bacteria 2763
434 Ga0495653_0505556 3300046463 Bacteria 753
435 Ga0495580_0003213 3300046472 Bacteria 13987
436 Ga0495582_0005205 3300046473 Bacteria 7280
437 Ga0495605_0208194 3300046474 Bacteria 850
438 Ga0495639_0004249 3300046475 Bacteria 6148
439 Ga0495639_0412299 3300046475 Bacteria 683
440 Ga0495639_0413845 3300046475 Bacteria 682
441 Ga0495662_0000863 3300046476 Bacteria 14796
442 Ga0495664_0003491 3300046477 Bacteria 8561
443 Ga0495664_0060800 3300046477 Bacteria 2249
444 Ga0495584_0122688 3300046491 Bacteria 1316
445 Ga0495585_0089891 3300046492 Bacteria 1655
446 Ga0495585_0155080 3300046492 Bacteria 1192
447 Ga0495594_0001496 3300046499 Bacteria 12118
448 Ga0495607_0355768 3300046501 Bacteria 675
449 Ga0495583_0022492 3300046506 Bacteria 3215
450 Ga0495606_0005431 3300046507 Bacteria 12209
451 Ga0495606_0317717 3300046507 Bacteria 838
452 Ga0495608_0017296 3300046511 Bacteria 4988
453 Ga0495608_0096090 3300046511 Bacteria 1914
454 Ga0495610_0049434 3300046512 Bacteria 2059
455 Ga0495618_0051675 3300046514 Bacteria 2597
456 Ga0495628_0037940 3300046516 Bacteria 3860
457 Ga0495631_0100949 3300046518 Bacteria 1242
458 Ga0495632_0299573 3300046519 Bacteria 713
459 Ga0495644_0110312 3300046523 Bacteria 1044
460 Ga0495644_0114149 3300046523 Bacteria 1026
461 Ga0495644_0140288 3300046523 Bacteria 923
462 Ga0495648_0006468 3300046524 Bacteria 9559
463 Ga0495648_0014905 3300046524 Bacteria 5663
464 Ga0495652_0032128 3300046529 Bacteria 4591
465 Ga0495652_0570552 3300046529 Bacteria 775
466 Ga0495665_0003348 3300046531 Bacteria 8690
467 Ga0495665_0241446 3300046531 Bacteria 931
468 Ga0495640_0009300 3300046533 Bacteria 7656
469 Ga0495640_0046057 3300046533 Bacteria 3024
470 Ga0495640_0315396 3300046533 Bacteria 969
471 Ga0495640_0457773 3300046533 Bacteria 779
472 Ga0495586_0043265 3300046535 Bacteria 2426
473 Ga0495587_0525231 3300046536 Bacteria 654
474 Ga0495645_0006879 3300046543 Bacteria 7905
475 Ga0495622_0002009 3300046557 Bacteria 9951
476 Ga0495622_0246915 3300046557 Bacteria 786
477 Ga0495622_0267449 3300046557 Bacteria 750
478 Ga0495667_0048853 3300046559 Bacteria 2793
479 Ga0495667_0101418 3300046559 Bacteria 1862
480 Ga0495667_0119440 3300046559 Bacteria 1702
481 Ga0495656_0064344 3300046615 Bacteria 1610
482 Ga0495656_0272161 3300046615 Bacteria 861
483 Ga0495668_0348610 3300046616 Bacteria 813
484 Ga0495668_0405527 3300046616 Bacteria 749
485 Ga0495634_0006673 3300046642 Bacteria 8749
486 Ga0495634_0039716 3300046642 Bacteria 3203
487 Ga0495634_0591184 3300046642 Bacteria 645
488 Ga0495611_0317539 3300046648 Bacteria 717
489 Ga0495625_0084673 3300046660 Bacteria 2202
490 Ga0495625_0138161 3300046660 Bacteria 1646
491 Ga0495625_0395515 3300046660 Bacteria 864
492 Ga0495635_0003606 3300046663 Bacteria 10723
493 Ga0495635_0081266 3300046663 Bacteria 2217
494 Ga0495661_0313609 3300046665 Bacteria 781
495 Ga0495588_0168280 3300046674 Bacteria 1159
496 Ga0495657_0048496 3300046675 Bacteria 2864
497 Ga0495657_0161401 3300046675 Bacteria 1387
498 Ga0495599_0016796 3300046678 Bacteria 4546
499 Ga0495599_0054003 3300046678 Bacteria 2517
500 Ga0495623_0088937 3300046679 Bacteria 1900
501 Ga0495646_0018039 3300046680 Bacteria 4469
502 Ga0495646_0044240 3300046680 Bacteria 2723
503 Ga0495647_0000907 3300046681 Bacteria 8886
504 Ga0495647_0170632 3300046681 Bacteria 942
505 Ga0495658_0054738 3300046683 Bacteria 2271
506 Ga0495658_0201760 3300046683 Bacteria 1240
507 Ga0495658_0237628 3300046683 Bacteria 1144
508 Ga0495658_0662183 3300046683 Bacteria 669
509 Ga0495669_0061007 3300046684 Bacteria 1706
510 Ga0495669_0188962 3300046684 Bacteria 983
511 Ga0495613_0016321 3300046689 Bacteria 5534
512 Ga0495613_0042165 3300046689 Bacteria 3378
513 Ga0495624_0011061 3300046690 Bacteria 6211
514 Ga0495670_0003592 3300046691 Bacteria 7613
515 Ga0495670_0427405 3300046691 Bacteria 717
516 Ga0495670_0542933 3300046691 Bacteria 632
517 Ga0495671_0259480 3300046692 Bacteria 838
518 Ga0495589_0240831 3300046794 Bacteria 847
519 Ga0495589_0399429 3300046794 Bacteria 631
520 Ga0495600_0016731 3300046809 Bacteria 4660
521 Ga0495604_0033676 3300047317 Bacteria 4054
522 Ga0495674_0044597 3300047319 Bacteria 3941
523 Ga0495674_0458341 3300047319 Bacteria 1024
524 Ga0495672_0023455 3300047320 Bacteria 3993
525 Ga0495672_0165631 3300047320 Bacteria 1132
526 Ga0495672_0255739 3300047320 Bacteria 848
527 Ga0495676_0027465 3300047321 Bacteria 4878
528 Ga0495680_0021899 3300047322 Bacteria 5340
529 Ga0495680_0188495 3300047322 Bacteria 1485
530 Ga0495680_0675205 3300047322 Bacteria 684
531 Ga0495675_0059117 3300047444 Bacteria 2430
532 Ga0495685_115833 3300047447 Bacteria 881
533 Ga0495673_0018684 3300047469 Bacteria 3490
534 Ga0495673_0178718 3300047469 Bacteria 805
535 Ga0495681_0091868 3300047470 Bacteria 1339
536 Ga0495684_0033784 3300047471 Bacteria 3924
537 Ga0495684_0102492 3300047471 Bacteria 2163
538 Ga0495686_0213697 3300047472 Bacteria 1101
539 Ga0495686_0266140 3300047472 Bacteria 958
540 Ga0495686_0280007 3300047472 Bacteria 927
541 Ga0495593_0000621 3300047673 Bacteria 20271
542 Ga0495593_0111065 3300047673 Bacteria 1400
543 Ga0495602_0052398 3300048088 Bacteria 3624
544 Ga0496100_0086180 3300048903 Bacteria 2133
545 Ga0496100_0101098 3300048903 Bacteria 1987
546 Ga0496100_0159052 3300048903 Bacteria 1618
547 Ga0496101_0075822 3300048904 Bacteria 2476
548 Ga0496101_0248394 3300048904 Bacteria 1386
549 Ga0496102_0281245 3300048905 Bacteria 1568
550 Ga0496102_0319757 3300048905 Bacteria 1462
551 Ga0496102_0339425 3300048905 Bacteria 1415
552 Ga0496102_0860421 3300048905 Bacteria 829
553 Ga0496102_0909584 3300048905 Bacteria 801
554 Ga0496102_1123320 3300048905 Bacteria 706
555 Ga0496103_0119376 3300048906 Bacteria 1679
556 Ga0496104_0038665 3300048907 Bacteria 4465
557 Ga0496104_0076944 3300048907 Bacteria 3178
558 Ga0496104_0300870 3300048907 Bacteria 1516
559 Ga0496104_0770192 3300048907 Bacteria 869
560 Ga0496105_0043842 3300048908 Bacteria 3689
561 Ga0496105_0346829 3300048908 Bacteria 1186
562 Ga0496106_0047038 3300048909 Bacteria 3245
563 Ga0496106_0102587 3300048909 Bacteria 2219
564 Ga0496106_0239412 3300048909 Bacteria 1450
565 Ga0496106_0246173 3300048909 Bacteria 1429
566 Ga0496107_0035789 3300048910 Bacteria 3560
567 Ga0496107_0094385 3300048910 Bacteria 2189
568 Ga0496107_0249764 3300048910 Bacteria 1320
569 Ga0496107_0377630 3300048910 Bacteria 1054
570 Ga0496108_0146426 3300048911 Bacteria 2036
571 Ga0496108_0282757 3300048911 Bacteria 1444
572 Ga0496108_0300594 3300048911 Bacteria 1398
573 Ga0496109_0011681 3300048912 Bacteria 7552
574 Ga0496109_0166779 3300048912 Bacteria 2065
575 Ga0496109_0507086 3300048912 Bacteria 1139
576 Ga0496110_0380973 3300048913 Bacteria 1285
577 Ga0496110_0632340 3300048913 Bacteria 969
578 Ga0496110_0712911 3300048913 Bacteria 905
579 Ga0496111_0129328 3300048914 Bacteria 1868
580 Ga0496111_0227189 3300048914 Bacteria 1386
581 Ga0496112_0000008 3300048915 Bacteria 310323
582 Ga0496112_0007690 3300048915 Bacteria 9587
583 Ga0496112_0143844 3300048915 Bacteria 2353
584 Ga0496112_0171249 3300048915 Bacteria 2136
585 Ga0496112_0246438 3300048915 Bacteria 1738
586 Ga0496113_0883047 3300048916 Bacteria 708
587 Ga0496113_1063936 3300048916 Bacteria 635
588 Ga0496114_0212855 3300048917 Bacteria 1695
589 Ga0496114_0262686 3300048917 Bacteria 1520
590 Ga0496115_0094912 3300048918 Bacteria 2441
591 Ga0496115_0105859 3300048918 Bacteria 2309
592 Ga0496115_0286475 3300048918 Bacteria 1352
593 Ga0496115_0340566 3300048918 Bacteria 1224
594 Ga0496116_0003779 3300048919 Bacteria 14802
595 Ga0496116_0202340 3300048919 Bacteria 1038
596 Ga0496117_0018912 3300048920 Bacteria 5682
597 Ga0496117_0188632 3300048920 Bacteria 1177
598 Ga0496118_0090018 3300048921 Bacteria 2116
599 Ga0496118_0106071 3300048921 Bacteria 1881
600 Ga0496118_0121942 3300048921 Bacteria 1697
601 Ga0496118_0147250 3300048921 Bacteria 1480
602 Ga0496119_0111484 3300048922 Bacteria 1518
603 Ga0496119_0141579 3300048922 Bacteria 1298
604 Ga0496119_0294137 3300048922 Bacteria 803
605 Ga0496120_0135515 3300048923 Bacteria 1256
606 Ga0496120_0197665 3300048923 Bacteria 975
607 Ga0496121_0000774 3300048924 Bacteria 58528
608 Ga0496121_0002381 3300048924 Bacteria 28889
609 Ga0496121_0002382 3300048924 Bacteria 28853
610 Ga0496121_0027414 3300048924 Bacteria 5332
611 Ga0496121_0080838 3300048924 Bacteria 2574
612 Ga0496121_0197642 3300048924 Bacteria 1436
613 Ga0496121_0751645 3300048924 Bacteria 580
614 Ga0496122_0065666 3300048925 Bacteria 2629
615 Ga0496122_0146220 3300048925 Bacteria 1468
616 Ga0496123_0020811 3300048926 Bacteria 5118
617 Ga0496123_0054544 3300048926 Bacteria 2630
618 Ga0496123_0184562 3300048926 Bacteria 1085
619 Ga0496124_0053613 3300048927 Bacteria 3417
620 Ga0496124_0134440 3300048927 Bacteria 1960
621 Ga0496124_0144855 3300048927 Bacteria 1871
622 Ga0496125_0000063 3300048928 Bacteria 250260
623 Ga0496125_0010926 3300048928 Bacteria 9129
624 Ga0496125_0057173 3300048928 Bacteria 3161
625 Ga0496125_0121490 3300048928 Bacteria 1862
626 Ga0496125_0303996 3300048928 Bacteria 976
627 Ga0496126_0006620 3300048929 Bacteria 12897
628 Ga0496126_0101796 3300048929 Bacteria 2512
629 Ga0496126_0101879 3300048929 Bacteria 2511
630 Ga0496126_0151614 3300048929 Bacteria 1986
631 Ga0496126_0160381 3300048929 Bacteria 1922
632 Ga0496126_0214149 3300048929 Bacteria 1621
633 Ga0496126_0437753 3300048929 Bacteria 1054
634 Ga0496126_0707662 3300048929 Bacteria 782
635 Ga0496126_0722284 3300048929 Bacteria 772
636 Ga0495678_207430 3300049459 Bacteria 601
637 Ga0501031_0001938 3300049568 Bacteria 13042
638 Ga0501031_0006046 3300049568 Bacteria 7900
639 Ga0501032_0000244 3300049569 Bacteria 45114
640 Ga0501032_0004101 3300049569 Bacteria 11038
641 Ga0501032_0164724 3300049569 Bacteria 1455
642 Ga0501033_0000951 3300049570 Bacteria 26299
643 Ga0501033_0001501 3300049570 Bacteria 20667
644 Ga0501034_0171980 3300049571 Bacteria 2133
645 Ga0501036_0007992 3300049572 Bacteria 8656
646 Ga0501036_0017775 3300049572 Bacteria 5954
647 Ga0501037_0000139 3300049573 Bacteria 67890
648 Ga0501037_0002392 3300049573 Bacteria 13546
649 Ga0501038_0000404 3300049574 Bacteria 37454
650 Ga0501038_0002970 3300049574 Bacteria 15808
651 Ga0501039_0000323 3300049575 Bacteria 34020
652 Ga0501039_0055409 3300049575 Bacteria 3070
653 Ga0501042_0150433 3300049578 Bacteria 1678
654 Ga0501042_0393897 3300049578 Bacteria 1003
655 Ga0501043_0000021 3300049579 Bacteria 155025
656 Ga0501043_0000959 3300049579 Bacteria 25541
657 Ga0501046_0004069 3300049580 Bacteria 13339
658 Ga0501046_0089880 3300049580 Bacteria 2363
659 Ga0501047_0046547 3300049581 Bacteria 4192
660 Ga0501048_0014297 3300049582 Bacteria 5878
661 Ga0501067_0023708 3300049583 Bacteria 3401
662 Ga0501068_0006769 3300049584 Bacteria 6332
663 Ga0501068_0132025 3300049584 Bacteria 1562
664 Ga0501069_0027611 3300049585 Bacteria 3110
665 Ga0501070_0003487 3300049586 Bacteria 13644
666 Ga0501070_0182566 3300049586 Bacteria 1726
667 Ga0501071_0313106 3300049587 Bacteria 1191
668 Ga0501071_0515936 3300049587 Bacteria 917
669 Ga0501072_0002290 3300049588 Bacteria 14329
670 Ga0501073_0000726 3300049589 Bacteria 23280
671 Ga0501073_0052853 3300049589 Bacteria 2844
672 Ga0501074_0002972 3300049590 Bacteria 11915
673 Ga0501074_0452410 3300049590 Bacteria 910
674 Ga0501079_0013190 3300049741 Bacteria 6301
675 Ga0501079_0699027 3300049741 Bacteria 798
676 Ga0501080_0011392 3300049742 Bacteria 8146
677 Ga0501080_0105981 3300049742 Bacteria 2606
678 Ga0501083_0126905 3300049744 Bacteria 1672
679 Ga0501035_0000090 3300049822 Bacteria 112445
680 Ga0501035_0016159 3300049822 Bacteria 6886
681 Ga0501035_0734703 3300049822 Bacteria 793
682 Ga0501044_0009643 3300049823 Bacteria 10506
683 Ga0501044_0131480 3300049823 Bacteria 2497
684 nmdc:mga0yw44_155797_c1 3300050492 Bacteria 1493
685 nmdc:mga0yw44_377368_c1 3300050492 Bacteria 957
686 nmdc:mga06z11_50134_c1 3300050494 Bacteria 2132
687 nmdc:mga08y16_151181_c1 3300050511 Bacteria 2413
688 nmdc:mga0n895_759733_c1 3300050512 Bacteria 962
689 nmdc:mga0sz30_23148_c1 3300050516 Bacteria 2525
690 nmdc:mga0sz30_41072_c1 3300050516 Bacteria 1944
691 Ga0495601_0109327 3300053077 Bacteria 1789
692 Ga0495601_0137052 3300053077 Bacteria 1596
693 Ga0495601_0168844 3300053077 Bacteria 1430
694 Ga0495601_0288435 3300053077 Bacteria 1070
695 Ga0495612_0019291 3300053078 Bacteria 2731
696 Ga0500635_0001465 3300053080 Bacteria 5671
697 Ga0495595_0006425 3300053084 Bacteria 4793
698 Ga0495619_0201267 3300053085 Bacteria 1379
699 Ga0495619_0565158 3300053085 Bacteria 780
700 Ga0500643_015959 3300053087 Bacteria 2561
701 Ga0500643_051154 3300053087 Bacteria 1180
702 Ga0500581_112648 3300053089 Bacteria 1323
703 Ga0500647_0168317 3300053091 Bacteria 1013
704 Ga0500583_0490957 3300053092 Bacteria 578
705 Ga0500651_0063529 3300053093 Bacteria 2304
706 Ga0500651_0275514 3300053093 Bacteria 972
707 Ga0500651_0311600 3300053093 Bacteria 901
708 Ga0500566_0000153 3300053094 Bacteria 35620
709 Ga0500566_0001073 3300053094 Bacteria 15835
710 Ga0500566_0060893 3300053094 Bacteria 2137
711 Ga0500640_007920 3300053095 Bacteria 4170
712 Ga0500641_0013221 3300053096 Bacteria 3030
713 Ga0500554_000472 3300053102 Bacteria 8375
714 Ga0500555_086926 3300053103 Bacteria 807
715 Ga0500556_0000002 3300053104 Bacteria 773626
716 Ga0500569_100001 3300053109 Bacteria 949
717 Ga0500572_003966 3300053111 Bacteria 3362
718 Ga0500591_016088 3300053115 Bacteria 3603
719 Ga0500593_140370 3300053117 Bacteria 952
720 Ga0500594_0028348 3300053118 Bacteria 1456
721 Ga0500595_000321 3300053119 Bacteria 31508
722 Ga0500595_009962 3300053119 Bacteria 3802
723 Ga0500595_078815 3300053119 Bacteria 967
724 Ga0500597_243328 3300053120 Bacteria 739
725 Ga0500607_057905 3300053121 Bacteria 2041
726 Ga0500608_013340 3300053122 Bacteria 3640
727 Ga0500608_075897 3300053122 Bacteria 1593
728 Ga0500618_003074 3300053125 Bacteria 5909
729 Ga0500642_0000026 3300053130 Bacteria 127731
730 Ga0500642_0293108 3300053130 Bacteria 736
731 Ga0500652_030196 3300053131 Bacteria 2118
732 Ga0500559_0009672 3300053136 Bacteria 4163
733 Ga0500559_0024281 3300053136 Bacteria 2578
734 Ga0500559_0210783 3300053136 Bacteria 916
735 Ga0500568_0000922 3300053139 Bacteria 20296
736 Ga0500577_0000121 3300053142 Bacteria 18893
737 Ga0500577_0018030 3300053142 Bacteria 2261
738 Ga0500586_000745 3300053145 Bacteria 6659
739 Ga0500588_0084418 3300053146 Bacteria 1069
740 Ga0500590_076907 3300053148 Bacteria 1648
741 Ga0500603_000152 3300053150 Bacteria 16988
742 Ga0500603_002170 3300053150 Bacteria 4333
743 Ga0500603_022909 3300053150 Bacteria 1551
744 Ga0500616_0000031 3300053153 Bacteria 415013
745 Ga0500616_0023186 3300053153 Bacteria 3459
746 Ga0500620_046688 3300053155 Bacteria 1440
747 Ga0500622_0000994 3300053156 Bacteria 23922
748 Ga0500627_0025163 3300053158 Bacteria 2443
749 Ga0500633_0065887 3300053160 Bacteria 1284
750 Ga0500634_0107321 3300053161 Bacteria 1385
751 Ga0500638_000125 3300053162 Bacteria 14917
752 Ga0500638_048424 3300053162 Bacteria 2056
753 Ga0500639_101620 3300053163 Bacteria 1414
754 Ga0500636_0004153 3300053177 Bacteria 8194
755 Ga0500636_0026285 3300053177 Bacteria 3441
756 Ga0500636_0066235 3300053177 Bacteria 2100
757 Ga0500636_0083215 3300053177 Bacteria 1841
758 Ga0500636_0139133 3300053177 Bacteria 1345
759 Ga0500637_0000264 3300053178 Bacteria 19641
760 Ga0500637_0115433 3300053178 Bacteria 1557
761 Ga0500637_0133318 3300053178 Bacteria 1439
762 Ga0500637_0221990 3300053178 Bacteria 1068
763 Ga0500637_0302452 3300053178 Bacteria 871
764 Ga0500637_0313305 3300053178 Bacteria 851
765 Ga0500657_080710 3300053728 Bacteria 1398
766 Ga0500596_002955 3300053735 Bacteria 3289
767 Ga0500596_038798 3300053735 Bacteria 755
768 Ga0501084_0034233 3300054114 Bacteria 4248
769 Ga0500661_003016 3300055283 Bacteria 3162
770 Ga0500661_059323 3300055283 Bacteria 690

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300017792 Ga0163161_11295032 Ga0163161_112950321 162
2 iso_pu_bacteria 2508501128 2509152935 162
3 3300005548 Ga0070665_100504618 Ga0070665_1005046182 165
4 3300028379 Ga0268266_10483770 Ga0268266_104837702 165
5 3300046615 Ga0495656_0272161 Ga0495656_0272161_261_779 165
6 3300047320 Ga0495672_0255739 Ga0495672_0255739_113_637 165
7 iso_pu_bacteria 2643221651 2644287598 165
8 3300005467 Ga0070706_100958057 Ga0070706_1009580572 166
9 3300005471 Ga0070698_100165606 Ga0070698_1001656062 166
10 3300005577 Ga0068857_100678751 Ga0068857_1006787512 166
11 3300009545 Ga0105237_10327752 Ga0105237_103277522 166
12 3300025914 Ga0207671_10592267 Ga0207671_105922672 166
13 3300026116 Ga0207674_10748389 Ga0207674_107483892 166
14 3300045976 Ga0466967_0249043 Ga0466967_0249043_115_645 166
15 3300005367 Ga0070667_101129865 Ga0070667_1011298651 167
16 3300005434 Ga0070709_10043109 Ga0070709_100431093 167
17 3300005434 Ga0070709_10174059 Ga0070709_101740592 167
18 3300005435 Ga0070714_100545111 Ga0070714_1005451112 167
19 3300005436 Ga0070713_100027160 Ga0070713_1000271604 167
20 3300005437 Ga0070710_10004247 Ga0070710_100042472 167
21 3300005439 Ga0070711_100074878 Ga0070711_1000748782 167
22 3300005439 Ga0070711_100140551 Ga0070711_1001405512 167
23 3300005439 Ga0070711_100177188 Ga0070711_1001771882 167
24 3300005458 Ga0070681_10029384 Ga0070681_100293842 167
25 3300005471 Ga0070698_100897763 Ga0070698_1008977631 167
26 3300005539 Ga0068853_101263809 Ga0068853_1012638091 167
27 3300005548 Ga0070665_100259573 Ga0070665_1002595731 167
28 3300005983 Ga0081540_1014350 Ga0081540_10143505 167
29 3300005983 Ga0081540_1038336 Ga0081540_10383362 167
30 3300006028 Ga0070717_10043944 Ga0070717_100439442 167
31 3300006028 Ga0070717_10386243 Ga0070717_103862432 167
32 3300006028 Ga0070717_10738688 Ga0070717_107386881 167
33 3300006038 Ga0075365_10160284 Ga0075365_101602842 167
34 3300006038 Ga0075365_10177483 Ga0075365_101774832 167
35 3300006051 Ga0075364_10383598 Ga0075364_103835982 167
36 3300006163 Ga0070715_10144201 Ga0070715_101442011 167
37 3300006175 Ga0070712_100378652 Ga0070712_1003786522 167
38 3300006175 Ga0070712_100599220 Ga0070712_1005992202 167
39 3300006178 Ga0075367_10070814 Ga0075367_100708142 167
40 3300009098 Ga0105245_10492386 Ga0105245_104923862 167
41 3300009177 Ga0105248_10096619 Ga0105248_100966195 167
42 3300009551 Ga0105238_10558455 Ga0105238_105584552 167
43 3300010375 Ga0105239_11131709 Ga0105239_111317092 167
44 3300013297 Ga0157378_10008253 Ga0157378_100082536 167
45 3300025898 Ga0207692_10023057 Ga0207692_100230573 167
46 3300025898 Ga0207692_10402236 Ga0207692_104022362 167
47 3300025905 Ga0207685_10253640 Ga0207685_102536402 167
48 3300025906 Ga0207699_10360891 Ga0207699_103608911 167
49 3300025912 Ga0207707_10126135 Ga0207707_101261353 167
50 3300025916 Ga0207663_10346697 Ga0207663_103466971 167
51 3300025916 Ga0207663_10426678 Ga0207663_104266781 167
52 3300025928 Ga0207700_10006639 Ga0207700_100066393 167
53 3300025928 Ga0207700_10208295 Ga0207700_102082952 167
54 3300025929 Ga0207664_10270999 Ga0207664_102709992 167
55 3300025929 Ga0207664_10551585 Ga0207664_105515852 167
56 3300025939 Ga0207665_10135423 Ga0207665_101354232 167
57 3300025986 Ga0207658_11131862 Ga0207658_111318622 167
58 3300026035 Ga0207703_10574425 Ga0207703_105744252 167
59 3300026067 Ga0207678_10090606 Ga0207678_100906061 167
60 3300031616 Ga0307508_10298787 Ga0307508_102987872 167
61 3300031730 Ga0307516_10011958 Ga0307516_100119587 167
62 3300031730 Ga0307516_10134449 Ga0307516_101344492 167
63 3300031911 Ga0307412_10112683 Ga0307412_101126832 167
64 3300033180 Ga0307510_10055327 Ga0307510_100553275 167
65 3300046460 Ga0495638_0050843 Ga0495638_0050843_991_1521 167
66 3300046460 Ga0495638_0209871 Ga0495638_0209871_491_1021 167
67 3300046506 Ga0495583_0022492 Ga0495583_0022492_772_1302 167
68 3300046512 Ga0495610_0049434 Ga0495610_0049434_809_1339 167
69 3300046519 Ga0495632_0299573 Ga0495632_0299573_157_687 167
70 3300046524 Ga0495648_0006468 Ga0495648_0006468_1192_1722 167
71 3300046660 Ga0495625_0084673 Ga0495625_0084673_1576_2115 167
72 3300046665 Ga0495661_0313609 Ga0495661_0313609_65_595 167
73 3300046691 Ga0495670_0003592 Ga0495670_0003592_3830_4360 167
74 3300046692 Ga0495671_0259480 Ga0495671_0259480_285_815 167
75 3300046794 Ga0495589_0240831 Ga0495589_0240831_186_716 167
76 3300047320 Ga0495672_0165631 Ga0495672_0165631_237_767 167
77 3300047470 Ga0495681_0091868 Ga0495681_0091868_405_935 167
78 3300047472 Ga0495686_0213697 Ga0495686_0213697_73_603 167
79 3300048905 Ga0496102_0860421 Ga0496102_0860421_17_547 167
80 3300048909 Ga0496106_0239412 Ga0496106_0239412_828_1358 167
81 3300048919 Ga0496116_0003779 Ga0496116_0003779_3077_3607 167
82 3300048920 Ga0496117_0018912 Ga0496117_0018912_1328_1858 167
83 3300048921 Ga0496118_0090018 Ga0496118_0090018_1037_1567 167
84 3300048921 Ga0496118_0106071 Ga0496118_0106071_713_1243 167
85 3300048921 Ga0496118_0147250 Ga0496118_0147250_810_1340 167
86 3300048922 Ga0496119_0141579 Ga0496119_0141579_193_723 167
87 3300048922 Ga0496119_0294137 Ga0496119_0294137_150_683 167
88 3300048923 Ga0496120_0135515 Ga0496120_0135515_533_1063 167
89 3300048924 Ga0496121_0080838 Ga0496121_0080838_764_1294 167
90 3300048925 Ga0496122_0065666 Ga0496122_0065666_1646_2179 167
91 3300048926 Ga0496123_0020811 Ga0496123_0020811_1232_1762 167
92 3300048926 Ga0496123_0184562 Ga0496123_0184562_285_815 167
93 3300048927 Ga0496124_0134440 Ga0496124_0134440_676_1206 167
94 3300048927 Ga0496124_0144855 Ga0496124_0144855_1029_1556 167
95 3300048928 Ga0496125_0000063 Ga0496125_0000063_209467_210000 167
96 3300048928 Ga0496125_0010926 Ga0496125_0010926_371_904 167
97 3300048928 Ga0496125_0057173 Ga0496125_0057173_1513_2043 167
98 3300048928 Ga0496125_0121490 Ga0496125_0121490_303_833 167
99 3300048929 Ga0496126_0101796 Ga0496126_0101796_977_1507 167
100 3300048929 Ga0496126_0160381 Ga0496126_0160381_1099_1626 167
101 3300049459 Ga0495678_207430 Ga0495678_207430_35_565 167
102 3300050492 nmdc:mga0yw44_155797_c1 nmdc:mga0yw44_155797_c1_248_778 167
103 3300050494 nmdc:mga06z11_50134_c1 nmdc:mga06z11_50134_c1_570_1100 167
104 3300050516 nmdc:mga0sz30_23148_c1 nmdc:mga0sz30_23148_c1_449_979 167
105 3300053087 Ga0500643_015959 Ga0500643_015959_741_1271 167
106 3300053089 Ga0500581_112648 Ga0500581_112648_549_1079 167
107 3300053093 Ga0500651_0063529 Ga0500651_0063529_460_1002 167
108 3300053093 Ga0500651_0311600 Ga0500651_0311600_121_651 167
109 3300053094 Ga0500566_0001073 Ga0500566_0001073_6425_6955 167
110 3300053096 Ga0500641_0013221 Ga0500641_0013221_2215_2745 167
111 3300053103 Ga0500555_086926 Ga0500555_086926_183_713 167
112 3300053104 Ga0500556_0000002 Ga0500556_0000002_20454_20984 167
113 3300053109 Ga0500569_100001 Ga0500569_100001_100_630 167
114 3300053117 Ga0500593_140370 Ga0500593_140370_388_918 167
115 3300053118 Ga0500594_0028348 Ga0500594_0028348_663_1193 167
116 3300053121 Ga0500607_057905 Ga0500607_057905_412_942 167
117 3300053122 Ga0500608_013340 Ga0500608_013340_514_1044 167
118 3300053125 Ga0500618_003074 Ga0500618_003074_5344_5874 167
119 3300053130 Ga0500642_0000026 Ga0500642_0000026_30014_30544 167
120 3300053131 Ga0500652_030196 Ga0500652_030196_1254_1784 167
121 3300053136 Ga0500559_0024281 Ga0500559_0024281_1012_1542 167
122 3300053136 Ga0500559_0210783 Ga0500559_0210783_354_887 167
123 3300053139 Ga0500568_0000922 Ga0500568_0000922_18658_19188 167
124 3300053142 Ga0500577_0018030 Ga0500577_0018030_985_1515 167
125 3300053145 Ga0500586_000745 Ga0500586_000745_5650_6180 167
126 3300053146 Ga0500588_0084418 Ga0500588_0084418_262_792 167
127 3300053148 Ga0500590_076907 Ga0500590_076907_335_865 167
128 3300053153 Ga0500616_0000031 Ga0500616_0000031_127724_128254 167
129 3300053156 Ga0500622_0000994 Ga0500622_0000994_12270_12800 167
130 3300053158 Ga0500627_0025163 Ga0500627_0025163_616_1146 167
131 3300053160 Ga0500633_0065887 Ga0500633_0065887_251_781 167
132 3300053177 Ga0500636_0004153 Ga0500636_0004153_7154_7684 167
133 3300053178 Ga0500637_0115433 Ga0500637_0115433_903_1433 167
134 iso_pu_bacteria 2513237102 2513702802 167
135 iso_pu_bacteria 2602042107 2603861357 167
136 iso_pu_bacteria 2857524615 2857530128 167
137 iso_pu_bacteria 2893066018 2893071741 167
138 iso_pu_bacteria 2919073203 2919076869 167
139 iso_pu_bacteria 8019648815 8019656214 167
140 3300003203 JGI25406J46586_10000014 JGI25406J46586_1000001451 168
141 3300005327 Ga0070658_10200182 Ga0070658_102001822 168
142 3300005334 Ga0068869_101241321 Ga0068869_1012413211 168
143 3300005336 Ga0070680_100090984 Ga0070680_1000909843 168
144 3300005336 Ga0070680_100752286 Ga0070680_1007522862 168
145 3300005347 Ga0070668_100875625 Ga0070668_1008756252 168
146 3300005356 Ga0070674_100252219 Ga0070674_1002522192 168
147 3300005366 Ga0070659_100495453 Ga0070659_1004954532 168
148 3300005458 Ga0070681_10032454 Ga0070681_100324542 168
149 3300005459 Ga0068867_100169379 Ga0068867_1001693792 168
150 3300005530 Ga0070679_100822211 Ga0070679_1008222111 168
151 3300005530 Ga0070679_101074049 Ga0070679_1010740491 168
152 3300005539 Ga0068853_100435914 Ga0068853_1004359142 168
153 3300005563 Ga0068855_100257410 Ga0068855_1002574102 168
154 3300005577 Ga0068857_100540558 Ga0068857_1005405581 168
155 3300005718 Ga0068866_10220657 Ga0068866_102206572 168
156 3300005719 Ga0068861_100167359 Ga0068861_1001673592 168
157 3300005844 Ga0068862_100730675 Ga0068862_1007306752 168
158 3300005985 Ga0081539_10000008 Ga0081539_10000008193 168
159 3300007788 Ga0099795_10052596 Ga0099795_100525962 168
160 3300009093 Ga0105240_10033625 Ga0105240_100336257 168
161 3300009094 Ga0111539_10102681 Ga0111539_101026812 168
162 3300009098 Ga0105245_10545874 Ga0105245_105458742 168
163 3300009148 Ga0105243_10158878 Ga0105243_101588782 168
164 3300013104 Ga0157370_10021137 Ga0157370_100211372 168
165 3300013306 Ga0163162_10924559 Ga0163162_109245592 168
166 3300013308 Ga0157375_11491018 Ga0157375_114910182 168
167 3300014326 Ga0157380_10521753 Ga0157380_105217532 168
168 3300025297 Ga0209758_1006960 Ga0209758_10069603 168
169 3300025909 Ga0207705_10344440 Ga0207705_103444402 168
170 3300025912 Ga0207707_10232317 Ga0207707_102323172 168
171 3300025917 Ga0207660_10378056 Ga0207660_103780562 168
172 3300025927 Ga0207687_10738855 Ga0207687_107388552 168
173 3300025929 Ga0207664_10779213 Ga0207664_107792132 168
174 3300025935 Ga0207709_10638910 Ga0207709_106389102 168
175 3300025937 Ga0207669_10174358 Ga0207669_101743582 168
176 3300025949 Ga0207667_10208124 Ga0207667_102081242 168
177 3300026067 Ga0207678_10482957 Ga0207678_104829572 168
178 3300026078 Ga0207702_10215943 Ga0207702_102159432 168
179 3300026118 Ga0207675_100081038 Ga0207675_1000810383 168
180 3300027907 Ga0207428_10119177 Ga0207428_101191772 168
181 3300028380 Ga0268265_10775534 Ga0268265_107755342 168
182 3300030521 Ga0307511_10063099 Ga0307511_100630993 168
183 3300031249 Ga0265339_10002131 Ga0265339_100021317 168
184 3300031507 Ga0307509_10239085 Ga0307509_102390852 168
185 3300031616 Ga0307508_10325595 Ga0307508_103255952 168
186 3300031730 Ga0307516_10481807 Ga0307516_104818072 168
187 3300033179 Ga0307507_10108194 Ga0307507_101081942 168
188 3300033180 Ga0307510_10320212 Ga0307510_103202122 168
189 3300035113 Ga0373936_0045330 Ga0373936_0045330_1021_1542 168
190 3300035691 Ga0373931_0446653 Ga0373931_0446653_28_558 168
191 3300035695 Ga0373927_0046752 Ga0373927_0046752_2057_2608 168
192 3300036459 Ga0372808_015490 Ga0372808_015490_442_972 168
193 3300037068 Ga0373925_0186996 Ga0373925_0186996_186_737 168
194 3300037466 Ga0395898_0555431 Ga0395898_0555431_329_868 168
195 3300038443 Ga0395901_0437061 Ga0395901_0437061_317_856 168
196 3300039450 Ga0436363_0770554 Ga0436363_0770554_55_585 168
197 3300041452 Ga0451793_0932724 Ga0451793_0932724_111_647 168
198 3300046452 Ga0495617_137042 Ga0495617_137042_89_619 168
199 3300046455 Ga0495603_0306700 Ga0495603_0306700_177_707 168
200 3300046457 Ga0495590_0249967 Ga0495590_0249967_112_642 168
201 3300046457 Ga0495590_0313476 Ga0495590_0313476_49_579 168
202 3300046474 Ga0495605_0208194 Ga0495605_0208194_197_727 168
203 3300046491 Ga0495584_0122688 Ga0495584_0122688_646_1176 168
204 3300046492 Ga0495585_0155080 Ga0495585_0155080_502_1032 168
205 3300046507 Ga0495606_0005431 Ga0495606_0005431_5998_6522 168
206 3300046518 Ga0495631_0100949 Ga0495631_0100949_193_723 168
207 3300046523 Ga0495644_0110312 Ga0495644_0110312_350_880 168
208 3300046523 Ga0495644_0114149 Ga0495644_0114149_301_843 168
209 3300046523 Ga0495644_0140288 Ga0495644_0140288_181_711 168
210 3300046533 Ga0495640_0457773 Ga0495640_0457773_29_580 168
211 3300046536 Ga0495587_0525231 Ga0495587_0525231_97_630 168
212 3300046557 Ga0495622_0267449 Ga0495622_0267449_137_667 168
213 3300046616 Ga0495668_0348610 Ga0495668_0348610_227_757 168
214 3300046642 Ga0495634_0591184 Ga0495634_0591184_52_603 168
215 3300046648 Ga0495611_0317539 Ga0495611_0317539_110_640 168
216 3300046660 Ga0495625_0395515 Ga0495625_0395515_199_729 168
217 3300046683 Ga0495658_0237628 Ga0495658_0237628_285_836 168
218 3300046691 Ga0495670_0542933 Ga0495670_0542933_90_620 168
219 3300047322 Ga0495680_0188495 Ga0495680_0188495_858_1409 168
220 3300047322 Ga0495680_0675205 Ga0495680_0675205_20_550 168
221 3300047447 Ga0495685_115833 Ga0495685_115833_26_550 168
222 3300047469 Ga0495673_0178718 Ga0495673_0178718_10_540 168
223 3300047472 Ga0495686_0266140 Ga0495686_0266140_167_697 168
224 3300048904 Ga0496101_0248394 Ga0496101_0248394_196_726 168
225 3300048915 Ga0496112_0000008 Ga0496112_0000008_278768_279292 168
226 3300048929 Ga0496126_0437753 Ga0496126_0437753_208_738 168
227 3300048929 Ga0496126_0707662 Ga0496126_0707662_31_546 168
228 3300050511 nmdc:mga08y16_151181_c1 nmdc:mga08y16_151181_c1_1464_1994 168
229 3300053093 Ga0500651_0275514 Ga0500651_0275514_102_653 168
230 3300053094 Ga0500566_0000153 Ga0500566_0000153_81_614 168
231 3300053095 Ga0500640_007920 Ga0500640_007920_849_1382 168
232 3300053111 Ga0500572_003966 Ga0500572_003966_2647_3180 168
233 3300053115 Ga0500591_016088 Ga0500591_016088_511_1044 168
234 3300053119 Ga0500595_078815 Ga0500595_078815_124_675 168
235 3300053120 Ga0500597_243328 Ga0500597_243328_162_713 168
236 3300053122 Ga0500608_075897 Ga0500608_075897_181_714 168
237 3300053136 Ga0500559_0009672 Ga0500559_0009672_1090_1623 168
238 3300053142 Ga0500577_0000121 Ga0500577_0000121_13871_14401 168
239 3300053150 Ga0500603_002170 Ga0500603_002170_2783_3316 168
240 3300053150 Ga0500603_022909 Ga0500603_022909_778_1329 168
241 3300053153 Ga0500616_0023186 Ga0500616_0023186_2313_2831 168
242 3300053162 Ga0500638_048424 Ga0500638_048424_883_1416 168
243 3300053177 Ga0500636_0026285 Ga0500636_0026285_169_705 168
244 3300053177 Ga0500636_0083215 Ga0500636_0083215_704_1255 168
245 3300053178 Ga0500637_0221990 Ga0500637_0221990_225_758 168
246 3300053178 Ga0500637_0302452 Ga0500637_0302452_31_582 168
247 3300053178 Ga0500637_0313305 Ga0500637_0313305_141_677 168
248 3300053735 Ga0500596_002955 Ga0500596_002955_1833_2366 168
249 3300055283 Ga0500661_059323 Ga0500661_059323_132_665 168
250 3300005329 Ga0070683_100383800 Ga0070683_1003838002 169
251 3300005336 Ga0070680_100057871 Ga0070680_1000578713 169
252 3300005338 Ga0068868_100197195 Ga0068868_1001971952 169
253 3300005355 Ga0070671_100340295 Ga0070671_1003402952 169
254 3300005436 Ga0070713_100888636 Ga0070713_1008886362 169
255 3300005439 Ga0070711_100477546 Ga0070711_1004775462 169
256 3300005441 Ga0070700_101023494 Ga0070700_1010234941 169
257 3300005455 Ga0070663_100152007 Ga0070663_1001520072 169
258 3300005458 Ga0070681_10147281 Ga0070681_101472812 169
259 3300005535 Ga0070684_100691310 Ga0070684_1006913102 169
260 3300005548 Ga0070665_100572884 Ga0070665_1005728842 169
261 3300005564 Ga0070664_100092913 Ga0070664_1000929132 169
262 3300005618 Ga0068864_100273824 Ga0068864_1002738242 169
263 3300005840 Ga0068870_10386536 Ga0068870_103865362 169
264 3300005937 Ga0081455_10352661 Ga0081455_103526612 169
265 3300006237 Ga0097621_100329091 Ga0097621_1003290912 169
266 3300009093 Ga0105240_10541275 Ga0105240_105412752 169
267 3300009098 Ga0105245_10443341 Ga0105245_104433411 169
268 3300009101 Ga0105247_10185345 Ga0105247_101853452 169
269 3300009551 Ga0105238_10472932 Ga0105238_104729322 169
270 3300010375 Ga0105239_10335961 Ga0105239_103359612 169
271 3300011119 Ga0105246_10289005 Ga0105246_102890052 169
272 3300013296 Ga0157374_10555674 Ga0157374_105556742 169
273 3300013297 Ga0157378_10412335 Ga0157378_104123353 169
274 3300013297 Ga0157378_11049931 Ga0157378_110499312 169
275 3300013306 Ga0163162_10188063 Ga0163162_101880632 169
276 3300014745 Ga0157377_10159048 Ga0157377_101590482 169
277 3300014969 Ga0157376_11038579 Ga0157376_110385792 169
278 3300025908 Ga0207643_10248204 Ga0207643_102482042 169
279 3300025912 Ga0207707_10164097 Ga0207707_101640972 169
280 3300025913 Ga0207695_11011674 Ga0207695_110116741 169
281 3300025916 Ga0207663_10773625 Ga0207663_107736252 169
282 3300025917 Ga0207660_10237211 Ga0207660_102372112 169
283 3300025921 Ga0207652_10032549 Ga0207652_100325493 169
284 3300025938 Ga0207704_10115511 Ga0207704_101155112 169
285 3300026041 Ga0207639_10539091 Ga0207639_105390912 169
286 3300026067 Ga0207678_10206682 Ga0207678_102066822 169
287 3300028379 Ga0268266_11683244 Ga0268266_116832441 169
288 3300032126 Ga0307415_101229870 Ga0307415_1012298701 169
289 3300039438 Ga0436360_0219222 Ga0436360_0219222_964_1497 169
290 3300039447 Ga0436361_1092805 Ga0436361_1092805_143_676 169
291 3300039450 Ga0436363_1433138 Ga0436363_1433138_772_1302 169
292 3300044842 Ga0466957_1047243 Ga0466957_1047243_22_555 169
293 3300045049 Ga0466959_0220792 Ga0466959_0220792_65_598 169
294 3300046557 Ga0495622_0246915 Ga0495622_0246915_43_582 169
295 3300046684 Ga0495669_0061007 Ga0495669_0061007_303_830 169
296 3300048903 Ga0496100_0086180 Ga0496100_0086180_665_1192 169
297 3300048904 Ga0496101_0075822 Ga0496101_0075822_375_902 169
298 3300048905 Ga0496102_0281245 Ga0496102_0281245_448_975 169
299 3300048905 Ga0496102_0319757 Ga0496102_0319757_340_879 169
300 3300048907 Ga0496104_0076944 Ga0496104_0076944_721_1248 169
301 3300048907 Ga0496104_0300870 Ga0496104_0300870_530_1069 169
302 3300048908 Ga0496105_0043842 Ga0496105_0043842_2121_2648 169
303 3300048909 Ga0496106_0047038 Ga0496106_0047038_324_863 169
304 3300048909 Ga0496106_0246173 Ga0496106_0246173_499_1026 169
305 3300048910 Ga0496107_0094385 Ga0496107_0094385_613_1140 169
306 3300048911 Ga0496108_0146426 Ga0496108_0146426_1236_1775 169
307 3300048911 Ga0496108_0282757 Ga0496108_0282757_271_798 169
308 3300048912 Ga0496109_0011681 Ga0496109_0011681_6502_7041 169
309 3300048912 Ga0496109_0166779 Ga0496109_0166779_460_987 169
310 3300048913 Ga0496110_0632340 Ga0496110_0632340_172_699 169
311 3300048914 Ga0496111_0129328 Ga0496111_0129328_476_1003 169
312 3300048915 Ga0496112_0246438 Ga0496112_0246438_756_1283 169
313 3300048916 Ga0496113_1063936 Ga0496113_1063936_97_624 169
314 3300048918 Ga0496115_0105859 Ga0496115_0105859_636_1163 169
315 3300048918 Ga0496115_0340566 Ga0496115_0340566_371_910 169
316 3300048924 Ga0496121_0027414 Ga0496121_0027414_461_985 169
317 3300050516 nmdc:mga0sz30_41072_c1 nmdc:mga0sz30_41072_c1_411_941 169
318 3300053087 Ga0500643_051154 Ga0500643_051154_501_1016 169
319 3300053094 Ga0500566_0060893 Ga0500566_0060893_1340_1870 169
320 3300053119 Ga0500595_000321 Ga0500595_000321_15885_16415 169
321 3300053162 Ga0500638_000125 Ga0500638_000125_704_1234 169
322 3300053178 Ga0500637_0000264 Ga0500637_0000264_13623_14153 169
323 3300055283 Ga0500661_003016 Ga0500661_003016_2015_2545 169
324 3300003203 JGI25406J46586_10001807 JGI25406J46586_100018076 170
325 3300003322 rootL2_10109221 rootL2_101092212 170
326 3300003659 JGI25404J52841_10006804 JGI25404J52841_100068042 170
327 3300003911 JGI25405J52794_10008955 JGI25405J52794_100089552 170
328 3300005327 Ga0070658_10368769 Ga0070658_103687692 170
329 3300005328 Ga0070676_10291953 Ga0070676_102919531 170
330 3300005329 Ga0070683_100266630 Ga0070683_1002666303 170
331 3300005330 Ga0070690_100457252 Ga0070690_1004572521 170
332 3300005336 Ga0070680_100408720 Ga0070680_1004087202 170
333 3300005339 Ga0070660_100020298 Ga0070660_1000202982 170
334 3300005344 Ga0070661_100073144 Ga0070661_1000731443 170
335 3300005344 Ga0070661_100389421 Ga0070661_1003894212 170
336 3300005356 Ga0070674_101095979 Ga0070674_1010959791 170
337 3300005366 Ga0070659_100257443 Ga0070659_1002574432 170
338 3300005367 Ga0070667_100685174 Ga0070667_1006851742 170
339 3300005435 Ga0070714_100610696 Ga0070714_1006106961 170
340 3300005435 Ga0070714_101040822 Ga0070714_1010408222 170
341 3300005439 Ga0070711_100122929 Ga0070711_1001229292 170
342 3300005445 Ga0070708_100024183 Ga0070708_1000241835 170
343 3300005456 Ga0070678_100023118 Ga0070678_1000231183 170
344 3300005458 Ga0070681_10759283 Ga0070681_107592832 170
345 3300005458 Ga0070681_10796442 Ga0070681_107964422 170
346 3300005468 Ga0070707_100059117 Ga0070707_1000591173 170
347 3300005518 Ga0070699_100344373 Ga0070699_1003443732 170
348 3300005536 Ga0070697_100099202 Ga0070697_1000992022 170
349 3300005539 Ga0068853_100116651 Ga0068853_1001166513 170
350 3300005539 Ga0068853_100405406 Ga0068853_1004054062 170
351 3300005543 Ga0070672_100191424 Ga0070672_1001914242 170
352 3300005563 Ga0068855_100362031 Ga0068855_1003620312 170
353 3300005564 Ga0070664_100756355 Ga0070664_1007563552 170
354 3300005578 Ga0068854_100483442 Ga0068854_1004834422 170
355 3300005617 Ga0068859_100494907 Ga0068859_1004949072 170
356 3300005617 Ga0068859_100585114 Ga0068859_1005851142 170
357 3300005618 Ga0068864_100344036 Ga0068864_1003440362 170
358 3300005834 Ga0068851_10144894 Ga0068851_101448942 170
359 3300005842 Ga0068858_100205400 Ga0068858_1002054003 170
360 3300005842 Ga0068858_100672324 Ga0068858_1006723242 170
361 3300005843 Ga0068860_100666207 Ga0068860_1006662072 170
362 3300005937 Ga0081455_10002315 Ga0081455_100023158 170
363 3300005937 Ga0081455_10003763 Ga0081455_100037634 170
364 3300005983 Ga0081540_1014288 Ga0081540_10142884 170
365 3300005983 Ga0081540_1015322 Ga0081540_10153224 170
366 3300005983 Ga0081540_1017198 Ga0081540_10171984 170
367 3300005983 Ga0081540_1031008 Ga0081540_10310083 170
368 3300005983 Ga0081540_1060524 Ga0081540_10605241 170
369 3300005983 Ga0081540_1212145 Ga0081540_12121452 170
370 3300005985 Ga0081539_10016204 Ga0081539_100162044 170
371 3300006038 Ga0075365_10406909 Ga0075365_104069092 170
372 3300006048 Ga0075363_100160701 Ga0075363_1001607012 170
373 3300006173 Ga0070716_100355041 Ga0070716_1003550412 170
374 3300006175 Ga0070712_100263013 Ga0070712_1002630131 170
375 3300006195 Ga0075366_10311351 Ga0075366_103113512 170
376 3300006358 Ga0068871_100159211 Ga0068871_1001592112 170
377 3300006881 Ga0068865_100051469 Ga0068865_1000514693 170
378 3300006931 Ga0097620_100494922 Ga0097620_1004949222 170
379 3300006931 Ga0097620_100585103 Ga0097620_1005851032 170
380 3300007265 Ga0099794_10024884 Ga0099794_100248841 170
381 3300007265 Ga0099794_10069744 Ga0099794_100697443 170
382 3300007265 Ga0099794_10073600 Ga0099794_100736002 170
383 3300007265 Ga0099794_10080765 Ga0099794_100807653 170
384 3300007788 Ga0099795_10169340 Ga0099795_101693401 170
385 3300007788 Ga0099795_10186248 Ga0099795_101862482 170
386 3300007788 Ga0099795_10201647 Ga0099795_102016472 170
387 3300009093 Ga0105240_10191760 Ga0105240_101917603 170
388 3300009093 Ga0105240_10415609 Ga0105240_104156092 170
389 3300009101 Ga0105247_10021726 Ga0105247_100217264 170
390 3300009101 Ga0105247_10056534 Ga0105247_100565345 170
391 3300009148 Ga0105243_10235850 Ga0105243_102358503 170
392 3300009176 Ga0105242_10112239 Ga0105242_101122394 170
393 3300009545 Ga0105237_10135809 Ga0105237_101358092 170
394 3300009545 Ga0105237_10264685 Ga0105237_102646852 170
395 3300009551 Ga0105238_10507345 Ga0105238_105073452 170
396 3300010159 Ga0099796_10053153 Ga0099796_100531532 170
397 3300010375 Ga0105239_10296202 Ga0105239_102962022 170
398 3300013104 Ga0157370_10326090 Ga0157370_103260902 170
399 3300013105 Ga0157369_10681669 Ga0157369_106816691 170
400 3300013306 Ga0163162_10844259 Ga0163162_108442591 170
401 3300013307 Ga0157372_11515383 Ga0157372_115153832 170
402 3300013308 Ga0157375_10148202 Ga0157375_101482022 170
403 3300014326 Ga0157380_10130340 Ga0157380_101303403 170
404 3300014968 Ga0157379_10077545 Ga0157379_100775452 170
405 3300014968 Ga0157379_10782536 Ga0157379_107825362 170
406 3300014969 Ga0157376_10197216 Ga0157376_101972162 170
407 3300025321 Ga0207656_10050024 Ga0207656_100500242 170
408 3300025900 Ga0207710_10032279 Ga0207710_100322792 170
409 3300025900 Ga0207710_10073353 Ga0207710_100733531 170
410 3300025909 Ga0207705_10346885 Ga0207705_103468852 170
411 3300025912 Ga0207707_10054640 Ga0207707_100546403 170
412 3300025913 Ga0207695_10615981 Ga0207695_106159812 170
413 3300025914 Ga0207671_10325787 Ga0207671_103257872 170
414 3300025914 Ga0207671_10435166 Ga0207671_104351662 170
415 3300025915 Ga0207693_10018324 Ga0207693_100183244 170
416 3300025915 Ga0207693_10090304 Ga0207693_100903042 170
417 3300025917 Ga0207660_10029269 Ga0207660_100292693 170
418 3300025919 Ga0207657_10003884 Ga0207657_1000388412 170
419 3300025920 Ga0207649_10087684 Ga0207649_100876842 170
420 3300025920 Ga0207649_10943099 Ga0207649_109430991 170
421 3300025921 Ga0207652_10069342 Ga0207652_100693424 170
422 3300025921 Ga0207652_10461987 Ga0207652_104619872 170
423 3300025922 Ga0207646_10060246 Ga0207646_100602463 170
424 3300025924 Ga0207694_10032236 Ga0207694_100322362 170
425 3300025928 Ga0207700_10297755 Ga0207700_102977552 170
426 3300025929 Ga0207664_10293479 Ga0207664_102934793 170
427 3300025932 Ga0207690_10249888 Ga0207690_102498882 170
428 3300025938 Ga0207704_10073231 Ga0207704_100732313 170
429 3300025939 Ga0207665_10191612 Ga0207665_101916122 170
430 3300025939 Ga0207665_10579014 Ga0207665_105790141 170
431 3300025939 Ga0207665_10688216 Ga0207665_106882162 170
432 3300025949 Ga0207667_10617995 Ga0207667_106179952 170
433 3300025981 Ga0207640_10588737 Ga0207640_105887372 170
434 3300025986 Ga0207658_10295834 Ga0207658_102958341 170
435 3300026035 Ga0207703_10357255 Ga0207703_103572551 170
436 3300026041 Ga0207639_10090411 Ga0207639_100904112 170
437 3300026075 Ga0207708_10839615 Ga0207708_108396152 170
438 3300026078 Ga0207702_10152318 Ga0207702_101523183 170
439 3300026078 Ga0207702_10569058 Ga0207702_105690582 170
440 3300026078 Ga0207702_11196162 Ga0207702_111961621 170
441 3300026089 Ga0207648_10415890 Ga0207648_104158901 170
442 3300026116 Ga0207674_10010401 Ga0207674_100104012 170
443 3300026121 Ga0207683_10029994 Ga0207683_100299944 170
444 3300026142 Ga0207698_10605940 Ga0207698_106059402 170
445 3300027512 Ga0209179_1017557 Ga0209179_10175571 170
446 3300027671 Ga0209588_1032828 Ga0209588_10328282 170
447 3300027671 Ga0209588_1103361 Ga0209588_11033611 170
448 3300028379 Ga0268266_10211015 Ga0268266_102110152 170
449 3300028379 Ga0268266_10560944 Ga0268266_105609442 170
450 3300028381 Ga0268264_10516765 Ga0268264_105167652 170
451 3300028556 Ga0265337_1004498 Ga0265337_10044982 170
452 3300028558 Ga0265326_10068355 Ga0265326_100683552 170
453 3300028573 Ga0265334_10151694 Ga0265334_101516942 170
454 3300028653 Ga0265323_10005809 Ga0265323_100058095 170
455 3300028666 Ga0265336_10000701 Ga0265336_100007015 170
456 3300028786 Ga0307517_10000315 Ga0307517_1000031525 170
457 3300028794 Ga0307515_10044290 Ga0307515_100442902 170
458 3300028800 Ga0265338_10000207 Ga0265338_100002075 170
459 3300029957 Ga0265324_10010437 Ga0265324_100104373 170
460 3300031241 Ga0265325_10251751 Ga0265325_102517512 170
461 3300031249 Ga0265339_10056328 Ga0265339_100563282 170
462 3300031456 Ga0307513_10707252 Ga0307513_107072522 170
463 3300031456 Ga0307513_10779275 Ga0307513_107792752 170
464 3300031616 Ga0307508_10245703 Ga0307508_102457032 170
465 3300031616 Ga0307508_10520957 Ga0307508_105209572 170
466 3300031730 Ga0307516_10468538 Ga0307516_104685382 170
467 3300031731 Ga0307405_10173423 Ga0307405_101734232 170
468 3300032002 Ga0307416_101430599 Ga0307416_1014305992 170
469 3300033180 Ga0307510_10106440 Ga0307510_101064402 170
470 3300033180 Ga0307510_10282433 Ga0307510_102824332 170
471 3300034820 Ga0373959_0059673 Ga0373959_0059673_227_760 170
472 3300035111 Ga0373923_0036398 Ga0373923_0036398_427_969 170
473 3300035112 Ga0373932_0158852 Ga0373932_0158852_13_555 170
474 3300035118 Ga0373954_0020726 Ga0373954_0020726_1857_2399 170
475 3300035118 Ga0373954_0037043 Ga0373954_0037043_1610_2224 170
476 3300035118 Ga0373954_0185217 Ga0373954_0185217_328_870 170
477 3300035119 Ga0373956_0043042 Ga0373956_0043042_428_970 170
478 3300035119 Ga0373956_0075773 Ga0373956_0075773_731_1345 170
479 3300035120 Ga0373957_0015182 Ga0373957_0015182_1845_2387 170
480 3300035170 Ga0373943_0057167 Ga0373943_0057167_144_686 170
481 3300035170 Ga0373943_0070257 Ga0373943_0070257_615_1229 170
482 3300035170 Ga0373943_0282805 Ga0373943_0282805_205_747 170
483 3300035171 Ga0373946_0025116 Ga0373946_0025116_802_1344 170
484 3300035172 Ga0373955_0052678 Ga0373955_0052678_718_1260 170
485 3300035172 Ga0373955_0493790 Ga0373955_0493790_12_596 170
486 3300035410 Ga0373924_0009645 Ga0373924_0009645_936_1478 170
487 3300035410 Ga0373924_0023745 Ga0373924_0023745_1060_1602 170
488 3300035691 Ga0373931_0006466 Ga0373931_0006466_1392_1934 170
489 3300035691 Ga0373931_0799926 Ga0373931_0799926_53_577 170
490 3300035692 Ga0373935_0003292 Ga0373935_0003292_1819_2433 170
491 3300035692 Ga0373935_0081515 Ga0373935_0081515_752_1294 170
492 3300035692 Ga0373935_0135059 Ga0373935_0135059_1010_1552 170
493 3300035695 Ga0373927_0009017 Ga0373927_0009017_3939_4481 170
494 3300035695 Ga0373927_0021578 Ga0373927_0021578_1499_2041 170
495 3300035695 Ga0373927_0077805 Ga0373927_0077805_1503_2045 170
496 3300035724 Ga0373933_0000020 Ga0373933_0000020_93221_93763 170
497 3300035724 Ga0373933_0043400 Ga0373933_0043400_549_1091 170
498 3300035725 Ga0373947_0002978 Ga0373947_0002978_1585_2199 170
499 3300035725 Ga0373947_0044955 Ga0373947_0044955_1488_2030 170
500 3300036401 Ga0373937_0223275 Ga0373937_0223275_761_1303 170
501 3300037068 Ga0373925_0017528 Ga0373925_0017528_1488_2102 170
502 3300037068 Ga0373925_0039385 Ga0373925_0039385_2110_2652 170
503 3300037068 Ga0373925_0383341 Ga0373925_0383341_548_1090 170
504 3300037068 Ga0373925_0655911 Ga0373925_0655911_134_658 170
505 3300037418 Ga0395900_0678959 Ga0395900_0678959_322_864 170
506 3300039437 Ga0436365_0678448 Ga0436365_0678448_11_538 170
507 3300039438 Ga0436360_0489238 Ga0436360_0489238_93_629 170
508 3300039438 Ga0436360_1269431 Ga0436360_1269431_3386_3958 170
509 3300039447 Ga0436361_0031890 Ga0436361_0031890_1849_2385 170
510 3300039447 Ga0436361_0433577 Ga0436361_0433577_449_1021 170
511 3300039447 Ga0436361_0453191 Ga0436361_0453191_233_808 170
512 3300039453 Ga0436362_0656309 Ga0436362_0656309_374_946 170
513 3300041452 Ga0451793_0199320 Ga0451793_0199320_20_562 170
514 3300041452 Ga0451793_1842940 Ga0451793_1842940_454_993 170
515 3300044842 Ga0466957_0944783 Ga0466957_0944783_61_591 170
516 3300046454 Ga0495592_0007751 Ga0495592_0007751_1896_2510 170
517 3300046454 Ga0495592_0026319 Ga0495592_0026319_2806_3348 170
518 3300046455 Ga0495603_0002560 Ga0495603_0002560_3076_3690 170
519 3300046455 Ga0495603_0031707 Ga0495603_0031707_1268_1810 170
520 3300046455 Ga0495603_0058714 Ga0495603_0058714_1486_2028 170
521 3300046455 Ga0495603_0410336 Ga0495603_0410336_16_558 170
522 3300046459 Ga0495629_0000466 Ga0495629_0000466_20200_20814 170
523 3300046459 Ga0495629_0069952 Ga0495629_0069952_718_1260 170
524 3300046460 Ga0495638_0114634 Ga0495638_0114634_1037_1588 170
525 3300046461 Ga0495641_0004267 Ga0495641_0004267_9356_9970 170
526 3300046461 Ga0495641_0299467 Ga0495641_0299467_18_560 170
527 3300046463 Ga0495653_0064356 Ga0495653_0064356_1933_2475 170
528 3300046463 Ga0495653_0505556 Ga0495653_0505556_53_595 170
529 3300046472 Ga0495580_0003213 Ga0495580_0003213_9739_10353 170
530 3300046473 Ga0495582_0005205 Ga0495582_0005205_1567_2181 170
531 3300046475 Ga0495639_0004249 Ga0495639_0004249_1456_2070 170
532 3300046475 Ga0495639_0412299 Ga0495639_0412299_56_598 170
533 3300046475 Ga0495639_0413845 Ga0495639_0413845_57_581 170
534 3300046476 Ga0495662_0000863 Ga0495662_0000863_9514_10128 170
535 3300046477 Ga0495664_0003491 Ga0495664_0003491_3869_4483 170
536 3300046477 Ga0495664_0060800 Ga0495664_0060800_1597_2139 170
537 3300046492 Ga0495585_0089891 Ga0495585_0089891_250_789 170
538 3300046499 Ga0495594_0001496 Ga0495594_0001496_10177_10791 170
539 3300046507 Ga0495606_0317717 Ga0495606_0317717_55_600 170
540 3300046511 Ga0495608_0017296 Ga0495608_0017296_3890_4432 170
541 3300046511 Ga0495608_0096090 Ga0495608_0096090_802_1416 170
542 3300046514 Ga0495618_0051675 Ga0495618_0051675_219_761 170
543 3300046516 Ga0495628_0037940 Ga0495628_0037940_2288_2830 170
544 3300046529 Ga0495652_0032128 Ga0495652_0032128_1990_2532 170
545 3300046529 Ga0495652_0570552 Ga0495652_0570552_135_677 170
546 3300046531 Ga0495665_0003348 Ga0495665_0003348_6367_6981 170
547 3300046531 Ga0495665_0241446 Ga0495665_0241446_339_881 170
548 3300046533 Ga0495640_0009300 Ga0495640_0009300_297_911 170
549 3300046533 Ga0495640_0046057 Ga0495640_0046057_220_762 170
550 3300046533 Ga0495640_0315396 Ga0495640_0315396_261_803 170
551 3300046535 Ga0495586_0043265 Ga0495586_0043265_878_1420 170
552 3300046543 Ga0495645_0006879 Ga0495645_0006879_4008_4550 170
553 3300046557 Ga0495622_0002009 Ga0495622_0002009_3460_4074 170
554 3300046559 Ga0495667_0048853 Ga0495667_0048853_471_1013 170
555 3300046559 Ga0495667_0101418 Ga0495667_0101418_467_1081 170
556 3300046559 Ga0495667_0119440 Ga0495667_0119440_513_1055 170
557 3300046615 Ga0495656_0064344 Ga0495656_0064344_487_1026 170
558 3300046616 Ga0495668_0405527 Ga0495668_0405527_144_689 170
559 3300046642 Ga0495634_0006673 Ga0495634_0006673_6332_6946 170
560 3300046642 Ga0495634_0039716 Ga0495634_0039716_351_893 170
561 3300046663 Ga0495635_0003606 Ga0495635_0003606_7206_7820 170
562 3300046663 Ga0495635_0081266 Ga0495635_0081266_1006_1548 170
563 3300046674 Ga0495588_0168280 Ga0495588_0168280_413_952 170
564 3300046675 Ga0495657_0048496 Ga0495657_0048496_1668_2210 170
565 3300046675 Ga0495657_0161401 Ga0495657_0161401_376_990 170
566 3300046678 Ga0495599_0016796 Ga0495599_0016796_2175_2717 170
567 3300046678 Ga0495599_0054003 Ga0495599_0054003_964_1578 170
568 3300046679 Ga0495623_0088937 Ga0495623_0088937_983_1525 170
569 3300046680 Ga0495646_0018039 Ga0495646_0018039_591_1133 170
570 3300046680 Ga0495646_0044240 Ga0495646_0044240_441_1055 170
571 3300046681 Ga0495647_0000907 Ga0495647_0000907_3665_4279 170
572 3300046683 Ga0495658_0054738 Ga0495658_0054738_1120_1734 170
573 3300046683 Ga0495658_0201760 Ga0495658_0201760_476_1018 170
574 3300046683 Ga0495658_0662183 Ga0495658_0662183_73_615 170
575 3300046684 Ga0495669_0188962 Ga0495669_0188962_166_705 170
576 3300046689 Ga0495613_0016321 Ga0495613_0016321_120_734 170
577 3300046689 Ga0495613_0042165 Ga0495613_0042165_1158_1700 170
578 3300046690 Ga0495624_0011061 Ga0495624_0011061_1407_2021 170
579 3300046691 Ga0495670_0427405 Ga0495670_0427405_50_589 170
580 3300046794 Ga0495589_0399429 Ga0495589_0399429_36_578 170
581 3300046809 Ga0495600_0016731 Ga0495600_0016731_3088_3630 170
582 3300047317 Ga0495604_0033676 Ga0495604_0033676_1773_2315 170
583 3300047319 Ga0495674_0044597 Ga0495674_0044597_1109_1651 170
584 3300047319 Ga0495674_0458341 Ga0495674_0458341_204_746 170
585 3300047320 Ga0495672_0023455 Ga0495672_0023455_789_1340 170
586 3300047321 Ga0495676_0027465 Ga0495676_0027465_4009_4623 170
587 3300047322 Ga0495680_0021899 Ga0495680_0021899_1755_2297 170
588 3300047444 Ga0495675_0059117 Ga0495675_0059117_235_777 170
589 3300047469 Ga0495673_0018684 Ga0495673_0018684_1900_2457 170
590 3300047471 Ga0495684_0033784 Ga0495684_0033784_2425_3039 170
591 3300047471 Ga0495684_0102492 Ga0495684_0102492_1234_1776 170
592 3300047673 Ga0495593_0000621 Ga0495593_0000621_7343_7957 170
593 3300047673 Ga0495593_0111065 Ga0495593_0111065_759_1301 170
594 3300048088 Ga0495602_0052398 Ga0495602_0052398_2003_2545 170
595 3300048903 Ga0496100_0101098 Ga0496100_0101098_745_1287 170
596 3300048903 Ga0496100_0159052 Ga0496100_0159052_848_1390 170
597 3300048905 Ga0496102_0339425 Ga0496102_0339425_126_668 170
598 3300048905 Ga0496102_0909584 Ga0496102_0909584_156_698 170
599 3300048905 Ga0496102_1123320 Ga0496102_1123320_99_641 170
600 3300048906 Ga0496103_0119376 Ga0496103_0119376_98_640 170
601 3300048907 Ga0496104_0038665 Ga0496104_0038665_3400_3942 170
602 3300048907 Ga0496104_0770192 Ga0496104_0770192_56_598 170
603 3300048908 Ga0496105_0346829 Ga0496105_0346829_461_1003 170
604 3300048909 Ga0496106_0102587 Ga0496106_0102587_1205_1747 170
605 3300048910 Ga0496107_0035789 Ga0496107_0035789_982_1503 170
606 3300048910 Ga0496107_0249764 Ga0496107_0249764_417_959 170
607 3300048910 Ga0496107_0377630 Ga0496107_0377630_378_920 170
608 3300048911 Ga0496108_0300594 Ga0496108_0300594_346_888 170
609 3300048912 Ga0496109_0507086 Ga0496109_0507086_377_919 170
610 3300048913 Ga0496110_0380973 Ga0496110_0380973_508_1050 170
611 3300048913 Ga0496110_0712911 Ga0496110_0712911_101_643 170
612 3300048914 Ga0496111_0227189 Ga0496111_0227189_308_832 170
613 3300048915 Ga0496112_0007690 Ga0496112_0007690_4869_5411 170
614 3300048915 Ga0496112_0143844 Ga0496112_0143844_1255_1797 170
615 3300048915 Ga0496112_0171249 Ga0496112_0171249_37_579 170
616 3300048916 Ga0496113_0883047 Ga0496113_0883047_28_570 170
617 3300048917 Ga0496114_0212855 Ga0496114_0212855_464_1006 170
618 3300048917 Ga0496114_0262686 Ga0496114_0262686_291_845 170
619 3300048918 Ga0496115_0094912 Ga0496115_0094912_1755_2297 170
620 3300048918 Ga0496115_0286475 Ga0496115_0286475_33_575 170
621 3300048919 Ga0496116_0202340 Ga0496116_0202340_40_582 170
622 3300048920 Ga0496117_0188632 Ga0496117_0188632_143_685 170
623 3300048921 Ga0496118_0121942 Ga0496118_0121942_853_1395 170
624 3300048922 Ga0496119_0111484 Ga0496119_0111484_59_601 170
625 3300048924 Ga0496121_0000774 Ga0496121_0000774_17239_17781 170
626 3300048924 Ga0496121_0002381 Ga0496121_0002381_20904_21446 170
627 3300048924 Ga0496121_0002382 Ga0496121_0002382_23062_23583 170
628 3300048924 Ga0496121_0751645 Ga0496121_0751645_11_541 170
629 3300048929 Ga0496126_0006620 Ga0496126_0006620_4785_5306 170
630 3300048929 Ga0496126_0101879 Ga0496126_0101879_369_911 170
631 3300048929 Ga0496126_0151614 Ga0496126_0151614_227_769 170
632 3300049568 Ga0501031_0001938 Ga0501031_0001938_1274_1828 170
633 3300049569 Ga0501032_0004101 Ga0501032_0004101_8799_9353 170
634 3300049570 Ga0501033_0000951 Ga0501033_0000951_2160_2714 170
635 3300049571 Ga0501034_0171980 Ga0501034_0171980_1039_1593 170
636 3300049572 Ga0501036_0017775 Ga0501036_0017775_1676_2230 170
637 3300049573 Ga0501037_0002392 Ga0501037_0002392_6658_7212 170
638 3300049574 Ga0501038_0002970 Ga0501038_0002970_2861_3415 170
639 3300049575 Ga0501039_0055409 Ga0501039_0055409_39_593 170
640 3300049578 Ga0501042_0150433 Ga0501042_0150433_154_708 170
641 3300049579 Ga0501043_0000959 Ga0501043_0000959_12873_13427 170
642 3300049584 Ga0501068_0132025 Ga0501068_0132025_324_878 170
643 3300049587 Ga0501071_0515936 Ga0501071_0515936_168_722 170
644 3300049741 Ga0501079_0699027 Ga0501079_0699027_134_688 170
645 3300049742 Ga0501080_0105981 Ga0501080_0105981_1557_2111 170
646 3300049822 Ga0501035_0016159 Ga0501035_0016159_3632_4186 170
647 3300049822 Ga0501035_0734703 Ga0501035_0734703_184_717 170
648 3300049823 Ga0501044_0131480 Ga0501044_0131480_30_584 170
649 3300050492 nmdc:mga0yw44_377368_c1 nmdc:mga0yw44_377368_c1_67_609 170
650 3300053077 Ga0495601_0109327 Ga0495601_0109327_439_981 170
651 3300053077 Ga0495601_0137052 Ga0495601_0137052_580_1122 170
652 3300053077 Ga0495601_0168844 Ga0495601_0168844_254_796 170
653 3300053077 Ga0495601_0288435 Ga0495601_0288435_280_894 170
654 3300053078 Ga0495612_0019291 Ga0495612_0019291_977_1519 170
655 3300053080 Ga0500635_0001465 Ga0500635_0001465_1651_2193 170
656 3300053084 Ga0495595_0006425 Ga0495595_0006425_2784_3326 170
657 3300053085 Ga0495619_0201267 Ga0495619_0201267_306_920 170
658 3300053085 Ga0495619_0565158 Ga0495619_0565158_124_663 170
659 3300053091 Ga0500647_0168317 Ga0500647_0168317_424_957 170
660 3300053092 Ga0500583_0490957 Ga0500583_0490957_15_557 170
661 3300053102 Ga0500554_000472 Ga0500554_000472_1285_1827 170
662 3300053119 Ga0500595_009962 Ga0500595_009962_3030_3572 170
663 3300053130 Ga0500642_0293108 Ga0500642_0293108_156_698 170
664 3300053150 Ga0500603_000152 Ga0500603_000152_6142_6684 170
665 3300053155 Ga0500620_046688 Ga0500620_046688_506_1048 170
666 3300053161 Ga0500634_0107321 Ga0500634_0107321_595_1122 170
667 3300053178 Ga0500637_0133318 Ga0500637_0133318_317_859 170
668 iso_pu_bacteria 2513237141 2513893848 170
669 3300005439 Ga0070711_100141421 Ga0070711_1001414213 171
670 3300005458 Ga0070681_10006786 Ga0070681_100067863 171
671 3300005563 Ga0068855_100360971 Ga0068855_1003609713 171
672 3300005843 Ga0068860_100004618 Ga0068860_1000046185 171
673 3300006871 Ga0075434_100803792 Ga0075434_1008037922 171
674 3300009545 Ga0105237_10027598 Ga0105237_100275985 171
675 3300009551 Ga0105238_10013191 Ga0105238_100131913 171
676 3300009551 Ga0105238_10707661 Ga0105238_107076612 171
677 3300010375 Ga0105239_10023344 Ga0105239_100233447 171
678 3300013102 Ga0157371_10148352 Ga0157371_101483523 171
679 3300013296 Ga0157374_10131445 Ga0157374_101314453 171
680 3300025295 Ga0209564_1000468 Ga0209564_100046848 171
681 3300025912 Ga0207707_10077728 Ga0207707_100777284 171
682 3300025914 Ga0207671_10108412 Ga0207671_101084122 171
683 3300025914 Ga0207671_10499420 Ga0207671_104994202 171
684 3300025944 Ga0207661_11506968 Ga0207661_115069681 171
685 3300026041 Ga0207639_10188444 Ga0207639_101884442 171
686 3300028379 Ga0268266_10221116 Ga0268266_102211162 171
687 3300028381 Ga0268264_10001711 Ga0268264_1000171112 171
688 3300031730 Ga0307516_10213157 Ga0307516_102131572 171
689 3300031838 Ga0307518_10345779 Ga0307518_103457791 171
690 3300039437 Ga0436365_1606465 Ga0436365_1606465_461_991 171
691 3300041486 Ga0451807_0693661 Ga0451807_0693661_91_636 171
692 3300041509 Ga0451843_0275340 Ga0451843_0275340_19_567 171
693 3300046501 Ga0495607_0355768 Ga0495607_0355768_36_578 171
694 3300046524 Ga0495648_0014905 Ga0495648_0014905_4168_4743 171
695 3300046660 Ga0495625_0138161 Ga0495625_0138161_125_676 171
696 3300046681 Ga0495647_0170632 Ga0495647_0170632_53_595 171
697 3300048923 Ga0496120_0197665 Ga0496120_0197665_394_927 171
698 3300048924 Ga0496121_0197642 Ga0496121_0197642_370_918 171
699 3300048925 Ga0496122_0146220 Ga0496122_0146220_553_1086 171
700 3300048926 Ga0496123_0054544 Ga0496123_0054544_1569_2102 171
701 3300048927 Ga0496124_0053613 Ga0496124_0053613_2591_3124 171
702 3300048928 Ga0496125_0303996 Ga0496125_0303996_110_658 171
703 3300048929 Ga0496126_0214149 Ga0496126_0214149_742_1275 171
704 3300048929 Ga0496126_0722284 Ga0496126_0722284_62_610 171
705 3300049568 Ga0501031_0006046 Ga0501031_0006046_4700_5245 171
706 3300049569 Ga0501032_0000244 Ga0501032_0000244_8013_8558 171
707 3300049569 Ga0501032_0164724 Ga0501032_0164724_163_693 171
708 3300049570 Ga0501033_0001501 Ga0501033_0001501_12654_13199 171
709 3300049572 Ga0501036_0007992 Ga0501036_0007992_243_788 171
710 3300049573 Ga0501037_0000139 Ga0501037_0000139_59723_60268 171
711 3300049574 Ga0501038_0000404 Ga0501038_0000404_7730_8275 171
712 3300049575 Ga0501039_0000323 Ga0501039_0000323_26826_27371 171
713 3300049578 Ga0501042_0393897 Ga0501042_0393897_73_618 171
714 3300049579 Ga0501043_0000021 Ga0501043_0000021_153249_153794 171
715 3300049580 Ga0501046_0004069 Ga0501046_0004069_5411_5956 171
716 3300049580 Ga0501046_0089880 Ga0501046_0089880_1744_2274 171
717 3300049581 Ga0501047_0046547 Ga0501047_0046547_69_599 171
718 3300049582 Ga0501048_0014297 Ga0501048_0014297_604_1149 171
719 3300049583 Ga0501067_0023708 Ga0501067_0023708_217_762 171
720 3300049584 Ga0501068_0006769 Ga0501068_0006769_1743_2288 171
721 3300049585 Ga0501069_0027611 Ga0501069_0027611_32_577 171
722 3300049586 Ga0501070_0003487 Ga0501070_0003487_1953_2498 171
723 3300049586 Ga0501070_0182566 Ga0501070_0182566_100_630 171
724 3300049587 Ga0501071_0313106 Ga0501071_0313106_448_993 171
725 3300049588 Ga0501072_0002290 Ga0501072_0002290_7290_7835 171
726 3300049589 Ga0501073_0000726 Ga0501073_0000726_11955_12500 171
727 3300049589 Ga0501073_0052853 Ga0501073_0052853_1485_2015 171
728 3300049590 Ga0501074_0002972 Ga0501074_0002972_6307_6852 171
729 3300049590 Ga0501074_0452410 Ga0501074_0452410_240_770 171
730 3300049741 Ga0501079_0013190 Ga0501079_0013190_2746_3291 171
731 3300049742 Ga0501080_0011392 Ga0501080_0011392_6403_6933 171
732 3300049744 Ga0501083_0126905 Ga0501083_0126905_1040_1585 171
733 3300049822 Ga0501035_0000090 Ga0501035_0000090_105518_106063 171
734 3300049823 Ga0501044_0009643 Ga0501044_0009643_3299_3829 171
735 3300050512 nmdc:mga0n895_759733_c1 nmdc:mga0n895_759733_c1_381_908 171
736 3300053163 Ga0500639_101620 Ga0500639_101620_430_978 171
737 3300053177 Ga0500636_0066235 Ga0500636_0066235_746_1294 171
738 3300053177 Ga0500636_0139133 Ga0500636_0139133_75_623 171
739 3300053728 Ga0500657_080710 Ga0500657_080710_274_822 171
740 3300053735 Ga0500596_038798 Ga0500596_038798_176_724 171
741 3300054114 Ga0501084_0034233 Ga0501084_0034233_1995_2540 171
742 3300035695 Ga0373927_0832224 Ga0373927_0832224_34_567 172
743 3300047472 Ga0495686_0280007 Ga0495686_0280007_230_778 172
744 3300039450 Ga0436363_1613900 Ga0436363_1613900_485_1024 173
745 3300001979 JGI24740J21852_10015408 JGI24740J21852_100154082 175
746 3300001990 JGI24737J22298_10009425 JGI24737J22298_100094253 175
747 3300005455 Ga0070663_100364737 Ga0070663_1003647372 175
748 3300005539 Ga0068853_100010165 Ga0068853_1000101656 175
749 3300005563 Ga0068855_100013119 Ga0068855_1000131197 175
750 3300005563 Ga0068855_100577460 Ga0068855_1005774603 175
751 3300005577 Ga0068857_100002370 Ga0068857_1000023705 175
752 3300005578 Ga0068854_100028344 Ga0068854_1000283445 175
753 3300005578 Ga0068854_100036291 Ga0068854_1000362911 175
754 3300005614 Ga0068856_100036605 Ga0068856_1000366053 175
755 3300005616 Ga0068852_101174225 Ga0068852_1011742251 175
756 3300009093 Ga0105240_10014285 Ga0105240_100142855 175
757 3300009093 Ga0105240_10020795 Ga0105240_100207958 175
758 3300009174 Ga0105241_10004158 Ga0105241_100041588 175
759 3300009545 Ga0105237_10164830 Ga0105237_101648302 175
760 3300009551 Ga0105238_10002076 Ga0105238_1000207616 175
761 3300009551 Ga0105238_10019168 Ga0105238_100191685 175
762 3300010375 Ga0105239_10010188 Ga0105239_100101888 175
763 3300010375 Ga0105239_10328771 Ga0105239_103287713 175
764 3300025904 Ga0207647_10000586 Ga0207647_1000058611 175
765 3300025911 Ga0207654_10001537 Ga0207654_100015377 175
766 3300025913 Ga0207695_10001321 Ga0207695_100013218 175
767 3300025914 Ga0207671_10154249 Ga0207671_101542492 175
768 3300025924 Ga0207694_10000135 Ga0207694_1000013534 175
769 3300025932 Ga0207690_10368005 Ga0207690_103680052 175
770 3300025949 Ga0207667_10011574 Ga0207667_100115745 175
771 3300025949 Ga0207667_10039549 Ga0207667_100395492 175
772 3300025981 Ga0207640_10011594 Ga0207640_100115942 175
773 3300025981 Ga0207640_10256926 Ga0207640_102569262 175
774 3300026041 Ga0207639_11294189 Ga0207639_112941892 175
775 3300026067 Ga0207678_10033115 Ga0207678_100331155 175
776 3300026078 Ga0207702_10000026 Ga0207702_10000026138 175
777 3300026078 Ga0207702_10025557 Ga0207702_100255572 175
778 3300026116 Ga0207674_10050495 Ga0207674_100504953 175
779 3300026142 Ga0207698_10603567 Ga0207698_106035673 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13242

Hydrolase_like

HAD-hyrolase-like

126

195

0.93

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

116

171

0.92

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

9

166

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l8f-assembly1.cif.gz_A crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from e. coli complexed with magnesium and phosphate 0.9163 9 171
2o2x-assembly1.cif.gz_A crystal structure of a putative had-like phosphatase (mll2559) from mesorhizobium loti at 1.50 a resolution 0.8899 1 174
3l8h-assembly4.cif.gz_D crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from b. bronchiseptica complexed with magnesium and phosphate 0.8831 11 175
2o2x-assembly1.cif.gz_A crystal structure of a putative had-like phosphatase (mll2559) from mesorhizobium loti at 1.50 a resolution 0.8805 1 174
2fpu-assembly1.cif.gz_A crystal structure of the n-terminal domain of e.coli hisb- complex with histidinol 0.8669 9 159
ID Description Score Start End Superfamily
af_P9WMV3_2_164_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8861 9 162 3.40.50.1000
2fpuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8669 9 159 3.40.50.1000
2o2xA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8627 1 174 3.40.50.1000
3l8gA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8587 9 175 3.40.50.1000
3l8hD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.856 12 175 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A515KN55-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase (EC 3.1.3.-) 0.9998 8 175 GO:0005737
GO:0005975
GO:0016791
GO:0046872
AF-A0A090N6S3-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase 0.9958 37 175 GO:0005737
GO:0005975
GO:0016791
GO:0046872
AF-A0A1I4PES2-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase (EC 3.1.3.-) 0.9944 9 175 GO:0005737
GO:0005975
GO:0016791
GO:0046872
AF-A0A366FT82-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase 0.9938 9 167 GO:0005737
GO:0005975
GO:0009058
GO:0016791
AF-A0A554UAN5-F1-model_v4 deleted 0.993 13 175

Feature Viewer

pLDDT pTM Quality
94.8 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map