F480528

General Info

Members Datasets Scaffolds Average Seq Length
780 246 1560 191

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0263967|Ga0395905_0263967_502_1179
Length 225
Sequence MIMIASKRVGYSAGPPSTLATGGLARSGRRLHIAAMQIRTEHTPNPATRKFLPGQTVMGSGTRDFADAKSAEASPLANALFSSGLVEGVFFGHDFISVTAEPGTSWTDLEPVVIETLLDHFVTGAPLFTPGSAAGIHVASEPDFEEDPADADIIDQIKDLIETRVRPAVAQDGGDIAYKGYKDGHLYLSMHGACSGCPSSTVTLKRGIESLIRHYVPEVESVEAV

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
182 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
183 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
184 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
185 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
186 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
187 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
188 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
189 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
200 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
201 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
207 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
220 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
221 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
222 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
225 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
233 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
234 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
235 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
236 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
237 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
245 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
246 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0.64
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 0
Rhizoplane 2.31
Rhizosphere 95.13
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0263967 3300037471 Bacteria 1607
2 SwRhRL3b_contig_1116789 2162886006 Bacteria 1591
3 JGI24736J21556_1006620 3300001904 Bacteria 1950
4 JGI24740J21852_10028451 3300001979 Bacteria 1846
5 JGI24740J21852_10073743 3300001979 Bacteria 908
6 JGI24739J22299_10000665 3300001989 Bacteria 12367
7 JGI24739J22299_10020794 3300001989 Bacteria 2342
8 JGI24737J22298_10000557 3300001990 Bacteria 13073
9 JGI24737J22298_10003095 3300001990 Bacteria 5892
10 JGI24743J22301_10037491 3300001991 Bacteria 967
11 JGI24735J21928_10002448 3300002067 Bacteria 6450
12 JGI24738J21930_10007900 3300002075 Bacteria 2434
13 JGI24738J21930_10018425 3300002075 Bacteria 1459
14 Ga0055536_1010679 3300003781 Bacteria 3611
15 Ga0055534_1006405 3300003784 Bacteria 2968
16 Ga0055530_10000465 3300003791 Bacteria 35593
17 Ga0055531_10001005 3300003794 Bacteria 22405
18 Ga0065704_10124776 3300005289 Bacteria 1713
19 Ga0065707_10081814 3300005295 Bacteria 36963
20 Ga0070658_10004771 3300005327 Bacteria 11026
21 Ga0070658_10017951 3300005327 Bacteria 5659
22 Ga0070658_10025337 3300005327 Bacteria 4756
23 Ga0070658_10041960 3300005327 Bacteria 3691
24 Ga0070658_10164976 3300005327 Bacteria 1859
25 Ga0070658_10283476 3300005327 Bacteria 1410
26 Ga0070658_10539184 3300005327 Bacteria 1009
27 Ga0070658_10672490 3300005327 Bacteria 898
28 Ga0070676_10029351 3300005328 Bacteria 3127
29 Ga0070676_10067845 3300005328 Bacteria 2133
30 Ga0070676_10260830 3300005328 Bacteria 1160
31 Ga0070683_100029136 3300005329 Bacteria 4995
32 Ga0070683_100034172 3300005329 Bacteria 4643
33 Ga0070683_100076965 3300005329 Bacteria 3119
34 Ga0070683_100125675 3300005329 Bacteria 2425
35 Ga0070683_100201881 3300005329 Bacteria 1888
36 Ga0070670_100033815 3300005331 Bacteria 4402
37 Ga0070670_100167167 3300005331 Bacteria 1907
38 Ga0070670_100555959 3300005331 Bacteria 1024
39 Ga0068869_100028161 3300005334 Bacteria 3923
40 Ga0068869_100038426 3300005334 Bacteria 3412
41 Ga0070666_10003290 3300005335 Bacteria 9807
42 Ga0070666_10291056 3300005335 Bacteria 1162
43 Ga0070680_100007602 3300005336 Bacteria 8267
44 Ga0070680_100105284 3300005336 Bacteria 2345
45 Ga0070680_100351110 3300005336 Bacteria 1254
46 Ga0068868_100001497 3300005338 Bacteria 16125
47 Ga0068868_100006245 3300005338 Bacteria 8431
48 Ga0068868_100045650 3300005338 Bacteria 3428
49 Ga0068868_100486587 3300005338 Bacteria 1079
50 Ga0068868_100604793 3300005338 Bacteria 972
51 Ga0070660_100001079 3300005339 Bacteria 18342
52 Ga0070660_100001588 3300005339 Bacteria 15632
53 Ga0070660_100012165 3300005339 Bacteria 6144
54 Ga0070660_100032905 3300005339 Bacteria 3905
55 Ga0070660_100101515 3300005339 Bacteria 2280
56 Ga0070660_100248079 3300005339 Bacteria 1451
57 Ga0070660_100857457 3300005339 Bacteria 765
58 Ga0070689_100526010 3300005340 Bacteria 1016
59 Ga0070661_100025639 3300005344 Bacteria 4239
60 Ga0070661_100050925 3300005344 Bacteria 3030
61 Ga0070661_100091502 3300005344 Bacteria 2253
62 Ga0070661_100098461 3300005344 Bacteria 2172
63 Ga0070661_100587053 3300005344 Bacteria 900
64 Ga0070692_10002252 3300005345 Bacteria 7402
65 Ga0070692_10002478 3300005345 Bacteria 7180
66 Ga0070692_10013073 3300005345 Bacteria 3862
67 Ga0070692_10029359 3300005345 Bacteria 2740
68 Ga0070668_100020062 3300005347 Bacteria 5040
69 Ga0070668_100256180 3300005347 Bacteria 1454
70 Ga0070668_100563746 3300005347 Bacteria 992
71 Ga0070669_100006995 3300005353 Bacteria 8107
72 Ga0070669_100070671 3300005353 Bacteria 2581
73 Ga0070669_100091119 3300005353 Bacteria 2286
74 Ga0070669_100814687 3300005353 Bacteria 794
75 Ga0070671_100000972 3300005355 Bacteria 20998
76 Ga0070671_100009588 3300005355 Bacteria 7779
77 Ga0070671_100010307 3300005355 Bacteria 7499
78 Ga0070671_100022059 3300005355 Bacteria 5202
79 Ga0070671_100130155 3300005355 Bacteria 2119
80 Ga0070674_100379079 3300005356 Bacteria 1150
81 Ga0070674_100549006 3300005356 Bacteria 969
82 Ga0070673_100008938 3300005364 Bacteria 6698
83 Ga0070673_100090976 3300005364 Bacteria 2493
84 Ga0070673_100137914 3300005364 Bacteria 2055
85 Ga0070673_100243023 3300005364 Bacteria 1566
86 Ga0070673_100299117 3300005364 Bacteria 1416
87 Ga0070673_100613296 3300005364 Bacteria 993
88 Ga0070659_100003269 3300005366 Bacteria 11531
89 Ga0070659_100013747 3300005366 Bacteria 6035
90 Ga0070659_100018189 3300005366 Bacteria 5302
91 Ga0070659_100018789 3300005366 Bacteria 5218
92 Ga0070659_100044540 3300005366 Bacteria 3474
93 Ga0070659_100108042 3300005366 Bacteria 2244
94 Ga0070659_100169132 3300005366 Bacteria 1790
95 Ga0070659_100202256 3300005366 Bacteria 1635
96 Ga0070667_100004430 3300005367 Bacteria 11850
97 Ga0070667_100004674 3300005367 Bacteria 11490
98 Ga0070667_100008465 3300005367 Bacteria 8531
99 Ga0070667_100051525 3300005367 Bacteria 3471
100 Ga0070667_100121652 3300005367 Bacteria 2270
101 Ga0070667_100793066 3300005367 Bacteria 879
102 Ga0070667_101131158 3300005367 Bacteria 732
103 Ga0070709_10563038 3300005434 Bacteria 873
104 Ga0070714_100055765 3300005435 Bacteria 3378
105 Ga0070713_100014782 3300005436 Bacteria 5809
106 Ga0070694_100005040 3300005444 Bacteria 7970
107 Ga0070694_100949957 3300005444 Bacteria 712
108 Ga0070663_100007307 3300005455 Bacteria 6715
109 Ga0070663_100012043 3300005455 Bacteria 5456
110 Ga0070663_100038724 3300005455 Bacteria 3327
111 Ga0070663_100047050 3300005455 Bacteria 3055
112 Ga0070663_100300179 3300005455 Bacteria 1285
113 Ga0070663_100376212 3300005455 Bacteria 1156
114 Ga0070663_100472734 3300005455 Bacteria 1037
115 Ga0070678_100005628 3300005456 Bacteria 7272
116 Ga0070678_100038873 3300005456 Bacteria 3353
117 Ga0070662_100004126 3300005457 Bacteria 9137
118 Ga0070662_100027617 3300005457 Bacteria 3942
119 Ga0070662_100034491 3300005457 Bacteria 3568
120 Ga0070662_100046588 3300005457 Bacteria 3116
121 Ga0070662_100070100 3300005457 Bacteria 2582
122 Ga0070662_100081421 3300005457 Bacteria 2412
123 Ga0070662_100084432 3300005457 Bacteria 2372
124 Ga0070662_100100682 3300005457 Bacteria 2186
125 Ga0070662_100248784 3300005457 Bacteria 1428
126 Ga0070662_100261986 3300005457 Bacteria 1393
127 Ga0070662_100393399 3300005457 Bacteria 1143
128 Ga0070662_100797769 3300005457 Bacteria 803
129 Ga0070681_10067399 3300005458 Bacteria 3547
130 Ga0070681_10265942 3300005458 Bacteria 1626
131 Ga0070681_10271252 3300005458 Bacteria 1608
132 Ga0070681_10485995 3300005458 Bacteria 1147
133 Ga0068867_100003921 3300005459 Bacteria 10471
134 Ga0068867_100007261 3300005459 Bacteria 7835
135 Ga0068867_100251072 3300005459 Bacteria 1438
136 Ga0070685_10256271 3300005466 Bacteria 1161
137 Ga0070679_100018094 3300005530 Bacteria 6829
138 Ga0070679_100030368 3300005530 Bacteria 5336
139 Ga0070679_100041596 3300005530 Bacteria 4573
140 Ga0070679_100786405 3300005530 Bacteria 895
141 Ga0070684_100016831 3300005535 Bacteria 5988
142 Ga0070684_100420909 3300005535 Bacteria 1233
143 Ga0068853_100018832 3300005539 Bacteria 5717
144 Ga0068853_100036153 3300005539 Bacteria 4198
145 Ga0068853_100108807 3300005539 Bacteria 2459
146 Ga0068853_100333865 3300005539 Bacteria 1407
147 Ga0068853_100628701 3300005539 Bacteria 1021
148 Ga0070672_100015110 3300005543 Bacteria 5488
149 Ga0070672_100016848 3300005543 Bacteria 5242
150 Ga0070672_100685011 3300005543 Bacteria 897
151 Ga0070696_100004575 3300005546 Bacteria 9233
152 Ga0070696_100007442 3300005546 Bacteria 7323
153 Ga0070665_100000910 3300005548 Bacteria 37961
154 Ga0070665_100031166 3300005548 Bacteria 5367
155 Ga0070665_100456030 3300005548 Bacteria 1288
156 Ga0070665_100970124 3300005548 Bacteria 862
157 Ga0068855_100000348 3300005563 Bacteria 57384
158 Ga0068855_100019383 3300005563 Bacteria 8173
159 Ga0068855_100025693 3300005563 Bacteria 7044
160 Ga0068855_100032234 3300005563 Bacteria 6257
161 Ga0068855_100131291 3300005563 Bacteria 2860
162 Ga0068855_100251910 3300005563 Bacteria 1969
163 Ga0068855_100957316 3300005563 Bacteria 901
164 Ga0070664_100000464 3300005564 Bacteria 30816
165 Ga0070664_100011051 3300005564 Bacteria 7321
166 Ga0070664_100011994 3300005564 Bacteria 7038
167 Ga0070664_100080817 3300005564 Bacteria 2800
168 Ga0068857_100003653 3300005577 Bacteria 12894
169 Ga0068857_100005769 3300005577 Bacteria 10584
170 Ga0068857_100020316 3300005577 Bacteria 5840
171 Ga0068857_100137568 3300005577 Bacteria 2206
172 Ga0068857_100256497 3300005577 Bacteria 1604
173 Ga0068857_100413488 3300005577 Bacteria 1257
174 Ga0068854_100001166 3300005578 Bacteria 15765
175 Ga0068854_100042797 3300005578 Bacteria 3207
176 Ga0068854_100060480 3300005578 Bacteria 2741
177 Ga0068854_100112690 3300005578 Bacteria 2054
178 Ga0068854_100632525 3300005578 Bacteria 917
179 Ga0068856_100051429 3300005614 Bacteria 4062
180 Ga0068856_100257262 3300005614 Bacteria 1761
181 Ga0068856_100344135 3300005614 Bacteria 1509
182 Ga0068852_100001242 3300005616 Bacteria 16979
183 Ga0068852_100011416 3300005616 Bacteria 6687
184 Ga0068852_100088116 3300005616 Bacteria 2771
185 Ga0068852_100792987 3300005616 Bacteria 961
186 Ga0068859_100014918 3300005617 Bacteria 7801
187 Ga0068859_100032970 3300005617 Bacteria 5203
188 Ga0068859_100069045 3300005617 Bacteria 3568
189 Ga0068864_100000986 3300005618 Bacteria 23851
190 Ga0068864_100007881 3300005618 Bacteria 8778
191 Ga0068864_100020095 3300005618 Bacteria 5585
192 Ga0068864_100025785 3300005618 Bacteria 4955
193 Ga0068864_100451374 3300005618 Bacteria 1229
194 Ga0068866_10059942 3300005718 Bacteria 1971
195 Ga0068866_10493989 3300005718 Bacteria 808
196 Ga0068861_100027419 3300005719 Bacteria 4148
197 Ga0068851_10010919 3300005834 Bacteria 4248
198 Ga0068851_10038633 3300005834 Bacteria 2395
199 Ga0068863_100005345 3300005841 Bacteria 12666
200 Ga0068863_100014112 3300005841 Bacteria 7697
201 Ga0068863_100016593 3300005841 Bacteria 7067
202 Ga0068863_100017708 3300005841 Bacteria 6820
203 Ga0068863_100107279 3300005841 Bacteria 2657
204 Ga0068858_100008352 3300005842 Bacteria 9962
205 Ga0068858_100010205 3300005842 Bacteria 8913
206 Ga0068858_100019480 3300005842 Bacteria 6346
207 Ga0068860_100018040 3300005843 Bacteria 6872
208 Ga0068860_100027166 3300005843 Bacteria 5514
209 Ga0068860_100101228 3300005843 Bacteria 2749
210 Ga0068860_100136638 3300005843 Bacteria 2354
211 Ga0068860_100139000 3300005843 Bacteria 2333
212 Ga0068860_100342309 3300005843 Bacteria 1470
213 Ga0068860_101101404 3300005843 Bacteria 813
214 Ga0068862_100011955 3300005844 Bacteria 7171
215 Ga0068862_100012682 3300005844 Bacteria 6975
216 Ga0068862_100031211 3300005844 Bacteria 4496
217 Ga0068862_100054509 3300005844 Bacteria 3423
218 Ga0068862_100172430 3300005844 Bacteria 1937
219 Ga0070717_10032783 3300006028 Bacteria 4188
220 Ga0068871_100133100 3300006358 Bacteria 2110
221 Ga0075433_10040384 3300006852 Bacteria 4038
222 Ga0075434_100273456 3300006871 Bacteria 1708
223 Ga0068865_100015080 3300006881 Bacteria 4924
224 Ga0068865_101074199 3300006881 Bacteria 708
225 Ga0097620_100014918 3300006931 Bacteria 7801
226 Ga0097620_100032963 3300006931 Bacteria 5203
227 Ga0097620_100069046 3300006931 Bacteria 3568
228 Ga0105250_10023253 3300009092 Bacteria 2497
229 Ga0105240_10071968 3300009093 Bacteria 4274
230 Ga0111539_10528836 3300009094 Bacteria 1374
231 Ga0105245_10035663 3300009098 Bacteria 4415
232 Ga0105245_10414483 3300009098 Bacteria 1349
233 Ga0105247_10348072 3300009101 Bacteria 1041
234 Ga0105243_10014046 3300009148 Bacteria 6061
235 Ga0105243_10023919 3300009148 Bacteria 4655
236 Ga0105243_10081976 3300009148 Bacteria 2635
237 Ga0105241_10299108 3300009174 Bacteria 1380
238 Ga0105241_10505520 3300009174 Bacteria 1078
239 Ga0105248_10009131 3300009177 Bacteria 10906
240 Ga0105248_10015656 3300009177 Bacteria 8357
241 Ga0105248_10017397 3300009177 Bacteria 7926
242 Ga0105248_10018610 3300009177 Bacteria 7678
243 Ga0105248_10038332 3300009177 Bacteria 5363
244 Ga0105248_10045614 3300009177 Bacteria 4915
245 Ga0105237_10319578 3300009545 Bacteria 1556
246 Ga0105238_10048925 3300009551 Bacteria 4260
247 Ga0105238_10075558 3300009551 Bacteria 3361
248 Ga0105238_10514386 3300009551 Bacteria 1199
249 Ga0105238_10598788 3300009551 Bacteria 1110
250 Ga0105249_10004132 3300009553 Bacteria 12539
251 Ga0105249_10020929 3300009553 Bacteria 5850
252 Ga0105239_10063251 3300010375 Bacteria 4063
253 Ga0105239_10250933 3300010375 Bacteria 1987
254 Ga0105246_10076246 3300011119 Bacteria 2375
255 Ga0105246_10206160 3300011119 Bacteria 1532
256 Ga0157373_10014933 3300013100 Bacteria 5685
257 Ga0157373_10087790 3300013100 Bacteria 2191
258 Ga0157373_10145016 3300013100 Bacteria 1670
259 Ga0157373_10152475 3300013100 Bacteria 1626
260 Ga0157373_10173486 3300013100 Bacteria 1517
261 Ga0157371_10003605 3300013102 Bacteria 13952
262 Ga0157371_10018859 3300013102 Bacteria 5097
263 Ga0157371_10021995 3300013102 Bacteria 4681
264 Ga0157371_10034279 3300013102 Bacteria 3642
265 Ga0157371_10055107 3300013102 Bacteria 2821
266 Ga0157371_10224208 3300013102 Bacteria 1350
267 Ga0157371_10767537 3300013102 Bacteria 725
268 Ga0157370_10044569 3300013104 Bacteria 4262
269 Ga0157370_10048078 3300013104 Bacteria 4087
270 Ga0157370_10373989 3300013104 Bacteria 1313
271 Ga0157369_10046601 3300013105 Bacteria 4711
272 Ga0157369_10684948 3300013105 Bacteria 1056
273 Ga0157378_10004024 3300013297 Bacteria 12979
274 Ga0163162_10016652 3300013306 Bacteria 7185
275 Ga0163162_10076434 3300013306 Bacteria 3410
276 Ga0157372_10324137 3300013307 Bacteria 1794
277 Ga0157372_10710118 3300013307 Bacteria 1170
278 Ga0157375_10142007 3300013308 Bacteria 2529
279 Ga0157375_10592572 3300013308 Bacteria 1268
280 Ga0163163_10002274 3300014325 Bacteria 16195
281 Ga0157380_10000062 3300014326 Bacteria 61714
282 Ga0157380_10012605 3300014326 Bacteria 6133
283 Ga0157380_10043648 3300014326 Bacteria 3511
284 Ga0157380_10456344 3300014326 Bacteria 1229
285 Ga0182008_10135877 3300014497 Bacteria 1228
286 Ga0157379_10007825 3300014968 Bacteria 9254
287 Ga0206354_11155707 3300020081 Bacteria 3149
288 Ga0206353_10034428 3300020082 Bacteria 5197
289 Ga0154015_1501775 3300020610 Bacteria 815
290 Ga0209675_1000384 3300025291 Bacteria 36771
291 Ga0209676_1000421 3300025292 Bacteria 74706
292 Ga0209676_1000693 3300025292 Bacteria 47361
293 Ga0209676_1001736 3300025292 Bacteria 18672
294 Ga0209025_1010226 3300025294 Bacteria 6391
295 Ga0209758_1040983 3300025297 Bacteria 1739
296 Ga0209050_1000112 3300025298 Bacteria 210320
297 Ga0209257_1000600 3300025304 Bacteria 59824
298 Ga0207697_10000082 3300025315 Bacteria 41919
299 Ga0207656_10019799 3300025321 Bacteria 2665
300 Ga0207656_10077190 3300025321 Bacteria 1491
301 Ga0207688_10000446 3300025901 Bacteria 19571
302 Ga0207688_10062492 3300025901 Bacteria 2099
303 Ga0207688_10078702 3300025901 Bacteria 1879
304 Ga0207680_10057297 3300025903 Bacteria 2357
305 Ga0207680_10157372 3300025903 Bacteria 1520
306 Ga0207647_10000259 3300025904 Bacteria 43433
307 Ga0207647_10000559 3300025904 Bacteria 29551
308 Ga0207647_10011631 3300025904 Bacteria 6163
309 Ga0207647_10050514 3300025904 Bacteria 2574
310 Ga0207647_10122574 3300025904 Bacteria 1532
311 Ga0207645_10013857 3300025907 Bacteria 5410
312 Ga0207645_10014069 3300025907 Bacteria 5362
313 Ga0207645_10017964 3300025907 Bacteria 4664
314 Ga0207645_10039347 3300025907 Bacteria 3030
315 Ga0207645_10040814 3300025907 Bacteria 2972
316 Ga0207645_10061810 3300025907 Bacteria 2392
317 Ga0207645_10109354 3300025907 Bacteria 1788
318 Ga0207645_10115205 3300025907 Bacteria 1742
319 Ga0207645_10137078 3300025907 Bacteria 1594
320 Ga0207705_10000208 3300025909 Bacteria 59559
321 Ga0207705_10001651 3300025909 Bacteria 17706
322 Ga0207705_10008087 3300025909 Bacteria 7707
323 Ga0207705_10048160 3300025909 Bacteria 3065
324 Ga0207705_10051927 3300025909 Bacteria 2951
325 Ga0207705_10163648 3300025909 Bacteria 1672
326 Ga0207705_10224584 3300025909 Bacteria 1427
327 Ga0207705_10478767 3300025909 Bacteria 966
328 Ga0207705_10568595 3300025909 Bacteria 881
329 Ga0207654_10173133 3300025911 Bacteria 1403
330 Ga0207707_10117980 3300025912 Bacteria 2320
331 Ga0207707_10140795 3300025912 Bacteria 2109
332 Ga0207695_10053761 3300025913 Bacteria 4209
333 Ga0207660_10203731 3300025917 Bacteria 1546
334 Ga0207660_10263166 3300025917 Bacteria 1364
335 Ga0207660_10508902 3300025917 Bacteria 977
336 Ga0207657_10000284 3300025919 Bacteria 53982
337 Ga0207657_10001862 3300025919 Bacteria 22804
338 Ga0207657_10002637 3300025919 Bacteria 19364
339 Ga0207657_10007708 3300025919 Bacteria 10999
340 Ga0207657_10010079 3300025919 Bacteria 9447
341 Ga0207657_10014951 3300025919 Bacteria 7542
342 Ga0207657_10021157 3300025919 Bacteria 6129
343 Ga0207657_10057990 3300025919 Bacteria 3334
344 Ga0207657_10080788 3300025919 Bacteria 2732
345 Ga0207657_10350823 3300025919 Bacteria 1164
346 Ga0207649_10040316 3300025920 Bacteria 2837
347 Ga0207649_10154179 3300025920 Bacteria 1585
348 Ga0207649_10226871 3300025920 Bacteria 1334
349 Ga0207649_10327629 3300025920 Bacteria 1127
350 Ga0207649_10524177 3300025920 Bacteria 904
351 Ga0207649_10577663 3300025920 Bacteria 863
352 Ga0207652_10012439 3300025921 Bacteria 6878
353 Ga0207652_10091994 3300025921 Bacteria 2667
354 Ga0207652_10128231 3300025921 Bacteria 2261
355 Ga0207652_10174624 3300025921 Bacteria 1929
356 Ga0207652_10599049 3300025921 Bacteria 988
357 Ga0207681_10006047 3300025923 Bacteria 7423
358 Ga0207681_10057188 3300025923 Bacteria 2664
359 Ga0207681_10090117 3300025923 Bacteria 2188
360 Ga0207681_10486224 3300025923 Bacteria 1009
361 Ga0207681_10804091 3300025923 Bacteria 785
362 Ga0207694_10058306 3300025924 Bacteria 3003
363 Ga0207650_10001833 3300025925 Bacteria 15000
364 Ga0207650_10027695 3300025925 Bacteria 4058
365 Ga0207650_10036259 3300025925 Bacteria 3587
366 Ga0207659_10954949 3300025926 Bacteria 737
367 Ga0207687_10030752 3300025927 Bacteria 3623
368 Ga0207687_10188882 3300025927 Bacteria 1602
369 Ga0207700_10029593 3300025928 Bacteria 3866
370 Ga0207664_10078495 3300025929 Bacteria 2677
371 Ga0207644_10000151 3300025931 Bacteria 49728
372 Ga0207644_10000649 3300025931 Bacteria 21990
373 Ga0207644_10010655 3300025931 Bacteria 6061
374 Ga0207644_10115567 3300025931 Bacteria 2035
375 Ga0207690_10006603 3300025932 Bacteria 6871
376 Ga0207690_10024135 3300025932 Bacteria 3805
377 Ga0207690_10189764 3300025932 Bacteria 1554
378 Ga0207690_10231956 3300025932 Bacteria 1417
379 Ga0207690_10237542 3300025932 Bacteria 1402
380 Ga0207690_10244752 3300025932 Bacteria 1383
381 Ga0207690_10250530 3300025932 Bacteria 1368
382 Ga0207690_10329586 3300025932 Bacteria 1202
383 Ga0207690_10349071 3300025932 Bacteria 1169
384 Ga0207690_10406623 3300025932 Bacteria 1086
385 Ga0207690_10447404 3300025932 Bacteria 1038
386 Ga0207690_10996632 3300025932 Bacteria 697
387 Ga0207706_10001125 3300025933 Bacteria 27208
388 Ga0207706_10013317 3300025933 Bacteria 7483
389 Ga0207706_10013884 3300025933 Bacteria 7305
390 Ga0207706_10013903 3300025933 Bacteria 7300
391 Ga0207706_10021981 3300025933 Bacteria 5726
392 Ga0207706_10022201 3300025933 Bacteria 5696
393 Ga0207706_10024920 3300025933 Bacteria 5362
394 Ga0207706_10031520 3300025933 Bacteria 4723
395 Ga0207706_10068572 3300025933 Bacteria 3121
396 Ga0207706_10158550 3300025933 Bacteria 1990
397 Ga0207706_10186534 3300025933 Bacteria 1821
398 Ga0207709_10038883 3300025935 Bacteria 2837
399 Ga0207709_10279164 3300025935 Bacteria 1233
400 Ga0207670_10154461 3300025936 Bacteria 1706
401 Ga0207669_10373538 3300025937 Bacteria 1109
402 Ga0207704_10319864 3300025938 Bacteria 1196
403 Ga0207704_10678526 3300025938 Bacteria 851
404 Ga0207691_10004203 3300025940 Bacteria 13982
405 Ga0207691_10042467 3300025940 Bacteria 4191
406 Ga0207691_10089460 3300025940 Bacteria 2761
407 Ga0207691_10204522 3300025940 Bacteria 1717
408 Ga0207691_10688685 3300025940 Bacteria 862
409 Ga0207711_10000665 3300025941 Bacteria 34189
410 Ga0207711_10006008 3300025941 Bacteria 10261
411 Ga0207711_10007176 3300025941 Bacteria 9342
412 Ga0207711_10010757 3300025941 Bacteria 7608
413 Ga0207711_10072836 3300025941 Bacteria 2985
414 Ga0207711_10090559 3300025941 Bacteria 2689
415 Ga0207689_10000561 3300025942 Bacteria 35545
416 Ga0207689_10012928 3300025942 Bacteria 7127
417 Ga0207689_10040698 3300025942 Bacteria 3846
418 Ga0207661_10013866 3300025944 Bacteria 5890
419 Ga0207661_10021095 3300025944 Bacteria 4880
420 Ga0207661_10085278 3300025944 Bacteria 2618
421 Ga0207661_10263033 3300025944 Bacteria 1537
422 Ga0207679_10002863 3300025945 Bacteria 10700
423 Ga0207679_10008940 3300025945 Bacteria 6397
424 Ga0207679_10074157 3300025945 Bacteria 2577
425 Ga0207679_10099732 3300025945 Bacteria 2268
426 Ga0207679_10186245 3300025945 Bacteria 1721
427 Ga0207679_10638097 3300025945 Bacteria 962
428 Ga0207679_10972829 3300025945 Bacteria 778
429 Ga0207667_10000670 3300025949 Bacteria 44352
430 Ga0207667_10007898 3300025949 Bacteria 12707
431 Ga0207667_10067263 3300025949 Bacteria 3732
432 Ga0207667_10443261 3300025949 Bacteria 1320
433 Ga0207667_10458335 3300025949 Bacteria 1295
434 Ga0207667_10494986 3300025949 Bacteria 1240
435 Ga0207651_10016825 3300025960 Bacteria 4299
436 Ga0207651_10031344 3300025960 Bacteria 3397
437 Ga0207651_10073751 3300025960 Bacteria 2428
438 Ga0207651_10293601 3300025960 Bacteria 1349
439 Ga0207651_10294586 3300025960 Bacteria 1347
440 Ga0207651_10351465 3300025960 Bacteria 1241
441 Ga0207712_10000594 3300025961 Bacteria 28960
442 Ga0207712_10003474 3300025961 Bacteria 9950
443 Ga0207712_10062274 3300025961 Bacteria 2651
444 Ga0207668_10033073 3300025972 Bacteria 3423
445 Ga0207668_10106410 3300025972 Bacteria 2095
446 Ga0207668_10215094 3300025972 Bacteria 1539
447 Ga0207640_10002967 3300025981 Bacteria 9137
448 Ga0207640_10144110 3300025981 Bacteria 1741
449 Ga0207640_10171270 3300025981 Bacteria 1618
450 Ga0207640_10736660 3300025981 Bacteria 848
451 Ga0207658_10005726 3300025986 Bacteria 8496
452 Ga0207658_10012588 3300025986 Bacteria 5775
453 Ga0207658_10022209 3300025986 Bacteria 4415
454 Ga0207658_10028434 3300025986 Bacteria 3936
455 Ga0207658_10105060 3300025986 Bacteria 2220
456 Ga0207658_10137337 3300025986 Bacteria 1973
457 Ga0207658_10716277 3300025986 Bacteria 905
458 Ga0207677_10003171 3300026023 Bacteria 8683
459 Ga0207677_10119956 3300026023 Bacteria 1976
460 Ga0207677_10332170 3300026023 Bacteria 1267
461 Ga0207703_10001264 3300026035 Bacteria 23607
462 Ga0207703_10033936 3300026035 Bacteria 4047
463 Ga0207703_10044667 3300026035 Bacteria 3562
464 Ga0207639_10018484 3300026041 Bacteria 4954
465 Ga0207639_10055559 3300026041 Bacteria 3031
466 Ga0207639_10083620 3300026041 Bacteria 2534
467 Ga0207639_10090976 3300026041 Bacteria 2442
468 Ga0207639_11009289 3300026041 Bacteria 779
469 Ga0207678_10000918 3300026067 Bacteria 26949
470 Ga0207678_10002834 3300026067 Bacteria 15715
471 Ga0207678_10003157 3300026067 Bacteria 14905
472 Ga0207678_10058270 3300026067 Bacteria 3323
473 Ga0207678_10058536 3300026067 Bacteria 3315
474 Ga0207678_10135396 3300026067 Bacteria 2102
475 Ga0207678_10295468 3300026067 Bacteria 1392
476 Ga0207678_10398966 3300026067 Bacteria 1191
477 Ga0207678_10399905 3300026067 Bacteria 1189
478 Ga0207678_10466781 3300026067 Bacteria 1098
479 Ga0207702_10017951 3300026078 Bacteria 5854
480 Ga0207702_10075082 3300026078 Bacteria 2920
481 Ga0207702_10151120 3300026078 Bacteria 2112
482 Ga0207702_10906309 3300026078 Bacteria 874
483 Ga0207641_10022925 3300026088 Bacteria 5142
484 Ga0207641_10028116 3300026088 Bacteria 4644
485 Ga0207641_10041560 3300026088 Bacteria 3853
486 Ga0207641_10058494 3300026088 Bacteria 3280
487 Ga0207641_10163849 3300026088 Bacteria 2023
488 Ga0207648_10002485 3300026089 Bacteria 19787
489 Ga0207648_10035339 3300026089 Bacteria 4402
490 Ga0207648_10062448 3300026089 Bacteria 3247
491 Ga0207648_10592464 3300026089 Bacteria 1021
492 Ga0207676_10001742 3300026095 Bacteria 15995
493 Ga0207676_10006367 3300026095 Bacteria 8342
494 Ga0207676_10011438 3300026095 Bacteria 6342
495 Ga0207676_10034919 3300026095 Bacteria 3810
496 Ga0207676_10131444 3300026095 Bacteria 2129
497 Ga0207676_10151749 3300026095 Bacteria 1996
498 Ga0207674_10002685 3300026116 Bacteria 22206
499 Ga0207674_10005179 3300026116 Bacteria 15532
500 Ga0207674_10021322 3300026116 Bacteria 6980
501 Ga0207674_10031773 3300026116 Bacteria 5543
502 Ga0207674_10054076 3300026116 Bacteria 4089
503 Ga0207674_10061129 3300026116 Bacteria 3807
504 Ga0207675_100067971 3300026118 Bacteria 3331
505 Ga0207675_100994226 3300026118 Bacteria 857
506 Ga0207683_10010290 3300026121 Bacteria 7975
507 Ga0207683_10070654 3300026121 Bacteria 3085
508 Ga0207683_10404226 3300026121 Bacteria 1257
509 Ga0207698_10003601 3300026142 Bacteria 9354
510 Ga0207698_10009389 3300026142 Bacteria 6236
511 Ga0207698_10027098 3300026142 Bacteria 4064
512 Ga0207698_10091102 3300026142 Bacteria 2495
513 Ga0207698_10317402 3300026142 Bacteria 1458
514 Ga0207698_10650310 3300026142 Bacteria 1044
515 Ga0207698_10694098 3300026142 Bacteria 1012
516 Ga0207698_10760635 3300026142 Bacteria 968
517 Ga0209984_1006046 3300027424 Bacteria 1475
518 Ga0209971_1004722 3300027682 Bacteria 3232
519 Ga0209974_10005408 3300027876 Bacteria 4494
520 Ga0209974_10009096 3300027876 Bacteria 3377
521 Ga0268266_10000458 3300028379 Bacteria 59553
522 Ga0268266_10044171 3300028379 Bacteria 3809
523 Ga0268266_10048625 3300028379 Bacteria 3636
524 Ga0268266_10109549 3300028379 Bacteria 2445
525 Ga0268266_10436323 3300028379 Bacteria 1243
526 Ga0268266_11052021 3300028379 Bacteria 787
527 Ga0268265_10007310 3300028380 Bacteria 7455
528 Ga0268265_10015977 3300028380 Bacteria 5151
529 Ga0268265_10052909 3300028380 Bacteria 3073
530 Ga0268265_10078342 3300028380 Bacteria 2599
531 Ga0268265_10604431 3300028380 Bacteria 1048
532 Ga0268264_10004182 3300028381 Bacteria 12331
533 Ga0268264_10004643 3300028381 Bacteria 11672
534 Ga0268264_10030408 3300028381 Bacteria 4426
535 Ga0268264_10161592 3300028381 Bacteria 2018
536 Ga0268264_10277850 3300028381 Bacteria 1567
537 Ga0307408_100014095 3300031548 Bacteria 5311
538 Ga0307408_100054924 3300031548 Bacteria 2881
539 Ga0307408_100205969 3300031548 Bacteria 1595
540 Ga0307408_100365245 3300031548 Bacteria 1229
541 Ga0307408_100494373 3300031548 Bacteria 1070
542 Ga0307408_101285865 3300031548 Bacteria 685
543 Ga0307405_10021072 3300031731 Bacteria 3658
544 Ga0307405_10110386 3300031731 Bacteria 1862
545 Ga0307405_10146192 3300031731 Bacteria 1656
546 Ga0307405_10169082 3300031731 Bacteria 1557
547 Ga0307405_10383880 3300031731 Bacteria 1094
548 Ga0307405_10559906 3300031731 Bacteria 926
549 Ga0307413_10023426 3300031824 Bacteria 3346
550 Ga0307413_10046517 3300031824 Bacteria 2580
551 Ga0307413_10077304 3300031824 Bacteria 2119
552 Ga0307413_10079428 3300031824 Bacteria 2097
553 Ga0307413_10128630 3300031824 Bacteria 1729
554 Ga0307413_10129317 3300031824 Bacteria 1725
555 Ga0307413_10245415 3300031824 Bacteria 1325
556 Ga0307413_10430509 3300031824 Bacteria 1042
557 Ga0307410_10023280 3300031852 Bacteria 3847
558 Ga0307410_10033637 3300031852 Bacteria 3311
559 Ga0307410_10041185 3300031852 Bacteria 3045
560 Ga0307410_10043006 3300031852 Bacteria 2990
561 Ga0307410_10056045 3300031852 Bacteria 2678
562 Ga0307410_10084279 3300031852 Bacteria 2240
563 Ga0307410_10104191 3300031852 Bacteria 2039
564 Ga0307410_10123438 3300031852 Bacteria 1892
565 Ga0307410_10364442 3300031852 Bacteria 1158
566 Ga0307410_10411833 3300031852 Bacteria 1094
567 Ga0307406_10020731 3300031901 Bacteria 3877
568 Ga0307406_10268186 3300031901 Unclassified 1295
569 Ga0307406_10315194 3300031901 Bacteria 1207
570 Ga0307406_10958772 3300031901 Bacteria 731
571 Ga0307407_10024748 3300031903 Bacteria 3153
572 Ga0307407_10044148 3300031903 Bacteria 2510
573 Ga0307407_10052351 3300031903 Bacteria 2344
574 Ga0307407_10230642 3300031903 Bacteria 1257
575 Ga0307407_10240556 3300031903 Bacteria 1234
576 Ga0307407_10444596 3300031903 Bacteria 939
577 Ga0307412_10005832 3300031911 Bacteria 6929
578 Ga0307412_10009146 3300031911 Bacteria 5677
579 Ga0307412_10010159 3300031911 Bacteria 5415
580 Ga0307412_10015207 3300031911 Bacteria 4555
581 Ga0307412_10050561 3300031911 Bacteria 2743
582 Ga0307412_10053820 3300031911 Bacteria 2669
583 Ga0307412_10070737 3300031911 Bacteria 2379
584 Ga0307412_10075489 3300031911 Bacteria 2312
585 Ga0307412_10282716 3300031911 Bacteria 1303
586 Ga0307412_10329921 3300031911 Bacteria 1217
587 Ga0307409_100063703 3300031995 Bacteria 2892
588 Ga0307409_100130352 3300031995 Bacteria 2147
589 Ga0307409_100149129 3300031995 Bacteria 2028
590 Ga0307409_100300996 3300031995 Bacteria 1492
591 Ga0307409_100308981 3300031995 Bacteria 1474
592 Ga0307409_100360104 3300031995 Bacteria 1376
593 Ga0307416_100017877 3300032002 Bacteria 4977
594 Ga0307416_100044295 3300032002 Bacteria 3492
595 Ga0307416_100069215 3300032002 Bacteria 2919
596 Ga0307416_100081148 3300032002 Bacteria 2741
597 Ga0307416_100130266 3300032002 Bacteria 2263
598 Ga0307416_100133628 3300032002 Bacteria 2239
599 Ga0307416_100316214 3300032002 Bacteria 1561
600 Ga0307416_101516922 3300032002 Bacteria 776
601 Ga0307414_10026742 3300032004 Bacteria 3718
602 Ga0307414_10042776 3300032004 Bacteria 3080
603 Ga0307414_10045198 3300032004 Bacteria 3014
604 Ga0307414_10068246 3300032004 Bacteria 2550
605 Ga0307414_10082120 3300032004 Bacteria 2362
606 Ga0307414_10104944 3300032004 Bacteria 2135
607 Ga0307411_10029671 3300032005 Bacteria 3343
608 Ga0307411_10050258 3300032005 Bacteria 2714
609 Ga0307411_10071935 3300032005 Bacteria 2346
610 Ga0307411_10076095 3300032005 Bacteria 2293
611 Ga0307411_10095040 3300032005 Bacteria 2091
612 Ga0307411_10097861 3300032005 Bacteria 2066
613 Ga0307411_10131053 3300032005 Bacteria 1832
614 Ga0307415_100004299 3300032126 Bacteria 7374
615 Ga0307415_100007649 3300032126 Bacteria 5927
616 Ga0307415_100054013 3300032126 Bacteria 2740
617 Ga0307415_100065212 3300032126 Bacteria 2537
618 Ga0307415_100098848 3300032126 Bacteria 2134
619 Ga0307415_100100324 3300032126 Bacteria 2121
620 Ga0307415_100140431 3300032126 Bacteria 1844
621 Ga0307415_100175854 3300032126 Bacteria 1674
622 Ga0307415_100364303 3300032126 Bacteria 1221
623 Ga0307415_100533840 3300032126 Bacteria 1032
624 Ga0307415_101266756 3300032126 Bacteria 697
625 Ga0373943_0424569 3300035170 Bacteria 770
626 Ga0373935_0025493 3300035692 Bacteria 3644
627 Ga0395899_0000162 3300037312 Bacteria 102362
628 Ga0395899_0001939 3300037312 Bacteria 17035
629 Ga0395899_0014094 3300037312 Bacteria 6103
630 Ga0395899_0018881 3300037312 Bacteria 5240
631 Ga0395899_0053690 3300037312 Bacteria 2982
632 Ga0395899_0095724 3300037312 Bacteria 2147
633 Ga0395899_0150269 3300037312 Bacteria 1651
634 Ga0395899_0176349 3300037312 Bacteria 1503
635 Ga0395899_0635292 3300037312 Bacteria 676
636 Ga0395899_0645996 3300037312 Bacteria 669
637 Ga0395900_0000129 3300037418 Bacteria 126281
638 Ga0395900_0001134 3300037418 Bacteria 33662
639 Ga0395900_0003531 3300037418 Bacteria 16821
640 Ga0395900_0004336 3300037418 Bacteria 15050
641 Ga0395900_0009452 3300037418 Bacteria 9992
642 Ga0395900_0045713 3300037418 Bacteria 4509
643 Ga0395900_0062328 3300037418 Bacteria 3833
644 Ga0395900_0081187 3300037418 Bacteria 3331
645 Ga0395900_0103635 3300037418 Bacteria 2922
646 Ga0395900_0108784 3300037418 Bacteria 2848
647 Ga0395900_0294363 3300037418 Bacteria 1611
648 Ga0395900_0379720 3300037418 Bacteria 1381
649 Ga0395900_0642248 3300037418 Bacteria 999
650 Ga0395900_0835282 3300037418 Bacteria 847
651 Ga0395898_0012813 3300037466 Bacteria 8656
652 Ga0395898_0021649 3300037466 Bacteria 6517
653 Ga0395898_0051551 3300037466 Bacteria 4023
654 Ga0395898_0104116 3300037466 Bacteria 2722
655 Ga0395898_0170977 3300037466 Bacteria 2077
656 Ga0395898_0301178 3300037466 Bacteria 1529
657 Ga0395898_0433427 3300037466 Bacteria 1252
658 Ga0395898_0529241 3300037466 Bacteria 1120
659 Ga0395898_0814910 3300037466 Bacteria 873
660 Ga0395905_0001888 3300037471 Bacteria 24158
661 Ga0395905_0001997 3300037471 Bacteria 23312
662 Ga0395905_0004499 3300037471 Bacteria 14448
663 Ga0395905_0006735 3300037471 Bacteria 11506
664 Ga0395905_0014251 3300037471 Bacteria 7595
665 Ga0395905_0016636 3300037471 Bacteria 6991
666 Ga0395905_0035788 3300037471 Bacteria 4663
667 Ga0395905_0060550 3300037471 Bacteria 3540
668 Ga0395905_0083865 3300037471 Bacteria 2985
669 Ga0395905_0091575 3300037471 Bacteria 2851
670 Ga0395905_0175109 3300037471 Bacteria 2014
671 Ga0395905_0178748 3300037471 Bacteria 1992
672 Ga0395905_0315375 3300037471 Bacteria 1453
673 Ga0395905_0482194 3300037471 Bacteria 1139
674 Ga0395905_0632684 3300037471 Bacteria 972
675 Ga0395905_0649456 3300037471 Bacteria 957
676 Ga0395905_0828571 3300037471 Bacteria 828
677 Ga0395905_0988231 3300037471 Bacteria 745
678 Ga0395901_0000111 3300038443 Bacteria 112522
679 Ga0395901_0002513 3300038443 Bacteria 18561
680 Ga0395901_0028578 3300038443 Bacteria 5735
681 Ga0395901_0036368 3300038443 Bacteria 5089
682 Ga0395901_0129661 3300038443 Bacteria 2649
683 Ga0395901_0153405 3300038443 Bacteria 2419
684 Ga0395901_0223096 3300038443 Bacteria 1969
685 Ga0395901_0458359 3300038443 Bacteria 1303
686 Ga0395901_0991717 3300038443 Bacteria 816
687 Ga0395901_1040387 3300038443 Bacteria 792
688 Ga0439465_0073350 3300041413 Bacteria 1150
689 Ga0451835_0066670 3300041492 Bacteria 653
690 Ga0439432_010753 3300042006 Bacteria 3164
691 Ga0439432_020938 3300042006 Bacteria 2171
692 Ga0439432_039753 3300042006 Bacteria 1494
693 Ga0439449_0059304 3300042007 Bacteria 1413
694 Ga0450914_010170 3300042118 Bacteria 904
695 Ga0450890_001357 3300042127 Bacteria 3538
696 Ga0450905_001817 3300042142 Bacteria 2727
697 Ga0439458_0000074 3300042157 Bacteria 18402
698 Ga0439458_0000203 3300042157 Bacteria 13755
699 Ga0466969_0038320 3300044656 Bacteria 2413
700 Ga0466969_0064445 3300044656 Bacteria 1774
701 Ga0466966_0120518 3300044684 Bacteria 1611
702 Ga0466963_0015835 3300044694 Bacteria 4680
703 Ga0466963_0020306 3300044694 Bacteria 4176
704 Ga0466963_0152736 3300044694 Bacteria 1604
705 Ga0466963_0154325 3300044694 Bacteria 1595
706 Ga0466964_0038138 3300044706 Bacteria 1931
707 Ga0466964_0110801 3300044706 Bacteria 1224
708 Ga0466971_0031636 3300044719 Bacteria 2369
709 Ga0466970_0040748 3300044765 Bacteria 2466
710 Ga0466957_0057451 3300044842 Bacteria 2381
711 Ga0466957_0652752 3300044842 Bacteria 740
712 Ga0466959_0068115 3300045049 Bacteria 2579
713 Ga0466958_0044967 3300045836 Bacteria 2662
714 Ga0466967_0008219 3300045976 Bacteria 7622
715 Ga0466967_0055571 3300045976 Bacteria 3487
716 Ga0466967_0107115 3300045976 Bacteria 2563
717 Ga0466967_0368703 3300045976 Bacteria 1392
718 Ga0466967_0404147 3300045976 Bacteria 1329
719 Ga0466967_0567786 3300045976 Bacteria 1118
720 Ga0495663_0002141 3300046525 Bacteria 6025
721 Ga0495663_0012207 3300046525 Bacteria 2394
722 Ga0495598_0009247 3300046537 Bacteria 2323
723 Ga0495621_0026361 3300046539 Bacteria 1960
724 Ga0495668_0246361 3300046616 Bacteria 978
725 Ga0495625_0000339 3300046660 Bacteria 71474
726 Ga0495669_0004210 3300046684 Bacteria 5923
727 Ga0495669_0011798 3300046684 Bacteria 3715
728 Ga0495669_0049091 3300046684 Bacteria 1889
729 Ga0495669_0122194 3300046684 Bacteria 1221
730 Ga0495670_0016628 3300046691 Bacteria 3617
731 Ga0495683_0064166 3300047323 Bacteria 1814
732 Ga0495677_0008339 3300047445 Bacteria 3852
733 Ga0495677_0189683 3300047445 Bacteria 798
734 Ga0496100_0640491 3300048903 Bacteria 827
735 Ga0496102_0000049 3300048905 Bacteria 179480
736 Ga0496103_0000037 3300048906 Bacteria 179474
737 Ga0496106_0516999 3300048909 Bacteria 959
738 Ga0496107_0118472 3300048910 Bacteria 1950
739 Ga0496107_0166360 3300048910 Bacteria 1635
740 Ga0496107_0343020 3300048910 Bacteria 1111
741 Ga0496108_0018939 3300048911 Bacteria 5645
742 Ga0496109_0119764 3300048912 Bacteria 2451
743 Ga0496109_0387907 3300048912 Bacteria 1320
744 Ga0496110_0004837 3300048913 Bacteria 10498
745 Ga0496111_0028001 3300048914 Bacteria 3992
746 Ga0496112_0006215 3300048915 Bacteria 10459
747 Ga0496112_0010453 3300048915 Bacteria 8419
748 Ga0496112_0075557 3300048915 Bacteria 3332
749 Ga0496112_0151353 3300048915 Bacteria 2287
750 Ga0496113_0012009 3300048916 Bacteria 5808
751 Ga0496113_0429438 3300048916 Bacteria 1061
752 Ga0496116_0001001 3300048919 Bacteria 34554
753 Ga0496117_0000115 3300048920 Bacteria 179488
754 Ga0496118_0000086 3300048921 Bacteria 179488
755 Ga0496119_0053377 3300048922 Bacteria 2469
756 Ga0496124_0000102 3300048927 Bacteria 179488
757 Ga0501298_041098 3300049521 Bacteria 938
758 Ga0501311_059276 3300049527 Bacteria 615
759 Ga0501336_011766 3300049552 Bacteria 716
760 Ga0501031_0316686 3300049568 Bacteria 1011
761 Ga0501038_0419319 3300049574 Bacteria 1033
762 Ga0501067_0047530 3300049583 Bacteria 2380
763 Ga0501070_0422290 3300049586 Bacteria 1077
764 Ga0501075_0877939 3300049591 Bacteria 682
765 Ga0501223_067626 3300049663 Bacteria 703
766 Ga0501242_017501 3300049674 Bacteria 905
767 Ga0501083_0804523 3300049744 Bacteria 612
768 Ga0501268_038394 3300049765 Bacteria 893
769 Ga0501270_009364 3300049767 Bacteria 1263
770 Ga0501273_005844 3300049770 Bacteria 1405
771 Ga0501273_032476 3300049770 Bacteria 748
772 nmdc:mga00v17_637848_c1 3300050491 Bacteria 685
773 nmdc:mga08y16_60968_c1 3300050511 Bacteria 3939
774 nmdc:mga0n895_274384_c1 3300050512 Bacteria 1710
775 nmdc:mga0rr50_106881_c1 3300050513 Bacteria 2208
776 nmdc:mga0a205_70699_c1 3300050515 Bacteria 3370
777 Ga0500658_0000037 3300053134 Bacteria 84326
778 Ga0466962_0014827 3300061719 Bacteria 3754
779 2852657066 2852653556 Bacteria 4050083
780 2852683757 2852680915 Bacteria 4100189
781 Ga0395905_0263967
782 SwRhRL3b_contig_1116789
783 JGI24736J21556_1006620
784 JGI24740J21852_10028451
785 JGI24740J21852_10073743
786 JGI24739J22299_10000665
787 JGI24739J22299_10020794
788 JGI24737J22298_10000557
789 JGI24737J22298_10003095
790 JGI24743J22301_10037491
791 JGI24735J21928_10002448
792 JGI24738J21930_10007900
793 JGI24738J21930_10018425
794 Ga0055536_1010679
795 Ga0055534_1006405
796 Ga0055530_10000465
797 Ga0055531_10001005
798 Ga0065704_10124776
799 Ga0065707_10081814
800 Ga0070658_10004771
801 Ga0070658_10017951
802 Ga0070658_10025337
803 Ga0070658_10041960
804 Ga0070658_10164976
805 Ga0070658_10283476
806 Ga0070658_10539184
807 Ga0070658_10672490
808 Ga0070676_10029351
809 Ga0070676_10067845
810 Ga0070676_10260830
811 Ga0070683_100029136
812 Ga0070683_100034172
813 Ga0070683_100076965
814 Ga0070683_100125675
815 Ga0070683_100201881
816 Ga0070670_100033815
817 Ga0070670_100167167
818 Ga0070670_100555959
819 Ga0068869_100028161
820 Ga0068869_100038426
821 Ga0070666_10003290
822 Ga0070666_10291056
823 Ga0070680_100007602
824 Ga0070680_100105284
825 Ga0070680_100351110
826 Ga0068868_100001497
827 Ga0068868_100006245
828 Ga0068868_100045650
829 Ga0068868_100486587
830 Ga0068868_100604793
831 Ga0070660_100001079
832 Ga0070660_100001588
833 Ga0070660_100012165
834 Ga0070660_100032905
835 Ga0070660_100101515
836 Ga0070660_100248079
837 Ga0070660_100857457
838 Ga0070689_100526010
839 Ga0070661_100025639
840 Ga0070661_100050925
841 Ga0070661_100091502
842 Ga0070661_100098461
843 Ga0070661_100587053
844 Ga0070692_10002252
845 Ga0070692_10002478
846 Ga0070692_10013073
847 Ga0070692_10029359
848 Ga0070668_100020062
849 Ga0070668_100256180
850 Ga0070668_100563746
851 Ga0070669_100006995
852 Ga0070669_100070671
853 Ga0070669_100091119
854 Ga0070669_100814687
855 Ga0070671_100000972
856 Ga0070671_100009588
857 Ga0070671_100010307
858 Ga0070671_100022059
859 Ga0070671_100130155
860 Ga0070674_100379079
861 Ga0070674_100549006
862 Ga0070673_100008938
863 Ga0070673_100090976
864 Ga0070673_100137914
865 Ga0070673_100243023
866 Ga0070673_100299117
867 Ga0070673_100613296
868 Ga0070659_100003269
869 Ga0070659_100013747
870 Ga0070659_100018189
871 Ga0070659_100018789
872 Ga0070659_100044540
873 Ga0070659_100108042
874 Ga0070659_100169132
875 Ga0070659_100202256
876 Ga0070667_100004430
877 Ga0070667_100004674
878 Ga0070667_100008465
879 Ga0070667_100051525
880 Ga0070667_100121652
881 Ga0070667_100793066
882 Ga0070667_101131158
883 Ga0070709_10563038
884 Ga0070714_100055765
885 Ga0070713_100014782
886 Ga0070694_100005040
887 Ga0070694_100949957
888 Ga0070663_100007307
889 Ga0070663_100012043
890 Ga0070663_100038724
891 Ga0070663_100047050
892 Ga0070663_100300179
893 Ga0070663_100376212
894 Ga0070663_100472734
895 Ga0070678_100005628
896 Ga0070678_100038873
897 Ga0070662_100004126
898 Ga0070662_100027617
899 Ga0070662_100034491
900 Ga0070662_100046588
901 Ga0070662_100070100
902 Ga0070662_100081421
903 Ga0070662_100084432
904 Ga0070662_100100682
905 Ga0070662_100248784
906 Ga0070662_100261986
907 Ga0070662_100393399
908 Ga0070662_100797769
909 Ga0070681_10067399
910 Ga0070681_10265942
911 Ga0070681_10271252
912 Ga0070681_10485995
913 Ga0068867_100003921
914 Ga0068867_100007261
915 Ga0068867_100251072
916 Ga0070685_10256271
917 Ga0070679_100018094
918 Ga0070679_100030368
919 Ga0070679_100041596
920 Ga0070679_100786405
921 Ga0070684_100016831
922 Ga0070684_100420909
923 Ga0068853_100018832
924 Ga0068853_100036153
925 Ga0068853_100108807
926 Ga0068853_100333865
927 Ga0068853_100628701
928 Ga0070672_100015110
929 Ga0070672_100016848
930 Ga0070672_100685011
931 Ga0070696_100004575
932 Ga0070696_100007442
933 Ga0070665_100000910
934 Ga0070665_100031166
935 Ga0070665_100456030
936 Ga0070665_100970124
937 Ga0068855_100000348
938 Ga0068855_100019383
939 Ga0068855_100025693
940 Ga0068855_100032234
941 Ga0068855_100131291
942 Ga0068855_100251910
943 Ga0068855_100957316
944 Ga0070664_100000464
945 Ga0070664_100011051
946 Ga0070664_100011994
947 Ga0070664_100080817
948 Ga0068857_100003653
949 Ga0068857_100005769
950 Ga0068857_100020316
951 Ga0068857_100137568
952 Ga0068857_100256497
953 Ga0068857_100413488
954 Ga0068854_100001166
955 Ga0068854_100042797
956 Ga0068854_100060480
957 Ga0068854_100112690
958 Ga0068854_100632525
959 Ga0068856_100051429
960 Ga0068856_100257262
961 Ga0068856_100344135
962 Ga0068852_100001242
963 Ga0068852_100011416
964 Ga0068852_100088116
965 Ga0068852_100792987
966 Ga0068859_100014918
967 Ga0068859_100032970
968 Ga0068859_100069045
969 Ga0068864_100000986
970 Ga0068864_100007881
971 Ga0068864_100020095
972 Ga0068864_100025785
973 Ga0068864_100451374
974 Ga0068866_10059942
975 Ga0068866_10493989
976 Ga0068861_100027419
977 Ga0068851_10010919
978 Ga0068851_10038633
979 Ga0068863_100005345
980 Ga0068863_100014112
981 Ga0068863_100016593
982 Ga0068863_100017708
983 Ga0068863_100107279
984 Ga0068858_100008352
985 Ga0068858_100010205
986 Ga0068858_100019480
987 Ga0068860_100018040
988 Ga0068860_100027166
989 Ga0068860_100101228
990 Ga0068860_100136638
991 Ga0068860_100139000
992 Ga0068860_100342309
993 Ga0068860_101101404
994 Ga0068862_100011955
995 Ga0068862_100012682
996 Ga0068862_100031211
997 Ga0068862_100054509
998 Ga0068862_100172430
999 Ga0070717_10032783
1000 Ga0068871_100133100
1001 Ga0075433_10040384
1002 Ga0075434_100273456
1003 Ga0068865_100015080
1004 Ga0068865_101074199
1005 Ga0097620_100014918
1006 Ga0097620_100032963
1007 Ga0097620_100069046
1008 Ga0105250_10023253
1009 Ga0105240_10071968
1010 Ga0111539_10528836
1011 Ga0105245_10035663
1012 Ga0105245_10414483
1013 Ga0105247_10348072
1014 Ga0105243_10014046
1015 Ga0105243_10023919
1016 Ga0105243_10081976
1017 Ga0105241_10299108
1018 Ga0105241_10505520
1019 Ga0105248_10009131
1020 Ga0105248_10015656
1021 Ga0105248_10017397
1022 Ga0105248_10018610
1023 Ga0105248_10038332
1024 Ga0105248_10045614
1025 Ga0105237_10319578
1026 Ga0105238_10048925
1027 Ga0105238_10075558
1028 Ga0105238_10514386
1029 Ga0105238_10598788
1030 Ga0105249_10004132
1031 Ga0105249_10020929
1032 Ga0105239_10063251
1033 Ga0105239_10250933
1034 Ga0105246_10076246
1035 Ga0105246_10206160
1036 Ga0157373_10014933
1037 Ga0157373_10087790
1038 Ga0157373_10145016
1039 Ga0157373_10152475
1040 Ga0157373_10173486
1041 Ga0157371_10003605
1042 Ga0157371_10018859
1043 Ga0157371_10021995
1044 Ga0157371_10034279
1045 Ga0157371_10055107
1046 Ga0157371_10224208
1047 Ga0157371_10767537
1048 Ga0157370_10044569
1049 Ga0157370_10048078
1050 Ga0157370_10373989
1051 Ga0157369_10046601
1052 Ga0157369_10684948
1053 Ga0157378_10004024
1054 Ga0163162_10016652
1055 Ga0163162_10076434
1056 Ga0157372_10324137
1057 Ga0157372_10710118
1058 Ga0157375_10142007
1059 Ga0157375_10592572
1060 Ga0163163_10002274
1061 Ga0157380_10000062
1062 Ga0157380_10012605
1063 Ga0157380_10043648
1064 Ga0157380_10456344
1065 Ga0182008_10135877
1066 Ga0157379_10007825
1067 Ga0206354_11155707
1068 Ga0206353_10034428
1069 Ga0154015_1501775
1070 Ga0209675_1000384
1071 Ga0209676_1000421
1072 Ga0209676_1000693
1073 Ga0209676_1001736
1074 Ga0209025_1010226
1075 Ga0209758_1040983
1076 Ga0209050_1000112
1077 Ga0209257_1000600
1078 Ga0207697_10000082
1079 Ga0207656_10019799
1080 Ga0207656_10077190
1081 Ga0207688_10000446
1082 Ga0207688_10062492
1083 Ga0207688_10078702
1084 Ga0207680_10057297
1085 Ga0207680_10157372
1086 Ga0207647_10000259
1087 Ga0207647_10000559
1088 Ga0207647_10011631
1089 Ga0207647_10050514
1090 Ga0207647_10122574
1091 Ga0207645_10013857
1092 Ga0207645_10014069
1093 Ga0207645_10017964
1094 Ga0207645_10039347
1095 Ga0207645_10040814
1096 Ga0207645_10061810
1097 Ga0207645_10109354
1098 Ga0207645_10115205
1099 Ga0207645_10137078
1100 Ga0207705_10000208
1101 Ga0207705_10001651
1102 Ga0207705_10008087
1103 Ga0207705_10048160
1104 Ga0207705_10051927
1105 Ga0207705_10163648
1106 Ga0207705_10224584
1107 Ga0207705_10478767
1108 Ga0207705_10568595
1109 Ga0207654_10173133
1110 Ga0207707_10117980
1111 Ga0207707_10140795
1112 Ga0207695_10053761
1113 Ga0207660_10203731
1114 Ga0207660_10263166
1115 Ga0207660_10508902
1116 Ga0207657_10000284
1117 Ga0207657_10001862
1118 Ga0207657_10002637
1119 Ga0207657_10007708
1120 Ga0207657_10010079
1121 Ga0207657_10014951
1122 Ga0207657_10021157
1123 Ga0207657_10057990
1124 Ga0207657_10080788
1125 Ga0207657_10350823
1126 Ga0207649_10040316
1127 Ga0207649_10154179
1128 Ga0207649_10226871
1129 Ga0207649_10327629
1130 Ga0207649_10524177
1131 Ga0207649_10577663
1132 Ga0207652_10012439
1133 Ga0207652_10091994
1134 Ga0207652_10128231
1135 Ga0207652_10174624
1136 Ga0207652_10599049
1137 Ga0207681_10006047
1138 Ga0207681_10057188
1139 Ga0207681_10090117
1140 Ga0207681_10486224
1141 Ga0207681_10804091
1142 Ga0207694_10058306
1143 Ga0207650_10001833
1144 Ga0207650_10027695
1145 Ga0207650_10036259
1146 Ga0207659_10954949
1147 Ga0207687_10030752
1148 Ga0207687_10188882
1149 Ga0207700_10029593
1150 Ga0207664_10078495
1151 Ga0207644_10000151
1152 Ga0207644_10000649
1153 Ga0207644_10010655
1154 Ga0207644_10115567
1155 Ga0207690_10006603
1156 Ga0207690_10024135
1157 Ga0207690_10189764
1158 Ga0207690_10231956
1159 Ga0207690_10237542
1160 Ga0207690_10244752
1161 Ga0207690_10250530
1162 Ga0207690_10329586
1163 Ga0207690_10349071
1164 Ga0207690_10406623
1165 Ga0207690_10447404
1166 Ga0207690_10996632
1167 Ga0207706_10001125
1168 Ga0207706_10013317
1169 Ga0207706_10013884
1170 Ga0207706_10013903
1171 Ga0207706_10021981
1172 Ga0207706_10022201
1173 Ga0207706_10024920
1174 Ga0207706_10031520
1175 Ga0207706_10068572
1176 Ga0207706_10158550
1177 Ga0207706_10186534
1178 Ga0207709_10038883
1179 Ga0207709_10279164
1180 Ga0207670_10154461
1181 Ga0207669_10373538
1182 Ga0207704_10319864
1183 Ga0207704_10678526
1184 Ga0207691_10004203
1185 Ga0207691_10042467
1186 Ga0207691_10089460
1187 Ga0207691_10204522
1188 Ga0207691_10688685
1189 Ga0207711_10000665
1190 Ga0207711_10006008
1191 Ga0207711_10007176
1192 Ga0207711_10010757
1193 Ga0207711_10072836
1194 Ga0207711_10090559
1195 Ga0207689_10000561
1196 Ga0207689_10012928
1197 Ga0207689_10040698
1198 Ga0207661_10013866
1199 Ga0207661_10021095
1200 Ga0207661_10085278
1201 Ga0207661_10263033
1202 Ga0207679_10002863
1203 Ga0207679_10008940
1204 Ga0207679_10074157
1205 Ga0207679_10099732
1206 Ga0207679_10186245
1207 Ga0207679_10638097
1208 Ga0207679_10972829
1209 Ga0207667_10000670
1210 Ga0207667_10007898
1211 Ga0207667_10067263
1212 Ga0207667_10443261
1213 Ga0207667_10458335
1214 Ga0207667_10494986
1215 Ga0207651_10016825
1216 Ga0207651_10031344
1217 Ga0207651_10073751
1218 Ga0207651_10293601
1219 Ga0207651_10294586
1220 Ga0207651_10351465
1221 Ga0207712_10000594
1222 Ga0207712_10003474
1223 Ga0207712_10062274
1224 Ga0207668_10033073
1225 Ga0207668_10106410
1226 Ga0207668_10215094
1227 Ga0207640_10002967
1228 Ga0207640_10144110
1229 Ga0207640_10171270
1230 Ga0207640_10736660
1231 Ga0207658_10005726
1232 Ga0207658_10012588
1233 Ga0207658_10022209
1234 Ga0207658_10028434
1235 Ga0207658_10105060
1236 Ga0207658_10137337
1237 Ga0207658_10716277
1238 Ga0207677_10003171
1239 Ga0207677_10119956
1240 Ga0207677_10332170
1241 Ga0207703_10001264
1242 Ga0207703_10033936
1243 Ga0207703_10044667
1244 Ga0207639_10018484
1245 Ga0207639_10055559
1246 Ga0207639_10083620
1247 Ga0207639_10090976
1248 Ga0207639_11009289
1249 Ga0207678_10000918
1250 Ga0207678_10002834
1251 Ga0207678_10003157
1252 Ga0207678_10058270
1253 Ga0207678_10058536
1254 Ga0207678_10135396
1255 Ga0207678_10295468
1256 Ga0207678_10398966
1257 Ga0207678_10399905
1258 Ga0207678_10466781
1259 Ga0207702_10017951
1260 Ga0207702_10075082
1261 Ga0207702_10151120
1262 Ga0207702_10906309
1263 Ga0207641_10022925
1264 Ga0207641_10028116
1265 Ga0207641_10041560
1266 Ga0207641_10058494
1267 Ga0207641_10163849
1268 Ga0207648_10002485
1269 Ga0207648_10035339
1270 Ga0207648_10062448
1271 Ga0207648_10592464
1272 Ga0207676_10001742
1273 Ga0207676_10006367
1274 Ga0207676_10011438
1275 Ga0207676_10034919
1276 Ga0207676_10131444
1277 Ga0207676_10151749
1278 Ga0207674_10002685
1279 Ga0207674_10005179
1280 Ga0207674_10021322
1281 Ga0207674_10031773
1282 Ga0207674_10054076
1283 Ga0207674_10061129
1284 Ga0207675_100067971
1285 Ga0207675_100994226
1286 Ga0207683_10010290
1287 Ga0207683_10070654
1288 Ga0207683_10404226
1289 Ga0207698_10003601
1290 Ga0207698_10009389
1291 Ga0207698_10027098
1292 Ga0207698_10091102
1293 Ga0207698_10317402
1294 Ga0207698_10650310
1295 Ga0207698_10694098
1296 Ga0207698_10760635
1297 Ga0209984_1006046
1298 Ga0209971_1004722
1299 Ga0209974_10005408
1300 Ga0209974_10009096
1301 Ga0268266_10000458
1302 Ga0268266_10044171
1303 Ga0268266_10048625
1304 Ga0268266_10109549
1305 Ga0268266_10436323
1306 Ga0268266_11052021
1307 Ga0268265_10007310
1308 Ga0268265_10015977
1309 Ga0268265_10052909
1310 Ga0268265_10078342
1311 Ga0268265_10604431
1312 Ga0268264_10004182
1313 Ga0268264_10004643
1314 Ga0268264_10030408
1315 Ga0268264_10161592
1316 Ga0268264_10277850
1317 Ga0307408_100014095
1318 Ga0307408_100054924
1319 Ga0307408_100205969
1320 Ga0307408_100365245
1321 Ga0307408_100494373
1322 Ga0307408_101285865
1323 Ga0307405_10021072
1324 Ga0307405_10110386
1325 Ga0307405_10146192
1326 Ga0307405_10169082
1327 Ga0307405_10383880
1328 Ga0307405_10559906
1329 Ga0307413_10023426
1330 Ga0307413_10046517
1331 Ga0307413_10077304
1332 Ga0307413_10079428
1333 Ga0307413_10128630
1334 Ga0307413_10129317
1335 Ga0307413_10245415
1336 Ga0307413_10430509
1337 Ga0307410_10023280
1338 Ga0307410_10033637
1339 Ga0307410_10041185
1340 Ga0307410_10043006
1341 Ga0307410_10056045
1342 Ga0307410_10084279
1343 Ga0307410_10104191
1344 Ga0307410_10123438
1345 Ga0307410_10364442
1346 Ga0307410_10411833
1347 Ga0307406_10020731
1348 Ga0307406_10268186
1349 Ga0307406_10315194
1350 Ga0307406_10958772
1351 Ga0307407_10024748
1352 Ga0307407_10044148
1353 Ga0307407_10052351
1354 Ga0307407_10230642
1355 Ga0307407_10240556
1356 Ga0307407_10444596
1357 Ga0307412_10005832
1358 Ga0307412_10009146
1359 Ga0307412_10010159
1360 Ga0307412_10015207
1361 Ga0307412_10050561
1362 Ga0307412_10053820
1363 Ga0307412_10070737
1364 Ga0307412_10075489
1365 Ga0307412_10282716
1366 Ga0307412_10329921
1367 Ga0307409_100063703
1368 Ga0307409_100130352
1369 Ga0307409_100149129
1370 Ga0307409_100300996
1371 Ga0307409_100308981
1372 Ga0307409_100360104
1373 Ga0307416_100017877
1374 Ga0307416_100044295
1375 Ga0307416_100069215
1376 Ga0307416_100081148
1377 Ga0307416_100130266
1378 Ga0307416_100133628
1379 Ga0307416_100316214
1380 Ga0307416_101516922
1381 Ga0307414_10026742
1382 Ga0307414_10042776
1383 Ga0307414_10045198
1384 Ga0307414_10068246
1385 Ga0307414_10082120
1386 Ga0307414_10104944
1387 Ga0307411_10029671
1388 Ga0307411_10050258
1389 Ga0307411_10071935
1390 Ga0307411_10076095
1391 Ga0307411_10095040
1392 Ga0307411_10097861
1393 Ga0307411_10131053
1394 Ga0307415_100004299
1395 Ga0307415_100007649
1396 Ga0307415_100054013
1397 Ga0307415_100065212
1398 Ga0307415_100098848
1399 Ga0307415_100100324
1400 Ga0307415_100140431
1401 Ga0307415_100175854
1402 Ga0307415_100364303
1403 Ga0307415_100533840
1404 Ga0307415_101266756
1405 Ga0373943_0424569
1406 Ga0373935_0025493
1407 Ga0395899_0000162
1408 Ga0395899_0001939
1409 Ga0395899_0014094
1410 Ga0395899_0018881
1411 Ga0395899_0053690
1412 Ga0395899_0095724
1413 Ga0395899_0150269
1414 Ga0395899_0176349
1415 Ga0395899_0635292
1416 Ga0395899_0645996
1417 Ga0395900_0000129
1418 Ga0395900_0001134
1419 Ga0395900_0003531
1420 Ga0395900_0004336
1421 Ga0395900_0009452
1422 Ga0395900_0045713
1423 Ga0395900_0062328
1424 Ga0395900_0081187
1425 Ga0395900_0103635
1426 Ga0395900_0108784
1427 Ga0395900_0294363
1428 Ga0395900_0379720
1429 Ga0395900_0642248
1430 Ga0395900_0835282
1431 Ga0395898_0012813
1432 Ga0395898_0021649
1433 Ga0395898_0051551
1434 Ga0395898_0104116
1435 Ga0395898_0170977
1436 Ga0395898_0301178
1437 Ga0395898_0433427
1438 Ga0395898_0529241
1439 Ga0395898_0814910
1440 Ga0395905_0001888
1441 Ga0395905_0001997
1442 Ga0395905_0004499
1443 Ga0395905_0006735
1444 Ga0395905_0014251
1445 Ga0395905_0016636
1446 Ga0395905_0035788
1447 Ga0395905_0060550
1448 Ga0395905_0083865
1449 Ga0395905_0091575
1450 Ga0395905_0175109
1451 Ga0395905_0178748
1452 Ga0395905_0315375
1453 Ga0395905_0482194
1454 Ga0395905_0632684
1455 Ga0395905_0649456
1456 Ga0395905_0828571
1457 Ga0395905_0988231
1458 Ga0395901_0000111
1459 Ga0395901_0002513
1460 Ga0395901_0028578
1461 Ga0395901_0036368
1462 Ga0395901_0129661
1463 Ga0395901_0153405
1464 Ga0395901_0223096
1465 Ga0395901_0458359
1466 Ga0395901_0991717
1467 Ga0395901_1040387
1468 Ga0439465_0073350
1469 Ga0451835_0066670
1470 Ga0439432_010753
1471 Ga0439432_020938
1472 Ga0439432_039753
1473 Ga0439449_0059304
1474 Ga0450914_010170
1475 Ga0450890_001357
1476 Ga0450905_001817
1477 Ga0439458_0000074
1478 Ga0439458_0000203
1479 Ga0466969_0038320
1480 Ga0466969_0064445
1481 Ga0466966_0120518
1482 Ga0466963_0015835
1483 Ga0466963_0020306
1484 Ga0466963_0152736
1485 Ga0466963_0154325
1486 Ga0466964_0038138
1487 Ga0466964_0110801
1488 Ga0466971_0031636
1489 Ga0466970_0040748
1490 Ga0466957_0057451
1491 Ga0466957_0652752
1492 Ga0466959_0068115
1493 Ga0466958_0044967
1494 Ga0466967_0008219
1495 Ga0466967_0055571
1496 Ga0466967_0107115
1497 Ga0466967_0368703
1498 Ga0466967_0404147
1499 Ga0466967_0567786
1500 Ga0495663_0002141
1501 Ga0495663_0012207
1502 Ga0495598_0009247
1503 Ga0495621_0026361
1504 Ga0495668_0246361
1505 Ga0495625_0000339
1506 Ga0495669_0004210
1507 Ga0495669_0011798
1508 Ga0495669_0049091
1509 Ga0495669_0122194
1510 Ga0495670_0016628
1511 Ga0495683_0064166
1512 Ga0495677_0008339
1513 Ga0495677_0189683
1514 Ga0496100_0640491
1515 Ga0496102_0000049
1516 Ga0496103_0000037
1517 Ga0496106_0516999
1518 Ga0496107_0118472
1519 Ga0496107_0166360
1520 Ga0496107_0343020
1521 Ga0496108_0018939
1522 Ga0496109_0119764
1523 Ga0496109_0387907
1524 Ga0496110_0004837
1525 Ga0496111_0028001
1526 Ga0496112_0006215
1527 Ga0496112_0010453
1528 Ga0496112_0075557
1529 Ga0496112_0151353
1530 Ga0496113_0012009
1531 Ga0496113_0429438
1532 Ga0496116_0001001
1533 Ga0496117_0000115
1534 Ga0496118_0000086
1535 Ga0496119_0053377
1536 Ga0496124_0000102
1537 Ga0501298_041098
1538 Ga0501311_059276
1539 Ga0501336_011766
1540 Ga0501031_0316686
1541 Ga0501038_0419319
1542 Ga0501067_0047530
1543 Ga0501070_0422290
1544 Ga0501075_0877939
1545 Ga0501223_067626
1546 Ga0501242_017501
1547 Ga0501083_0804523
1548 Ga0501268_038394
1549 Ga0501270_009364
1550 Ga0501273_005844
1551 Ga0501273_032476
1552 nmdc:mga00v17_637848_c1
1553 nmdc:mga08y16_60968_c1
1554 nmdc:mga0n895_274384_c1
1555 nmdc:mga0rr50_106881_c1
1556 nmdc:mga0a205_70699_c1
1557 Ga0500658_0000037
1558 Ga0466962_0014827
1559 2852657066
1560 2852683757

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01106

NifU

NifU-like domain

157

223

0.99

PF08712

Nfu_N

Scaffold protein Nfu/NifU N terminal

38

124

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ltm-assembly1.cif.gz_A solution nmr structure of nfu1 iron-sulfur cluster scaffold homolog from homo sapiens, northeast structural genomics consortium (nesg) target hr2876b 0.937 1 97
2m5o-assembly1.cif.gz_A solution nmr structure ctd domain of nfu1 iron-sulfur cluster scaffold homolog from homo sapiens, northeast structural genomics consortium (nesg) target hr2876c 0.9363 122 192
2z51-assembly1.cif.gz_A-2 crystal structure of arabidopsis cnfu involved in iron-sulfur cluster biosynthesis 0.8631 122 192
2ltl-assembly1.cif.gz_A solution nmr structure of nifu-like protein from saccharomyces cerevisiae, northeast structural genomics consortium (nesg) target yr313a 0.8623 4 98
2ffm-assembly1.cif.gz_A x-ray crystal structure of protein sav1430 from staphylococcus aureus. northeast structural genomics consortium target zr18. 0.857 4 85
ID Description Score Start End Superfamily
af_Q54MZ7_83_193_3.30.1370.70 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;Scaffold protein Nfu/NifU, N-terminal domain 0.9704 3 97 3.30.1370.70
af_Q59N44_19_128_3.30.1370.70 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;Scaffold protein Nfu/NifU, N-terminal domain 0.9618 2 98 3.30.1370.70
af_Q4DVM2_55_159_3.30.1370.70 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;Scaffold protein Nfu/NifU, N-terminal domain 0.9557 4 98 3.30.1370.70
af_Q9UUB8_30_140_3.30.1370.70 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;Scaffold protein Nfu/NifU, N-terminal domain 0.9525 1 97 3.30.1370.70
af_Q8SY96_56_163_3.30.1370.70 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;Scaffold protein Nfu/NifU, N-terminal domain 0.9509 2 99 3.30.1370.70
ID Description Score Start End GO Terms
AF-A0A1F3XZP9-F1-model_v4 NIF system FeS cluster assembly NifU C-terminal domain-containing protein 0.9937 121 192 GO:0005506
GO:0016226
GO:0051536
AF-E2M4V8-F1-model_v4 deleted 0.9896 4 99
AF-A0A7X6EQG8-F1-model_v4 deleted 0.989 4 89
AF-A0A0G1T2A7-F1-model_v4 Thioredoxin 0.9823 121 192 GO:0005506
GO:0016226
GO:0051536
AF-A0A0B7C4D9-F1-model_v4 NIF system FeS cluster assembly NifU C-terminal domain-containing protein 0.9808 119 192 GO:0005506
GO:0005739
GO:0016226
GO:0051536

Map