F480541
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 780 | 505 | 519 | 203 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0186986|Ga0501034_0186986_989_1705 |
| Length | 238 |
| Sequence | MLPLLANRGEKRRTNAAFQRSRRFLTFGLYQGASMTIRLHKGDLPEGIRFTGSVAIDTETLGLNPLRDRLCLVQLSAGDGTADIVQIAAGQTSAPRLAALLADRAVTKIFHFARFDIAALEHALGVMAEPIFCTKIASRLTRTYTDRHGLKDLAKELLDVDLSKQQQSSDWAAETLSDAQLAYAASDVLYLHQLRDKLAARLVREGRQELAAACFRFLPTRARLDLMGWGEEDIFAHS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 4 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 5 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 6 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 7 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 8 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 9 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 10 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 11 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 12 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 13 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 14 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 15 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 16 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 17 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 18 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 19 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 20 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 21 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 22 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 23 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 24 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 25 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 26 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 27 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 28 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 29 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 30 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 31 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 32 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 33 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 34 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 35 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 36 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 37 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 38 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 39 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 40 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 41 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 42 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 43 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 44 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 45 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 46 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 47 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 48 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 49 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 50 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 51 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 52 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 53 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 54 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 55 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 56 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 57 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 58 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 59 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 60 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 61 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 62 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 63 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 64 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 65 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 66 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 67 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 68 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 69 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 70 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 71 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 72 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 73 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 74 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 75 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 76 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 77 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 78 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 79 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 80 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 81 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 82 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 83 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 84 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 85 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 86 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 87 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 88 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 89 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 90 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 91 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 92 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 93 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 94 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 95 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 96 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 97 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 98 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 99 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 100 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 101 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 102 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 103 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 104 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 105 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 106 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 107 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 108 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 109 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 110 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 111 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 112 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 113 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 114 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 115 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 116 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 117 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 118 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 119 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 120 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 121 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 122 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 123 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 124 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 125 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 126 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 127 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 128 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 129 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 130 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 131 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 132 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 133 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 134 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 135 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 136 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 137 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 138 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 139 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 140 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 141 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 142 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 143 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 144 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 145 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 146 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 147 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 148 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 149 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 150 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 151 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 152 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 153 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 154 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 155 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 156 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 157 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 158 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 159 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 160 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 161 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 162 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 163 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 164 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 165 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 166 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 167 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 168 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 169 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 170 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 171 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 172 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 173 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 174 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 175 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 176 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 177 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 178 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 179 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 180 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 181 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 182 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 183 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 184 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 185 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 186 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 187 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 188 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 189 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 190 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 191 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 192 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 193 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 194 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 195 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 196 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 197 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 198 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 199 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 200 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 201 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 202 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 203 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 204 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 205 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 206 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 207 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 208 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 209 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 210 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 211 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 212 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 213 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 214 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 215 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 216 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 217 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 218 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 219 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 220 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 221 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 222 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 223 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 224 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 225 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 226 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 227 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 228 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 229 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 230 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 231 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 232 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 233 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 234 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 235 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 236 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 237 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 238 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 239 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 240 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 241 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 242 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 243 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 244 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 245 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 246 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 247 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 248 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 249 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 250 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 251 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 252 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 253 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 254 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 255 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 256 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 257 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 258 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 259 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 260 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 261 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 262 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 263 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 264 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 265 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 266 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 267 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 268 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 269 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 270 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 271 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 272 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 273 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 274 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 275 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 276 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 277 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 278 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 279 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 280 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 281 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 282 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 283 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 284 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 285 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 286 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 287 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 288 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 289 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 290 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 291 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 293 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 294 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 295 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 296 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 297 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 298 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 299 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 300 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 301 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 302 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 303 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 304 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 305 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 306 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 307 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 308 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 309 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 310 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 311 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 312 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 313 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 314 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 315 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 316 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 317 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 318 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 319 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 320 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 347 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 349 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 350 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 351 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 352 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 353 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 354 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 355 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 356 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 357 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 358 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 359 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 360 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 361 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 362 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 363 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 364 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 365 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 366 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 367 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 368 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 369 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 370 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 371 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 372 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 373 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 374 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 375 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 376 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 377 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 378 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 379 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 380 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 381 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 382 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 383 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 384 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 385 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 386 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 387 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 388 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 389 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 390 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 391 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 392 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 393 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 394 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 395 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 396 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 397 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 398 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 399 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 400 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 401 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 422 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 423 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 424 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 425 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 426 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 427 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 428 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 429 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 430 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 431 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 432 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 433 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 434 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 465 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 466 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 467 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 468 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 469 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 470 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 471 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 477 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 478 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 479 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 480 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 481 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 482 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 483 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 484 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 485 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 486 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 487 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 488 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 489 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 490 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 491 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 492 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 493 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 494 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 495 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 496 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 497 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 498 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 499 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 500 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 501 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 502 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 503 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 504 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 505 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 66.54 |
| Metatranscriptomes | 0 |
| Isolates | 33.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.44 |
| Nodule | 28.08 |
| Rhizoplane | 1.79 |
| Rhizosphere | 54.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10014860 | 3300001979 | Bacteria | 2859 |
| 2 | JGI24739J22299_10053437 | 3300001989 | Bacteria | 1296 |
| 3 | JGI24735J21928_10054364 | 3300002067 | Bacteria | 1154 |
| 4 | JGI25156J39149_1002078 | 3300002705 | Bacteria | 7594 |
| 5 | JGI25157J39369_1002436 | 3300002741 | Bacteria | 4645 |
| 6 | JGI25165J46597_1000034 | 3300003214 | Bacteria | 292458 |
| 7 | rootH1_10020692 | 3300003323 | Bacteria | 5302 |
| 8 | Ga0055542_1000299 | 3300003762 | Bacteria | 55023 |
| 9 | Ga0055542_1001140 | 3300003762 | Bacteria | 15682 |
| 10 | Ga0055529_1002112 | 3300003763 | Bacteria | 4209 |
| 11 | Ga0070658_10003464 | 3300005327 | Bacteria | 12971 |
| 12 | Ga0070658_10073478 | 3300005327 | Bacteria | 2804 |
| 13 | Ga0070658_10102585 | 3300005327 | Bacteria | 2366 |
| 14 | Ga0070658_10300021 | 3300005327 | Bacteria | 1370 |
| 15 | Ga0070680_100025492 | 3300005336 | Bacteria | 4727 |
| 16 | Ga0070680_100077710 | 3300005336 | Bacteria | 2734 |
| 17 | Ga0070680_100159731 | 3300005336 | Bacteria | 1894 |
| 18 | Ga0070660_100097417 | 3300005339 | Bacteria | 2327 |
| 19 | Ga0070660_100126282 | 3300005339 | Bacteria | 2044 |
| 20 | Ga0070691_10001404 | 3300005341 | Bacteria | 10282 |
| 21 | Ga0070674_100172869 | 3300005356 | Bacteria | 1649 |
| 22 | Ga0070659_100563058 | 3300005366 | Bacteria | 976 |
| 23 | Ga0070714_100011222 | 3300005435 | Bacteria | 7104 |
| 24 | Ga0070714_100021373 | 3300005435 | Bacteria | 5295 |
| 25 | Ga0070714_100105952 | 3300005435 | Bacteria | 2483 |
| 26 | Ga0070713_100015441 | 3300005436 | Bacteria | 5710 |
| 27 | Ga0070713_100042235 | 3300005436 | Bacteria | 3720 |
| 28 | Ga0070711_100016334 | 3300005439 | Bacteria | 4713 |
| 29 | Ga0070663_100381597 | 3300005455 | Bacteria | 1148 |
| 30 | Ga0070681_10033498 | 3300005458 | Bacteria | 5157 |
| 31 | Ga0070699_100487009 | 3300005518 | Bacteria | 1120 |
| 32 | Ga0070679_100032673 | 3300005530 | Bacteria | 5149 |
| 33 | Ga0070679_100067069 | 3300005530 | Bacteria | 3578 |
| 34 | Ga0070679_100094930 | 3300005530 | Bacteria | 2970 |
| 35 | Ga0068853_100014665 | 3300005539 | Bacteria | 6427 |
| 36 | Ga0068853_100163930 | 3300005539 | Bacteria | 2007 |
| 37 | Ga0068853_100211323 | 3300005539 | Bacteria | 1768 |
| 38 | Ga0068853_100559500 | 3300005539 | Bacteria | 1084 |
| 39 | Ga0068853_100605580 | 3300005539 | Bacteria | 1041 |
| 40 | Ga0070672_100791249 | 3300005543 | Bacteria | 834 |
| 41 | Ga0070693_100537585 | 3300005547 | Bacteria | 835 |
| 42 | Ga0070665_100016431 | 3300005548 | Bacteria | 7421 |
| 43 | Ga0070665_100221828 | 3300005548 | Bacteria | 1891 |
| 44 | Ga0068855_100031023 | 3300005563 | Bacteria | 6387 |
| 45 | Ga0068855_100979296 | 3300005563 | Bacteria | 889 |
| 46 | Ga0068854_100154905 | 3300005578 | Bacteria | 1770 |
| 47 | Ga0068856_100157583 | 3300005614 | Bacteria | 2280 |
| 48 | Ga0068856_100524487 | 3300005614 | Bacteria | 1206 |
| 49 | Ga0068852_100264523 | 3300005616 | Bacteria | 1652 |
| 50 | Ga0068859_100631076 | 3300005617 | Bacteria | 1164 |
| 51 | Ga0081455_10274102 | 3300005937 | Bacteria | 1222 |
| 52 | Ga0081540_1001159 | 3300005983 | Bacteria | 23221 |
| 53 | Ga0081539_10001022 | 3300005985 | Bacteria | 51499 |
| 54 | Ga0070717_10346160 | 3300006028 | Bacteria | 1328 |
| 55 | Ga0075365_10011143 | 3300006038 | Bacteria | 5274 |
| 56 | Ga0075365_10040336 | 3300006038 | Bacteria | 3044 |
| 57 | Ga0075365_10056224 | 3300006038 | Bacteria | 2615 |
| 58 | Ga0075365_10521708 | 3300006038 | Bacteria | 840 |
| 59 | Ga0075368_10056697 | 3300006042 | Bacteria | 1563 |
| 60 | Ga0075363_100130882 | 3300006048 | Bacteria | 1407 |
| 61 | Ga0075364_10022475 | 3300006051 | Bacteria | 3983 |
| 62 | Ga0075364_10307707 | 3300006051 | Bacteria | 1079 |
| 63 | Ga0070712_100102626 | 3300006175 | Bacteria | 2118 |
| 64 | Ga0070712_100134721 | 3300006175 | Bacteria | 1877 |
| 65 | Ga0075362_10058515 | 3300006177 | Bacteria | 1738 |
| 66 | Ga0075362_10095718 | 3300006177 | Bacteria | 1383 |
| 67 | Ga0075362_10315075 | 3300006177 | Bacteria | 778 |
| 68 | Ga0075367_10223102 | 3300006178 | Bacteria | 1180 |
| 69 | Ga0075367_10226190 | 3300006178 | Bacteria | 1171 |
| 70 | Ga0075367_10445586 | 3300006178 | Bacteria | 820 |
| 71 | Ga0075369_10193123 | 3300006186 | Bacteria | 938 |
| 72 | Ga0075370_10377584 | 3300006353 | Bacteria | 849 |
| 73 | Ga0068865_100679356 | 3300006881 | Bacteria | 878 |
| 74 | Ga0097620_100631081 | 3300006931 | Bacteria | 1164 |
| 75 | Ga0105240_10007628 | 3300009093 | Bacteria | 15668 |
| 76 | Ga0105240_10035830 | 3300009093 | Bacteria | 6390 |
| 77 | Ga0105240_10551499 | 3300009093 | Bacteria | 1275 |
| 78 | Ga0105240_10674437 | 3300009093 | Bacteria | 1131 |
| 79 | Ga0105242_10359047 | 3300009176 | Bacteria | 1348 |
| 80 | Ga0105237_10460789 | 3300009545 | Bacteria | 1277 |
| 81 | Ga0105237_10728967 | 3300009545 | Bacteria | 998 |
| 82 | Ga0105238_10026262 | 3300009551 | Bacteria | 5935 |
| 83 | Ga0105238_10126589 | 3300009551 | Bacteria | 2533 |
| 84 | Ga0105238_10147811 | 3300009551 | Bacteria | 2326 |
| 85 | Ga0105238_10427365 | 3300009551 | Bacteria | 1320 |
| 86 | Ga0105239_10099033 | 3300010375 | Bacteria | 3223 |
| 87 | Ga0105239_10377452 | 3300010375 | Bacteria | 1603 |
| 88 | Ga0105239_10476700 | 3300010375 | Bacteria | 1417 |
| 89 | Ga0105246_10530456 | 3300011119 | Bacteria | 1005 |
| 90 | Ga0157373_10518186 | 3300013100 | Bacteria | 862 |
| 91 | Ga0157373_10589507 | 3300013100 | Bacteria | 809 |
| 92 | Ga0157370_10513709 | 3300013104 | Bacteria | 1100 |
| 93 | Ga0157374_10200108 | 3300013296 | Bacteria | 1956 |
| 94 | Ga0157374_10648459 | 3300013296 | Bacteria | 1068 |
| 95 | Ga0163163_10059183 | 3300014325 | Bacteria | 3789 |
| 96 | Ga0157380_10006688 | 3300014326 | Bacteria | 8141 |
| 97 | Ga0182008_10069715 | 3300014497 | Bacteria | 1730 |
| 98 | Ga0182008_10156763 | 3300014497 | Bacteria | 1144 |
| 99 | Ga0182008_10176785 | 3300014497 | Bacteria | 1079 |
| 100 | Ga0157379_10521239 | 3300014968 | Bacteria | 1103 |
| 101 | Ga0157376_10001430 | 3300014969 | Bacteria | 15703 |
| 102 | Ga0182006_1037866 | 3300015261 | Bacteria | 1910 |
| 103 | Ga0182005_1011656 | 3300015265 | Bacteria | 2501 |
| 104 | Ga0163161_10324901 | 3300017792 | Bacteria | 1217 |
| 105 | Ga0213872_10255936 | 3300021361 | Bacteria | 736 |
| 106 | Ga0213876_10004936 | 3300021384 | Bacteria | 7383 |
| 107 | Ga0213876_10193059 | 3300021384 | Bacteria | 1083 |
| 108 | Ga0213875_10002299 | 3300021388 | Bacteria | 11574 |
| 109 | Ga0213875_10073021 | 3300021388 | Bacteria | 1601 |
| 110 | Ga0213871_10003974 | 3300021441 | Bacteria | 2913 |
| 111 | Ga0213871_10093114 | 3300021441 | Bacteria | 875 |
| 112 | Ga0209026_1000100 | 3300025250 | Bacteria | 156131 |
| 113 | Ga0209148_1000069 | 3300025254 | Bacteria | 334444 |
| 114 | Ga0209148_1007365 | 3300025254 | Bacteria | 2294 |
| 115 | Ga0209759_1000438 | 3300025256 | Bacteria | 49192 |
| 116 | Ga0209233_1000028 | 3300025261 | Bacteria | 642062 |
| 117 | Ga0209455_1000135 | 3300025272 | Bacteria | 148007 |
| 118 | Ga0209025_1055391 | 3300025294 | Bacteria | 1534 |
| 119 | Ga0209758_1006381 | 3300025297 | Bacteria | 8513 |
| 120 | Ga0207680_10237139 | 3300025903 | Bacteria | 1256 |
| 121 | Ga0207647_10012504 | 3300025904 | Bacteria | 5907 |
| 122 | Ga0207647_10042332 | 3300025904 | Bacteria | 2858 |
| 123 | Ga0207645_10108736 | 3300025907 | Bacteria | 1794 |
| 124 | Ga0207705_10032668 | 3300025909 | Bacteria | 3720 |
| 125 | Ga0207705_10111723 | 3300025909 | Bacteria | 2020 |
| 126 | Ga0207705_10119510 | 3300025909 | Bacteria | 1954 |
| 127 | Ga0207707_10005836 | 3300025912 | Bacteria | 10760 |
| 128 | Ga0207707_10023528 | 3300025912 | Bacteria | 5388 |
| 129 | Ga0207671_10352224 | 3300025914 | Bacteria | 1168 |
| 130 | Ga0207671_10492362 | 3300025914 | Bacteria | 977 |
| 131 | Ga0207671_10527829 | 3300025914 | Bacteria | 941 |
| 132 | Ga0207693_10089615 | 3300025915 | Bacteria | 2411 |
| 133 | Ga0207663_10011790 | 3300025916 | Bacteria | 4706 |
| 134 | Ga0207660_10371041 | 3300025917 | Bacteria | 1149 |
| 135 | Ga0207657_10081611 | 3300025919 | Bacteria | 2716 |
| 136 | Ga0207649_10827700 | 3300025920 | Bacteria | 723 |
| 137 | Ga0207652_10033644 | 3300025921 | Bacteria | 4317 |
| 138 | Ga0207652_10040007 | 3300025921 | Bacteria | 3981 |
| 139 | Ga0207694_10184419 | 3300025924 | Bacteria | 1693 |
| 140 | Ga0207700_10007179 | 3300025928 | Bacteria | 6791 |
| 141 | Ga0207700_10034319 | 3300025928 | Bacteria | 3641 |
| 142 | Ga0207664_10002435 | 3300025929 | Bacteria | 12311 |
| 143 | Ga0207664_10022275 | 3300025929 | Bacteria | 4728 |
| 144 | Ga0207664_10048471 | 3300025929 | Bacteria | 3341 |
| 145 | Ga0207690_10322522 | 3300025932 | Bacteria | 1214 |
| 146 | Ga0207686_10304441 | 3300025934 | Bacteria | 1185 |
| 147 | Ga0207669_10132765 | 3300025937 | Bacteria | 1714 |
| 148 | Ga0207669_10606377 | 3300025937 | Bacteria | 890 |
| 149 | Ga0207667_10287804 | 3300025949 | Bacteria | 1679 |
| 150 | Ga0207667_10351063 | 3300025949 | Bacteria | 1504 |
| 151 | Ga0207640_10143941 | 3300025981 | Bacteria | 1742 |
| 152 | Ga0207640_10323186 | 3300025981 | Bacteria | 1229 |
| 153 | Ga0207639_10104195 | 3300026041 | Bacteria | 2300 |
| 154 | Ga0207639_10413278 | 3300026041 | Bacteria | 1218 |
| 155 | Ga0207639_10503046 | 3300026041 | Bacteria | 1107 |
| 156 | Ga0207678_10014969 | 3300026067 | Bacteria | 6824 |
| 157 | Ga0207678_10417068 | 3300026067 | Bacteria | 1164 |
| 158 | Ga0207702_10127366 | 3300026078 | Bacteria | 2288 |
| 159 | Ga0207674_10129991 | 3300026116 | Bacteria | 2482 |
| 160 | Ga0207675_100693675 | 3300026118 | Bacteria | 1027 |
| 161 | Ga0207698_10359611 | 3300026142 | Bacteria | 1378 |
| 162 | Ga0209813_10099727 | 3300027866 | Bacteria | 987 |
| 163 | Ga0268266_10034154 | 3300028379 | Bacteria | 4325 |
| 164 | Ga0268266_10075245 | 3300028379 | Bacteria | 2933 |
| 165 | Ga0268266_10175352 | 3300028379 | Bacteria | 1949 |
| 166 | Ga0268266_10182704 | 3300028379 | Bacteria | 1910 |
| 167 | Ga0268266_10702934 | 3300028379 | Bacteria | 974 |
| 168 | Ga0265334_10009214 | 3300028573 | Bacteria | 4181 |
| 169 | Ga0265338_10114786 | 3300028800 | Bacteria | 2160 |
| 170 | Ga0265330_10051719 | 3300031235 | Bacteria | 1801 |
| 171 | Ga0265330_10192679 | 3300031235 | Bacteria | 862 |
| 172 | Ga0265332_10120577 | 3300031238 | Bacteria | 1102 |
| 173 | Ga0265332_10236964 | 3300031238 | Bacteria | 756 |
| 174 | Ga0265328_10000183 | 3300031239 | Bacteria | 29210 |
| 175 | Ga0265325_10015163 | 3300031241 | Bacteria | 4340 |
| 176 | Ga0265325_10022512 | 3300031241 | Bacteria | 3451 |
| 177 | Ga0265325_10048025 | 3300031241 | Bacteria | 2208 |
| 178 | Ga0265325_10065023 | 3300031241 | Bacteria | 1843 |
| 179 | Ga0265340_10000575 | 3300031247 | Bacteria | 20409 |
| 180 | Ga0265340_10021893 | 3300031247 | Bacteria | 3273 |
| 181 | Ga0265340_10043626 | 3300031247 | Bacteria | 2197 |
| 182 | Ga0265340_10064561 | 3300031247 | Bacteria | 1745 |
| 183 | Ga0265340_10068721 | 3300031247 | Bacteria | 1682 |
| 184 | Ga0265339_10000788 | 3300031249 | Bacteria | 24487 |
| 185 | Ga0265339_10127026 | 3300031249 | Bacteria | 1306 |
| 186 | Ga0265339_10131062 | 3300031249 | Bacteria | 1282 |
| 187 | Ga0265331_10003205 | 3300031250 | Bacteria | 10676 |
| 188 | Ga0265331_10029735 | 3300031250 | Bacteria | 2724 |
| 189 | Ga0265331_10055239 | 3300031250 | Bacteria | 1889 |
| 190 | Ga0265327_10000070 | 3300031251 | Bacteria | 217350 |
| 191 | Ga0265327_10012708 | 3300031251 | Bacteria | 5655 |
| 192 | Ga0265327_10071509 | 3300031251 | Bacteria | 1735 |
| 193 | Ga0265316_10004940 | 3300031344 | Bacteria | 13113 |
| 194 | Ga0265316_10307218 | 3300031344 | Bacteria | 1154 |
| 195 | Ga0265316_10325327 | 3300031344 | Bacteria | 1116 |
| 196 | Ga0307513_10783999 | 3300031456 | Bacteria | 659 |
| 197 | Ga0265313_10000004 | 3300031595 | Bacteria | 188027 |
| 198 | Ga0265313_10001970 | 3300031595 | Bacteria | 18560 |
| 199 | Ga0265313_10033316 | 3300031595 | Bacteria | 2620 |
| 200 | Ga0265313_10036836 | 3300031595 | Bacteria | 2453 |
| 201 | Ga0265313_10109635 | 3300031595 | Bacteria | 1215 |
| 202 | Ga0265313_10115674 | 3300031595 | Bacteria | 1175 |
| 203 | Ga0316575_10027535 | 3300031665 | Bacteria | 2212 |
| 204 | Ga0316579_10163637 | 3300031691 | Bacteria | 1075 |
| 205 | Ga0265314_10044136 | 3300031711 | Bacteria | 3162 |
| 206 | Ga0265314_10127667 | 3300031711 | Bacteria | 1591 |
| 207 | Ga0265342_10040548 | 3300031712 | Bacteria | 2823 |
| 208 | Ga0265342_10041348 | 3300031712 | Bacteria | 2792 |
| 209 | Ga0265342_10103090 | 3300031712 | Bacteria | 1623 |
| 210 | Ga0265342_10113886 | 3300031712 | Bacteria | 1528 |
| 211 | Ga0307516_10000030 | 3300031730 | Bacteria | 159694 |
| 212 | Ga0307406_10277063 | 3300031901 | Bacteria | 1277 |
| 213 | Ga0307414_10424870 | 3300032004 | Bacteria | 1160 |
| 214 | Ga0307411_10559823 | 3300032005 | Bacteria | 977 |
| 215 | Ga0316583_10122777 | 3300032133 | Bacteria | 905 |
| 216 | Ga0307510_10141629 | 3300033180 | Bacteria | 2046 |
| 217 | Ga0373923_0077558 | 3300035111 | Bacteria | 1437 |
| 218 | Ga0373923_0105915 | 3300035111 | Bacteria | 1244 |
| 219 | Ga0373941_0198298 | 3300035115 | Bacteria | 762 |
| 220 | Ga0373953_0051258 | 3300035117 | Bacteria | 1668 |
| 221 | Ga0373943_0130253 | 3300035170 | Bacteria | 1346 |
| 222 | Ga0373943_0269064 | 3300035170 | Bacteria | 961 |
| 223 | Ga0373943_0503711 | 3300035170 | Bacteria | 708 |
| 224 | Ga0316574_0318993 | 3300035398 | Bacteria | 987 |
| 225 | Ga0373927_0040176 | 3300035695 | Bacteria | 3036 |
| 226 | Ga0373933_0006885 | 3300035724 | Bacteria | 6192 |
| 227 | Ga0373933_0029810 | 3300035724 | Bacteria | 3157 |
| 228 | Ga0373947_0046584 | 3300035725 | Bacteria | 2597 |
| 229 | Ga0373937_0004353 | 3300036401 | Bacteria | 12020 |
| 230 | Ga0373937_0019732 | 3300036401 | Bacteria | 6038 |
| 231 | Ga0373937_0030563 | 3300036401 | Bacteria | 4878 |
| 232 | Ga0373937_0095788 | 3300036401 | Bacteria | 2752 |
| 233 | Ga0316582_0387278 | 3300036647 | Bacteria | 962 |
| 234 | Ga0316584_0005127 | 3300036712 | Bacteria | 8745 |
| 235 | Ga0373925_0054797 | 3300037068 | Bacteria | 2983 |
| 236 | Ga0373925_0102420 | 3300037068 | Bacteria | 2203 |
| 237 | Ga0373925_0688931 | 3300037068 | Bacteria | 842 |
| 238 | Ga0395900_0089863 | 3300037418 | Bacteria | 3157 |
| 239 | Ga0395900_0097510 | 3300037418 | Bacteria | 3020 |
| 240 | Ga0395900_0128830 | 3300037418 | Bacteria | 2594 |
| 241 | Ga0395900_0153414 | 3300037418 | Bacteria | 2353 |
| 242 | Ga0395898_0023354 | 3300037466 | Bacteria | 6250 |
| 243 | Ga0395898_0094496 | 3300037466 | Bacteria | 2873 |
| 244 | Ga0395898_0705918 | 3300037466 | Bacteria | 950 |
| 245 | Ga0395905_0121593 | 3300037471 | Bacteria | 2454 |
| 246 | Ga0395905_1142804 | 3300037471 | Bacteria | 682 |
| 247 | Ga0436364_0313282 | 3300037853 | Bacteria | 852 |
| 248 | Ga0436364_0420938 | 3300037853 | Bacteria | 1107 |
| 249 | Ga0436364_0546627 | 3300037853 | Bacteria | 1417 |
| 250 | Ga0436364_0834964 | 3300037853 | Bacteria | 10664 |
| 251 | Ga0436364_1431099 | 3300037853 | Bacteria | 8523 |
| 252 | Ga0395901_0065947 | 3300038443 | Bacteria | 3771 |
| 253 | Ga0395901_0105520 | 3300038443 | Bacteria | 2957 |
| 254 | Ga0395901_0143173 | 3300038443 | Bacteria | 2513 |
| 255 | Ga0395901_0145772 | 3300038443 | Bacteria | 2488 |
| 256 | Ga0395901_0239139 | 3300038443 | Bacteria | 1894 |
| 257 | Ga0395901_0285229 | 3300038443 | Bacteria | 1715 |
| 258 | Ga0395901_0452472 | 3300038443 | Bacteria | 1313 |
| 259 | Ga0436365_0097041 | 3300039437 | Bacteria | 967 |
| 260 | Ga0436365_0249297 | 3300039437 | Bacteria | 2219 |
| 261 | Ga0436365_1624935 | 3300039437 | Bacteria | 9034 |
| 262 | Ga0436365_1691170 | 3300039437 | Bacteria | 24758 |
| 263 | Ga0436360_0261887 | 3300039438 | Bacteria | 2785 |
| 264 | Ga0436360_0397922 | 3300039438 | Bacteria | 3864 |
| 265 | Ga0436360_0701477 | 3300039438 | Bacteria | 2882 |
| 266 | Ga0436360_0930277 | 3300039438 | Bacteria | 1637 |
| 267 | Ga0436360_1132676 | 3300039438 | Bacteria | 2372 |
| 268 | Ga0436361_0219390 | 3300039447 | Bacteria | 5330 |
| 269 | Ga0436361_0917993 | 3300039447 | Bacteria | 3838 |
| 270 | Ga0436363_0789771 | 3300039450 | Bacteria | 2146 |
| 271 | Ga0436362_0265607 | 3300039453 | Bacteria | 1620 |
| 272 | Ga0436362_0312797 | 3300039453 | Bacteria | 4621 |
| 273 | Ga0439458_0058653 | 3300042157 | Bacteria | 959 |
| 274 | Ga0451577_0090571 | 3300042876 | Bacteria | 2730 |
| 275 | Ga0466972_0136707 | 3300044658 | Bacteria | 1153 |
| 276 | Ga0453683_0042228 | 3300044673 | Bacteria | 2863 |
| 277 | Ga0453684_0246399 | 3300044712 | Bacteria | 2054 |
| 278 | Ga0466957_0143220 | 3300044842 | Bacteria | 1541 |
| 279 | Ga0451576_0100030 | 3300045051 | Bacteria | 3016 |
| 280 | Ga0451576_1153558 | 3300045051 | Bacteria | 810 |
| 281 | Ga0466967_0227611 | 3300045976 | Bacteria | 1774 |
| 282 | Ga0466967_0586450 | 3300045976 | Bacteria | 1099 |
| 283 | Ga0495651_0459720 | 3300046462 | Bacteria | 821 |
| 284 | Ga0495664_0002764 | 3300046477 | Bacteria | 9441 |
| 285 | Ga0495584_0140576 | 3300046491 | Bacteria | 1226 |
| 286 | Ga0495608_0016666 | 3300046511 | Bacteria | 5084 |
| 287 | Ga0495628_0155315 | 3300046516 | Bacteria | 1741 |
| 288 | Ga0495643_0088111 | 3300046522 | Bacteria | 1605 |
| 289 | Ga0495652_0248572 | 3300046529 | Bacteria | 1319 |
| 290 | Ga0495587_0014361 | 3300046536 | Bacteria | 4969 |
| 291 | Ga0495667_0142314 | 3300046559 | Bacteria | 1545 |
| 292 | Ga0495668_0022331 | 3300046616 | Bacteria | 3618 |
| 293 | Ga0495657_0045248 | 3300046675 | Bacteria | 2988 |
| 294 | Ga0495657_0145600 | 3300046675 | Bacteria | 1474 |
| 295 | Ga0495623_0122240 | 3300046679 | Bacteria | 1566 |
| 296 | Ga0495613_0549764 | 3300046689 | Bacteria | 773 |
| 297 | Ga0495674_0020122 | 3300047319 | Bacteria | 6184 |
| 298 | Ga0495672_0191604 | 3300047320 | Bacteria | 1028 |
| 299 | Ga0495680_0086848 | 3300047322 | Bacteria | 2353 |
| 300 | Ga0495680_0162769 | 3300047322 | Bacteria | 1619 |
| 301 | Ga0495675_0054343 | 3300047444 | Bacteria | 2541 |
| 302 | Ga0495684_0533181 | 3300047471 | Bacteria | 802 |
| 303 | Ga0495686_0000134 | 3300047472 | Bacteria | 149997 |
| 304 | Ga0495686_0029749 | 3300047472 | Bacteria | 3552 |
| 305 | Ga0495602_0004731 | 3300048088 | Bacteria | 14232 |
| 306 | Ga0496100_0059937 | 3300048903 | Bacteria | 2503 |
| 307 | Ga0496101_0368355 | 3300048904 | Bacteria | 1130 |
| 308 | Ga0496102_0567832 | 3300048905 | Bacteria | 1057 |
| 309 | Ga0496104_0006145 | 3300048907 | Bacteria | 10542 |
| 310 | Ga0496104_0068515 | 3300048907 | Bacteria | 3372 |
| 311 | Ga0496105_0542075 | 3300048908 | Bacteria | 909 |
| 312 | Ga0496106_0516315 | 3300048909 | Bacteria | 959 |
| 313 | Ga0496110_0340712 | 3300048913 | Bacteria | 1366 |
| 314 | Ga0496110_0457545 | 3300048913 | Bacteria | 1163 |
| 315 | Ga0496112_0005948 | 3300048915 | Bacteria | 10644 |
| 316 | Ga0496112_0177133 | 3300048915 | Bacteria | 2097 |
| 317 | Ga0496112_0185465 | 3300048915 | Bacteria | 2044 |
| 318 | Ga0496115_0026066 | 3300048918 | Bacteria | 4558 |
| 319 | Ga0496119_0047186 | 3300048922 | Bacteria | 2682 |
| 320 | Ga0496119_0134926 | 3300048922 | Bacteria | 1340 |
| 321 | Ga0496119_0252331 | 3300048922 | Bacteria | 889 |
| 322 | Ga0496120_0005180 | 3300048923 | Bacteria | 10526 |
| 323 | Ga0496124_0090338 | 3300048927 | Bacteria | 2499 |
| 324 | Ga0496124_0463140 | 3300048927 | Bacteria | 861 |
| 325 | Ga0496126_0054032 | 3300048929 | Bacteria | 3641 |
| 326 | Ga0496126_0179274 | 3300048929 | Bacteria | 1801 |
| 327 | Ga0496126_0512780 | 3300048929 | Bacteria | 957 |
| 328 | Ga0501031_0002511 | 3300049568 | Bacteria | 11690 |
| 329 | Ga0501031_0176874 | 3300049568 | Bacteria | 1394 |
| 330 | Ga0501031_0229433 | 3300049568 | Bacteria | 1208 |
| 331 | Ga0501032_0000001 | 3300049569 | Bacteria | 422097 |
| 332 | Ga0501032_0012538 | 3300049569 | Bacteria | 6052 |
| 333 | Ga0501032_0023599 | 3300049569 | Bacteria | 4246 |
| 334 | Ga0501032_0023883 | 3300049569 | Bacteria | 4223 |
| 335 | Ga0501032_0158289 | 3300049569 | Bacteria | 1487 |
| 336 | Ga0501033_0000092 | 3300049570 | Bacteria | 85398 |
| 337 | Ga0501033_0004609 | 3300049570 | Bacteria | 11038 |
| 338 | Ga0501033_0004805 | 3300049570 | Bacteria | 10790 |
| 339 | Ga0501033_0031426 | 3300049570 | Bacteria | 3990 |
| 340 | Ga0501033_0408083 | 3300049570 | Bacteria | 947 |
| 341 | Ga0501034_0000036 | 3300049571 | Bacteria | 239274 |
| 342 | Ga0501034_0002736 | 3300049571 | Bacteria | 20749 |
| 343 | Ga0501034_0014538 | 3300049571 | Bacteria | 8106 |
| 344 | Ga0501034_0026322 | 3300049571 | Bacteria | 5925 |
| 345 | Ga0501034_0071950 | 3300049571 | Bacteria | 3466 |
| 346 | Ga0501034_0082916 | 3300049571 | Bacteria | 3208 |
| 347 | Ga0501034_0083962 | 3300049571 | Bacteria | 3187 |
| 348 | Ga0501034_0186986 | 3300049571 | Bacteria | 2034 |
| 349 | Ga0501034_0561630 | 3300049571 | Bacteria | 1050 |
| 350 | Ga0501034_0562489 | 3300049571 | Bacteria | 1049 |
| 351 | Ga0501034_0979653 | 3300049571 | Bacteria | 730 |
| 352 | Ga0501036_0000078 | 3300049572 | Bacteria | 60614 |
| 353 | Ga0501036_0020232 | 3300049572 | Bacteria | 5589 |
| 354 | Ga0501036_0076427 | 3300049572 | Bacteria | 2833 |
| 355 | Ga0501037_0000017 | 3300049573 | Bacteria | 157276 |
| 356 | Ga0501037_0000047 | 3300049573 | Bacteria | 114757 |
| 357 | Ga0501037_0015409 | 3300049573 | Bacteria | 5624 |
| 358 | Ga0501037_0020807 | 3300049573 | Bacteria | 4844 |
| 359 | Ga0501037_0065473 | 3300049573 | Bacteria | 2648 |
| 360 | Ga0501037_0463426 | 3300049573 | Bacteria | 863 |
| 361 | Ga0501037_0581950 | 3300049573 | Bacteria | 753 |
| 362 | Ga0501038_0000036 | 3300049574 | Bacteria | 124766 |
| 363 | Ga0501038_0039916 | 3300049574 | Bacteria | 4103 |
| 364 | Ga0501038_0078757 | 3300049574 | Bacteria | 2780 |
| 365 | Ga0501038_0094343 | 3300049574 | Bacteria | 2502 |
| 366 | Ga0501039_0000011 | 3300049575 | Bacteria | 245124 |
| 367 | Ga0501039_0015572 | 3300049575 | Bacteria | 5819 |
| 368 | Ga0501039_0179429 | 3300049575 | Bacteria | 1665 |
| 369 | Ga0501040_0011447 | 3300049576 | Bacteria | 5809 |
| 370 | Ga0501041_0476458 | 3300049577 | Bacteria | 793 |
| 371 | Ga0501042_0147981 | 3300049578 | Bacteria | 1693 |
| 372 | Ga0501043_0000105 | 3300049579 | Bacteria | 78189 |
| 373 | Ga0501043_0000369 | 3300049579 | Bacteria | 40714 |
| 374 | Ga0501043_0012998 | 3300049579 | Bacteria | 6507 |
| 375 | Ga0501043_0047536 | 3300049579 | Bacteria | 3374 |
| 376 | Ga0501043_0078845 | 3300049579 | Bacteria | 2588 |
| 377 | Ga0501043_0101175 | 3300049579 | Bacteria | 2265 |
| 378 | Ga0501043_0177072 | 3300049579 | Bacteria | 1662 |
| 379 | Ga0501043_0189208 | 3300049579 | Bacteria | 1601 |
| 380 | Ga0501043_0329581 | 3300049579 | Bacteria | 1163 |
| 381 | Ga0501046_0062978 | 3300049580 | Bacteria | 2897 |
| 382 | Ga0501046_0100118 | 3300049580 | Bacteria | 2224 |
| 383 | Ga0501046_0352819 | 3300049580 | Bacteria | 1068 |
| 384 | Ga0501046_0575739 | 3300049580 | Bacteria | 801 |
| 385 | Ga0501047_0010824 | 3300049581 | Bacteria | 8620 |
| 386 | Ga0501047_0015525 | 3300049581 | Bacteria | 7255 |
| 387 | Ga0501047_0030528 | 3300049581 | Bacteria | 5194 |
| 388 | Ga0501047_0031988 | 3300049581 | Bacteria | 5076 |
| 389 | Ga0501047_0036547 | 3300049581 | Bacteria | 4747 |
| 390 | Ga0501047_0038432 | 3300049581 | Bacteria | 4631 |
| 391 | Ga0501047_0072155 | 3300049581 | Bacteria | 3323 |
| 392 | Ga0501047_0078101 | 3300049581 | Bacteria | 3184 |
| 393 | Ga0501047_0082152 | 3300049581 | Bacteria | 3097 |
| 394 | Ga0501047_0173380 | 3300049581 | Bacteria | 2026 |
| 395 | Ga0501047_0225421 | 3300049581 | Bacteria | 1729 |
| 396 | Ga0501047_0417668 | 3300049581 | Bacteria | 1173 |
| 397 | Ga0501047_0657982 | 3300049581 | Bacteria | 867 |
| 398 | Ga0501048_0005606 | 3300049582 | Bacteria | 9549 |
| 399 | Ga0501048_0378083 | 3300049582 | Bacteria | 1011 |
| 400 | Ga0501067_0001320 | 3300049583 | Bacteria | 13442 |
| 401 | Ga0501067_0009788 | 3300049583 | Bacteria | 5305 |
| 402 | Ga0501067_0051777 | 3300049583 | Bacteria | 2275 |
| 403 | Ga0501067_0166742 | 3300049583 | Bacteria | 1227 |
| 404 | Ga0501067_0181600 | 3300049583 | Bacteria | 1172 |
| 405 | Ga0501067_0186971 | 3300049583 | Bacteria | 1154 |
| 406 | Ga0501067_0247253 | 3300049583 | Bacteria | 993 |
| 407 | Ga0501068_0003141 | 3300049584 | Bacteria | 8842 |
| 408 | Ga0501068_0254661 | 3300049584 | Bacteria | 1119 |
| 409 | Ga0501068_0397772 | 3300049584 | Bacteria | 888 |
| 410 | Ga0501069_0000073 | 3300049585 | Bacteria | 50646 |
| 411 | Ga0501069_0001305 | 3300049585 | Bacteria | 12228 |
| 412 | Ga0501069_0044113 | 3300049585 | Bacteria | 2469 |
| 413 | Ga0501069_0257669 | 3300049585 | Bacteria | 1018 |
| 414 | Ga0501070_0000385 | 3300049586 | Bacteria | 40440 |
| 415 | Ga0501070_0008366 | 3300049586 | Bacteria | 8742 |
| 416 | Ga0501070_0009729 | 3300049586 | Bacteria | 8129 |
| 417 | Ga0501070_0024862 | 3300049586 | Bacteria | 5022 |
| 418 | Ga0501070_0094321 | 3300049586 | Bacteria | 2476 |
| 419 | Ga0501070_0111893 | 3300049586 | Bacteria | 2256 |
| 420 | Ga0501070_0245995 | 3300049586 | Bacteria | 1463 |
| 421 | Ga0501070_0593943 | 3300049586 | Bacteria | 883 |
| 422 | Ga0501071_0012434 | 3300049587 | Bacteria | 5772 |
| 423 | Ga0501071_0131128 | 3300049587 | Bacteria | 1862 |
| 424 | Ga0501071_0159548 | 3300049587 | Bacteria | 1685 |
| 425 | Ga0501072_0429229 | 3300049588 | Bacteria | 1047 |
| 426 | Ga0501072_0574267 | 3300049588 | Bacteria | 890 |
| 427 | Ga0501073_0016266 | 3300049589 | Bacteria | 5391 |
| 428 | Ga0501073_0028749 | 3300049589 | Bacteria | 3972 |
| 429 | Ga0501073_0069005 | 3300049589 | Bacteria | 2464 |
| 430 | Ga0501073_0128882 | 3300049589 | Bacteria | 1754 |
| 431 | Ga0501073_0236581 | 3300049589 | Bacteria | 1261 |
| 432 | Ga0501074_0000390 | 3300049590 | Bacteria | 26047 |
| 433 | Ga0501074_0009564 | 3300049590 | Bacteria | 7039 |
| 434 | Ga0501074_0015949 | 3300049590 | Bacteria | 5464 |
| 435 | Ga0501074_0016234 | 3300049590 | Bacteria | 5409 |
| 436 | Ga0501074_0088081 | 3300049590 | Bacteria | 2223 |
| 437 | Ga0501076_0967807 | 3300049592 | Bacteria | 701 |
| 438 | Ga0501079_0511893 | 3300049741 | Bacteria | 944 |
| 439 | Ga0501079_0794851 | 3300049741 | Bacteria | 745 |
| 440 | Ga0501080_0003536 | 3300049742 | Bacteria | 13766 |
| 441 | Ga0501080_0011370 | 3300049742 | Bacteria | 8151 |
| 442 | Ga0501080_0021998 | 3300049742 | Bacteria | 5906 |
| 443 | Ga0501080_0060900 | 3300049742 | Bacteria | 3514 |
| 444 | Ga0501080_0062492 | 3300049742 | Bacteria | 3466 |
| 445 | Ga0501080_0118406 | 3300049742 | Bacteria | 2455 |
| 446 | Ga0501080_0423021 | 3300049742 | Bacteria | 1196 |
| 447 | Ga0501083_0000235 | 3300049744 | Bacteria | 35557 |
| 448 | Ga0501083_0005780 | 3300049744 | Bacteria | 8756 |
| 449 | Ga0501083_0032218 | 3300049744 | Bacteria | 3596 |
| 450 | Ga0501083_0122242 | 3300049744 | Bacteria | 1707 |
| 451 | Ga0501035_0000025 | 3300049822 | Bacteria | 204195 |
| 452 | Ga0501035_0000028 | 3300049822 | Bacteria | 179195 |
| 453 | Ga0501035_0001951 | 3300049822 | Bacteria | 20653 |
| 454 | Ga0501035_0004666 | 3300049822 | Bacteria | 13009 |
| 455 | Ga0501035_0006605 | 3300049822 | Bacteria | 10857 |
| 456 | Ga0501035_0019298 | 3300049822 | Bacteria | 6274 |
| 457 | Ga0501035_0044425 | 3300049822 | Bacteria | 4001 |
| 458 | Ga0501035_0104265 | 3300049822 | Bacteria | 2487 |
| 459 | Ga0501035_0138377 | 3300049822 | Bacteria | 2118 |
| 460 | Ga0501035_0690543 | 3300049822 | Bacteria | 824 |
| 461 | Ga0501044_0000031 | 3300049823 | Bacteria | 173135 |
| 462 | Ga0501044_0004322 | 3300049823 | Bacteria | 15928 |
| 463 | Ga0501044_0007776 | 3300049823 | Bacteria | 11787 |
| 464 | Ga0501044_0011168 | 3300049823 | Bacteria | 9741 |
| 465 | Ga0501044_0043873 | 3300049823 | Bacteria | 4643 |
| 466 | Ga0501044_0065538 | 3300049823 | Bacteria | 3704 |
| 467 | Ga0501044_0082098 | 3300049823 | Bacteria | 3262 |
| 468 | Ga0501044_0124367 | 3300049823 | Bacteria | 2577 |
| 469 | Ga0501044_0140858 | 3300049823 | Bacteria | 2400 |
| 470 | Ga0501044_0340371 | 3300049823 | Bacteria | 1421 |
| 471 | Ga0501045_0015919 | 3300049824 | Bacteria | 5334 |
| 472 | Ga0501045_0238195 | 3300049824 | Bacteria | 1355 |
| 473 | nmdc:mga03683_185333_c1 | 3300050489 | Bacteria | 951 |
| 474 | nmdc:mga03683_2822_c1 | 3300050489 | Bacteria | 5472 |
| 475 | nmdc:mga03n38_379259_c1 | 3300050490 | Bacteria | 775 |
| 476 | nmdc:mga00v17_299473_c1 | 3300050491 | Bacteria | 1044 |
| 477 | nmdc:mga00v17_80386_c1 | 3300050491 | Bacteria | 2034 |
| 478 | nmdc:mga0yw44_277910_c1 | 3300050492 | Bacteria | 1119 |
| 479 | nmdc:mga0yw44_363204_c1 | 3300050492 | Bacteria | 976 |
| 480 | nmdc:mga0yw44_98184_c1 | 3300050492 | Bacteria | 1862 |
| 481 | nmdc:mga06z11_268310_c1 | 3300050494 | Bacteria | 1009 |
| 482 | nmdc:mga06z11_78137_c1 | 3300050494 | Bacteria | 1768 |
| 483 | nmdc:mga07m45_307350_c1 | 3300050496 | Bacteria | 922 |
| 484 | nmdc:mga0sz30_32382_c1 | 3300050516 | Bacteria | 2168 |
| 485 | Ga0495601_0041469 | 3300053077 | Bacteria | 2885 |
| 486 | Ga0495601_0549975 | 3300053077 | Bacteria | 743 |
| 487 | Ga0495612_0000290 | 3300053078 | Bacteria | 20485 |
| 488 | Ga0495655_0142639 | 3300053083 | Bacteria | 747 |
| 489 | Ga0495595_0029895 | 3300053084 | Bacteria | 2441 |
| 490 | Ga0495595_0165647 | 3300053084 | Bacteria | 1092 |
| 491 | Ga0495619_0031108 | 3300053085 | Bacteria | 3457 |
| 492 | Ga0495619_0045966 | 3300053085 | Bacteria | 2870 |
| 493 | Ga0500644_0034639 | 3300053088 | Bacteria | 1631 |
| 494 | Ga0500583_0149864 | 3300053092 | Bacteria | 1161 |
| 495 | Ga0500651_0186221 | 3300053093 | Bacteria | 1231 |
| 496 | Ga0500650_0148469 | 3300053098 | Bacteria | 1085 |
| 497 | Ga0500593_000183 | 3300053117 | Bacteria | 25578 |
| 498 | Ga0500642_0229131 | 3300053130 | Bacteria | 859 |
| 499 | Ga0500568_0000002 | 3300053139 | Bacteria | 880601 |
| 500 | Ga0500604_0046695 | 3300053151 | Bacteria | 1325 |
| 501 | Ga0500616_0003337 | 3300053153 | Bacteria | 12363 |
| 502 | Ga0500620_009644 | 3300053155 | Bacteria | 2502 |
| 503 | Ga0500620_055802 | 3300053155 | Bacteria | 1335 |
| 504 | Ga0500627_0106025 | 3300053158 | Bacteria | 1263 |
| 505 | Ga0500627_0117718 | 3300053158 | Bacteria | 1197 |
| 506 | Ga0500627_0121450 | 3300053158 | Bacteria | 1178 |
| 507 | Ga0500627_0244259 | 3300053158 | Bacteria | 796 |
| 508 | Ga0500636_0125725 | 3300053177 | Bacteria | 1434 |
| 509 | Ga0500611_015028 | 3300053727 | Bacteria | 1363 |
| 510 | Ga0500611_112636 | 3300053727 | Bacteria | 717 |
| 511 | Ga0500552_002516 | 3300053733 | Bacteria | 1792 |
| 512 | Ga0501084_0043399 | 3300054114 | Bacteria | 3762 |
| 513 | Ga0501084_0269146 | 3300054114 | Bacteria | 1438 |
| 514 | Ga0501084_0411714 | 3300054114 | Bacteria | 1143 |
| 515 | Ga0501084_0610506 | 3300054114 | Bacteria | 921 |
| 516 | Ga0501082_0002950 | 3300060353 | Bacteria | 14841 |
| 517 | Ga0501082_0146904 | 3300060353 | Bacteria | 2047 |
| 518 | Ga0501082_0150111 | 3300060353 | Bacteria | 2024 |
| 519 | Ga0501082_0239219 | 3300060353 | Bacteria | 1580 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035170 | Ga0373943_0503711 | Ga0373943_0503711_115_663 | 165 |
| 2 | 3300049822 | Ga0501035_0690543 | Ga0501035_0690543_21_569 | 165 |
| 3 | 3300025932 | Ga0207690_10322522 | Ga0207690_103225222 | 182 |
| 4 | 3300006175 | Ga0070712_100134721 | Ga0070712_1001347212 | 183 |
| 5 | 3300025929 | Ga0207664_10002435 | Ga0207664_1000243510 | 183 |
| 6 | iso_pu_bacteria | 3000405567 | 3000408065 | 187 |
| 7 | iso_pu_bacteria | 2513237087 | 2513592972 | 188 |
| 8 | iso_pu_bacteria | 2828305725 | 2828308294 | 188 |
| 9 | iso_pu_bacteria | 2891088606 | 2891089248 | 188 |
| 10 | iso_pu_bacteria | 2939669807 | 2939673419 | 188 |
| 11 | 3300053083 | Ga0495655_0142639 | Ga0495655_0142639_86_703 | 189 |
| 12 | iso_pu_bacteria | 2513237351 | 2514586314 | 189 |
| 13 | iso_pu_bacteria | 2643221623 | 2644133785 | 189 |
| 14 | iso_pu_bacteria | 2738543024 | 2739307727 | 189 |
| 15 | iso_pu_bacteria | 2889790730 | 2889795875 | 189 |
| 16 | iso_pu_bacteria | 2889914905 | 2889917748 | 189 |
| 17 | iso_pu_bacteria | 2937843397 | 2937846944 | 189 |
| 18 | iso_pu_bacteria | 2996310559 | 2996316575 | 189 |
| 19 | iso_pu_bacteria | 8002285264 | 8002290934 | 189 |
| 20 | 3300005336 | Ga0070680_100159731 | Ga0070680_1001597312 | 190 |
| 21 | 3300005436 | Ga0070713_100042235 | Ga0070713_1000422353 | 190 |
| 22 | 3300005530 | Ga0070679_100032673 | Ga0070679_1000326734 | 190 |
| 23 | 3300005547 | Ga0070693_100537585 | Ga0070693_1005375851 | 190 |
| 24 | 3300021441 | Ga0213871_10003974 | Ga0213871_100039743 | 190 |
| 25 | 3300025903 | Ga0207680_10237139 | Ga0207680_102371392 | 190 |
| 26 | 3300025928 | Ga0207700_10007179 | Ga0207700_100071793 | 190 |
| 27 | 3300028800 | Ga0265338_10114786 | Ga0265338_101147864 | 190 |
| 28 | 3300039438 | Ga0436360_0261887 | Ga0436360_0261887_73_723 | 190 |
| 29 | 3300039438 | Ga0436360_0701477 | Ga0436360_0701477_1934_2584 | 190 |
| 30 | 3300039438 | Ga0436360_1132676 | Ga0436360_1132676_1589_2224 | 190 |
| 31 | 3300039453 | Ga0436362_0265607 | Ga0436362_0265607_697_1356 | 190 |
| 32 | iso_pu_bacteria | 2503198000 | 2503199780 | 190 |
| 33 | iso_pu_bacteria | 2508501123 | 2509114735 | 190 |
| 34 | iso_pu_bacteria | 2508501127 | 2509142403 | 190 |
| 35 | iso_pu_bacteria | 2509276018 | 2509371997 | 190 |
| 36 | iso_pu_bacteria | 2509276022 | 2509394701 | 190 |
| 37 | iso_pu_bacteria | 2510065059 | 2510318710 | 190 |
| 38 | iso_pu_bacteria | 2512875016 | 2512932800 | 190 |
| 39 | iso_pu_bacteria | 2512875024 | 2512960821 | 190 |
| 40 | iso_pu_bacteria | 2513237090 | 2513608920 | 190 |
| 41 | iso_pu_bacteria | 2513237164 | 2514036590 | 190 |
| 42 | iso_pu_bacteria | 2513237305 | 2514417401 | 190 |
| 43 | iso_pu_bacteria | 2588253730 | 2588518853 | 190 |
| 44 | iso_pu_bacteria | 2597489875 | 2597811007 | 190 |
| 45 | iso_pu_bacteria | 2599185301 | 2599939801 | 190 |
| 46 | iso_pu_bacteria | 2643221551 | 2643776747 | 190 |
| 47 | iso_pu_bacteria | 2643221555 | 2643795195 | 190 |
| 48 | iso_pu_bacteria | 2643221595 | 2643987542 | 190 |
| 49 | iso_pu_bacteria | 2643221627 | 2644157937 | 190 |
| 50 | iso_pu_bacteria | 2687453392 | 2688597026 | 190 |
| 51 | iso_pu_bacteria | 2693429784 | 2694635620 | 190 |
| 52 | iso_pu_bacteria | 2721755686 | 2723574187 | 190 |
| 53 | iso_pu_bacteria | 2756170246 | 2756671000 | 190 |
| 54 | iso_pu_bacteria | 2791355123 | 2792748213 | 190 |
| 55 | iso_pu_bacteria | 2841734538 | 2841737527 | 190 |
| 56 | iso_pu_bacteria | 2844002411 | 2844008905 | 190 |
| 57 | iso_pu_bacteria | 2844009547 | 2844012377 | 190 |
| 58 | iso_pu_bacteria | 2856320880 | 2856322874 | 190 |
| 59 | iso_pu_bacteria | 2856328259 | 2856334646 | 190 |
| 60 | iso_pu_bacteria | 2856334872 | 2856341224 | 190 |
| 61 | iso_pu_bacteria | 2856342000 | 2856349185 | 190 |
| 62 | iso_pu_bacteria | 2857349434 | 2857352198 | 190 |
| 63 | iso_pu_bacteria | 2857367948 | 2857371716 | 190 |
| 64 | iso_pu_bacteria | 2869162929 | 2869165742 | 190 |
| 65 | iso_pu_bacteria | 2869169390 | 2869174373 | 190 |
| 66 | iso_pu_bacteria | 2869234852 | 2869237636 | 190 |
| 67 | iso_pu_bacteria | 2869242130 | 2869248079 | 190 |
| 68 | iso_pu_bacteria | 2869249662 | 2869254160 | 190 |
| 69 | iso_pu_bacteria | 2869256925 | 2869257803 | 190 |
| 70 | iso_pu_bacteria | 2869264136 | 2869269989 | 190 |
| 71 | iso_pu_bacteria | 2869271264 | 2869277440 | 190 |
| 72 | iso_pu_bacteria | 2869278585 | 2869282424 | 190 |
| 73 | iso_pu_bacteria | 2871435913 | 2871438208 | 190 |
| 74 | iso_pu_bacteria | 2871451962 | 2871452555 | 190 |
| 75 | iso_pu_bacteria | 2871459585 | 2871463465 | 190 |
| 76 | iso_pu_bacteria | 2871466892 | 2871466964 | 190 |
| 77 | iso_pu_bacteria | 2871474448 | 2871477011 | 190 |
| 78 | iso_pu_bacteria | 2871481445 | 2871486449 | 190 |
| 79 | iso_pu_bacteria | 2871488783 | 2871493447 | 190 |
| 80 | iso_pu_bacteria | 2871495908 | 2871496481 | 190 |
| 81 | iso_pu_bacteria | 2874109183 | 2874114318 | 190 |
| 82 | iso_pu_bacteria | 2874116593 | 2874119965 | 190 |
| 83 | iso_pu_bacteria | 2874123672 | 2874129004 | 190 |
| 84 | iso_pu_bacteria | 2874131515 | 2874136911 | 190 |
| 85 | iso_pu_bacteria | 2874139085 | 2874142079 | 190 |
| 86 | iso_pu_bacteria | 2874162495 | 2874163097 | 190 |
| 87 | iso_pu_bacteria | 2874168670 | 2874175005 | 190 |
| 88 | iso_pu_bacteria | 2876363079 | 2876364951 | 190 |
| 89 | iso_pu_bacteria | 2876369609 | 2876373228 | 190 |
| 90 | iso_pu_bacteria | 2876377896 | 2876385539 | 190 |
| 91 | iso_pu_bacteria | 2876386047 | 2876392529 | 190 |
| 92 | iso_pu_bacteria | 2876399893 | 2876402640 | 190 |
| 93 | iso_pu_bacteria | 2876406927 | 2876410674 | 190 |
| 94 | iso_pu_bacteria | 2876420981 | 2876424185 | 190 |
| 95 | iso_pu_bacteria | 2878730984 | 2878738779 | 190 |
| 96 | iso_pu_bacteria | 2878738818 | 2878744737 | 190 |
| 97 | iso_pu_bacteria | 2878760144 | 2878760709 | 190 |
| 98 | iso_pu_bacteria | 2878767105 | 2878767666 | 190 |
| 99 | iso_pu_bacteria | 2878774303 | 2878776090 | 190 |
| 100 | iso_pu_bacteria | 2878781027 | 2878784190 | 190 |
| 101 | iso_pu_bacteria | 2878788777 | 2878793851 | 190 |
| 102 | iso_pu_bacteria | 2881147464 | 2881149653 | 190 |
| 103 | iso_pu_bacteria | 2881155292 | 2881160843 | 190 |
| 104 | iso_pu_bacteria | 2881853255 | 2881859834 | 190 |
| 105 | iso_pu_bacteria | 2882632389 | 2882639457 | 190 |
| 106 | iso_pu_bacteria | 2882912400 | 2882918972 | 190 |
| 107 | iso_pu_bacteria | 2885305155 | 2885308016 | 190 |
| 108 | iso_pu_bacteria | 2885312484 | 2885313065 | 190 |
| 109 | iso_pu_bacteria | 2885318864 | 2885319265 | 190 |
| 110 | iso_pu_bacteria | 2885326080 | 2885327811 | 190 |
| 111 | iso_pu_bacteria | 2885334103 | 2885341549 | 190 |
| 112 | iso_pu_bacteria | 2885342637 | 2885347389 | 190 |
| 113 | iso_pu_bacteria | 2885350715 | 2885351196 | 190 |
| 114 | iso_pu_bacteria | 2888337043 | 2888338103 | 190 |
| 115 | iso_pu_bacteria | 2888343758 | 2888345449 | 190 |
| 116 | iso_pu_bacteria | 2888350351 | 2888354753 | 190 |
| 117 | iso_pu_bacteria | 2889010040 | 2889016370 | 190 |
| 118 | iso_pu_bacteria | 2889016732 | 2889018606 | 190 |
| 119 | iso_pu_bacteria | 2903448605 | 2903449587 | 190 |
| 120 | iso_pu_bacteria | 2903492973 | 2903501219 | 190 |
| 121 | iso_pu_bacteria | 2903513507 | 2903514004 | 190 |
| 122 | iso_pu_bacteria | 2903521522 | 2903522313 | 190 |
| 123 | iso_pu_bacteria | 2903528002 | 2903528692 | 190 |
| 124 | iso_pu_bacteria | 2903540706 | 2903541275 | 190 |
| 125 | iso_pu_bacteria | 2906354277 | 2906362778 | 190 |
| 126 | iso_pu_bacteria | 2906363423 | 2906366500 | 190 |
| 127 | iso_pu_bacteria | 2906370794 | 2906373522 | 190 |
| 128 | iso_pu_bacteria | 2906378014 | 2906383072 | 190 |
| 129 | iso_pu_bacteria | 2906386501 | 2906392719 | 190 |
| 130 | iso_pu_bacteria | 2906393657 | 2906398479 | 190 |
| 131 | iso_pu_bacteria | 2906401398 | 2906403466 | 190 |
| 132 | iso_pu_bacteria | 2906408224 | 2906409098 | 190 |
| 133 | iso_pu_bacteria | 2906427513 | 2906430125 | 190 |
| 134 | iso_pu_bacteria | 2922130491 | 2922133104 | 190 |
| 135 | iso_pu_bacteria | 2922151315 | 2922156554 | 190 |
| 136 | iso_pu_bacteria | 2922172374 | 2922173737 | 190 |
| 137 | iso_pu_bacteria | 2922178524 | 2922185189 | 190 |
| 138 | iso_pu_bacteria | 2922185730 | 2922185864 | 190 |
| 139 | iso_pu_bacteria | 2924710171 | 2924716306 | 190 |
| 140 | iso_pu_bacteria | 2924718760 | 2924725239 | 190 |
| 141 | iso_pu_bacteria | 2924733363 | 2924737391 | 190 |
| 142 | iso_pu_bacteria | 2924741084 | 2924742457 | 190 |
| 143 | iso_pu_bacteria | 2924748358 | 2924749626 | 190 |
| 144 | iso_pu_bacteria | 2924754689 | 2924756950 | 190 |
| 145 | iso_pu_bacteria | 2924762789 | 2924765263 | 190 |
| 146 | iso_pu_bacteria | 2924776078 | 2924782768 | 190 |
| 147 | iso_pu_bacteria | 2924784321 | 2924786786 | 190 |
| 148 | iso_pu_bacteria | 2937822353 | 2937822478 | 190 |
| 149 | iso_pu_bacteria | 2937836603 | 2937840235 | 190 |
| 150 | iso_pu_bacteria | 2937848649 | 2937852244 | 190 |
| 151 | iso_pu_bacteria | 2937861824 | 2937862634 | 190 |
| 152 | iso_pu_bacteria | 2937868953 | 2937874051 | 190 |
| 153 | iso_pu_bacteria | 2937877337 | 2937881503 | 190 |
| 154 | iso_pu_bacteria | 2937972304 | 2937977500 | 190 |
| 155 | iso_pu_bacteria | 2937994558 | 2937995131 | 190 |
| 156 | iso_pu_bacteria | 2938014810 | 2938018809 | 190 |
| 157 | iso_pu_bacteria | 2958034702 | 2958039206 | 190 |
| 158 | iso_pu_bacteria | 2958041894 | 2958053164 | 190 |
| 159 | iso_pu_bacteria | 2958064165 | 2958070411 | 190 |
| 160 | iso_pu_bacteria | 2958071322 | 2958071444 | 190 |
| 161 | iso_pu_bacteria | 2958084443 | 2958087940 | 190 |
| 162 | iso_pu_bacteria | 2958092219 | 2958100779 | 190 |
| 163 | iso_pu_bacteria | 2958100919 | 2958103727 | 190 |
| 164 | iso_pu_bacteria | 2958108152 | 2958109095 | 190 |
| 165 | iso_pu_bacteria | 2958122699 | 2958129482 | 190 |
| 166 | iso_pu_bacteria | 2958137437 | 2958141443 | 190 |
| 167 | iso_pu_bacteria | 2958144490 | 2958151913 | 190 |
| 168 | iso_pu_bacteria | 2958158011 | 2958161810 | 190 |
| 169 | iso_pu_bacteria | 2958165035 | 2958165604 | 190 |
| 170 | iso_pu_bacteria | 2958172287 | 2958178707 | 190 |
| 171 | iso_pu_bacteria | 2961127735 | 2961127977 | 190 |
| 172 | iso_pu_bacteria | 2961136820 | 2961138455 | 190 |
| 173 | iso_pu_bacteria | 2961163497 | 2961164063 | 190 |
| 174 | iso_pu_bacteria | 2961183825 | 2961190214 | 190 |
| 175 | iso_pu_bacteria | 2963644680 | 2963646407 | 190 |
| 176 | iso_pu_bacteria | 2965018300 | 2965018871 | 190 |
| 177 | iso_pu_bacteria | 2965025482 | 2965027097 | 190 |
| 178 | iso_pu_bacteria | 2965032056 | 2965035218 | 190 |
| 179 | iso_pu_bacteria | 2965040258 | 2965042451 | 190 |
| 180 | iso_pu_bacteria | 2965089291 | 2965095712 | 190 |
| 181 | iso_pu_bacteria | 2965102966 | 2965105097 | 190 |
| 182 | iso_pu_bacteria | 2965110997 | 2965112755 | 190 |
| 183 | iso_pu_bacteria | 2965119406 | 2965123403 | 190 |
| 184 | iso_pu_bacteria | 2967996073 | 2967999816 | 190 |
| 185 | iso_pu_bacteria | 2968003550 | 2968008175 | 190 |
| 186 | iso_pu_bacteria | 2968016561 | 2968020532 | 190 |
| 187 | iso_pu_bacteria | 2968083720 | 2968087067 | 190 |
| 188 | iso_pu_bacteria | 2968117919 | 2968119041 | 190 |
| 189 | iso_pu_bacteria | 2968138860 | 2968144058 | 190 |
| 190 | iso_pu_bacteria | 2968171901 | 2968172466 | 190 |
| 191 | iso_pu_bacteria | 2970469710 | 2970473829 | 190 |
| 192 | iso_pu_bacteria | 2970489779 | 2970492776 | 190 |
| 193 | iso_pu_bacteria | 2970503327 | 2970507770 | 190 |
| 194 | iso_pu_bacteria | 2970510686 | 2970516569 | 190 |
| 195 | iso_pu_bacteria | 2970524798 | 2970527162 | 190 |
| 196 | iso_pu_bacteria | 2970540015 | 2970544020 | 190 |
| 197 | iso_pu_bacteria | 2970547951 | 2970551191 | 190 |
| 198 | iso_pu_bacteria | 2970554993 | 2970555562 | 190 |
| 199 | iso_pu_bacteria | 2970593180 | 2970597033 | 190 |
| 200 | iso_pu_bacteria | 2970619444 | 2970621877 | 190 |
| 201 | iso_pu_bacteria | 2970627176 | 2970630651 | 190 |
| 202 | iso_pu_bacteria | 2977821940 | 2977826648 | 190 |
| 203 | iso_pu_bacteria | 2977828996 | 2977836757 | 190 |
| 204 | iso_pu_bacteria | 2977851361 | 2977857922 | 190 |
| 205 | iso_pu_bacteria | 2977864932 | 2977870164 | 190 |
| 206 | iso_pu_bacteria | 2977872689 | 2977872836 | 190 |
| 207 | iso_pu_bacteria | 2977898635 | 2977906316 | 190 |
| 208 | iso_pu_bacteria | 2977907340 | 2977910919 | 190 |
| 209 | iso_pu_bacteria | 2977915119 | 2977919410 | 190 |
| 210 | iso_pu_bacteria | 2977922695 | 2977926504 | 190 |
| 211 | iso_pu_bacteria | 2977935797 | 2977937815 | 190 |
| 212 | iso_pu_bacteria | 2977942078 | 2977945155 | 190 |
| 213 | iso_pu_bacteria | 2977950692 | 2977956903 | 190 |
| 214 | iso_pu_bacteria | 2977957713 | 2977960394 | 190 |
| 215 | iso_pu_bacteria | 2977986579 | 2977990616 | 190 |
| 216 | iso_pu_bacteria | 2979710463 | 2979710958 | 190 |
| 217 | iso_pu_bacteria | 2979742915 | 2979745690 | 190 |
| 218 | iso_pu_bacteria | 2979764755 | 2979766440 | 190 |
| 219 | iso_pu_bacteria | 2979772303 | 2979776979 | 190 |
| 220 | iso_pu_bacteria | 2979793036 | 2979800607 | 190 |
| 221 | iso_pu_bacteria | 2979808191 | 2979812954 | 190 |
| 222 | iso_pu_bacteria | 2987636660 | 2987639382 | 190 |
| 223 | iso_pu_bacteria | 2987645492 | 2987651352 | 190 |
| 224 | iso_pu_bacteria | 2987652177 | 2987658335 | 190 |
| 225 | iso_pu_bacteria | 2987659509 | 2987660071 | 190 |
| 226 | iso_pu_bacteria | 2987666974 | 2987669623 | 190 |
| 227 | iso_pu_bacteria | 2987673487 | 2987673574 | 190 |
| 228 | iso_pu_bacteria | 2996336353 | 2996336471 | 190 |
| 229 | iso_pu_bacteria | 2996348954 | 2996352850 | 190 |
| 230 | iso_pu_bacteria | 2996386984 | 2996387240 | 190 |
| 231 | iso_pu_bacteria | 3000135777 | 3000139382 | 190 |
| 232 | iso_pu_bacteria | 3004167301 | 3004167424 | 190 |
| 233 | iso_pu_bacteria | 3004188549 | 3004189119 | 190 |
| 234 | iso_pu_bacteria | 3004195979 | 3004199008 | 190 |
| 235 | iso_pu_bacteria | 3004203850 | 3004204374 | 190 |
| 236 | iso_pu_bacteria | 3004211236 | 3004217843 | 190 |
| 237 | iso_pu_bacteria | 3004218560 | 3004221109 | 190 |
| 238 | iso_pu_bacteria | 3004232784 | 3004232888 | 190 |
| 239 | iso_pu_bacteria | 3004239961 | 3004247879 | 190 |
| 240 | iso_pu_bacteria | 3004248173 | 3004254580 | 190 |
| 241 | iso_pu_bacteria | 3004268573 | 3004274137 | 190 |
| 242 | iso_pu_bacteria | 3004275668 | 3004279532 | 190 |
| 243 | iso_pu_bacteria | 3004289098 | 3004290794 | 190 |
| 244 | iso_pu_bacteria | 3004334049 | 3004335987 | 190 |
| 245 | iso_pu_bacteria | 637000159 | 637075882 | 190 |
| 246 | iso_pu_bacteria | 649633066 | 649871582 | 190 |
| 247 | iso_pu_bacteria | 8004300914 | 8004302228 | 190 |
| 248 | iso_pu_bacteria | 8004312739 | 8004315381 | 190 |
| 249 | iso_pu_bacteria | 8004361976 | 8004365342 | 190 |
| 250 | iso_pu_bacteria | 8004374579 | 8004379064 | 190 |
| 251 | iso_pu_bacteria | 8004633249 | 8004637455 | 190 |
| 252 | iso_pu_bacteria | 8004695233 | 8004697468 | 190 |
| 253 | iso_pu_bacteria | 8004727605 | 8004730212 | 190 |
| 254 | iso_pu_bacteria | 8055617313 | 8055619245 | 190 |
| 255 | 3300003323 | rootH1_10020692 | rootH1_100206928 | 191 |
| 256 | 3300005327 | Ga0070658_10003464 | Ga0070658_100034647 | 191 |
| 257 | 3300005327 | Ga0070658_10300021 | Ga0070658_103000212 | 191 |
| 258 | 3300005336 | Ga0070680_100025492 | Ga0070680_1000254921 | 191 |
| 259 | 3300005341 | Ga0070691_10001404 | Ga0070691_100014046 | 191 |
| 260 | 3300005366 | Ga0070659_100563058 | Ga0070659_1005630581 | 191 |
| 261 | 3300005455 | Ga0070663_100381597 | Ga0070663_1003815972 | 191 |
| 262 | 3300005518 | Ga0070699_100487009 | Ga0070699_1004870091 | 191 |
| 263 | 3300005530 | Ga0070679_100094930 | Ga0070679_1000949302 | 191 |
| 264 | 3300005543 | Ga0070672_100791249 | Ga0070672_1007912492 | 191 |
| 265 | 3300005563 | Ga0068855_100031023 | Ga0068855_1000310233 | 191 |
| 266 | 3300005617 | Ga0068859_100631076 | Ga0068859_1006310762 | 191 |
| 267 | 3300006038 | Ga0075365_10056224 | Ga0075365_100562243 | 191 |
| 268 | 3300006042 | Ga0075368_10056697 | Ga0075368_100566973 | 191 |
| 269 | 3300006177 | Ga0075362_10058515 | Ga0075362_100585152 | 191 |
| 270 | 3300006177 | Ga0075362_10095718 | Ga0075362_100957181 | 191 |
| 271 | 3300006177 | Ga0075362_10315075 | Ga0075362_103150751 | 191 |
| 272 | 3300006178 | Ga0075367_10445586 | Ga0075367_104455861 | 191 |
| 273 | 3300006186 | Ga0075369_10193123 | Ga0075369_101931232 | 191 |
| 274 | 3300006931 | Ga0097620_100631081 | Ga0097620_1006310812 | 191 |
| 275 | 3300009093 | Ga0105240_10007628 | Ga0105240_1000762810 | 191 |
| 276 | 3300009551 | Ga0105238_10427365 | Ga0105238_104273653 | 191 |
| 277 | 3300021384 | Ga0213876_10193059 | Ga0213876_101930592 | 191 |
| 278 | 3300025909 | Ga0207705_10119510 | Ga0207705_101195101 | 191 |
| 279 | 3300025912 | Ga0207707_10005836 | Ga0207707_100058362 | 191 |
| 280 | 3300025917 | Ga0207660_10371041 | Ga0207660_103710413 | 191 |
| 281 | 3300025921 | Ga0207652_10033644 | Ga0207652_100336443 | 191 |
| 282 | 3300025949 | Ga0207667_10351063 | Ga0207667_103510633 | 191 |
| 283 | 3300026067 | Ga0207678_10417068 | Ga0207678_104170682 | 191 |
| 284 | 3300026118 | Ga0207675_100693675 | Ga0207675_1006936752 | 191 |
| 285 | 3300027866 | Ga0209813_10099727 | Ga0209813_100997272 | 191 |
| 286 | 3300028573 | Ga0265334_10009214 | Ga0265334_100092143 | 191 |
| 287 | 3300031235 | Ga0265330_10051719 | Ga0265330_100517193 | 191 |
| 288 | 3300031238 | Ga0265332_10120577 | Ga0265332_101205772 | 191 |
| 289 | 3300031241 | Ga0265325_10015163 | Ga0265325_100151632 | 191 |
| 290 | 3300031241 | Ga0265325_10048025 | Ga0265325_100480253 | 191 |
| 291 | 3300031247 | Ga0265340_10043626 | Ga0265340_100436263 | 191 |
| 292 | 3300031247 | Ga0265340_10068721 | Ga0265340_100687212 | 191 |
| 293 | 3300031249 | Ga0265339_10127026 | Ga0265339_101270262 | 191 |
| 294 | 3300031249 | Ga0265339_10131062 | Ga0265339_101310622 | 191 |
| 295 | 3300031250 | Ga0265331_10029735 | Ga0265331_100297351 | 191 |
| 296 | 3300031251 | Ga0265327_10000070 | Ga0265327_1000007049 | 191 |
| 297 | 3300031344 | Ga0265316_10325327 | Ga0265316_103253272 | 191 |
| 298 | 3300031456 | Ga0307513_10783999 | Ga0307513_107839991 | 191 |
| 299 | 3300031595 | Ga0265313_10000004 | Ga0265313_10000004147 | 191 |
| 300 | 3300031595 | Ga0265313_10033316 | Ga0265313_100333164 | 191 |
| 301 | 3300031595 | Ga0265313_10036836 | Ga0265313_100368363 | 191 |
| 302 | 3300031595 | Ga0265313_10109635 | Ga0265313_101096352 | 191 |
| 303 | 3300031711 | Ga0265314_10127667 | Ga0265314_101276672 | 191 |
| 304 | 3300031712 | Ga0265342_10041348 | Ga0265342_100413483 | 191 |
| 305 | 3300031712 | Ga0265342_10103090 | Ga0265342_101030903 | 191 |
| 306 | 3300031712 | Ga0265342_10113886 | Ga0265342_101138863 | 191 |
| 307 | 3300035170 | Ga0373943_0269064 | Ga0373943_0269064_118_729 | 191 |
| 308 | 3300035725 | Ga0373947_0046584 | Ga0373947_0046584_1478_2089 | 191 |
| 309 | 3300037853 | Ga0436364_1431099 | Ga0436364_1431099_2822_3475 | 191 |
| 310 | 3300038443 | Ga0395901_0285229 | Ga0395901_0285229_65_679 | 191 |
| 311 | 3300039437 | Ga0436365_0249297 | Ga0436365_0249297_1218_1871 | 191 |
| 312 | 3300042876 | Ga0451577_0090571 | Ga0451577_0090571_1816_2427 | 191 |
| 313 | 3300044673 | Ga0453683_0042228 | Ga0453683_0042228_463_1074 | 191 |
| 314 | 3300044712 | Ga0453684_0246399 | Ga0453684_0246399_1318_1929 | 191 |
| 315 | 3300044842 | Ga0466957_0143220 | Ga0466957_0143220_827_1438 | 191 |
| 316 | 3300045051 | Ga0451576_1153558 | Ga0451576_1153558_105_716 | 191 |
| 317 | 3300047472 | Ga0495686_0000134 | Ga0495686_0000134_61138_61752 | 191 |
| 318 | 3300048929 | Ga0496126_0054032 | Ga0496126_0054032_1097_1708 | 191 |
| 319 | 3300049568 | Ga0501031_0229433 | Ga0501031_0229433_353_964 | 191 |
| 320 | 3300049571 | Ga0501034_0014538 | Ga0501034_0014538_392_1003 | 191 |
| 321 | 3300049571 | Ga0501034_0979653 | Ga0501034_0979653_46_657 | 191 |
| 322 | 3300049573 | Ga0501037_0581950 | Ga0501037_0581950_107_718 | 191 |
| 323 | 3300049574 | Ga0501038_0078757 | Ga0501038_0078757_1501_2112 | 191 |
| 324 | 3300049575 | Ga0501039_0179429 | Ga0501039_0179429_740_1441 | 191 |
| 325 | 3300049579 | Ga0501043_0078845 | Ga0501043_0078845_505_1116 | 191 |
| 326 | 3300049579 | Ga0501043_0329581 | Ga0501043_0329581_101_712 | 191 |
| 327 | 3300049581 | Ga0501047_0038432 | Ga0501047_0038432_2180_2794 | 191 |
| 328 | 3300049581 | Ga0501047_0225421 | Ga0501047_0225421_161_772 | 191 |
| 329 | 3300049581 | Ga0501047_0657982 | Ga0501047_0657982_46_660 | 191 |
| 330 | 3300049583 | Ga0501067_0001320 | Ga0501067_0001320_532_1143 | 191 |
| 331 | 3300049583 | Ga0501067_0009788 | Ga0501067_0009788_417_1028 | 191 |
| 332 | 3300049583 | Ga0501067_0247253 | Ga0501067_0247253_286_897 | 191 |
| 333 | 3300049584 | Ga0501068_0397772 | Ga0501068_0397772_210_821 | 191 |
| 334 | 3300049585 | Ga0501069_0044113 | Ga0501069_0044113_1832_2455 | 191 |
| 335 | 3300049585 | Ga0501069_0257669 | Ga0501069_0257669_200_811 | 191 |
| 336 | 3300049586 | Ga0501070_0245995 | Ga0501070_0245995_374_985 | 191 |
| 337 | 3300049588 | Ga0501072_0574267 | Ga0501072_0574267_34_645 | 191 |
| 338 | 3300049589 | Ga0501073_0028749 | Ga0501073_0028749_268_969 | 191 |
| 339 | 3300049589 | Ga0501073_0069005 | Ga0501073_0069005_1327_1938 | 191 |
| 340 | 3300049590 | Ga0501074_0088081 | Ga0501074_0088081_1530_2141 | 191 |
| 341 | 3300049742 | Ga0501080_0060900 | Ga0501080_0060900_1867_2478 | 191 |
| 342 | 3300049742 | Ga0501080_0118406 | Ga0501080_0118406_1402_2013 | 191 |
| 343 | 3300049744 | Ga0501083_0000235 | Ga0501083_0000235_28232_28843 | 191 |
| 344 | 3300049744 | Ga0501083_0122242 | Ga0501083_0122242_415_1026 | 191 |
| 345 | 3300049823 | Ga0501044_0124367 | Ga0501044_0124367_1557_2168 | 191 |
| 346 | 3300050489 | nmdc:mga03683_185333_c1 | nmdc:mga03683_185333_c1_240_851 | 191 |
| 347 | 3300050489 | nmdc:mga03683_2822_c1 | nmdc:mga03683_2822_c1_1151_1762 | 191 |
| 348 | 3300050491 | nmdc:mga00v17_299473_c1 | nmdc:mga00v17_299473_c1_132_743 | 191 |
| 349 | 3300050492 | nmdc:mga0yw44_363204_c1 | nmdc:mga0yw44_363204_c1_288_899 | 191 |
| 350 | 3300050516 | nmdc:mga0sz30_32382_c1 | nmdc:mga0sz30_32382_c1_167_778 | 191 |
| 351 | 3300053088 | Ga0500644_0034639 | Ga0500644_0034639_82_693 | 191 |
| 352 | 3300053092 | Ga0500583_0149864 | Ga0500583_0149864_73_684 | 191 |
| 353 | 3300053093 | Ga0500651_0186221 | Ga0500651_0186221_131_742 | 191 |
| 354 | 3300053153 | Ga0500616_0003337 | Ga0500616_0003337_6752_7378 | 191 |
| 355 | 3300053733 | Ga0500552_002516 | Ga0500552_002516_839_1450 | 191 |
| 356 | 3300054114 | Ga0501084_0043399 | Ga0501084_0043399_2705_3316 | 191 |
| 357 | 3300054114 | Ga0501084_0269146 | Ga0501084_0269146_687_1298 | 191 |
| 358 | 3300054114 | Ga0501084_0411714 | Ga0501084_0411714_149_760 | 191 |
| 359 | 3300060353 | Ga0501082_0146904 | Ga0501082_0146904_645_1256 | 191 |
| 360 | 3300060353 | Ga0501082_0239219 | Ga0501082_0239219_838_1449 | 191 |
| 361 | iso_pu_bacteria | 2643221564 | 2643840154 | 191 |
| 362 | iso_pu_bacteria | 2693429783 | 2694630287 | 191 |
| 363 | iso_pu_bacteria | 2856364286 | 2856366915 | 191 |
| 364 | iso_pu_bacteria | 2869285874 | 2869287673 | 191 |
| 365 | iso_pu_bacteria | 2871429161 | 2871435621 | 191 |
| 366 | iso_pu_bacteria | 2874146452 | 2874151304 | 191 |
| 367 | iso_pu_bacteria | 2874155637 | 2874158938 | 191 |
| 368 | iso_pu_bacteria | 2876413966 | 2876417357 | 191 |
| 369 | iso_pu_bacteria | 2878745973 | 2878749184 | 191 |
| 370 | iso_pu_bacteria | 2878753008 | 2878757490 | 191 |
| 371 | iso_pu_bacteria | 2881845957 | 2881848372 | 191 |
| 372 | iso_pu_bacteria | 2903492973 | 2903498648 | 191 |
| 373 | iso_pu_bacteria | 2906308376 | 2906310222 | 191 |
| 374 | iso_pu_bacteria | 2906321335 | 2906324287 | 191 |
| 375 | iso_pu_bacteria | 2937813078 | 2937817046 | 191 |
| 376 | iso_pu_bacteria | 2958041894 | 2958049366 | 191 |
| 377 | iso_pu_bacteria | 2958130278 | 2958132075 | 191 |
| 378 | iso_pu_bacteria | 2958179912 | 2958181889 | 191 |
| 379 | iso_pu_bacteria | 2961077736 | 2961079733 | 191 |
| 380 | iso_pu_bacteria | 2961170736 | 2961175182 | 191 |
| 381 | iso_pu_bacteria | 2977843712 | 2977847337 | 191 |
| 382 | iso_pu_bacteria | 8004387939 | 8004389458 | 191 |
| 383 | iso_pu_bacteria | 8004640170 | 8004643342 | 191 |
| 384 | iso_pu_bacteria | 8004714634 | 8004717856 | 191 |
| 385 | 3300005327 | Ga0070658_10073478 | Ga0070658_100734781 | 192 |
| 386 | 3300005339 | Ga0070660_100097417 | Ga0070660_1000974171 | 192 |
| 387 | 3300005435 | Ga0070714_100011222 | Ga0070714_1000112226 | 192 |
| 388 | 3300005435 | Ga0070714_100021373 | Ga0070714_1000213735 | 192 |
| 389 | 3300005435 | Ga0070714_100105952 | Ga0070714_1001059522 | 192 |
| 390 | 3300005436 | Ga0070713_100015441 | Ga0070713_1000154416 | 192 |
| 391 | 3300005439 | Ga0070711_100016334 | Ga0070711_1000163344 | 192 |
| 392 | 3300005539 | Ga0068853_100163930 | Ga0068853_1001639303 | 192 |
| 393 | 3300005563 | Ga0068855_100979296 | Ga0068855_1009792961 | 192 |
| 394 | 3300005614 | Ga0068856_100157583 | Ga0068856_1001575833 | 192 |
| 395 | 3300005983 | Ga0081540_1001159 | Ga0081540_10011594 | 192 |
| 396 | 3300006175 | Ga0070712_100102626 | Ga0070712_1001026263 | 192 |
| 397 | 3300009176 | Ga0105242_10359047 | Ga0105242_103590472 | 192 |
| 398 | 3300010375 | Ga0105239_10476700 | Ga0105239_104767002 | 192 |
| 399 | 3300013100 | Ga0157373_10518186 | Ga0157373_105181861 | 192 |
| 400 | 3300013296 | Ga0157374_10648459 | Ga0157374_106484592 | 192 |
| 401 | 3300014325 | Ga0163163_10059183 | Ga0163163_100591835 | 192 |
| 402 | 3300014326 | Ga0157380_10006688 | Ga0157380_100066885 | 192 |
| 403 | 3300014497 | Ga0182008_10156763 | Ga0182008_101567632 | 192 |
| 404 | 3300014497 | Ga0182008_10176785 | Ga0182008_101767852 | 192 |
| 405 | 3300014968 | Ga0157379_10521239 | Ga0157379_105212392 | 192 |
| 406 | 3300014969 | Ga0157376_10001430 | Ga0157376_1000143010 | 192 |
| 407 | 3300015261 | Ga0182006_1037866 | Ga0182006_10378662 | 192 |
| 408 | 3300015265 | Ga0182005_1011656 | Ga0182005_10116563 | 192 |
| 409 | 3300021361 | Ga0213872_10255936 | Ga0213872_102559361 | 192 |
| 410 | 3300021384 | Ga0213876_10004936 | Ga0213876_1000493610 | 192 |
| 411 | 3300021388 | Ga0213875_10002299 | Ga0213875_100022997 | 192 |
| 412 | 3300021388 | Ga0213875_10073021 | Ga0213875_100730213 | 192 |
| 413 | 3300021441 | Ga0213871_10093114 | Ga0213871_100931141 | 192 |
| 414 | 3300025294 | Ga0209025_1055391 | Ga0209025_10553912 | 192 |
| 415 | 3300025909 | Ga0207705_10111723 | Ga0207705_101117232 | 192 |
| 416 | 3300025915 | Ga0207693_10089615 | Ga0207693_100896152 | 192 |
| 417 | 3300025916 | Ga0207663_10011790 | Ga0207663_100117904 | 192 |
| 418 | 3300025921 | Ga0207652_10040007 | Ga0207652_100400074 | 192 |
| 419 | 3300025928 | Ga0207700_10034319 | Ga0207700_100343194 | 192 |
| 420 | 3300025929 | Ga0207664_10022275 | Ga0207664_100222753 | 192 |
| 421 | 3300025929 | Ga0207664_10048471 | Ga0207664_100484714 | 192 |
| 422 | 3300025934 | Ga0207686_10304441 | Ga0207686_103044412 | 192 |
| 423 | 3300025949 | Ga0207667_10287804 | Ga0207667_102878042 | 192 |
| 424 | 3300026078 | Ga0207702_10127366 | Ga0207702_101273663 | 192 |
| 425 | 3300028379 | Ga0268266_10034154 | Ga0268266_100341545 | 192 |
| 426 | 3300031235 | Ga0265330_10192679 | Ga0265330_101926791 | 192 |
| 427 | 3300031238 | Ga0265332_10236964 | Ga0265332_102369641 | 192 |
| 428 | 3300031239 | Ga0265328_10000183 | Ga0265328_1000018333 | 192 |
| 429 | 3300031241 | Ga0265325_10022512 | Ga0265325_100225124 | 192 |
| 430 | 3300031241 | Ga0265325_10065023 | Ga0265325_100650232 | 192 |
| 431 | 3300031247 | Ga0265340_10000575 | Ga0265340_1000057517 | 192 |
| 432 | 3300031247 | Ga0265340_10021893 | Ga0265340_100218934 | 192 |
| 433 | 3300031247 | Ga0265340_10064561 | Ga0265340_100645611 | 192 |
| 434 | 3300031249 | Ga0265339_10000788 | Ga0265339_1000078814 | 192 |
| 435 | 3300031250 | Ga0265331_10003205 | Ga0265331_100032051 | 192 |
| 436 | 3300031250 | Ga0265331_10055239 | Ga0265331_100552393 | 192 |
| 437 | 3300031251 | Ga0265327_10012708 | Ga0265327_100127082 | 192 |
| 438 | 3300031251 | Ga0265327_10071509 | Ga0265327_100715092 | 192 |
| 439 | 3300031344 | Ga0265316_10004940 | Ga0265316_1000494010 | 192 |
| 440 | 3300031344 | Ga0265316_10307218 | Ga0265316_103072182 | 192 |
| 441 | 3300031595 | Ga0265313_10001970 | Ga0265313_1000197013 | 192 |
| 442 | 3300031595 | Ga0265313_10115674 | Ga0265313_101156741 | 192 |
| 443 | 3300031665 | Ga0316575_10027535 | Ga0316575_100275353 | 192 |
| 444 | 3300031691 | Ga0316579_10163637 | Ga0316579_101636372 | 192 |
| 445 | 3300031711 | Ga0265314_10044136 | Ga0265314_100441363 | 192 |
| 446 | 3300031712 | Ga0265342_10040548 | Ga0265342_100405481 | 192 |
| 447 | 3300031730 | Ga0307516_10000030 | Ga0307516_1000003023 | 192 |
| 448 | 3300031901 | Ga0307406_10277063 | Ga0307406_102770632 | 192 |
| 449 | 3300032133 | Ga0316583_10122777 | Ga0316583_101227771 | 192 |
| 450 | 3300033180 | Ga0307510_10141629 | Ga0307510_101416291 | 192 |
| 451 | 3300035111 | Ga0373923_0077558 | Ga0373923_0077558_377_1030 | 192 |
| 452 | 3300035111 | Ga0373923_0105915 | Ga0373923_0105915_486_1139 | 192 |
| 453 | 3300035115 | Ga0373941_0198298 | Ga0373941_0198298_12_626 | 192 |
| 454 | 3300035117 | Ga0373953_0051258 | Ga0373953_0051258_203_856 | 192 |
| 455 | 3300035170 | Ga0373943_0130253 | Ga0373943_0130253_77_730 | 192 |
| 456 | 3300035695 | Ga0373927_0040176 | Ga0373927_0040176_318_971 | 192 |
| 457 | 3300035724 | Ga0373933_0006885 | Ga0373933_0006885_3540_4193 | 192 |
| 458 | 3300035724 | Ga0373933_0029810 | Ga0373933_0029810_237_890 | 192 |
| 459 | 3300036401 | Ga0373937_0004353 | Ga0373937_0004353_5506_6159 | 192 |
| 460 | 3300036401 | Ga0373937_0019732 | Ga0373937_0019732_3138_3791 | 192 |
| 461 | 3300036401 | Ga0373937_0030563 | Ga0373937_0030563_546_1199 | 192 |
| 462 | 3300036401 | Ga0373937_0095788 | Ga0373937_0095788_523_1176 | 192 |
| 463 | 3300036647 | Ga0316582_0387278 | Ga0316582_0387278_244_906 | 192 |
| 464 | 3300036712 | Ga0316584_0005127 | Ga0316584_0005127_6872_7534 | 192 |
| 465 | 3300037068 | Ga0373925_0054797 | Ga0373925_0054797_1791_2444 | 192 |
| 466 | 3300037068 | Ga0373925_0102420 | Ga0373925_0102420_196_849 | 192 |
| 467 | 3300037068 | Ga0373925_0688931 | Ga0373925_0688931_153_806 | 192 |
| 468 | 3300037418 | Ga0395900_0097510 | Ga0395900_0097510_817_1431 | 192 |
| 469 | 3300037466 | Ga0395898_0094496 | Ga0395898_0094496_2211_2825 | 192 |
| 470 | 3300037853 | Ga0436364_0420938 | Ga0436364_0420938_344_997 | 192 |
| 471 | 3300037853 | Ga0436364_0546627 | Ga0436364_0546627_63_722 | 192 |
| 472 | 3300037853 | Ga0436364_0834964 | Ga0436364_0834964_7686_8342 | 192 |
| 473 | 3300038443 | Ga0395901_0145772 | Ga0395901_0145772_490_1104 | 192 |
| 474 | 3300039437 | Ga0436365_1624935 | Ga0436365_1624935_1277_1933 | 192 |
| 475 | 3300039437 | Ga0436365_1691170 | Ga0436365_1691170_12474_13088 | 192 |
| 476 | 3300039438 | Ga0436360_0397922 | Ga0436360_0397922_1630_2283 | 192 |
| 477 | 3300039438 | Ga0436360_0930277 | Ga0436360_0930277_467_1123 | 192 |
| 478 | 3300039447 | Ga0436361_0219390 | Ga0436361_0219390_4463_5116 | 192 |
| 479 | 3300039447 | Ga0436361_0917993 | Ga0436361_0917993_2689_3309 | 192 |
| 480 | 3300039450 | Ga0436363_0789771 | Ga0436363_0789771_141_797 | 192 |
| 481 | 3300039453 | Ga0436362_0312797 | Ga0436362_0312797_2933_3589 | 192 |
| 482 | 3300045051 | Ga0451576_0100030 | Ga0451576_0100030_1431_2045 | 192 |
| 483 | 3300045976 | Ga0466967_0227611 | Ga0466967_0227611_187_804 | 192 |
| 484 | 3300046462 | Ga0495651_0459720 | Ga0495651_0459720_86_739 | 192 |
| 485 | 3300046477 | Ga0495664_0002764 | Ga0495664_0002764_3370_4023 | 192 |
| 486 | 3300046491 | Ga0495584_0140576 | Ga0495584_0140576_484_1101 | 192 |
| 487 | 3300046511 | Ga0495608_0016666 | Ga0495608_0016666_4025_4678 | 192 |
| 488 | 3300046516 | Ga0495628_0155315 | Ga0495628_0155315_261_914 | 192 |
| 489 | 3300046529 | Ga0495652_0248572 | Ga0495652_0248572_469_1122 | 192 |
| 490 | 3300046536 | Ga0495587_0014361 | Ga0495587_0014361_1353_2006 | 192 |
| 491 | 3300046559 | Ga0495667_0142314 | Ga0495667_0142314_104_757 | 192 |
| 492 | 3300046675 | Ga0495657_0045248 | Ga0495657_0045248_126_779 | 192 |
| 493 | 3300046675 | Ga0495657_0145600 | Ga0495657_0145600_182_835 | 192 |
| 494 | 3300046679 | Ga0495623_0122240 | Ga0495623_0122240_701_1354 | 192 |
| 495 | 3300046689 | Ga0495613_0549764 | Ga0495613_0549764_34_687 | 192 |
| 496 | 3300047319 | Ga0495674_0020122 | Ga0495674_0020122_1805_2458 | 192 |
| 497 | 3300047320 | Ga0495672_0191604 | Ga0495672_0191604_282_896 | 192 |
| 498 | 3300047322 | Ga0495680_0086848 | Ga0495680_0086848_1001_1654 | 192 |
| 499 | 3300047322 | Ga0495680_0162769 | Ga0495680_0162769_757_1410 | 192 |
| 500 | 3300047444 | Ga0495675_0054343 | Ga0495675_0054343_567_1220 | 192 |
| 501 | 3300047471 | Ga0495684_0533181 | Ga0495684_0533181_117_770 | 192 |
| 502 | 3300048088 | Ga0495602_0004731 | Ga0495602_0004731_3077_3730 | 192 |
| 503 | 3300048903 | Ga0496100_0059937 | Ga0496100_0059937_620_1234 | 192 |
| 504 | 3300048907 | Ga0496104_0068515 | Ga0496104_0068515_136_753 | 192 |
| 505 | 3300048913 | Ga0496110_0457545 | Ga0496110_0457545_528_1142 | 192 |
| 506 | 3300048915 | Ga0496112_0177133 | Ga0496112_0177133_1415_2068 | 192 |
| 507 | 3300048929 | Ga0496126_0179274 | Ga0496126_0179274_292_906 | 192 |
| 508 | 3300048929 | Ga0496126_0512780 | Ga0496126_0512780_233_847 | 192 |
| 509 | 3300049569 | Ga0501032_0023883 | Ga0501032_0023883_1042_1659 | 192 |
| 510 | 3300049570 | Ga0501033_0408083 | Ga0501033_0408083_242_856 | 192 |
| 511 | 3300049571 | Ga0501034_0002736 | Ga0501034_0002736_10629_11246 | 192 |
| 512 | 3300049571 | Ga0501034_0186986 | Ga0501034_0186986_989_1705 | 192 |
| 513 | 3300049571 | Ga0501034_0562489 | Ga0501034_0562489_199_816 | 192 |
| 514 | 3300049573 | Ga0501037_0020807 | Ga0501037_0020807_3741_4397 | 192 |
| 515 | 3300049573 | Ga0501037_0065473 | Ga0501037_0065473_413_1027 | 192 |
| 516 | 3300049574 | Ga0501038_0039916 | Ga0501038_0039916_701_1315 | 192 |
| 517 | 3300049579 | Ga0501043_0189208 | Ga0501043_0189208_216_932 | 192 |
| 518 | 3300049580 | Ga0501046_0352819 | Ga0501046_0352819_268_921 | 192 |
| 519 | 3300049580 | Ga0501046_0575739 | Ga0501046_0575739_39_653 | 192 |
| 520 | 3300049581 | Ga0501047_0031988 | Ga0501047_0031988_33_647 | 192 |
| 521 | 3300049581 | Ga0501047_0036547 | Ga0501047_0036547_2255_2971 | 192 |
| 522 | 3300049581 | Ga0501047_0173380 | Ga0501047_0173380_456_1112 | 192 |
| 523 | 3300049581 | Ga0501047_0417668 | Ga0501047_0417668_385_1038 | 192 |
| 524 | 3300049582 | Ga0501048_0378083 | Ga0501048_0378083_140_754 | 192 |
| 525 | 3300049583 | Ga0501067_0181600 | Ga0501067_0181600_404_1018 | 192 |
| 526 | 3300049583 | Ga0501067_0186971 | Ga0501067_0186971_520_1134 | 192 |
| 527 | 3300049586 | Ga0501070_0593943 | Ga0501070_0593943_243_857 | 192 |
| 528 | 3300049589 | Ga0501073_0128882 | Ga0501073_0128882_1117_1731 | 192 |
| 529 | 3300049822 | Ga0501035_0104265 | Ga0501035_0104265_350_1006 | 192 |
| 530 | 3300049823 | Ga0501044_0011168 | Ga0501044_0011168_331_945 | 192 |
| 531 | 3300053077 | Ga0495601_0041469 | Ga0495601_0041469_1013_1666 | 192 |
| 532 | 3300053077 | Ga0495601_0549975 | Ga0495601_0549975_66_719 | 192 |
| 533 | 3300053078 | Ga0495612_0000290 | Ga0495612_0000290_18645_19298 | 192 |
| 534 | 3300053084 | Ga0495595_0029895 | Ga0495595_0029895_1127_1780 | 192 |
| 535 | 3300053084 | Ga0495595_0165647 | Ga0495595_0165647_83_736 | 192 |
| 536 | 3300053085 | Ga0495619_0031108 | Ga0495619_0031108_2764_3417 | 192 |
| 537 | 3300053085 | Ga0495619_0045966 | Ga0495619_0045966_1949_2602 | 192 |
| 538 | 3300053098 | Ga0500650_0148469 | Ga0500650_0148469_332_946 | 192 |
| 539 | 3300053117 | Ga0500593_000183 | Ga0500593_000183_23257_23871 | 192 |
| 540 | 3300053139 | Ga0500568_0000002 | Ga0500568_0000002_815957_816571 | 192 |
| 541 | 3300053177 | Ga0500636_0125725 | Ga0500636_0125725_230_844 | 192 |
| 542 | 3300060353 | Ga0501082_0002950 | Ga0501082_0002950_12661_13275 | 192 |
| 543 | iso_pu_bacteria | 2643221550 | 2643769969 | 192 |
| 544 | 3300005336 | Ga0070680_100077710 | Ga0070680_1000777102 | 193 |
| 545 | 3300005339 | Ga0070660_100126282 | Ga0070660_1001262822 | 193 |
| 546 | 3300005458 | Ga0070681_10033498 | Ga0070681_100334983 | 193 |
| 547 | 3300005530 | Ga0070679_100067069 | Ga0070679_1000670692 | 193 |
| 548 | 3300005539 | Ga0068853_100559500 | Ga0068853_1005595002 | 193 |
| 549 | 3300005548 | Ga0070665_100016431 | Ga0070665_1000164315 | 193 |
| 550 | 3300005985 | Ga0081539_10001022 | Ga0081539_1000102210 | 193 |
| 551 | 3300006028 | Ga0070717_10346160 | Ga0070717_103461602 | 193 |
| 552 | 3300009093 | Ga0105240_10551499 | Ga0105240_105514992 | 193 |
| 553 | 3300009093 | Ga0105240_10674437 | Ga0105240_106744372 | 193 |
| 554 | 3300009551 | Ga0105238_10126589 | Ga0105238_101265895 | 193 |
| 555 | 3300010375 | Ga0105239_10099033 | Ga0105239_100990336 | 193 |
| 556 | 3300013100 | Ga0157373_10589507 | Ga0157373_105895071 | 193 |
| 557 | 3300014497 | Ga0182008_10069715 | Ga0182008_100697153 | 193 |
| 558 | 3300025904 | Ga0207647_10042332 | Ga0207647_100423322 | 193 |
| 559 | 3300025912 | Ga0207707_10023528 | Ga0207707_100235282 | 193 |
| 560 | 3300025919 | Ga0207657_10081611 | Ga0207657_100816113 | 193 |
| 561 | 3300025924 | Ga0207694_10184419 | Ga0207694_101844192 | 193 |
| 562 | 3300026041 | Ga0207639_10503046 | Ga0207639_105030461 | 193 |
| 563 | 3300026067 | Ga0207678_10014969 | Ga0207678_100149693 | 193 |
| 564 | 3300028379 | Ga0268266_10182704 | Ga0268266_101827041 | 193 |
| 565 | 3300035398 | Ga0316574_0318993 | Ga0316574_0318993_300_917 | 193 |
| 566 | 3300037418 | Ga0395900_0128830 | Ga0395900_0128830_1726_2346 | 193 |
| 567 | 3300037466 | Ga0395898_0023354 | Ga0395898_0023354_1706_2326 | 193 |
| 568 | 3300037853 | Ga0436364_0313282 | Ga0436364_0313282_85_702 | 193 |
| 569 | 3300038443 | Ga0395901_0105520 | Ga0395901_0105520_930_1550 | 193 |
| 570 | 3300038443 | Ga0395901_0143173 | Ga0395901_0143173_159_782 | 193 |
| 571 | 3300038443 | Ga0395901_0452472 | Ga0395901_0452472_95_712 | 193 |
| 572 | 3300039437 | Ga0436365_0097041 | Ga0436365_0097041_51_680 | 193 |
| 573 | 3300047472 | Ga0495686_0029749 | Ga0495686_0029749_2072_2689 | 193 |
| 574 | 3300048904 | Ga0496101_0368355 | Ga0496101_0368355_353_1006 | 193 |
| 575 | 3300048907 | Ga0496104_0006145 | Ga0496104_0006145_7053_7706 | 193 |
| 576 | 3300048909 | Ga0496106_0516315 | Ga0496106_0516315_226_879 | 193 |
| 577 | 3300048913 | Ga0496110_0340712 | Ga0496110_0340712_102_755 | 193 |
| 578 | 3300048915 | Ga0496112_0005948 | Ga0496112_0005948_1331_1951 | 193 |
| 579 | 3300048918 | Ga0496115_0026066 | Ga0496115_0026066_147_800 | 193 |
| 580 | 3300049568 | Ga0501031_0002511 | Ga0501031_0002511_314_931 | 193 |
| 581 | 3300049568 | Ga0501031_0176874 | Ga0501031_0176874_456_1073 | 193 |
| 582 | 3300049569 | Ga0501032_0000001 | Ga0501032_0000001_362374_362991 | 193 |
| 583 | 3300049569 | Ga0501032_0023599 | Ga0501032_0023599_1500_2117 | 193 |
| 584 | 3300049569 | Ga0501032_0158289 | Ga0501032_0158289_807_1424 | 193 |
| 585 | 3300049570 | Ga0501033_0000092 | Ga0501033_0000092_21770_22387 | 193 |
| 586 | 3300049570 | Ga0501033_0004609 | Ga0501033_0004609_4842_5459 | 193 |
| 587 | 3300049570 | Ga0501033_0031426 | Ga0501033_0031426_2095_2712 | 193 |
| 588 | 3300049571 | Ga0501034_0000036 | Ga0501034_0000036_58118_58735 | 193 |
| 589 | 3300049571 | Ga0501034_0071950 | Ga0501034_0071950_1716_2333 | 193 |
| 590 | 3300049571 | Ga0501034_0082916 | Ga0501034_0082916_1461_2078 | 193 |
| 591 | 3300049571 | Ga0501034_0083962 | Ga0501034_0083962_2499_3116 | 193 |
| 592 | 3300049571 | Ga0501034_0561630 | Ga0501034_0561630_38_655 | 193 |
| 593 | 3300049572 | Ga0501036_0000078 | Ga0501036_0000078_1802_2419 | 193 |
| 594 | 3300049572 | Ga0501036_0076427 | Ga0501036_0076427_1062_1679 | 193 |
| 595 | 3300049573 | Ga0501037_0000017 | Ga0501037_0000017_106565_107182 | 193 |
| 596 | 3300049573 | Ga0501037_0000047 | Ga0501037_0000047_77696_78313 | 193 |
| 597 | 3300049573 | Ga0501037_0463426 | Ga0501037_0463426_104_721 | 193 |
| 598 | 3300049574 | Ga0501038_0000036 | Ga0501038_0000036_81282_81899 | 193 |
| 599 | 3300049574 | Ga0501038_0094343 | Ga0501038_0094343_1154_1771 | 193 |
| 600 | 3300049575 | Ga0501039_0000011 | Ga0501039_0000011_60567_61184 | 193 |
| 601 | 3300049578 | Ga0501042_0147981 | Ga0501042_0147981_51_668 | 193 |
| 602 | 3300049579 | Ga0501043_0000105 | Ga0501043_0000105_18323_18940 | 193 |
| 603 | 3300049579 | Ga0501043_0000369 | Ga0501043_0000369_12750_13367 | 193 |
| 604 | 3300049579 | Ga0501043_0047536 | Ga0501043_0047536_1812_2429 | 193 |
| 605 | 3300049579 | Ga0501043_0101175 | Ga0501043_0101175_1163_1780 | 193 |
| 606 | 3300049579 | Ga0501043_0177072 | Ga0501043_0177072_444_1061 | 193 |
| 607 | 3300049580 | Ga0501046_0062978 | Ga0501046_0062978_1065_1682 | 193 |
| 608 | 3300049580 | Ga0501046_0100118 | Ga0501046_0100118_139_756 | 193 |
| 609 | 3300049581 | Ga0501047_0010824 | Ga0501047_0010824_7486_8103 | 193 |
| 610 | 3300049581 | Ga0501047_0015525 | Ga0501047_0015525_2078_2695 | 193 |
| 611 | 3300049581 | Ga0501047_0072155 | Ga0501047_0072155_2479_3096 | 193 |
| 612 | 3300049581 | Ga0501047_0078101 | Ga0501047_0078101_406_1023 | 193 |
| 613 | 3300049581 | Ga0501047_0082152 | Ga0501047_0082152_1980_2597 | 193 |
| 614 | 3300049583 | Ga0501067_0166742 | Ga0501067_0166742_557_1174 | 193 |
| 615 | 3300049584 | Ga0501068_0254661 | Ga0501068_0254661_142_759 | 193 |
| 616 | 3300049585 | Ga0501069_0000073 | Ga0501069_0000073_5659_6276 | 193 |
| 617 | 3300049585 | Ga0501069_0001305 | Ga0501069_0001305_3944_4561 | 193 |
| 618 | 3300049586 | Ga0501070_0000385 | Ga0501070_0000385_33971_34588 | 193 |
| 619 | 3300049586 | Ga0501070_0008366 | Ga0501070_0008366_4818_5435 | 193 |
| 620 | 3300049586 | Ga0501070_0009729 | Ga0501070_0009729_6964_7581 | 193 |
| 621 | 3300049586 | Ga0501070_0094321 | Ga0501070_0094321_390_1007 | 193 |
| 622 | 3300049587 | Ga0501071_0131128 | Ga0501071_0131128_1102_1719 | 193 |
| 623 | 3300049587 | Ga0501071_0159548 | Ga0501071_0159548_204_821 | 193 |
| 624 | 3300049589 | Ga0501073_0236581 | Ga0501073_0236581_78_695 | 193 |
| 625 | 3300049590 | Ga0501074_0000390 | Ga0501074_0000390_20019_20636 | 193 |
| 626 | 3300049590 | Ga0501074_0015949 | Ga0501074_0015949_4377_4994 | 193 |
| 627 | 3300049590 | Ga0501074_0016234 | Ga0501074_0016234_2164_2781 | 193 |
| 628 | 3300049741 | Ga0501079_0794851 | Ga0501079_0794851_50_667 | 193 |
| 629 | 3300049742 | Ga0501080_0011370 | Ga0501080_0011370_1742_2359 | 193 |
| 630 | 3300049742 | Ga0501080_0021998 | Ga0501080_0021998_573_1190 | 193 |
| 631 | 3300049742 | Ga0501080_0062492 | Ga0501080_0062492_613_1230 | 193 |
| 632 | 3300049742 | Ga0501080_0423021 | Ga0501080_0423021_128_745 | 193 |
| 633 | 3300049744 | Ga0501083_0005780 | Ga0501083_0005780_5517_6134 | 193 |
| 634 | 3300049822 | Ga0501035_0000025 | Ga0501035_0000025_36466_37083 | 193 |
| 635 | 3300049822 | Ga0501035_0000028 | Ga0501035_0000028_58244_58861 | 193 |
| 636 | 3300049822 | Ga0501035_0001951 | Ga0501035_0001951_18951_19568 | 193 |
| 637 | 3300049822 | Ga0501035_0006605 | Ga0501035_0006605_7026_7643 | 193 |
| 638 | 3300049822 | Ga0501035_0019298 | Ga0501035_0019298_2038_2655 | 193 |
| 639 | 3300049822 | Ga0501035_0044425 | Ga0501035_0044425_2796_3413 | 193 |
| 640 | 3300049822 | Ga0501035_0138377 | Ga0501035_0138377_1046_1663 | 193 |
| 641 | 3300049823 | Ga0501044_0000031 | Ga0501044_0000031_167107_167724 | 193 |
| 642 | 3300049823 | Ga0501044_0004322 | Ga0501044_0004322_12856_13473 | 193 |
| 643 | 3300049823 | Ga0501044_0007776 | Ga0501044_0007776_1111_1728 | 193 |
| 644 | 3300049823 | Ga0501044_0065538 | Ga0501044_0065538_2146_2763 | 193 |
| 645 | 3300049823 | Ga0501044_0082098 | Ga0501044_0082098_221_838 | 193 |
| 646 | 3300049823 | Ga0501044_0140858 | Ga0501044_0140858_1623_2240 | 193 |
| 647 | 3300049823 | Ga0501044_0340371 | Ga0501044_0340371_10_627 | 193 |
| 648 | 3300049824 | Ga0501045_0238195 | Ga0501045_0238195_157_774 | 193 |
| 649 | 3300053130 | Ga0500642_0229131 | Ga0500642_0229131_190_822 | 193 |
| 650 | 3300053158 | Ga0500627_0106025 | Ga0500627_0106025_148_765 | 193 |
| 651 | 3300053158 | Ga0500627_0121450 | Ga0500627_0121450_31_648 | 193 |
| 652 | 3300053158 | Ga0500627_0244259 | Ga0500627_0244259_100_717 | 193 |
| 653 | 3300053727 | Ga0500611_112636 | Ga0500611_112636_17_634 | 193 |
| 654 | 3300054114 | Ga0501084_0610506 | Ga0501084_0610506_294_911 | 193 |
| 655 | 3300060353 | Ga0501082_0150111 | Ga0501082_0150111_731_1348 | 193 |
| 656 | 3300001979 | JGI24740J21852_10014860 | JGI24740J21852_100148604 | 194 |
| 657 | 3300001989 | JGI24739J22299_10053437 | JGI24739J22299_100534372 | 194 |
| 658 | 3300002067 | JGI24735J21928_10054364 | JGI24735J21928_100543642 | 194 |
| 659 | 3300002705 | JGI25156J39149_1002078 | JGI25156J39149_10020784 | 194 |
| 660 | 3300002741 | JGI25157J39369_1002436 | JGI25157J39369_10024365 | 194 |
| 661 | 3300003214 | JGI25165J46597_1000034 | JGI25165J46597_1000034140 | 194 |
| 662 | 3300003762 | Ga0055542_1000299 | Ga0055542_100029911 | 194 |
| 663 | 3300003762 | Ga0055542_1001140 | Ga0055542_10011403 | 194 |
| 664 | 3300003763 | Ga0055529_1002112 | Ga0055529_10021125 | 194 |
| 665 | 3300005327 | Ga0070658_10102585 | Ga0070658_101025852 | 194 |
| 666 | 3300005356 | Ga0070674_100172869 | Ga0070674_1001728691 | 194 |
| 667 | 3300005539 | Ga0068853_100014665 | Ga0068853_1000146653 | 194 |
| 668 | 3300005539 | Ga0068853_100211323 | Ga0068853_1002113231 | 194 |
| 669 | 3300005539 | Ga0068853_100605580 | Ga0068853_1006055802 | 194 |
| 670 | 3300005548 | Ga0070665_100221828 | Ga0070665_1002218283 | 194 |
| 671 | 3300005578 | Ga0068854_100154905 | Ga0068854_1001549053 | 194 |
| 672 | 3300005614 | Ga0068856_100524487 | Ga0068856_1005244872 | 194 |
| 673 | 3300005616 | Ga0068852_100264523 | Ga0068852_1002645232 | 194 |
| 674 | 3300005937 | Ga0081455_10274102 | Ga0081455_102741021 | 194 |
| 675 | 3300006038 | Ga0075365_10011143 | Ga0075365_100111436 | 194 |
| 676 | 3300006038 | Ga0075365_10040336 | Ga0075365_100403361 | 194 |
| 677 | 3300006038 | Ga0075365_10521708 | Ga0075365_105217081 | 194 |
| 678 | 3300006048 | Ga0075363_100130882 | Ga0075363_1001308822 | 194 |
| 679 | 3300006051 | Ga0075364_10022475 | Ga0075364_100224752 | 194 |
| 680 | 3300006051 | Ga0075364_10307707 | Ga0075364_103077072 | 194 |
| 681 | 3300006178 | Ga0075367_10223102 | Ga0075367_102231022 | 194 |
| 682 | 3300006178 | Ga0075367_10226190 | Ga0075367_102261902 | 194 |
| 683 | 3300006353 | Ga0075370_10377584 | Ga0075370_103775841 | 194 |
| 684 | 3300006881 | Ga0068865_100679356 | Ga0068865_1006793562 | 194 |
| 685 | 3300009093 | Ga0105240_10035830 | Ga0105240_100358306 | 194 |
| 686 | 3300009545 | Ga0105237_10460789 | Ga0105237_104607892 | 194 |
| 687 | 3300009545 | Ga0105237_10728967 | Ga0105237_107289671 | 194 |
| 688 | 3300009551 | Ga0105238_10026262 | Ga0105238_100262622 | 194 |
| 689 | 3300009551 | Ga0105238_10147811 | Ga0105238_101478111 | 194 |
| 690 | 3300010375 | Ga0105239_10377452 | Ga0105239_103774522 | 194 |
| 691 | 3300011119 | Ga0105246_10530456 | Ga0105246_105304562 | 194 |
| 692 | 3300013104 | Ga0157370_10513709 | Ga0157370_105137092 | 194 |
| 693 | 3300013296 | Ga0157374_10200108 | Ga0157374_102001082 | 194 |
| 694 | 3300017792 | Ga0163161_10324901 | Ga0163161_103249012 | 194 |
| 695 | 3300025250 | Ga0209026_1000100 | Ga0209026_100010078 | 194 |
| 696 | 3300025254 | Ga0209148_1000069 | Ga0209148_100006994 | 194 |
| 697 | 3300025254 | Ga0209148_1007365 | Ga0209148_10073655 | 194 |
| 698 | 3300025256 | Ga0209759_1000438 | Ga0209759_100043814 | 194 |
| 699 | 3300025261 | Ga0209233_1000028 | Ga0209233_1000028144 | 194 |
| 700 | 3300025272 | Ga0209455_1000135 | Ga0209455_100013593 | 194 |
| 701 | 3300025297 | Ga0209758_1006381 | Ga0209758_10063813 | 194 |
| 702 | 3300025904 | Ga0207647_10012504 | Ga0207647_100125043 | 194 |
| 703 | 3300025907 | Ga0207645_10108736 | Ga0207645_101087365 | 194 |
| 704 | 3300025909 | Ga0207705_10032668 | Ga0207705_100326681 | 194 |
| 705 | 3300025914 | Ga0207671_10352224 | Ga0207671_103522242 | 194 |
| 706 | 3300025914 | Ga0207671_10492362 | Ga0207671_104923621 | 194 |
| 707 | 3300025914 | Ga0207671_10527829 | Ga0207671_105278292 | 194 |
| 708 | 3300025920 | Ga0207649_10827700 | Ga0207649_108277001 | 194 |
| 709 | 3300025937 | Ga0207669_10132765 | Ga0207669_101327652 | 194 |
| 710 | 3300025937 | Ga0207669_10606377 | Ga0207669_106063772 | 194 |
| 711 | 3300025981 | Ga0207640_10143941 | Ga0207640_101439412 | 194 |
| 712 | 3300025981 | Ga0207640_10323186 | Ga0207640_103231862 | 194 |
| 713 | 3300026041 | Ga0207639_10104195 | Ga0207639_101041952 | 194 |
| 714 | 3300026041 | Ga0207639_10413278 | Ga0207639_104132782 | 194 |
| 715 | 3300026116 | Ga0207674_10129991 | Ga0207674_101299912 | 194 |
| 716 | 3300026142 | Ga0207698_10359611 | Ga0207698_103596112 | 194 |
| 717 | 3300028379 | Ga0268266_10075245 | Ga0268266_100752455 | 194 |
| 718 | 3300028379 | Ga0268266_10175352 | Ga0268266_101753522 | 194 |
| 719 | 3300028379 | Ga0268266_10702934 | Ga0268266_107029342 | 194 |
| 720 | 3300032004 | Ga0307414_10424870 | Ga0307414_104248702 | 194 |
| 721 | 3300032005 | Ga0307411_10559823 | Ga0307411_105598231 | 194 |
| 722 | 3300037418 | Ga0395900_0089863 | Ga0395900_0089863_272_931 | 194 |
| 723 | 3300037418 | Ga0395900_0153414 | Ga0395900_0153414_26_649 | 194 |
| 724 | 3300037466 | Ga0395898_0705918 | Ga0395898_0705918_67_690 | 194 |
| 725 | 3300037471 | Ga0395905_0121593 | Ga0395905_0121593_33_692 | 194 |
| 726 | 3300037471 | Ga0395905_1142804 | Ga0395905_1142804_12_632 | 194 |
| 727 | 3300038443 | Ga0395901_0065947 | Ga0395901_0065947_2082_2702 | 194 |
| 728 | 3300038443 | Ga0395901_0239139 | Ga0395901_0239139_760_1419 | 194 |
| 729 | 3300042157 | Ga0439458_0058653 | Ga0439458_0058653_323_946 | 194 |
| 730 | 3300044658 | Ga0466972_0136707 | Ga0466972_0136707_134_754 | 194 |
| 731 | 3300045976 | Ga0466967_0586450 | Ga0466967_0586450_314_934 | 194 |
| 732 | 3300046522 | Ga0495643_0088111 | Ga0495643_0088111_205_861 | 194 |
| 733 | 3300046616 | Ga0495668_0022331 | Ga0495668_0022331_1794_2414 | 194 |
| 734 | 3300048905 | Ga0496102_0567832 | Ga0496102_0567832_271_930 | 194 |
| 735 | 3300048908 | Ga0496105_0542075 | Ga0496105_0542075_207_827 | 194 |
| 736 | 3300048915 | Ga0496112_0185465 | Ga0496112_0185465_1028_1687 | 194 |
| 737 | 3300048922 | Ga0496119_0047186 | Ga0496119_0047186_1729_2349 | 194 |
| 738 | 3300048922 | Ga0496119_0134926 | Ga0496119_0134926_559_1179 | 194 |
| 739 | 3300048922 | Ga0496119_0252331 | Ga0496119_0252331_155_775 | 194 |
| 740 | 3300048923 | Ga0496120_0005180 | Ga0496120_0005180_4379_4999 | 194 |
| 741 | 3300048927 | Ga0496124_0090338 | Ga0496124_0090338_725_1345 | 194 |
| 742 | 3300048927 | Ga0496124_0463140 | Ga0496124_0463140_219_839 | 194 |
| 743 | 3300049569 | Ga0501032_0012538 | Ga0501032_0012538_1727_2350 | 194 |
| 744 | 3300049570 | Ga0501033_0004805 | Ga0501033_0004805_3587_4210 | 194 |
| 745 | 3300049571 | Ga0501034_0026322 | Ga0501034_0026322_4379_5002 | 194 |
| 746 | 3300049572 | Ga0501036_0020232 | Ga0501036_0020232_4064_4687 | 194 |
| 747 | 3300049573 | Ga0501037_0015409 | Ga0501037_0015409_4210_4833 | 194 |
| 748 | 3300049575 | Ga0501039_0015572 | Ga0501039_0015572_4063_4686 | 194 |
| 749 | 3300049576 | Ga0501040_0011447 | Ga0501040_0011447_3643_4266 | 194 |
| 750 | 3300049577 | Ga0501041_0476458 | Ga0501041_0476458_143_766 | 194 |
| 751 | 3300049579 | Ga0501043_0012998 | Ga0501043_0012998_4158_4781 | 194 |
| 752 | 3300049581 | Ga0501047_0030528 | Ga0501047_0030528_3703_4326 | 194 |
| 753 | 3300049582 | Ga0501048_0005606 | Ga0501048_0005606_3323_3946 | 194 |
| 754 | 3300049583 | Ga0501067_0051777 | Ga0501067_0051777_1473_2096 | 194 |
| 755 | 3300049584 | Ga0501068_0003141 | Ga0501068_0003141_3857_4480 | 194 |
| 756 | 3300049586 | Ga0501070_0024862 | Ga0501070_0024862_3938_4561 | 194 |
| 757 | 3300049586 | Ga0501070_0111893 | Ga0501070_0111893_1086_1706 | 194 |
| 758 | 3300049587 | Ga0501071_0012434 | Ga0501071_0012434_3643_4266 | 194 |
| 759 | 3300049588 | Ga0501072_0429229 | Ga0501072_0429229_222_845 | 194 |
| 760 | 3300049589 | Ga0501073_0016266 | Ga0501073_0016266_1159_1782 | 194 |
| 761 | 3300049590 | Ga0501074_0009564 | Ga0501074_0009564_4056_4679 | 194 |
| 762 | 3300049592 | Ga0501076_0967807 | Ga0501076_0967807_17_640 | 194 |
| 763 | 3300049741 | Ga0501079_0511893 | Ga0501079_0511893_23_646 | 194 |
| 764 | 3300049742 | Ga0501080_0003536 | Ga0501080_0003536_3861_4484 | 194 |
| 765 | 3300049744 | Ga0501083_0032218 | Ga0501083_0032218_1459_2082 | 194 |
| 766 | 3300049822 | Ga0501035_0004666 | Ga0501035_0004666_3703_4326 | 194 |
| 767 | 3300049823 | Ga0501044_0043873 | Ga0501044_0043873_318_941 | 194 |
| 768 | 3300049824 | Ga0501045_0015919 | Ga0501045_0015919_4240_4863 | 194 |
| 769 | 3300050490 | nmdc:mga03n38_379259_c1 | nmdc:mga03n38_379259_c1_128_748 | 194 |
| 770 | 3300050491 | nmdc:mga00v17_80386_c1 | nmdc:mga00v17_80386_c1_1129_1749 | 194 |
| 771 | 3300050492 | nmdc:mga0yw44_277910_c1 | nmdc:mga0yw44_277910_c1_170_793 | 194 |
| 772 | 3300050492 | nmdc:mga0yw44_98184_c1 | nmdc:mga0yw44_98184_c1_94_771 | 194 |
| 773 | 3300050494 | nmdc:mga06z11_268310_c1 | nmdc:mga06z11_268310_c1_239_859 | 194 |
| 774 | 3300050494 | nmdc:mga06z11_78137_c1 | nmdc:mga06z11_78137_c1_887_1510 | 194 |
| 775 | 3300050496 | nmdc:mga07m45_307350_c1 | nmdc:mga07m45_307350_c1_225_845 | 194 |
| 776 | 3300053151 | Ga0500604_0046695 | Ga0500604_0046695_493_1113 | 194 |
| 777 | 3300053155 | Ga0500620_009644 | Ga0500620_009644_593_1249 | 194 |
| 778 | 3300053155 | Ga0500620_055802 | Ga0500620_055802_26_646 | 194 |
| 779 | 3300053158 | Ga0500627_0117718 | Ga0500627_0117718_278_943 | 194 |
| 780 | 3300053727 | Ga0500611_015028 | Ga0500611_015028_341_961 | 194 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7mpm-assembly1.cif.gz_A | bartonella henselae nrnc bound to paa | 0.9381 | 1 | 194 |
| 7mpm-assembly1.cif.gz_A | bartonella henselae nrnc bound to paa | 0.9334 | 1 | 194 |
| 5zo3-assembly1.cif.gz_A | apo form of the nuclease | 0.9276 | 1 | 194 |
| 7mpr-assembly2.cif.gz_B | brucella melitensis nrnc | 0.9255 | 5 | 194 |
| 7mpr-assembly1.cif.gz_A | brucella melitensis nrnc | 0.9249 | 5 | 194 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8ILY1_1321_1641_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.8994 | 6 | 180 | 3.30.420.10 |
| 1yt3A01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.8736 | 19 | 178 | 3.30.420.10 |
| 4nlbA01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.8689 | 17 | 175 | 3.30.420.10 |
| af_A0A1D8PDF4_132_438_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.8609 | 6 | 175 | 3.30.420.10 |
| af_A0A0P0XUY4_189_409_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.8264 | 6 | 137 | 3.30.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W4QPK4-F1-model_v4 | deleted | 0.9683 | 73 | 194 |
|
| AF-A0A1F8IDW9-F1-model_v4 | deleted | 0.967 | 51 | 194 |
|
| AF-A0A504JAC0-F1-model_v4 | Ribonuclease D | 0.9661 | 59 | 194 |
GO:0003676
GO:0006139 GO:0008408 |
| AF-A0A2V7VEZ5-F1-model_v4 | Ribonuclease D | 0.9661 | 49 | 193 |
GO:0003676
GO:0006139 GO:0008408 |
| AF-A0A4S0MQ05-F1-model_v4 | Ribonuclease D | 0.9653 | 64 | 164 |
GO:0003676
GO:0006139 GO:0008408 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar