F480541

General Info

Members Datasets Scaffolds Average Seq Length
780 505 519 203

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0186986|Ga0501034_0186986_989_1705
Length 238
Sequence MLPLLANRGEKRRTNAAFQRSRRFLTFGLYQGASMTIRLHKGDLPEGIRFTGSVAIDTETLGLNPLRDRLCLVQLSAGDGTADIVQIAAGQTSAPRLAALLADRAVTKIFHFARFDIAALEHALGVMAEPIFCTKIASRLTRTYTDRHGLKDLAKELLDVDLSKQQQSSDWAAETLSDAQLAYAASDVLYLHQLRDKLAARLVREGRQELAAACFRFLPTRARLDLMGWGEEDIFAHS

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
8 2512875024 Mesorhizobium loti R88b Isolate Nodule
9 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
10 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
11 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
12 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
13 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
14 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
15 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
16 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
17 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
18 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
19 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
20 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
21 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
22 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
23 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
24 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
25 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
26 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
27 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
28 2738543024 Aminobacter sp. AP02 Isolate Unclassified
29 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
30 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
31 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
32 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
33 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
34 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
35 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
36 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
37 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
38 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
39 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
40 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
41 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
42 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
43 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
44 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
45 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
46 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
47 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
48 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
49 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
50 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
51 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
52 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
53 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
54 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
55 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
56 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
57 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
58 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
59 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
60 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
61 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
62 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
63 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
64 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
65 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
66 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
67 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
68 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
69 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
70 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
71 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
72 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
73 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
74 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
75 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
76 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
77 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
78 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
79 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
80 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
81 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
82 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
83 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
84 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
85 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
86 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
87 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
88 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
89 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
90 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
91 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
92 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
93 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
94 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
95 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
96 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
97 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
98 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
99 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
100 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
101 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
102 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
103 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
104 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
105 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
106 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
107 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
108 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
109 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
110 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
111 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
112 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
113 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
114 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
115 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
116 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
117 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
118 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
119 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
120 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
121 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
122 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
123 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
124 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
125 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
126 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
127 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
128 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
129 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
130 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
131 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
132 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
133 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
134 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
135 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
136 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
137 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
138 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
139 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
140 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
141 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
142 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
143 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
144 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
145 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
146 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
147 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
148 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
149 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
150 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
151 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
152 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
153 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
154 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
155 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
156 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
157 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
158 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
159 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
160 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
161 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
162 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
163 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
164 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
165 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
166 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
167 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
168 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
169 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
170 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
171 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
172 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
173 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
174 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
175 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
176 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
177 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
178 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
179 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
180 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
181 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
182 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
183 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
184 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
185 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
186 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
187 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
188 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
189 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
190 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
191 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
192 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
193 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
194 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
195 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
196 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
197 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
198 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
199 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
200 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
201 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
202 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
203 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
204 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
205 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
206 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
207 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
208 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
209 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
210 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
211 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
212 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
213 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
214 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
215 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
216 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
217 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
218 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
219 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
220 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
221 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
222 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
223 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
224 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
225 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
226 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
227 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
228 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
229 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
230 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
231 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
232 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
233 3004167301 Mesorhizobium loti 582 Isolate Unclassified
234 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
235 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
236 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
237 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
238 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
239 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
240 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
241 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
242 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
243 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
244 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
245 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
246 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
247 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
248 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
249 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
250 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
251 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
252 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
253 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
254 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
255 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
256 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
257 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
258 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
259 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
260 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
261 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
262 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
263 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
264 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
265 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
266 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
267 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
268 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
269 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
270 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
271 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
272 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
273 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
274 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
275 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
276 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
277 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
278 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
279 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
280 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
281 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
282 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
283 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
284 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
285 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
286 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
287 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
288 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
289 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
290 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
291 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
292 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
293 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
294 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
295 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
296 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
297 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
298 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
299 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
300 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
301 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
302 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
303 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
304 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
305 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
306 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
307 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
308 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
309 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
310 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
311 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
312 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
313 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
314 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
315 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
316 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
317 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
318 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
319 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
320 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
347 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
349 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
350 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
351 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
352 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
353 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
354 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
355 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
356 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
357 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
358 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
359 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
360 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
361 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
362 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
363 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
364 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
365 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
366 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
367 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
368 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
369 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
370 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
371 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
372 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
373 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
374 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
375 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
376 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
377 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
378 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
379 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
380 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
381 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
382 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
383 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
384 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
385 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
386 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
387 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
388 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
389 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
390 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
391 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
392 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
393 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
394 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
395 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
396 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
397 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
398 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
399 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
400 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
401 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
402 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
403 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
404 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
405 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
406 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
407 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
408 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
409 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
410 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
411 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
412 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
413 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
414 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
415 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
416 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
417 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
418 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
419 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
420 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
421 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
422 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
423 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
424 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
425 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
426 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
427 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
428 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
429 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
430 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
431 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
432 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
433 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
434 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
439 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
442 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
447 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
449 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
450 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
451 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
452 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
453 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
454 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
455 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
456 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
457 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
458 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
459 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
460 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
461 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
464 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
465 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
466 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
467 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
468 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
469 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
470 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
471 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
472 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
473 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
474 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
475 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
476 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
477 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
478 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
479 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
480 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
481 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
482 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
483 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
484 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
485 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
486 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
487 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
488 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
489 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
490 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
491 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
492 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
493 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
494 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
495 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
496 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
497 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
498 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
499 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
500 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
501 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
502 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
503 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
504 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
505 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 66.54
Metatranscriptomes 0
Isolates 33.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.44
Nodule 28.08
Rhizoplane 1.79
Rhizosphere 54.62
Stem 0
Stem Tuber 0
Unclassified 8.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10014860 3300001979 Bacteria 2859
2 JGI24739J22299_10053437 3300001989 Bacteria 1296
3 JGI24735J21928_10054364 3300002067 Bacteria 1154
4 JGI25156J39149_1002078 3300002705 Bacteria 7594
5 JGI25157J39369_1002436 3300002741 Bacteria 4645
6 JGI25165J46597_1000034 3300003214 Bacteria 292458
7 rootH1_10020692 3300003323 Bacteria 5302
8 Ga0055542_1000299 3300003762 Bacteria 55023
9 Ga0055542_1001140 3300003762 Bacteria 15682
10 Ga0055529_1002112 3300003763 Bacteria 4209
11 Ga0070658_10003464 3300005327 Bacteria 12971
12 Ga0070658_10073478 3300005327 Bacteria 2804
13 Ga0070658_10102585 3300005327 Bacteria 2366
14 Ga0070658_10300021 3300005327 Bacteria 1370
15 Ga0070680_100025492 3300005336 Bacteria 4727
16 Ga0070680_100077710 3300005336 Bacteria 2734
17 Ga0070680_100159731 3300005336 Bacteria 1894
18 Ga0070660_100097417 3300005339 Bacteria 2327
19 Ga0070660_100126282 3300005339 Bacteria 2044
20 Ga0070691_10001404 3300005341 Bacteria 10282
21 Ga0070674_100172869 3300005356 Bacteria 1649
22 Ga0070659_100563058 3300005366 Bacteria 976
23 Ga0070714_100011222 3300005435 Bacteria 7104
24 Ga0070714_100021373 3300005435 Bacteria 5295
25 Ga0070714_100105952 3300005435 Bacteria 2483
26 Ga0070713_100015441 3300005436 Bacteria 5710
27 Ga0070713_100042235 3300005436 Bacteria 3720
28 Ga0070711_100016334 3300005439 Bacteria 4713
29 Ga0070663_100381597 3300005455 Bacteria 1148
30 Ga0070681_10033498 3300005458 Bacteria 5157
31 Ga0070699_100487009 3300005518 Bacteria 1120
32 Ga0070679_100032673 3300005530 Bacteria 5149
33 Ga0070679_100067069 3300005530 Bacteria 3578
34 Ga0070679_100094930 3300005530 Bacteria 2970
35 Ga0068853_100014665 3300005539 Bacteria 6427
36 Ga0068853_100163930 3300005539 Bacteria 2007
37 Ga0068853_100211323 3300005539 Bacteria 1768
38 Ga0068853_100559500 3300005539 Bacteria 1084
39 Ga0068853_100605580 3300005539 Bacteria 1041
40 Ga0070672_100791249 3300005543 Bacteria 834
41 Ga0070693_100537585 3300005547 Bacteria 835
42 Ga0070665_100016431 3300005548 Bacteria 7421
43 Ga0070665_100221828 3300005548 Bacteria 1891
44 Ga0068855_100031023 3300005563 Bacteria 6387
45 Ga0068855_100979296 3300005563 Bacteria 889
46 Ga0068854_100154905 3300005578 Bacteria 1770
47 Ga0068856_100157583 3300005614 Bacteria 2280
48 Ga0068856_100524487 3300005614 Bacteria 1206
49 Ga0068852_100264523 3300005616 Bacteria 1652
50 Ga0068859_100631076 3300005617 Bacteria 1164
51 Ga0081455_10274102 3300005937 Bacteria 1222
52 Ga0081540_1001159 3300005983 Bacteria 23221
53 Ga0081539_10001022 3300005985 Bacteria 51499
54 Ga0070717_10346160 3300006028 Bacteria 1328
55 Ga0075365_10011143 3300006038 Bacteria 5274
56 Ga0075365_10040336 3300006038 Bacteria 3044
57 Ga0075365_10056224 3300006038 Bacteria 2615
58 Ga0075365_10521708 3300006038 Bacteria 840
59 Ga0075368_10056697 3300006042 Bacteria 1563
60 Ga0075363_100130882 3300006048 Bacteria 1407
61 Ga0075364_10022475 3300006051 Bacteria 3983
62 Ga0075364_10307707 3300006051 Bacteria 1079
63 Ga0070712_100102626 3300006175 Bacteria 2118
64 Ga0070712_100134721 3300006175 Bacteria 1877
65 Ga0075362_10058515 3300006177 Bacteria 1738
66 Ga0075362_10095718 3300006177 Bacteria 1383
67 Ga0075362_10315075 3300006177 Bacteria 778
68 Ga0075367_10223102 3300006178 Bacteria 1180
69 Ga0075367_10226190 3300006178 Bacteria 1171
70 Ga0075367_10445586 3300006178 Bacteria 820
71 Ga0075369_10193123 3300006186 Bacteria 938
72 Ga0075370_10377584 3300006353 Bacteria 849
73 Ga0068865_100679356 3300006881 Bacteria 878
74 Ga0097620_100631081 3300006931 Bacteria 1164
75 Ga0105240_10007628 3300009093 Bacteria 15668
76 Ga0105240_10035830 3300009093 Bacteria 6390
77 Ga0105240_10551499 3300009093 Bacteria 1275
78 Ga0105240_10674437 3300009093 Bacteria 1131
79 Ga0105242_10359047 3300009176 Bacteria 1348
80 Ga0105237_10460789 3300009545 Bacteria 1277
81 Ga0105237_10728967 3300009545 Bacteria 998
82 Ga0105238_10026262 3300009551 Bacteria 5935
83 Ga0105238_10126589 3300009551 Bacteria 2533
84 Ga0105238_10147811 3300009551 Bacteria 2326
85 Ga0105238_10427365 3300009551 Bacteria 1320
86 Ga0105239_10099033 3300010375 Bacteria 3223
87 Ga0105239_10377452 3300010375 Bacteria 1603
88 Ga0105239_10476700 3300010375 Bacteria 1417
89 Ga0105246_10530456 3300011119 Bacteria 1005
90 Ga0157373_10518186 3300013100 Bacteria 862
91 Ga0157373_10589507 3300013100 Bacteria 809
92 Ga0157370_10513709 3300013104 Bacteria 1100
93 Ga0157374_10200108 3300013296 Bacteria 1956
94 Ga0157374_10648459 3300013296 Bacteria 1068
95 Ga0163163_10059183 3300014325 Bacteria 3789
96 Ga0157380_10006688 3300014326 Bacteria 8141
97 Ga0182008_10069715 3300014497 Bacteria 1730
98 Ga0182008_10156763 3300014497 Bacteria 1144
99 Ga0182008_10176785 3300014497 Bacteria 1079
100 Ga0157379_10521239 3300014968 Bacteria 1103
101 Ga0157376_10001430 3300014969 Bacteria 15703
102 Ga0182006_1037866 3300015261 Bacteria 1910
103 Ga0182005_1011656 3300015265 Bacteria 2501
104 Ga0163161_10324901 3300017792 Bacteria 1217
105 Ga0213872_10255936 3300021361 Bacteria 736
106 Ga0213876_10004936 3300021384 Bacteria 7383
107 Ga0213876_10193059 3300021384 Bacteria 1083
108 Ga0213875_10002299 3300021388 Bacteria 11574
109 Ga0213875_10073021 3300021388 Bacteria 1601
110 Ga0213871_10003974 3300021441 Bacteria 2913
111 Ga0213871_10093114 3300021441 Bacteria 875
112 Ga0209026_1000100 3300025250 Bacteria 156131
113 Ga0209148_1000069 3300025254 Bacteria 334444
114 Ga0209148_1007365 3300025254 Bacteria 2294
115 Ga0209759_1000438 3300025256 Bacteria 49192
116 Ga0209233_1000028 3300025261 Bacteria 642062
117 Ga0209455_1000135 3300025272 Bacteria 148007
118 Ga0209025_1055391 3300025294 Bacteria 1534
119 Ga0209758_1006381 3300025297 Bacteria 8513
120 Ga0207680_10237139 3300025903 Bacteria 1256
121 Ga0207647_10012504 3300025904 Bacteria 5907
122 Ga0207647_10042332 3300025904 Bacteria 2858
123 Ga0207645_10108736 3300025907 Bacteria 1794
124 Ga0207705_10032668 3300025909 Bacteria 3720
125 Ga0207705_10111723 3300025909 Bacteria 2020
126 Ga0207705_10119510 3300025909 Bacteria 1954
127 Ga0207707_10005836 3300025912 Bacteria 10760
128 Ga0207707_10023528 3300025912 Bacteria 5388
129 Ga0207671_10352224 3300025914 Bacteria 1168
130 Ga0207671_10492362 3300025914 Bacteria 977
131 Ga0207671_10527829 3300025914 Bacteria 941
132 Ga0207693_10089615 3300025915 Bacteria 2411
133 Ga0207663_10011790 3300025916 Bacteria 4706
134 Ga0207660_10371041 3300025917 Bacteria 1149
135 Ga0207657_10081611 3300025919 Bacteria 2716
136 Ga0207649_10827700 3300025920 Bacteria 723
137 Ga0207652_10033644 3300025921 Bacteria 4317
138 Ga0207652_10040007 3300025921 Bacteria 3981
139 Ga0207694_10184419 3300025924 Bacteria 1693
140 Ga0207700_10007179 3300025928 Bacteria 6791
141 Ga0207700_10034319 3300025928 Bacteria 3641
142 Ga0207664_10002435 3300025929 Bacteria 12311
143 Ga0207664_10022275 3300025929 Bacteria 4728
144 Ga0207664_10048471 3300025929 Bacteria 3341
145 Ga0207690_10322522 3300025932 Bacteria 1214
146 Ga0207686_10304441 3300025934 Bacteria 1185
147 Ga0207669_10132765 3300025937 Bacteria 1714
148 Ga0207669_10606377 3300025937 Bacteria 890
149 Ga0207667_10287804 3300025949 Bacteria 1679
150 Ga0207667_10351063 3300025949 Bacteria 1504
151 Ga0207640_10143941 3300025981 Bacteria 1742
152 Ga0207640_10323186 3300025981 Bacteria 1229
153 Ga0207639_10104195 3300026041 Bacteria 2300
154 Ga0207639_10413278 3300026041 Bacteria 1218
155 Ga0207639_10503046 3300026041 Bacteria 1107
156 Ga0207678_10014969 3300026067 Bacteria 6824
157 Ga0207678_10417068 3300026067 Bacteria 1164
158 Ga0207702_10127366 3300026078 Bacteria 2288
159 Ga0207674_10129991 3300026116 Bacteria 2482
160 Ga0207675_100693675 3300026118 Bacteria 1027
161 Ga0207698_10359611 3300026142 Bacteria 1378
162 Ga0209813_10099727 3300027866 Bacteria 987
163 Ga0268266_10034154 3300028379 Bacteria 4325
164 Ga0268266_10075245 3300028379 Bacteria 2933
165 Ga0268266_10175352 3300028379 Bacteria 1949
166 Ga0268266_10182704 3300028379 Bacteria 1910
167 Ga0268266_10702934 3300028379 Bacteria 974
168 Ga0265334_10009214 3300028573 Bacteria 4181
169 Ga0265338_10114786 3300028800 Bacteria 2160
170 Ga0265330_10051719 3300031235 Bacteria 1801
171 Ga0265330_10192679 3300031235 Bacteria 862
172 Ga0265332_10120577 3300031238 Bacteria 1102
173 Ga0265332_10236964 3300031238 Bacteria 756
174 Ga0265328_10000183 3300031239 Bacteria 29210
175 Ga0265325_10015163 3300031241 Bacteria 4340
176 Ga0265325_10022512 3300031241 Bacteria 3451
177 Ga0265325_10048025 3300031241 Bacteria 2208
178 Ga0265325_10065023 3300031241 Bacteria 1843
179 Ga0265340_10000575 3300031247 Bacteria 20409
180 Ga0265340_10021893 3300031247 Bacteria 3273
181 Ga0265340_10043626 3300031247 Bacteria 2197
182 Ga0265340_10064561 3300031247 Bacteria 1745
183 Ga0265340_10068721 3300031247 Bacteria 1682
184 Ga0265339_10000788 3300031249 Bacteria 24487
185 Ga0265339_10127026 3300031249 Bacteria 1306
186 Ga0265339_10131062 3300031249 Bacteria 1282
187 Ga0265331_10003205 3300031250 Bacteria 10676
188 Ga0265331_10029735 3300031250 Bacteria 2724
189 Ga0265331_10055239 3300031250 Bacteria 1889
190 Ga0265327_10000070 3300031251 Bacteria 217350
191 Ga0265327_10012708 3300031251 Bacteria 5655
192 Ga0265327_10071509 3300031251 Bacteria 1735
193 Ga0265316_10004940 3300031344 Bacteria 13113
194 Ga0265316_10307218 3300031344 Bacteria 1154
195 Ga0265316_10325327 3300031344 Bacteria 1116
196 Ga0307513_10783999 3300031456 Bacteria 659
197 Ga0265313_10000004 3300031595 Bacteria 188027
198 Ga0265313_10001970 3300031595 Bacteria 18560
199 Ga0265313_10033316 3300031595 Bacteria 2620
200 Ga0265313_10036836 3300031595 Bacteria 2453
201 Ga0265313_10109635 3300031595 Bacteria 1215
202 Ga0265313_10115674 3300031595 Bacteria 1175
203 Ga0316575_10027535 3300031665 Bacteria 2212
204 Ga0316579_10163637 3300031691 Bacteria 1075
205 Ga0265314_10044136 3300031711 Bacteria 3162
206 Ga0265314_10127667 3300031711 Bacteria 1591
207 Ga0265342_10040548 3300031712 Bacteria 2823
208 Ga0265342_10041348 3300031712 Bacteria 2792
209 Ga0265342_10103090 3300031712 Bacteria 1623
210 Ga0265342_10113886 3300031712 Bacteria 1528
211 Ga0307516_10000030 3300031730 Bacteria 159694
212 Ga0307406_10277063 3300031901 Bacteria 1277
213 Ga0307414_10424870 3300032004 Bacteria 1160
214 Ga0307411_10559823 3300032005 Bacteria 977
215 Ga0316583_10122777 3300032133 Bacteria 905
216 Ga0307510_10141629 3300033180 Bacteria 2046
217 Ga0373923_0077558 3300035111 Bacteria 1437
218 Ga0373923_0105915 3300035111 Bacteria 1244
219 Ga0373941_0198298 3300035115 Bacteria 762
220 Ga0373953_0051258 3300035117 Bacteria 1668
221 Ga0373943_0130253 3300035170 Bacteria 1346
222 Ga0373943_0269064 3300035170 Bacteria 961
223 Ga0373943_0503711 3300035170 Bacteria 708
224 Ga0316574_0318993 3300035398 Bacteria 987
225 Ga0373927_0040176 3300035695 Bacteria 3036
226 Ga0373933_0006885 3300035724 Bacteria 6192
227 Ga0373933_0029810 3300035724 Bacteria 3157
228 Ga0373947_0046584 3300035725 Bacteria 2597
229 Ga0373937_0004353 3300036401 Bacteria 12020
230 Ga0373937_0019732 3300036401 Bacteria 6038
231 Ga0373937_0030563 3300036401 Bacteria 4878
232 Ga0373937_0095788 3300036401 Bacteria 2752
233 Ga0316582_0387278 3300036647 Bacteria 962
234 Ga0316584_0005127 3300036712 Bacteria 8745
235 Ga0373925_0054797 3300037068 Bacteria 2983
236 Ga0373925_0102420 3300037068 Bacteria 2203
237 Ga0373925_0688931 3300037068 Bacteria 842
238 Ga0395900_0089863 3300037418 Bacteria 3157
239 Ga0395900_0097510 3300037418 Bacteria 3020
240 Ga0395900_0128830 3300037418 Bacteria 2594
241 Ga0395900_0153414 3300037418 Bacteria 2353
242 Ga0395898_0023354 3300037466 Bacteria 6250
243 Ga0395898_0094496 3300037466 Bacteria 2873
244 Ga0395898_0705918 3300037466 Bacteria 950
245 Ga0395905_0121593 3300037471 Bacteria 2454
246 Ga0395905_1142804 3300037471 Bacteria 682
247 Ga0436364_0313282 3300037853 Bacteria 852
248 Ga0436364_0420938 3300037853 Bacteria 1107
249 Ga0436364_0546627 3300037853 Bacteria 1417
250 Ga0436364_0834964 3300037853 Bacteria 10664
251 Ga0436364_1431099 3300037853 Bacteria 8523
252 Ga0395901_0065947 3300038443 Bacteria 3771
253 Ga0395901_0105520 3300038443 Bacteria 2957
254 Ga0395901_0143173 3300038443 Bacteria 2513
255 Ga0395901_0145772 3300038443 Bacteria 2488
256 Ga0395901_0239139 3300038443 Bacteria 1894
257 Ga0395901_0285229 3300038443 Bacteria 1715
258 Ga0395901_0452472 3300038443 Bacteria 1313
259 Ga0436365_0097041 3300039437 Bacteria 967
260 Ga0436365_0249297 3300039437 Bacteria 2219
261 Ga0436365_1624935 3300039437 Bacteria 9034
262 Ga0436365_1691170 3300039437 Bacteria 24758
263 Ga0436360_0261887 3300039438 Bacteria 2785
264 Ga0436360_0397922 3300039438 Bacteria 3864
265 Ga0436360_0701477 3300039438 Bacteria 2882
266 Ga0436360_0930277 3300039438 Bacteria 1637
267 Ga0436360_1132676 3300039438 Bacteria 2372
268 Ga0436361_0219390 3300039447 Bacteria 5330
269 Ga0436361_0917993 3300039447 Bacteria 3838
270 Ga0436363_0789771 3300039450 Bacteria 2146
271 Ga0436362_0265607 3300039453 Bacteria 1620
272 Ga0436362_0312797 3300039453 Bacteria 4621
273 Ga0439458_0058653 3300042157 Bacteria 959
274 Ga0451577_0090571 3300042876 Bacteria 2730
275 Ga0466972_0136707 3300044658 Bacteria 1153
276 Ga0453683_0042228 3300044673 Bacteria 2863
277 Ga0453684_0246399 3300044712 Bacteria 2054
278 Ga0466957_0143220 3300044842 Bacteria 1541
279 Ga0451576_0100030 3300045051 Bacteria 3016
280 Ga0451576_1153558 3300045051 Bacteria 810
281 Ga0466967_0227611 3300045976 Bacteria 1774
282 Ga0466967_0586450 3300045976 Bacteria 1099
283 Ga0495651_0459720 3300046462 Bacteria 821
284 Ga0495664_0002764 3300046477 Bacteria 9441
285 Ga0495584_0140576 3300046491 Bacteria 1226
286 Ga0495608_0016666 3300046511 Bacteria 5084
287 Ga0495628_0155315 3300046516 Bacteria 1741
288 Ga0495643_0088111 3300046522 Bacteria 1605
289 Ga0495652_0248572 3300046529 Bacteria 1319
290 Ga0495587_0014361 3300046536 Bacteria 4969
291 Ga0495667_0142314 3300046559 Bacteria 1545
292 Ga0495668_0022331 3300046616 Bacteria 3618
293 Ga0495657_0045248 3300046675 Bacteria 2988
294 Ga0495657_0145600 3300046675 Bacteria 1474
295 Ga0495623_0122240 3300046679 Bacteria 1566
296 Ga0495613_0549764 3300046689 Bacteria 773
297 Ga0495674_0020122 3300047319 Bacteria 6184
298 Ga0495672_0191604 3300047320 Bacteria 1028
299 Ga0495680_0086848 3300047322 Bacteria 2353
300 Ga0495680_0162769 3300047322 Bacteria 1619
301 Ga0495675_0054343 3300047444 Bacteria 2541
302 Ga0495684_0533181 3300047471 Bacteria 802
303 Ga0495686_0000134 3300047472 Bacteria 149997
304 Ga0495686_0029749 3300047472 Bacteria 3552
305 Ga0495602_0004731 3300048088 Bacteria 14232
306 Ga0496100_0059937 3300048903 Bacteria 2503
307 Ga0496101_0368355 3300048904 Bacteria 1130
308 Ga0496102_0567832 3300048905 Bacteria 1057
309 Ga0496104_0006145 3300048907 Bacteria 10542
310 Ga0496104_0068515 3300048907 Bacteria 3372
311 Ga0496105_0542075 3300048908 Bacteria 909
312 Ga0496106_0516315 3300048909 Bacteria 959
313 Ga0496110_0340712 3300048913 Bacteria 1366
314 Ga0496110_0457545 3300048913 Bacteria 1163
315 Ga0496112_0005948 3300048915 Bacteria 10644
316 Ga0496112_0177133 3300048915 Bacteria 2097
317 Ga0496112_0185465 3300048915 Bacteria 2044
318 Ga0496115_0026066 3300048918 Bacteria 4558
319 Ga0496119_0047186 3300048922 Bacteria 2682
320 Ga0496119_0134926 3300048922 Bacteria 1340
321 Ga0496119_0252331 3300048922 Bacteria 889
322 Ga0496120_0005180 3300048923 Bacteria 10526
323 Ga0496124_0090338 3300048927 Bacteria 2499
324 Ga0496124_0463140 3300048927 Bacteria 861
325 Ga0496126_0054032 3300048929 Bacteria 3641
326 Ga0496126_0179274 3300048929 Bacteria 1801
327 Ga0496126_0512780 3300048929 Bacteria 957
328 Ga0501031_0002511 3300049568 Bacteria 11690
329 Ga0501031_0176874 3300049568 Bacteria 1394
330 Ga0501031_0229433 3300049568 Bacteria 1208
331 Ga0501032_0000001 3300049569 Bacteria 422097
332 Ga0501032_0012538 3300049569 Bacteria 6052
333 Ga0501032_0023599 3300049569 Bacteria 4246
334 Ga0501032_0023883 3300049569 Bacteria 4223
335 Ga0501032_0158289 3300049569 Bacteria 1487
336 Ga0501033_0000092 3300049570 Bacteria 85398
337 Ga0501033_0004609 3300049570 Bacteria 11038
338 Ga0501033_0004805 3300049570 Bacteria 10790
339 Ga0501033_0031426 3300049570 Bacteria 3990
340 Ga0501033_0408083 3300049570 Bacteria 947
341 Ga0501034_0000036 3300049571 Bacteria 239274
342 Ga0501034_0002736 3300049571 Bacteria 20749
343 Ga0501034_0014538 3300049571 Bacteria 8106
344 Ga0501034_0026322 3300049571 Bacteria 5925
345 Ga0501034_0071950 3300049571 Bacteria 3466
346 Ga0501034_0082916 3300049571 Bacteria 3208
347 Ga0501034_0083962 3300049571 Bacteria 3187
348 Ga0501034_0186986 3300049571 Bacteria 2034
349 Ga0501034_0561630 3300049571 Bacteria 1050
350 Ga0501034_0562489 3300049571 Bacteria 1049
351 Ga0501034_0979653 3300049571 Bacteria 730
352 Ga0501036_0000078 3300049572 Bacteria 60614
353 Ga0501036_0020232 3300049572 Bacteria 5589
354 Ga0501036_0076427 3300049572 Bacteria 2833
355 Ga0501037_0000017 3300049573 Bacteria 157276
356 Ga0501037_0000047 3300049573 Bacteria 114757
357 Ga0501037_0015409 3300049573 Bacteria 5624
358 Ga0501037_0020807 3300049573 Bacteria 4844
359 Ga0501037_0065473 3300049573 Bacteria 2648
360 Ga0501037_0463426 3300049573 Bacteria 863
361 Ga0501037_0581950 3300049573 Bacteria 753
362 Ga0501038_0000036 3300049574 Bacteria 124766
363 Ga0501038_0039916 3300049574 Bacteria 4103
364 Ga0501038_0078757 3300049574 Bacteria 2780
365 Ga0501038_0094343 3300049574 Bacteria 2502
366 Ga0501039_0000011 3300049575 Bacteria 245124
367 Ga0501039_0015572 3300049575 Bacteria 5819
368 Ga0501039_0179429 3300049575 Bacteria 1665
369 Ga0501040_0011447 3300049576 Bacteria 5809
370 Ga0501041_0476458 3300049577 Bacteria 793
371 Ga0501042_0147981 3300049578 Bacteria 1693
372 Ga0501043_0000105 3300049579 Bacteria 78189
373 Ga0501043_0000369 3300049579 Bacteria 40714
374 Ga0501043_0012998 3300049579 Bacteria 6507
375 Ga0501043_0047536 3300049579 Bacteria 3374
376 Ga0501043_0078845 3300049579 Bacteria 2588
377 Ga0501043_0101175 3300049579 Bacteria 2265
378 Ga0501043_0177072 3300049579 Bacteria 1662
379 Ga0501043_0189208 3300049579 Bacteria 1601
380 Ga0501043_0329581 3300049579 Bacteria 1163
381 Ga0501046_0062978 3300049580 Bacteria 2897
382 Ga0501046_0100118 3300049580 Bacteria 2224
383 Ga0501046_0352819 3300049580 Bacteria 1068
384 Ga0501046_0575739 3300049580 Bacteria 801
385 Ga0501047_0010824 3300049581 Bacteria 8620
386 Ga0501047_0015525 3300049581 Bacteria 7255
387 Ga0501047_0030528 3300049581 Bacteria 5194
388 Ga0501047_0031988 3300049581 Bacteria 5076
389 Ga0501047_0036547 3300049581 Bacteria 4747
390 Ga0501047_0038432 3300049581 Bacteria 4631
391 Ga0501047_0072155 3300049581 Bacteria 3323
392 Ga0501047_0078101 3300049581 Bacteria 3184
393 Ga0501047_0082152 3300049581 Bacteria 3097
394 Ga0501047_0173380 3300049581 Bacteria 2026
395 Ga0501047_0225421 3300049581 Bacteria 1729
396 Ga0501047_0417668 3300049581 Bacteria 1173
397 Ga0501047_0657982 3300049581 Bacteria 867
398 Ga0501048_0005606 3300049582 Bacteria 9549
399 Ga0501048_0378083 3300049582 Bacteria 1011
400 Ga0501067_0001320 3300049583 Bacteria 13442
401 Ga0501067_0009788 3300049583 Bacteria 5305
402 Ga0501067_0051777 3300049583 Bacteria 2275
403 Ga0501067_0166742 3300049583 Bacteria 1227
404 Ga0501067_0181600 3300049583 Bacteria 1172
405 Ga0501067_0186971 3300049583 Bacteria 1154
406 Ga0501067_0247253 3300049583 Bacteria 993
407 Ga0501068_0003141 3300049584 Bacteria 8842
408 Ga0501068_0254661 3300049584 Bacteria 1119
409 Ga0501068_0397772 3300049584 Bacteria 888
410 Ga0501069_0000073 3300049585 Bacteria 50646
411 Ga0501069_0001305 3300049585 Bacteria 12228
412 Ga0501069_0044113 3300049585 Bacteria 2469
413 Ga0501069_0257669 3300049585 Bacteria 1018
414 Ga0501070_0000385 3300049586 Bacteria 40440
415 Ga0501070_0008366 3300049586 Bacteria 8742
416 Ga0501070_0009729 3300049586 Bacteria 8129
417 Ga0501070_0024862 3300049586 Bacteria 5022
418 Ga0501070_0094321 3300049586 Bacteria 2476
419 Ga0501070_0111893 3300049586 Bacteria 2256
420 Ga0501070_0245995 3300049586 Bacteria 1463
421 Ga0501070_0593943 3300049586 Bacteria 883
422 Ga0501071_0012434 3300049587 Bacteria 5772
423 Ga0501071_0131128 3300049587 Bacteria 1862
424 Ga0501071_0159548 3300049587 Bacteria 1685
425 Ga0501072_0429229 3300049588 Bacteria 1047
426 Ga0501072_0574267 3300049588 Bacteria 890
427 Ga0501073_0016266 3300049589 Bacteria 5391
428 Ga0501073_0028749 3300049589 Bacteria 3972
429 Ga0501073_0069005 3300049589 Bacteria 2464
430 Ga0501073_0128882 3300049589 Bacteria 1754
431 Ga0501073_0236581 3300049589 Bacteria 1261
432 Ga0501074_0000390 3300049590 Bacteria 26047
433 Ga0501074_0009564 3300049590 Bacteria 7039
434 Ga0501074_0015949 3300049590 Bacteria 5464
435 Ga0501074_0016234 3300049590 Bacteria 5409
436 Ga0501074_0088081 3300049590 Bacteria 2223
437 Ga0501076_0967807 3300049592 Bacteria 701
438 Ga0501079_0511893 3300049741 Bacteria 944
439 Ga0501079_0794851 3300049741 Bacteria 745
440 Ga0501080_0003536 3300049742 Bacteria 13766
441 Ga0501080_0011370 3300049742 Bacteria 8151
442 Ga0501080_0021998 3300049742 Bacteria 5906
443 Ga0501080_0060900 3300049742 Bacteria 3514
444 Ga0501080_0062492 3300049742 Bacteria 3466
445 Ga0501080_0118406 3300049742 Bacteria 2455
446 Ga0501080_0423021 3300049742 Bacteria 1196
447 Ga0501083_0000235 3300049744 Bacteria 35557
448 Ga0501083_0005780 3300049744 Bacteria 8756
449 Ga0501083_0032218 3300049744 Bacteria 3596
450 Ga0501083_0122242 3300049744 Bacteria 1707
451 Ga0501035_0000025 3300049822 Bacteria 204195
452 Ga0501035_0000028 3300049822 Bacteria 179195
453 Ga0501035_0001951 3300049822 Bacteria 20653
454 Ga0501035_0004666 3300049822 Bacteria 13009
455 Ga0501035_0006605 3300049822 Bacteria 10857
456 Ga0501035_0019298 3300049822 Bacteria 6274
457 Ga0501035_0044425 3300049822 Bacteria 4001
458 Ga0501035_0104265 3300049822 Bacteria 2487
459 Ga0501035_0138377 3300049822 Bacteria 2118
460 Ga0501035_0690543 3300049822 Bacteria 824
461 Ga0501044_0000031 3300049823 Bacteria 173135
462 Ga0501044_0004322 3300049823 Bacteria 15928
463 Ga0501044_0007776 3300049823 Bacteria 11787
464 Ga0501044_0011168 3300049823 Bacteria 9741
465 Ga0501044_0043873 3300049823 Bacteria 4643
466 Ga0501044_0065538 3300049823 Bacteria 3704
467 Ga0501044_0082098 3300049823 Bacteria 3262
468 Ga0501044_0124367 3300049823 Bacteria 2577
469 Ga0501044_0140858 3300049823 Bacteria 2400
470 Ga0501044_0340371 3300049823 Bacteria 1421
471 Ga0501045_0015919 3300049824 Bacteria 5334
472 Ga0501045_0238195 3300049824 Bacteria 1355
473 nmdc:mga03683_185333_c1 3300050489 Bacteria 951
474 nmdc:mga03683_2822_c1 3300050489 Bacteria 5472
475 nmdc:mga03n38_379259_c1 3300050490 Bacteria 775
476 nmdc:mga00v17_299473_c1 3300050491 Bacteria 1044
477 nmdc:mga00v17_80386_c1 3300050491 Bacteria 2034
478 nmdc:mga0yw44_277910_c1 3300050492 Bacteria 1119
479 nmdc:mga0yw44_363204_c1 3300050492 Bacteria 976
480 nmdc:mga0yw44_98184_c1 3300050492 Bacteria 1862
481 nmdc:mga06z11_268310_c1 3300050494 Bacteria 1009
482 nmdc:mga06z11_78137_c1 3300050494 Bacteria 1768
483 nmdc:mga07m45_307350_c1 3300050496 Bacteria 922
484 nmdc:mga0sz30_32382_c1 3300050516 Bacteria 2168
485 Ga0495601_0041469 3300053077 Bacteria 2885
486 Ga0495601_0549975 3300053077 Bacteria 743
487 Ga0495612_0000290 3300053078 Bacteria 20485
488 Ga0495655_0142639 3300053083 Bacteria 747
489 Ga0495595_0029895 3300053084 Bacteria 2441
490 Ga0495595_0165647 3300053084 Bacteria 1092
491 Ga0495619_0031108 3300053085 Bacteria 3457
492 Ga0495619_0045966 3300053085 Bacteria 2870
493 Ga0500644_0034639 3300053088 Bacteria 1631
494 Ga0500583_0149864 3300053092 Bacteria 1161
495 Ga0500651_0186221 3300053093 Bacteria 1231
496 Ga0500650_0148469 3300053098 Bacteria 1085
497 Ga0500593_000183 3300053117 Bacteria 25578
498 Ga0500642_0229131 3300053130 Bacteria 859
499 Ga0500568_0000002 3300053139 Bacteria 880601
500 Ga0500604_0046695 3300053151 Bacteria 1325
501 Ga0500616_0003337 3300053153 Bacteria 12363
502 Ga0500620_009644 3300053155 Bacteria 2502
503 Ga0500620_055802 3300053155 Bacteria 1335
504 Ga0500627_0106025 3300053158 Bacteria 1263
505 Ga0500627_0117718 3300053158 Bacteria 1197
506 Ga0500627_0121450 3300053158 Bacteria 1178
507 Ga0500627_0244259 3300053158 Bacteria 796
508 Ga0500636_0125725 3300053177 Bacteria 1434
509 Ga0500611_015028 3300053727 Bacteria 1363
510 Ga0500611_112636 3300053727 Bacteria 717
511 Ga0500552_002516 3300053733 Bacteria 1792
512 Ga0501084_0043399 3300054114 Bacteria 3762
513 Ga0501084_0269146 3300054114 Bacteria 1438
514 Ga0501084_0411714 3300054114 Bacteria 1143
515 Ga0501084_0610506 3300054114 Bacteria 921
516 Ga0501082_0002950 3300060353 Bacteria 14841
517 Ga0501082_0146904 3300060353 Bacteria 2047
518 Ga0501082_0150111 3300060353 Bacteria 2024
519 Ga0501082_0239219 3300060353 Bacteria 1580

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035170 Ga0373943_0503711 Ga0373943_0503711_115_663 165
2 3300049822 Ga0501035_0690543 Ga0501035_0690543_21_569 165
3 3300025932 Ga0207690_10322522 Ga0207690_103225222 182
4 3300006175 Ga0070712_100134721 Ga0070712_1001347212 183
5 3300025929 Ga0207664_10002435 Ga0207664_1000243510 183
6 iso_pu_bacteria 3000405567 3000408065 187
7 iso_pu_bacteria 2513237087 2513592972 188
8 iso_pu_bacteria 2828305725 2828308294 188
9 iso_pu_bacteria 2891088606 2891089248 188
10 iso_pu_bacteria 2939669807 2939673419 188
11 3300053083 Ga0495655_0142639 Ga0495655_0142639_86_703 189
12 iso_pu_bacteria 2513237351 2514586314 189
13 iso_pu_bacteria 2643221623 2644133785 189
14 iso_pu_bacteria 2738543024 2739307727 189
15 iso_pu_bacteria 2889790730 2889795875 189
16 iso_pu_bacteria 2889914905 2889917748 189
17 iso_pu_bacteria 2937843397 2937846944 189
18 iso_pu_bacteria 2996310559 2996316575 189
19 iso_pu_bacteria 8002285264 8002290934 189
20 3300005336 Ga0070680_100159731 Ga0070680_1001597312 190
21 3300005436 Ga0070713_100042235 Ga0070713_1000422353 190
22 3300005530 Ga0070679_100032673 Ga0070679_1000326734 190
23 3300005547 Ga0070693_100537585 Ga0070693_1005375851 190
24 3300021441 Ga0213871_10003974 Ga0213871_100039743 190
25 3300025903 Ga0207680_10237139 Ga0207680_102371392 190
26 3300025928 Ga0207700_10007179 Ga0207700_100071793 190
27 3300028800 Ga0265338_10114786 Ga0265338_101147864 190
28 3300039438 Ga0436360_0261887 Ga0436360_0261887_73_723 190
29 3300039438 Ga0436360_0701477 Ga0436360_0701477_1934_2584 190
30 3300039438 Ga0436360_1132676 Ga0436360_1132676_1589_2224 190
31 3300039453 Ga0436362_0265607 Ga0436362_0265607_697_1356 190
32 iso_pu_bacteria 2503198000 2503199780 190
33 iso_pu_bacteria 2508501123 2509114735 190
34 iso_pu_bacteria 2508501127 2509142403 190
35 iso_pu_bacteria 2509276018 2509371997 190
36 iso_pu_bacteria 2509276022 2509394701 190
37 iso_pu_bacteria 2510065059 2510318710 190
38 iso_pu_bacteria 2512875016 2512932800 190
39 iso_pu_bacteria 2512875024 2512960821 190
40 iso_pu_bacteria 2513237090 2513608920 190
41 iso_pu_bacteria 2513237164 2514036590 190
42 iso_pu_bacteria 2513237305 2514417401 190
43 iso_pu_bacteria 2588253730 2588518853 190
44 iso_pu_bacteria 2597489875 2597811007 190
45 iso_pu_bacteria 2599185301 2599939801 190
46 iso_pu_bacteria 2643221551 2643776747 190
47 iso_pu_bacteria 2643221555 2643795195 190
48 iso_pu_bacteria 2643221595 2643987542 190
49 iso_pu_bacteria 2643221627 2644157937 190
50 iso_pu_bacteria 2687453392 2688597026 190
51 iso_pu_bacteria 2693429784 2694635620 190
52 iso_pu_bacteria 2721755686 2723574187 190
53 iso_pu_bacteria 2756170246 2756671000 190
54 iso_pu_bacteria 2791355123 2792748213 190
55 iso_pu_bacteria 2841734538 2841737527 190
56 iso_pu_bacteria 2844002411 2844008905 190
57 iso_pu_bacteria 2844009547 2844012377 190
58 iso_pu_bacteria 2856320880 2856322874 190
59 iso_pu_bacteria 2856328259 2856334646 190
60 iso_pu_bacteria 2856334872 2856341224 190
61 iso_pu_bacteria 2856342000 2856349185 190
62 iso_pu_bacteria 2857349434 2857352198 190
63 iso_pu_bacteria 2857367948 2857371716 190
64 iso_pu_bacteria 2869162929 2869165742 190
65 iso_pu_bacteria 2869169390 2869174373 190
66 iso_pu_bacteria 2869234852 2869237636 190
67 iso_pu_bacteria 2869242130 2869248079 190
68 iso_pu_bacteria 2869249662 2869254160 190
69 iso_pu_bacteria 2869256925 2869257803 190
70 iso_pu_bacteria 2869264136 2869269989 190
71 iso_pu_bacteria 2869271264 2869277440 190
72 iso_pu_bacteria 2869278585 2869282424 190
73 iso_pu_bacteria 2871435913 2871438208 190
74 iso_pu_bacteria 2871451962 2871452555 190
75 iso_pu_bacteria 2871459585 2871463465 190
76 iso_pu_bacteria 2871466892 2871466964 190
77 iso_pu_bacteria 2871474448 2871477011 190
78 iso_pu_bacteria 2871481445 2871486449 190
79 iso_pu_bacteria 2871488783 2871493447 190
80 iso_pu_bacteria 2871495908 2871496481 190
81 iso_pu_bacteria 2874109183 2874114318 190
82 iso_pu_bacteria 2874116593 2874119965 190
83 iso_pu_bacteria 2874123672 2874129004 190
84 iso_pu_bacteria 2874131515 2874136911 190
85 iso_pu_bacteria 2874139085 2874142079 190
86 iso_pu_bacteria 2874162495 2874163097 190
87 iso_pu_bacteria 2874168670 2874175005 190
88 iso_pu_bacteria 2876363079 2876364951 190
89 iso_pu_bacteria 2876369609 2876373228 190
90 iso_pu_bacteria 2876377896 2876385539 190
91 iso_pu_bacteria 2876386047 2876392529 190
92 iso_pu_bacteria 2876399893 2876402640 190
93 iso_pu_bacteria 2876406927 2876410674 190
94 iso_pu_bacteria 2876420981 2876424185 190
95 iso_pu_bacteria 2878730984 2878738779 190
96 iso_pu_bacteria 2878738818 2878744737 190
97 iso_pu_bacteria 2878760144 2878760709 190
98 iso_pu_bacteria 2878767105 2878767666 190
99 iso_pu_bacteria 2878774303 2878776090 190
100 iso_pu_bacteria 2878781027 2878784190 190
101 iso_pu_bacteria 2878788777 2878793851 190
102 iso_pu_bacteria 2881147464 2881149653 190
103 iso_pu_bacteria 2881155292 2881160843 190
104 iso_pu_bacteria 2881853255 2881859834 190
105 iso_pu_bacteria 2882632389 2882639457 190
106 iso_pu_bacteria 2882912400 2882918972 190
107 iso_pu_bacteria 2885305155 2885308016 190
108 iso_pu_bacteria 2885312484 2885313065 190
109 iso_pu_bacteria 2885318864 2885319265 190
110 iso_pu_bacteria 2885326080 2885327811 190
111 iso_pu_bacteria 2885334103 2885341549 190
112 iso_pu_bacteria 2885342637 2885347389 190
113 iso_pu_bacteria 2885350715 2885351196 190
114 iso_pu_bacteria 2888337043 2888338103 190
115 iso_pu_bacteria 2888343758 2888345449 190
116 iso_pu_bacteria 2888350351 2888354753 190
117 iso_pu_bacteria 2889010040 2889016370 190
118 iso_pu_bacteria 2889016732 2889018606 190
119 iso_pu_bacteria 2903448605 2903449587 190
120 iso_pu_bacteria 2903492973 2903501219 190
121 iso_pu_bacteria 2903513507 2903514004 190
122 iso_pu_bacteria 2903521522 2903522313 190
123 iso_pu_bacteria 2903528002 2903528692 190
124 iso_pu_bacteria 2903540706 2903541275 190
125 iso_pu_bacteria 2906354277 2906362778 190
126 iso_pu_bacteria 2906363423 2906366500 190
127 iso_pu_bacteria 2906370794 2906373522 190
128 iso_pu_bacteria 2906378014 2906383072 190
129 iso_pu_bacteria 2906386501 2906392719 190
130 iso_pu_bacteria 2906393657 2906398479 190
131 iso_pu_bacteria 2906401398 2906403466 190
132 iso_pu_bacteria 2906408224 2906409098 190
133 iso_pu_bacteria 2906427513 2906430125 190
134 iso_pu_bacteria 2922130491 2922133104 190
135 iso_pu_bacteria 2922151315 2922156554 190
136 iso_pu_bacteria 2922172374 2922173737 190
137 iso_pu_bacteria 2922178524 2922185189 190
138 iso_pu_bacteria 2922185730 2922185864 190
139 iso_pu_bacteria 2924710171 2924716306 190
140 iso_pu_bacteria 2924718760 2924725239 190
141 iso_pu_bacteria 2924733363 2924737391 190
142 iso_pu_bacteria 2924741084 2924742457 190
143 iso_pu_bacteria 2924748358 2924749626 190
144 iso_pu_bacteria 2924754689 2924756950 190
145 iso_pu_bacteria 2924762789 2924765263 190
146 iso_pu_bacteria 2924776078 2924782768 190
147 iso_pu_bacteria 2924784321 2924786786 190
148 iso_pu_bacteria 2937822353 2937822478 190
149 iso_pu_bacteria 2937836603 2937840235 190
150 iso_pu_bacteria 2937848649 2937852244 190
151 iso_pu_bacteria 2937861824 2937862634 190
152 iso_pu_bacteria 2937868953 2937874051 190
153 iso_pu_bacteria 2937877337 2937881503 190
154 iso_pu_bacteria 2937972304 2937977500 190
155 iso_pu_bacteria 2937994558 2937995131 190
156 iso_pu_bacteria 2938014810 2938018809 190
157 iso_pu_bacteria 2958034702 2958039206 190
158 iso_pu_bacteria 2958041894 2958053164 190
159 iso_pu_bacteria 2958064165 2958070411 190
160 iso_pu_bacteria 2958071322 2958071444 190
161 iso_pu_bacteria 2958084443 2958087940 190
162 iso_pu_bacteria 2958092219 2958100779 190
163 iso_pu_bacteria 2958100919 2958103727 190
164 iso_pu_bacteria 2958108152 2958109095 190
165 iso_pu_bacteria 2958122699 2958129482 190
166 iso_pu_bacteria 2958137437 2958141443 190
167 iso_pu_bacteria 2958144490 2958151913 190
168 iso_pu_bacteria 2958158011 2958161810 190
169 iso_pu_bacteria 2958165035 2958165604 190
170 iso_pu_bacteria 2958172287 2958178707 190
171 iso_pu_bacteria 2961127735 2961127977 190
172 iso_pu_bacteria 2961136820 2961138455 190
173 iso_pu_bacteria 2961163497 2961164063 190
174 iso_pu_bacteria 2961183825 2961190214 190
175 iso_pu_bacteria 2963644680 2963646407 190
176 iso_pu_bacteria 2965018300 2965018871 190
177 iso_pu_bacteria 2965025482 2965027097 190
178 iso_pu_bacteria 2965032056 2965035218 190
179 iso_pu_bacteria 2965040258 2965042451 190
180 iso_pu_bacteria 2965089291 2965095712 190
181 iso_pu_bacteria 2965102966 2965105097 190
182 iso_pu_bacteria 2965110997 2965112755 190
183 iso_pu_bacteria 2965119406 2965123403 190
184 iso_pu_bacteria 2967996073 2967999816 190
185 iso_pu_bacteria 2968003550 2968008175 190
186 iso_pu_bacteria 2968016561 2968020532 190
187 iso_pu_bacteria 2968083720 2968087067 190
188 iso_pu_bacteria 2968117919 2968119041 190
189 iso_pu_bacteria 2968138860 2968144058 190
190 iso_pu_bacteria 2968171901 2968172466 190
191 iso_pu_bacteria 2970469710 2970473829 190
192 iso_pu_bacteria 2970489779 2970492776 190
193 iso_pu_bacteria 2970503327 2970507770 190
194 iso_pu_bacteria 2970510686 2970516569 190
195 iso_pu_bacteria 2970524798 2970527162 190
196 iso_pu_bacteria 2970540015 2970544020 190
197 iso_pu_bacteria 2970547951 2970551191 190
198 iso_pu_bacteria 2970554993 2970555562 190
199 iso_pu_bacteria 2970593180 2970597033 190
200 iso_pu_bacteria 2970619444 2970621877 190
201 iso_pu_bacteria 2970627176 2970630651 190
202 iso_pu_bacteria 2977821940 2977826648 190
203 iso_pu_bacteria 2977828996 2977836757 190
204 iso_pu_bacteria 2977851361 2977857922 190
205 iso_pu_bacteria 2977864932 2977870164 190
206 iso_pu_bacteria 2977872689 2977872836 190
207 iso_pu_bacteria 2977898635 2977906316 190
208 iso_pu_bacteria 2977907340 2977910919 190
209 iso_pu_bacteria 2977915119 2977919410 190
210 iso_pu_bacteria 2977922695 2977926504 190
211 iso_pu_bacteria 2977935797 2977937815 190
212 iso_pu_bacteria 2977942078 2977945155 190
213 iso_pu_bacteria 2977950692 2977956903 190
214 iso_pu_bacteria 2977957713 2977960394 190
215 iso_pu_bacteria 2977986579 2977990616 190
216 iso_pu_bacteria 2979710463 2979710958 190
217 iso_pu_bacteria 2979742915 2979745690 190
218 iso_pu_bacteria 2979764755 2979766440 190
219 iso_pu_bacteria 2979772303 2979776979 190
220 iso_pu_bacteria 2979793036 2979800607 190
221 iso_pu_bacteria 2979808191 2979812954 190
222 iso_pu_bacteria 2987636660 2987639382 190
223 iso_pu_bacteria 2987645492 2987651352 190
224 iso_pu_bacteria 2987652177 2987658335 190
225 iso_pu_bacteria 2987659509 2987660071 190
226 iso_pu_bacteria 2987666974 2987669623 190
227 iso_pu_bacteria 2987673487 2987673574 190
228 iso_pu_bacteria 2996336353 2996336471 190
229 iso_pu_bacteria 2996348954 2996352850 190
230 iso_pu_bacteria 2996386984 2996387240 190
231 iso_pu_bacteria 3000135777 3000139382 190
232 iso_pu_bacteria 3004167301 3004167424 190
233 iso_pu_bacteria 3004188549 3004189119 190
234 iso_pu_bacteria 3004195979 3004199008 190
235 iso_pu_bacteria 3004203850 3004204374 190
236 iso_pu_bacteria 3004211236 3004217843 190
237 iso_pu_bacteria 3004218560 3004221109 190
238 iso_pu_bacteria 3004232784 3004232888 190
239 iso_pu_bacteria 3004239961 3004247879 190
240 iso_pu_bacteria 3004248173 3004254580 190
241 iso_pu_bacteria 3004268573 3004274137 190
242 iso_pu_bacteria 3004275668 3004279532 190
243 iso_pu_bacteria 3004289098 3004290794 190
244 iso_pu_bacteria 3004334049 3004335987 190
245 iso_pu_bacteria 637000159 637075882 190
246 iso_pu_bacteria 649633066 649871582 190
247 iso_pu_bacteria 8004300914 8004302228 190
248 iso_pu_bacteria 8004312739 8004315381 190
249 iso_pu_bacteria 8004361976 8004365342 190
250 iso_pu_bacteria 8004374579 8004379064 190
251 iso_pu_bacteria 8004633249 8004637455 190
252 iso_pu_bacteria 8004695233 8004697468 190
253 iso_pu_bacteria 8004727605 8004730212 190
254 iso_pu_bacteria 8055617313 8055619245 190
255 3300003323 rootH1_10020692 rootH1_100206928 191
256 3300005327 Ga0070658_10003464 Ga0070658_100034647 191
257 3300005327 Ga0070658_10300021 Ga0070658_103000212 191
258 3300005336 Ga0070680_100025492 Ga0070680_1000254921 191
259 3300005341 Ga0070691_10001404 Ga0070691_100014046 191
260 3300005366 Ga0070659_100563058 Ga0070659_1005630581 191
261 3300005455 Ga0070663_100381597 Ga0070663_1003815972 191
262 3300005518 Ga0070699_100487009 Ga0070699_1004870091 191
263 3300005530 Ga0070679_100094930 Ga0070679_1000949302 191
264 3300005543 Ga0070672_100791249 Ga0070672_1007912492 191
265 3300005563 Ga0068855_100031023 Ga0068855_1000310233 191
266 3300005617 Ga0068859_100631076 Ga0068859_1006310762 191
267 3300006038 Ga0075365_10056224 Ga0075365_100562243 191
268 3300006042 Ga0075368_10056697 Ga0075368_100566973 191
269 3300006177 Ga0075362_10058515 Ga0075362_100585152 191
270 3300006177 Ga0075362_10095718 Ga0075362_100957181 191
271 3300006177 Ga0075362_10315075 Ga0075362_103150751 191
272 3300006178 Ga0075367_10445586 Ga0075367_104455861 191
273 3300006186 Ga0075369_10193123 Ga0075369_101931232 191
274 3300006931 Ga0097620_100631081 Ga0097620_1006310812 191
275 3300009093 Ga0105240_10007628 Ga0105240_1000762810 191
276 3300009551 Ga0105238_10427365 Ga0105238_104273653 191
277 3300021384 Ga0213876_10193059 Ga0213876_101930592 191
278 3300025909 Ga0207705_10119510 Ga0207705_101195101 191
279 3300025912 Ga0207707_10005836 Ga0207707_100058362 191
280 3300025917 Ga0207660_10371041 Ga0207660_103710413 191
281 3300025921 Ga0207652_10033644 Ga0207652_100336443 191
282 3300025949 Ga0207667_10351063 Ga0207667_103510633 191
283 3300026067 Ga0207678_10417068 Ga0207678_104170682 191
284 3300026118 Ga0207675_100693675 Ga0207675_1006936752 191
285 3300027866 Ga0209813_10099727 Ga0209813_100997272 191
286 3300028573 Ga0265334_10009214 Ga0265334_100092143 191
287 3300031235 Ga0265330_10051719 Ga0265330_100517193 191
288 3300031238 Ga0265332_10120577 Ga0265332_101205772 191
289 3300031241 Ga0265325_10015163 Ga0265325_100151632 191
290 3300031241 Ga0265325_10048025 Ga0265325_100480253 191
291 3300031247 Ga0265340_10043626 Ga0265340_100436263 191
292 3300031247 Ga0265340_10068721 Ga0265340_100687212 191
293 3300031249 Ga0265339_10127026 Ga0265339_101270262 191
294 3300031249 Ga0265339_10131062 Ga0265339_101310622 191
295 3300031250 Ga0265331_10029735 Ga0265331_100297351 191
296 3300031251 Ga0265327_10000070 Ga0265327_1000007049 191
297 3300031344 Ga0265316_10325327 Ga0265316_103253272 191
298 3300031456 Ga0307513_10783999 Ga0307513_107839991 191
299 3300031595 Ga0265313_10000004 Ga0265313_10000004147 191
300 3300031595 Ga0265313_10033316 Ga0265313_100333164 191
301 3300031595 Ga0265313_10036836 Ga0265313_100368363 191
302 3300031595 Ga0265313_10109635 Ga0265313_101096352 191
303 3300031711 Ga0265314_10127667 Ga0265314_101276672 191
304 3300031712 Ga0265342_10041348 Ga0265342_100413483 191
305 3300031712 Ga0265342_10103090 Ga0265342_101030903 191
306 3300031712 Ga0265342_10113886 Ga0265342_101138863 191
307 3300035170 Ga0373943_0269064 Ga0373943_0269064_118_729 191
308 3300035725 Ga0373947_0046584 Ga0373947_0046584_1478_2089 191
309 3300037853 Ga0436364_1431099 Ga0436364_1431099_2822_3475 191
310 3300038443 Ga0395901_0285229 Ga0395901_0285229_65_679 191
311 3300039437 Ga0436365_0249297 Ga0436365_0249297_1218_1871 191
312 3300042876 Ga0451577_0090571 Ga0451577_0090571_1816_2427 191
313 3300044673 Ga0453683_0042228 Ga0453683_0042228_463_1074 191
314 3300044712 Ga0453684_0246399 Ga0453684_0246399_1318_1929 191
315 3300044842 Ga0466957_0143220 Ga0466957_0143220_827_1438 191
316 3300045051 Ga0451576_1153558 Ga0451576_1153558_105_716 191
317 3300047472 Ga0495686_0000134 Ga0495686_0000134_61138_61752 191
318 3300048929 Ga0496126_0054032 Ga0496126_0054032_1097_1708 191
319 3300049568 Ga0501031_0229433 Ga0501031_0229433_353_964 191
320 3300049571 Ga0501034_0014538 Ga0501034_0014538_392_1003 191
321 3300049571 Ga0501034_0979653 Ga0501034_0979653_46_657 191
322 3300049573 Ga0501037_0581950 Ga0501037_0581950_107_718 191
323 3300049574 Ga0501038_0078757 Ga0501038_0078757_1501_2112 191
324 3300049575 Ga0501039_0179429 Ga0501039_0179429_740_1441 191
325 3300049579 Ga0501043_0078845 Ga0501043_0078845_505_1116 191
326 3300049579 Ga0501043_0329581 Ga0501043_0329581_101_712 191
327 3300049581 Ga0501047_0038432 Ga0501047_0038432_2180_2794 191
328 3300049581 Ga0501047_0225421 Ga0501047_0225421_161_772 191
329 3300049581 Ga0501047_0657982 Ga0501047_0657982_46_660 191
330 3300049583 Ga0501067_0001320 Ga0501067_0001320_532_1143 191
331 3300049583 Ga0501067_0009788 Ga0501067_0009788_417_1028 191
332 3300049583 Ga0501067_0247253 Ga0501067_0247253_286_897 191
333 3300049584 Ga0501068_0397772 Ga0501068_0397772_210_821 191
334 3300049585 Ga0501069_0044113 Ga0501069_0044113_1832_2455 191
335 3300049585 Ga0501069_0257669 Ga0501069_0257669_200_811 191
336 3300049586 Ga0501070_0245995 Ga0501070_0245995_374_985 191
337 3300049588 Ga0501072_0574267 Ga0501072_0574267_34_645 191
338 3300049589 Ga0501073_0028749 Ga0501073_0028749_268_969 191
339 3300049589 Ga0501073_0069005 Ga0501073_0069005_1327_1938 191
340 3300049590 Ga0501074_0088081 Ga0501074_0088081_1530_2141 191
341 3300049742 Ga0501080_0060900 Ga0501080_0060900_1867_2478 191
342 3300049742 Ga0501080_0118406 Ga0501080_0118406_1402_2013 191
343 3300049744 Ga0501083_0000235 Ga0501083_0000235_28232_28843 191
344 3300049744 Ga0501083_0122242 Ga0501083_0122242_415_1026 191
345 3300049823 Ga0501044_0124367 Ga0501044_0124367_1557_2168 191
346 3300050489 nmdc:mga03683_185333_c1 nmdc:mga03683_185333_c1_240_851 191
347 3300050489 nmdc:mga03683_2822_c1 nmdc:mga03683_2822_c1_1151_1762 191
348 3300050491 nmdc:mga00v17_299473_c1 nmdc:mga00v17_299473_c1_132_743 191
349 3300050492 nmdc:mga0yw44_363204_c1 nmdc:mga0yw44_363204_c1_288_899 191
350 3300050516 nmdc:mga0sz30_32382_c1 nmdc:mga0sz30_32382_c1_167_778 191
351 3300053088 Ga0500644_0034639 Ga0500644_0034639_82_693 191
352 3300053092 Ga0500583_0149864 Ga0500583_0149864_73_684 191
353 3300053093 Ga0500651_0186221 Ga0500651_0186221_131_742 191
354 3300053153 Ga0500616_0003337 Ga0500616_0003337_6752_7378 191
355 3300053733 Ga0500552_002516 Ga0500552_002516_839_1450 191
356 3300054114 Ga0501084_0043399 Ga0501084_0043399_2705_3316 191
357 3300054114 Ga0501084_0269146 Ga0501084_0269146_687_1298 191
358 3300054114 Ga0501084_0411714 Ga0501084_0411714_149_760 191
359 3300060353 Ga0501082_0146904 Ga0501082_0146904_645_1256 191
360 3300060353 Ga0501082_0239219 Ga0501082_0239219_838_1449 191
361 iso_pu_bacteria 2643221564 2643840154 191
362 iso_pu_bacteria 2693429783 2694630287 191
363 iso_pu_bacteria 2856364286 2856366915 191
364 iso_pu_bacteria 2869285874 2869287673 191
365 iso_pu_bacteria 2871429161 2871435621 191
366 iso_pu_bacteria 2874146452 2874151304 191
367 iso_pu_bacteria 2874155637 2874158938 191
368 iso_pu_bacteria 2876413966 2876417357 191
369 iso_pu_bacteria 2878745973 2878749184 191
370 iso_pu_bacteria 2878753008 2878757490 191
371 iso_pu_bacteria 2881845957 2881848372 191
372 iso_pu_bacteria 2903492973 2903498648 191
373 iso_pu_bacteria 2906308376 2906310222 191
374 iso_pu_bacteria 2906321335 2906324287 191
375 iso_pu_bacteria 2937813078 2937817046 191
376 iso_pu_bacteria 2958041894 2958049366 191
377 iso_pu_bacteria 2958130278 2958132075 191
378 iso_pu_bacteria 2958179912 2958181889 191
379 iso_pu_bacteria 2961077736 2961079733 191
380 iso_pu_bacteria 2961170736 2961175182 191
381 iso_pu_bacteria 2977843712 2977847337 191
382 iso_pu_bacteria 8004387939 8004389458 191
383 iso_pu_bacteria 8004640170 8004643342 191
384 iso_pu_bacteria 8004714634 8004717856 191
385 3300005327 Ga0070658_10073478 Ga0070658_100734781 192
386 3300005339 Ga0070660_100097417 Ga0070660_1000974171 192
387 3300005435 Ga0070714_100011222 Ga0070714_1000112226 192
388 3300005435 Ga0070714_100021373 Ga0070714_1000213735 192
389 3300005435 Ga0070714_100105952 Ga0070714_1001059522 192
390 3300005436 Ga0070713_100015441 Ga0070713_1000154416 192
391 3300005439 Ga0070711_100016334 Ga0070711_1000163344 192
392 3300005539 Ga0068853_100163930 Ga0068853_1001639303 192
393 3300005563 Ga0068855_100979296 Ga0068855_1009792961 192
394 3300005614 Ga0068856_100157583 Ga0068856_1001575833 192
395 3300005983 Ga0081540_1001159 Ga0081540_10011594 192
396 3300006175 Ga0070712_100102626 Ga0070712_1001026263 192
397 3300009176 Ga0105242_10359047 Ga0105242_103590472 192
398 3300010375 Ga0105239_10476700 Ga0105239_104767002 192
399 3300013100 Ga0157373_10518186 Ga0157373_105181861 192
400 3300013296 Ga0157374_10648459 Ga0157374_106484592 192
401 3300014325 Ga0163163_10059183 Ga0163163_100591835 192
402 3300014326 Ga0157380_10006688 Ga0157380_100066885 192
403 3300014497 Ga0182008_10156763 Ga0182008_101567632 192
404 3300014497 Ga0182008_10176785 Ga0182008_101767852 192
405 3300014968 Ga0157379_10521239 Ga0157379_105212392 192
406 3300014969 Ga0157376_10001430 Ga0157376_1000143010 192
407 3300015261 Ga0182006_1037866 Ga0182006_10378662 192
408 3300015265 Ga0182005_1011656 Ga0182005_10116563 192
409 3300021361 Ga0213872_10255936 Ga0213872_102559361 192
410 3300021384 Ga0213876_10004936 Ga0213876_1000493610 192
411 3300021388 Ga0213875_10002299 Ga0213875_100022997 192
412 3300021388 Ga0213875_10073021 Ga0213875_100730213 192
413 3300021441 Ga0213871_10093114 Ga0213871_100931141 192
414 3300025294 Ga0209025_1055391 Ga0209025_10553912 192
415 3300025909 Ga0207705_10111723 Ga0207705_101117232 192
416 3300025915 Ga0207693_10089615 Ga0207693_100896152 192
417 3300025916 Ga0207663_10011790 Ga0207663_100117904 192
418 3300025921 Ga0207652_10040007 Ga0207652_100400074 192
419 3300025928 Ga0207700_10034319 Ga0207700_100343194 192
420 3300025929 Ga0207664_10022275 Ga0207664_100222753 192
421 3300025929 Ga0207664_10048471 Ga0207664_100484714 192
422 3300025934 Ga0207686_10304441 Ga0207686_103044412 192
423 3300025949 Ga0207667_10287804 Ga0207667_102878042 192
424 3300026078 Ga0207702_10127366 Ga0207702_101273663 192
425 3300028379 Ga0268266_10034154 Ga0268266_100341545 192
426 3300031235 Ga0265330_10192679 Ga0265330_101926791 192
427 3300031238 Ga0265332_10236964 Ga0265332_102369641 192
428 3300031239 Ga0265328_10000183 Ga0265328_1000018333 192
429 3300031241 Ga0265325_10022512 Ga0265325_100225124 192
430 3300031241 Ga0265325_10065023 Ga0265325_100650232 192
431 3300031247 Ga0265340_10000575 Ga0265340_1000057517 192
432 3300031247 Ga0265340_10021893 Ga0265340_100218934 192
433 3300031247 Ga0265340_10064561 Ga0265340_100645611 192
434 3300031249 Ga0265339_10000788 Ga0265339_1000078814 192
435 3300031250 Ga0265331_10003205 Ga0265331_100032051 192
436 3300031250 Ga0265331_10055239 Ga0265331_100552393 192
437 3300031251 Ga0265327_10012708 Ga0265327_100127082 192
438 3300031251 Ga0265327_10071509 Ga0265327_100715092 192
439 3300031344 Ga0265316_10004940 Ga0265316_1000494010 192
440 3300031344 Ga0265316_10307218 Ga0265316_103072182 192
441 3300031595 Ga0265313_10001970 Ga0265313_1000197013 192
442 3300031595 Ga0265313_10115674 Ga0265313_101156741 192
443 3300031665 Ga0316575_10027535 Ga0316575_100275353 192
444 3300031691 Ga0316579_10163637 Ga0316579_101636372 192
445 3300031711 Ga0265314_10044136 Ga0265314_100441363 192
446 3300031712 Ga0265342_10040548 Ga0265342_100405481 192
447 3300031730 Ga0307516_10000030 Ga0307516_1000003023 192
448 3300031901 Ga0307406_10277063 Ga0307406_102770632 192
449 3300032133 Ga0316583_10122777 Ga0316583_101227771 192
450 3300033180 Ga0307510_10141629 Ga0307510_101416291 192
451 3300035111 Ga0373923_0077558 Ga0373923_0077558_377_1030 192
452 3300035111 Ga0373923_0105915 Ga0373923_0105915_486_1139 192
453 3300035115 Ga0373941_0198298 Ga0373941_0198298_12_626 192
454 3300035117 Ga0373953_0051258 Ga0373953_0051258_203_856 192
455 3300035170 Ga0373943_0130253 Ga0373943_0130253_77_730 192
456 3300035695 Ga0373927_0040176 Ga0373927_0040176_318_971 192
457 3300035724 Ga0373933_0006885 Ga0373933_0006885_3540_4193 192
458 3300035724 Ga0373933_0029810 Ga0373933_0029810_237_890 192
459 3300036401 Ga0373937_0004353 Ga0373937_0004353_5506_6159 192
460 3300036401 Ga0373937_0019732 Ga0373937_0019732_3138_3791 192
461 3300036401 Ga0373937_0030563 Ga0373937_0030563_546_1199 192
462 3300036401 Ga0373937_0095788 Ga0373937_0095788_523_1176 192
463 3300036647 Ga0316582_0387278 Ga0316582_0387278_244_906 192
464 3300036712 Ga0316584_0005127 Ga0316584_0005127_6872_7534 192
465 3300037068 Ga0373925_0054797 Ga0373925_0054797_1791_2444 192
466 3300037068 Ga0373925_0102420 Ga0373925_0102420_196_849 192
467 3300037068 Ga0373925_0688931 Ga0373925_0688931_153_806 192
468 3300037418 Ga0395900_0097510 Ga0395900_0097510_817_1431 192
469 3300037466 Ga0395898_0094496 Ga0395898_0094496_2211_2825 192
470 3300037853 Ga0436364_0420938 Ga0436364_0420938_344_997 192
471 3300037853 Ga0436364_0546627 Ga0436364_0546627_63_722 192
472 3300037853 Ga0436364_0834964 Ga0436364_0834964_7686_8342 192
473 3300038443 Ga0395901_0145772 Ga0395901_0145772_490_1104 192
474 3300039437 Ga0436365_1624935 Ga0436365_1624935_1277_1933 192
475 3300039437 Ga0436365_1691170 Ga0436365_1691170_12474_13088 192
476 3300039438 Ga0436360_0397922 Ga0436360_0397922_1630_2283 192
477 3300039438 Ga0436360_0930277 Ga0436360_0930277_467_1123 192
478 3300039447 Ga0436361_0219390 Ga0436361_0219390_4463_5116 192
479 3300039447 Ga0436361_0917993 Ga0436361_0917993_2689_3309 192
480 3300039450 Ga0436363_0789771 Ga0436363_0789771_141_797 192
481 3300039453 Ga0436362_0312797 Ga0436362_0312797_2933_3589 192
482 3300045051 Ga0451576_0100030 Ga0451576_0100030_1431_2045 192
483 3300045976 Ga0466967_0227611 Ga0466967_0227611_187_804 192
484 3300046462 Ga0495651_0459720 Ga0495651_0459720_86_739 192
485 3300046477 Ga0495664_0002764 Ga0495664_0002764_3370_4023 192
486 3300046491 Ga0495584_0140576 Ga0495584_0140576_484_1101 192
487 3300046511 Ga0495608_0016666 Ga0495608_0016666_4025_4678 192
488 3300046516 Ga0495628_0155315 Ga0495628_0155315_261_914 192
489 3300046529 Ga0495652_0248572 Ga0495652_0248572_469_1122 192
490 3300046536 Ga0495587_0014361 Ga0495587_0014361_1353_2006 192
491 3300046559 Ga0495667_0142314 Ga0495667_0142314_104_757 192
492 3300046675 Ga0495657_0045248 Ga0495657_0045248_126_779 192
493 3300046675 Ga0495657_0145600 Ga0495657_0145600_182_835 192
494 3300046679 Ga0495623_0122240 Ga0495623_0122240_701_1354 192
495 3300046689 Ga0495613_0549764 Ga0495613_0549764_34_687 192
496 3300047319 Ga0495674_0020122 Ga0495674_0020122_1805_2458 192
497 3300047320 Ga0495672_0191604 Ga0495672_0191604_282_896 192
498 3300047322 Ga0495680_0086848 Ga0495680_0086848_1001_1654 192
499 3300047322 Ga0495680_0162769 Ga0495680_0162769_757_1410 192
500 3300047444 Ga0495675_0054343 Ga0495675_0054343_567_1220 192
501 3300047471 Ga0495684_0533181 Ga0495684_0533181_117_770 192
502 3300048088 Ga0495602_0004731 Ga0495602_0004731_3077_3730 192
503 3300048903 Ga0496100_0059937 Ga0496100_0059937_620_1234 192
504 3300048907 Ga0496104_0068515 Ga0496104_0068515_136_753 192
505 3300048913 Ga0496110_0457545 Ga0496110_0457545_528_1142 192
506 3300048915 Ga0496112_0177133 Ga0496112_0177133_1415_2068 192
507 3300048929 Ga0496126_0179274 Ga0496126_0179274_292_906 192
508 3300048929 Ga0496126_0512780 Ga0496126_0512780_233_847 192
509 3300049569 Ga0501032_0023883 Ga0501032_0023883_1042_1659 192
510 3300049570 Ga0501033_0408083 Ga0501033_0408083_242_856 192
511 3300049571 Ga0501034_0002736 Ga0501034_0002736_10629_11246 192
512 3300049571 Ga0501034_0186986 Ga0501034_0186986_989_1705 192
513 3300049571 Ga0501034_0562489 Ga0501034_0562489_199_816 192
514 3300049573 Ga0501037_0020807 Ga0501037_0020807_3741_4397 192
515 3300049573 Ga0501037_0065473 Ga0501037_0065473_413_1027 192
516 3300049574 Ga0501038_0039916 Ga0501038_0039916_701_1315 192
517 3300049579 Ga0501043_0189208 Ga0501043_0189208_216_932 192
518 3300049580 Ga0501046_0352819 Ga0501046_0352819_268_921 192
519 3300049580 Ga0501046_0575739 Ga0501046_0575739_39_653 192
520 3300049581 Ga0501047_0031988 Ga0501047_0031988_33_647 192
521 3300049581 Ga0501047_0036547 Ga0501047_0036547_2255_2971 192
522 3300049581 Ga0501047_0173380 Ga0501047_0173380_456_1112 192
523 3300049581 Ga0501047_0417668 Ga0501047_0417668_385_1038 192
524 3300049582 Ga0501048_0378083 Ga0501048_0378083_140_754 192
525 3300049583 Ga0501067_0181600 Ga0501067_0181600_404_1018 192
526 3300049583 Ga0501067_0186971 Ga0501067_0186971_520_1134 192
527 3300049586 Ga0501070_0593943 Ga0501070_0593943_243_857 192
528 3300049589 Ga0501073_0128882 Ga0501073_0128882_1117_1731 192
529 3300049822 Ga0501035_0104265 Ga0501035_0104265_350_1006 192
530 3300049823 Ga0501044_0011168 Ga0501044_0011168_331_945 192
531 3300053077 Ga0495601_0041469 Ga0495601_0041469_1013_1666 192
532 3300053077 Ga0495601_0549975 Ga0495601_0549975_66_719 192
533 3300053078 Ga0495612_0000290 Ga0495612_0000290_18645_19298 192
534 3300053084 Ga0495595_0029895 Ga0495595_0029895_1127_1780 192
535 3300053084 Ga0495595_0165647 Ga0495595_0165647_83_736 192
536 3300053085 Ga0495619_0031108 Ga0495619_0031108_2764_3417 192
537 3300053085 Ga0495619_0045966 Ga0495619_0045966_1949_2602 192
538 3300053098 Ga0500650_0148469 Ga0500650_0148469_332_946 192
539 3300053117 Ga0500593_000183 Ga0500593_000183_23257_23871 192
540 3300053139 Ga0500568_0000002 Ga0500568_0000002_815957_816571 192
541 3300053177 Ga0500636_0125725 Ga0500636_0125725_230_844 192
542 3300060353 Ga0501082_0002950 Ga0501082_0002950_12661_13275 192
543 iso_pu_bacteria 2643221550 2643769969 192
544 3300005336 Ga0070680_100077710 Ga0070680_1000777102 193
545 3300005339 Ga0070660_100126282 Ga0070660_1001262822 193
546 3300005458 Ga0070681_10033498 Ga0070681_100334983 193
547 3300005530 Ga0070679_100067069 Ga0070679_1000670692 193
548 3300005539 Ga0068853_100559500 Ga0068853_1005595002 193
549 3300005548 Ga0070665_100016431 Ga0070665_1000164315 193
550 3300005985 Ga0081539_10001022 Ga0081539_1000102210 193
551 3300006028 Ga0070717_10346160 Ga0070717_103461602 193
552 3300009093 Ga0105240_10551499 Ga0105240_105514992 193
553 3300009093 Ga0105240_10674437 Ga0105240_106744372 193
554 3300009551 Ga0105238_10126589 Ga0105238_101265895 193
555 3300010375 Ga0105239_10099033 Ga0105239_100990336 193
556 3300013100 Ga0157373_10589507 Ga0157373_105895071 193
557 3300014497 Ga0182008_10069715 Ga0182008_100697153 193
558 3300025904 Ga0207647_10042332 Ga0207647_100423322 193
559 3300025912 Ga0207707_10023528 Ga0207707_100235282 193
560 3300025919 Ga0207657_10081611 Ga0207657_100816113 193
561 3300025924 Ga0207694_10184419 Ga0207694_101844192 193
562 3300026041 Ga0207639_10503046 Ga0207639_105030461 193
563 3300026067 Ga0207678_10014969 Ga0207678_100149693 193
564 3300028379 Ga0268266_10182704 Ga0268266_101827041 193
565 3300035398 Ga0316574_0318993 Ga0316574_0318993_300_917 193
566 3300037418 Ga0395900_0128830 Ga0395900_0128830_1726_2346 193
567 3300037466 Ga0395898_0023354 Ga0395898_0023354_1706_2326 193
568 3300037853 Ga0436364_0313282 Ga0436364_0313282_85_702 193
569 3300038443 Ga0395901_0105520 Ga0395901_0105520_930_1550 193
570 3300038443 Ga0395901_0143173 Ga0395901_0143173_159_782 193
571 3300038443 Ga0395901_0452472 Ga0395901_0452472_95_712 193
572 3300039437 Ga0436365_0097041 Ga0436365_0097041_51_680 193
573 3300047472 Ga0495686_0029749 Ga0495686_0029749_2072_2689 193
574 3300048904 Ga0496101_0368355 Ga0496101_0368355_353_1006 193
575 3300048907 Ga0496104_0006145 Ga0496104_0006145_7053_7706 193
576 3300048909 Ga0496106_0516315 Ga0496106_0516315_226_879 193
577 3300048913 Ga0496110_0340712 Ga0496110_0340712_102_755 193
578 3300048915 Ga0496112_0005948 Ga0496112_0005948_1331_1951 193
579 3300048918 Ga0496115_0026066 Ga0496115_0026066_147_800 193
580 3300049568 Ga0501031_0002511 Ga0501031_0002511_314_931 193
581 3300049568 Ga0501031_0176874 Ga0501031_0176874_456_1073 193
582 3300049569 Ga0501032_0000001 Ga0501032_0000001_362374_362991 193
583 3300049569 Ga0501032_0023599 Ga0501032_0023599_1500_2117 193
584 3300049569 Ga0501032_0158289 Ga0501032_0158289_807_1424 193
585 3300049570 Ga0501033_0000092 Ga0501033_0000092_21770_22387 193
586 3300049570 Ga0501033_0004609 Ga0501033_0004609_4842_5459 193
587 3300049570 Ga0501033_0031426 Ga0501033_0031426_2095_2712 193
588 3300049571 Ga0501034_0000036 Ga0501034_0000036_58118_58735 193
589 3300049571 Ga0501034_0071950 Ga0501034_0071950_1716_2333 193
590 3300049571 Ga0501034_0082916 Ga0501034_0082916_1461_2078 193
591 3300049571 Ga0501034_0083962 Ga0501034_0083962_2499_3116 193
592 3300049571 Ga0501034_0561630 Ga0501034_0561630_38_655 193
593 3300049572 Ga0501036_0000078 Ga0501036_0000078_1802_2419 193
594 3300049572 Ga0501036_0076427 Ga0501036_0076427_1062_1679 193
595 3300049573 Ga0501037_0000017 Ga0501037_0000017_106565_107182 193
596 3300049573 Ga0501037_0000047 Ga0501037_0000047_77696_78313 193
597 3300049573 Ga0501037_0463426 Ga0501037_0463426_104_721 193
598 3300049574 Ga0501038_0000036 Ga0501038_0000036_81282_81899 193
599 3300049574 Ga0501038_0094343 Ga0501038_0094343_1154_1771 193
600 3300049575 Ga0501039_0000011 Ga0501039_0000011_60567_61184 193
601 3300049578 Ga0501042_0147981 Ga0501042_0147981_51_668 193
602 3300049579 Ga0501043_0000105 Ga0501043_0000105_18323_18940 193
603 3300049579 Ga0501043_0000369 Ga0501043_0000369_12750_13367 193
604 3300049579 Ga0501043_0047536 Ga0501043_0047536_1812_2429 193
605 3300049579 Ga0501043_0101175 Ga0501043_0101175_1163_1780 193
606 3300049579 Ga0501043_0177072 Ga0501043_0177072_444_1061 193
607 3300049580 Ga0501046_0062978 Ga0501046_0062978_1065_1682 193
608 3300049580 Ga0501046_0100118 Ga0501046_0100118_139_756 193
609 3300049581 Ga0501047_0010824 Ga0501047_0010824_7486_8103 193
610 3300049581 Ga0501047_0015525 Ga0501047_0015525_2078_2695 193
611 3300049581 Ga0501047_0072155 Ga0501047_0072155_2479_3096 193
612 3300049581 Ga0501047_0078101 Ga0501047_0078101_406_1023 193
613 3300049581 Ga0501047_0082152 Ga0501047_0082152_1980_2597 193
614 3300049583 Ga0501067_0166742 Ga0501067_0166742_557_1174 193
615 3300049584 Ga0501068_0254661 Ga0501068_0254661_142_759 193
616 3300049585 Ga0501069_0000073 Ga0501069_0000073_5659_6276 193
617 3300049585 Ga0501069_0001305 Ga0501069_0001305_3944_4561 193
618 3300049586 Ga0501070_0000385 Ga0501070_0000385_33971_34588 193
619 3300049586 Ga0501070_0008366 Ga0501070_0008366_4818_5435 193
620 3300049586 Ga0501070_0009729 Ga0501070_0009729_6964_7581 193
621 3300049586 Ga0501070_0094321 Ga0501070_0094321_390_1007 193
622 3300049587 Ga0501071_0131128 Ga0501071_0131128_1102_1719 193
623 3300049587 Ga0501071_0159548 Ga0501071_0159548_204_821 193
624 3300049589 Ga0501073_0236581 Ga0501073_0236581_78_695 193
625 3300049590 Ga0501074_0000390 Ga0501074_0000390_20019_20636 193
626 3300049590 Ga0501074_0015949 Ga0501074_0015949_4377_4994 193
627 3300049590 Ga0501074_0016234 Ga0501074_0016234_2164_2781 193
628 3300049741 Ga0501079_0794851 Ga0501079_0794851_50_667 193
629 3300049742 Ga0501080_0011370 Ga0501080_0011370_1742_2359 193
630 3300049742 Ga0501080_0021998 Ga0501080_0021998_573_1190 193
631 3300049742 Ga0501080_0062492 Ga0501080_0062492_613_1230 193
632 3300049742 Ga0501080_0423021 Ga0501080_0423021_128_745 193
633 3300049744 Ga0501083_0005780 Ga0501083_0005780_5517_6134 193
634 3300049822 Ga0501035_0000025 Ga0501035_0000025_36466_37083 193
635 3300049822 Ga0501035_0000028 Ga0501035_0000028_58244_58861 193
636 3300049822 Ga0501035_0001951 Ga0501035_0001951_18951_19568 193
637 3300049822 Ga0501035_0006605 Ga0501035_0006605_7026_7643 193
638 3300049822 Ga0501035_0019298 Ga0501035_0019298_2038_2655 193
639 3300049822 Ga0501035_0044425 Ga0501035_0044425_2796_3413 193
640 3300049822 Ga0501035_0138377 Ga0501035_0138377_1046_1663 193
641 3300049823 Ga0501044_0000031 Ga0501044_0000031_167107_167724 193
642 3300049823 Ga0501044_0004322 Ga0501044_0004322_12856_13473 193
643 3300049823 Ga0501044_0007776 Ga0501044_0007776_1111_1728 193
644 3300049823 Ga0501044_0065538 Ga0501044_0065538_2146_2763 193
645 3300049823 Ga0501044_0082098 Ga0501044_0082098_221_838 193
646 3300049823 Ga0501044_0140858 Ga0501044_0140858_1623_2240 193
647 3300049823 Ga0501044_0340371 Ga0501044_0340371_10_627 193
648 3300049824 Ga0501045_0238195 Ga0501045_0238195_157_774 193
649 3300053130 Ga0500642_0229131 Ga0500642_0229131_190_822 193
650 3300053158 Ga0500627_0106025 Ga0500627_0106025_148_765 193
651 3300053158 Ga0500627_0121450 Ga0500627_0121450_31_648 193
652 3300053158 Ga0500627_0244259 Ga0500627_0244259_100_717 193
653 3300053727 Ga0500611_112636 Ga0500611_112636_17_634 193
654 3300054114 Ga0501084_0610506 Ga0501084_0610506_294_911 193
655 3300060353 Ga0501082_0150111 Ga0501082_0150111_731_1348 193
656 3300001979 JGI24740J21852_10014860 JGI24740J21852_100148604 194
657 3300001989 JGI24739J22299_10053437 JGI24739J22299_100534372 194
658 3300002067 JGI24735J21928_10054364 JGI24735J21928_100543642 194
659 3300002705 JGI25156J39149_1002078 JGI25156J39149_10020784 194
660 3300002741 JGI25157J39369_1002436 JGI25157J39369_10024365 194
661 3300003214 JGI25165J46597_1000034 JGI25165J46597_1000034140 194
662 3300003762 Ga0055542_1000299 Ga0055542_100029911 194
663 3300003762 Ga0055542_1001140 Ga0055542_10011403 194
664 3300003763 Ga0055529_1002112 Ga0055529_10021125 194
665 3300005327 Ga0070658_10102585 Ga0070658_101025852 194
666 3300005356 Ga0070674_100172869 Ga0070674_1001728691 194
667 3300005539 Ga0068853_100014665 Ga0068853_1000146653 194
668 3300005539 Ga0068853_100211323 Ga0068853_1002113231 194
669 3300005539 Ga0068853_100605580 Ga0068853_1006055802 194
670 3300005548 Ga0070665_100221828 Ga0070665_1002218283 194
671 3300005578 Ga0068854_100154905 Ga0068854_1001549053 194
672 3300005614 Ga0068856_100524487 Ga0068856_1005244872 194
673 3300005616 Ga0068852_100264523 Ga0068852_1002645232 194
674 3300005937 Ga0081455_10274102 Ga0081455_102741021 194
675 3300006038 Ga0075365_10011143 Ga0075365_100111436 194
676 3300006038 Ga0075365_10040336 Ga0075365_100403361 194
677 3300006038 Ga0075365_10521708 Ga0075365_105217081 194
678 3300006048 Ga0075363_100130882 Ga0075363_1001308822 194
679 3300006051 Ga0075364_10022475 Ga0075364_100224752 194
680 3300006051 Ga0075364_10307707 Ga0075364_103077072 194
681 3300006178 Ga0075367_10223102 Ga0075367_102231022 194
682 3300006178 Ga0075367_10226190 Ga0075367_102261902 194
683 3300006353 Ga0075370_10377584 Ga0075370_103775841 194
684 3300006881 Ga0068865_100679356 Ga0068865_1006793562 194
685 3300009093 Ga0105240_10035830 Ga0105240_100358306 194
686 3300009545 Ga0105237_10460789 Ga0105237_104607892 194
687 3300009545 Ga0105237_10728967 Ga0105237_107289671 194
688 3300009551 Ga0105238_10026262 Ga0105238_100262622 194
689 3300009551 Ga0105238_10147811 Ga0105238_101478111 194
690 3300010375 Ga0105239_10377452 Ga0105239_103774522 194
691 3300011119 Ga0105246_10530456 Ga0105246_105304562 194
692 3300013104 Ga0157370_10513709 Ga0157370_105137092 194
693 3300013296 Ga0157374_10200108 Ga0157374_102001082 194
694 3300017792 Ga0163161_10324901 Ga0163161_103249012 194
695 3300025250 Ga0209026_1000100 Ga0209026_100010078 194
696 3300025254 Ga0209148_1000069 Ga0209148_100006994 194
697 3300025254 Ga0209148_1007365 Ga0209148_10073655 194
698 3300025256 Ga0209759_1000438 Ga0209759_100043814 194
699 3300025261 Ga0209233_1000028 Ga0209233_1000028144 194
700 3300025272 Ga0209455_1000135 Ga0209455_100013593 194
701 3300025297 Ga0209758_1006381 Ga0209758_10063813 194
702 3300025904 Ga0207647_10012504 Ga0207647_100125043 194
703 3300025907 Ga0207645_10108736 Ga0207645_101087365 194
704 3300025909 Ga0207705_10032668 Ga0207705_100326681 194
705 3300025914 Ga0207671_10352224 Ga0207671_103522242 194
706 3300025914 Ga0207671_10492362 Ga0207671_104923621 194
707 3300025914 Ga0207671_10527829 Ga0207671_105278292 194
708 3300025920 Ga0207649_10827700 Ga0207649_108277001 194
709 3300025937 Ga0207669_10132765 Ga0207669_101327652 194
710 3300025937 Ga0207669_10606377 Ga0207669_106063772 194
711 3300025981 Ga0207640_10143941 Ga0207640_101439412 194
712 3300025981 Ga0207640_10323186 Ga0207640_103231862 194
713 3300026041 Ga0207639_10104195 Ga0207639_101041952 194
714 3300026041 Ga0207639_10413278 Ga0207639_104132782 194
715 3300026116 Ga0207674_10129991 Ga0207674_101299912 194
716 3300026142 Ga0207698_10359611 Ga0207698_103596112 194
717 3300028379 Ga0268266_10075245 Ga0268266_100752455 194
718 3300028379 Ga0268266_10175352 Ga0268266_101753522 194
719 3300028379 Ga0268266_10702934 Ga0268266_107029342 194
720 3300032004 Ga0307414_10424870 Ga0307414_104248702 194
721 3300032005 Ga0307411_10559823 Ga0307411_105598231 194
722 3300037418 Ga0395900_0089863 Ga0395900_0089863_272_931 194
723 3300037418 Ga0395900_0153414 Ga0395900_0153414_26_649 194
724 3300037466 Ga0395898_0705918 Ga0395898_0705918_67_690 194
725 3300037471 Ga0395905_0121593 Ga0395905_0121593_33_692 194
726 3300037471 Ga0395905_1142804 Ga0395905_1142804_12_632 194
727 3300038443 Ga0395901_0065947 Ga0395901_0065947_2082_2702 194
728 3300038443 Ga0395901_0239139 Ga0395901_0239139_760_1419 194
729 3300042157 Ga0439458_0058653 Ga0439458_0058653_323_946 194
730 3300044658 Ga0466972_0136707 Ga0466972_0136707_134_754 194
731 3300045976 Ga0466967_0586450 Ga0466967_0586450_314_934 194
732 3300046522 Ga0495643_0088111 Ga0495643_0088111_205_861 194
733 3300046616 Ga0495668_0022331 Ga0495668_0022331_1794_2414 194
734 3300048905 Ga0496102_0567832 Ga0496102_0567832_271_930 194
735 3300048908 Ga0496105_0542075 Ga0496105_0542075_207_827 194
736 3300048915 Ga0496112_0185465 Ga0496112_0185465_1028_1687 194
737 3300048922 Ga0496119_0047186 Ga0496119_0047186_1729_2349 194
738 3300048922 Ga0496119_0134926 Ga0496119_0134926_559_1179 194
739 3300048922 Ga0496119_0252331 Ga0496119_0252331_155_775 194
740 3300048923 Ga0496120_0005180 Ga0496120_0005180_4379_4999 194
741 3300048927 Ga0496124_0090338 Ga0496124_0090338_725_1345 194
742 3300048927 Ga0496124_0463140 Ga0496124_0463140_219_839 194
743 3300049569 Ga0501032_0012538 Ga0501032_0012538_1727_2350 194
744 3300049570 Ga0501033_0004805 Ga0501033_0004805_3587_4210 194
745 3300049571 Ga0501034_0026322 Ga0501034_0026322_4379_5002 194
746 3300049572 Ga0501036_0020232 Ga0501036_0020232_4064_4687 194
747 3300049573 Ga0501037_0015409 Ga0501037_0015409_4210_4833 194
748 3300049575 Ga0501039_0015572 Ga0501039_0015572_4063_4686 194
749 3300049576 Ga0501040_0011447 Ga0501040_0011447_3643_4266 194
750 3300049577 Ga0501041_0476458 Ga0501041_0476458_143_766 194
751 3300049579 Ga0501043_0012998 Ga0501043_0012998_4158_4781 194
752 3300049581 Ga0501047_0030528 Ga0501047_0030528_3703_4326 194
753 3300049582 Ga0501048_0005606 Ga0501048_0005606_3323_3946 194
754 3300049583 Ga0501067_0051777 Ga0501067_0051777_1473_2096 194
755 3300049584 Ga0501068_0003141 Ga0501068_0003141_3857_4480 194
756 3300049586 Ga0501070_0024862 Ga0501070_0024862_3938_4561 194
757 3300049586 Ga0501070_0111893 Ga0501070_0111893_1086_1706 194
758 3300049587 Ga0501071_0012434 Ga0501071_0012434_3643_4266 194
759 3300049588 Ga0501072_0429229 Ga0501072_0429229_222_845 194
760 3300049589 Ga0501073_0016266 Ga0501073_0016266_1159_1782 194
761 3300049590 Ga0501074_0009564 Ga0501074_0009564_4056_4679 194
762 3300049592 Ga0501076_0967807 Ga0501076_0967807_17_640 194
763 3300049741 Ga0501079_0511893 Ga0501079_0511893_23_646 194
764 3300049742 Ga0501080_0003536 Ga0501080_0003536_3861_4484 194
765 3300049744 Ga0501083_0032218 Ga0501083_0032218_1459_2082 194
766 3300049822 Ga0501035_0004666 Ga0501035_0004666_3703_4326 194
767 3300049823 Ga0501044_0043873 Ga0501044_0043873_318_941 194
768 3300049824 Ga0501045_0015919 Ga0501045_0015919_4240_4863 194
769 3300050490 nmdc:mga03n38_379259_c1 nmdc:mga03n38_379259_c1_128_748 194
770 3300050491 nmdc:mga00v17_80386_c1 nmdc:mga00v17_80386_c1_1129_1749 194
771 3300050492 nmdc:mga0yw44_277910_c1 nmdc:mga0yw44_277910_c1_170_793 194
772 3300050492 nmdc:mga0yw44_98184_c1 nmdc:mga0yw44_98184_c1_94_771 194
773 3300050494 nmdc:mga06z11_268310_c1 nmdc:mga06z11_268310_c1_239_859 194
774 3300050494 nmdc:mga06z11_78137_c1 nmdc:mga06z11_78137_c1_887_1510 194
775 3300050496 nmdc:mga07m45_307350_c1 nmdc:mga07m45_307350_c1_225_845 194
776 3300053151 Ga0500604_0046695 Ga0500604_0046695_493_1113 194
777 3300053155 Ga0500620_009644 Ga0500620_009644_593_1249 194
778 3300053155 Ga0500620_055802 Ga0500620_055802_26_646 194
779 3300053158 Ga0500627_0117718 Ga0500627_0117718_278_943 194
780 3300053727 Ga0500611_015028 Ga0500611_015028_341_961 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01612

DNA_pol_A_exo1

3'-5' exonuclease

42

203

0.94

PF13482

RNase_H_2

RNase_H superfamily

54

199

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mpm-assembly1.cif.gz_A bartonella henselae nrnc bound to paa 0.9381 1 194
7mpm-assembly1.cif.gz_A bartonella henselae nrnc bound to paa 0.9334 1 194
5zo3-assembly1.cif.gz_A apo form of the nuclease 0.9276 1 194
7mpr-assembly2.cif.gz_B brucella melitensis nrnc 0.9255 5 194
7mpr-assembly1.cif.gz_A brucella melitensis nrnc 0.9249 5 194
ID Description Score Start End Superfamily
af_Q8ILY1_1321_1641_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8994 6 180 3.30.420.10
1yt3A01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8736 19 178 3.30.420.10
4nlbA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8689 17 175 3.30.420.10
af_A0A1D8PDF4_132_438_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8609 6 175 3.30.420.10
af_A0A0P0XUY4_189_409_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8264 6 137 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A2W4QPK4-F1-model_v4 deleted 0.9683 73 194
AF-A0A1F8IDW9-F1-model_v4 deleted 0.967 51 194
AF-A0A504JAC0-F1-model_v4 Ribonuclease D 0.9661 59 194 GO:0003676
GO:0006139
GO:0008408
AF-A0A2V7VEZ5-F1-model_v4 Ribonuclease D 0.9661 49 193 GO:0003676
GO:0006139
GO:0008408
AF-A0A4S0MQ05-F1-model_v4 Ribonuclease D 0.9653 64 164 GO:0003676
GO:0006139
GO:0008408

Feature Viewer

pLDDT pTM Quality
86.3 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map