F480565

General Info

Members Datasets Scaffolds Average Seq Length
781 335 1562 295

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10000165|Ga0307515_10000165100
Length 320
Sequence MGTGKVSRAVSGTVSSSPLSFDDWARAHLDAVESALDAWVPADAPAGLGEAMRYGVLDGGKRLRPLLVMAACEALHGQPQAALRAAVAVELIHAYSLVHDDMPCMDNDVLRRGKPTVHVKYGQAQAMLAGDAMQALAFEVLTPTPGEGPASKLSGGIEPALQARLTSLLARSAGHAGMAGGQAIDLASIGCPLDEAALRDMHRRKTGALLQASVLMGAACGRPDATAWQALADYGAAIGLAFQVVDDILDVTQASATLGKTAGKDIDANKPTYVSVLGLDAARRHAQDLRTQAHAALSRSGLTNAAALSMLADKVVERDS

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
82 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
109 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
170 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
175 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
176 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
177 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
178 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
179 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
180 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
181 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
184 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
185 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
196 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
197 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
198 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
199 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
201 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
202 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
203 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
204 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
214 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
215 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
216 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
217 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
218 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
219 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
220 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
221 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
222 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
223 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
224 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
225 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
226 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
227 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
228 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
229 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
230 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
231 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
232 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
233 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
234 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
235 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
239 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
240 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
241 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
242 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
243 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
244 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
245 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
246 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
247 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
248 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
251 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
252 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
253 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
254 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
255 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
256 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
257 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
258 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
259 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
260 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
261 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
264 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
265 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
266 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
267 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
268 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
269 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
282 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
283 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
284 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
291 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
292 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
293 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
294 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
295 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
296 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
297 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
298 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
299 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
302 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
303 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
304 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
305 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
306 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
307 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
308 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
309 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
310 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
311 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
312 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
313 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
314 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
315 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
316 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
317 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
318 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
319 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
320 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
321 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
322 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
323 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
324 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
325 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
326 2643221609 Acidovorax sp. Root217 Isolate Unclassified
327 2643221611 Acidovorax sp. Root219 Isolate Unclassified
328 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
329 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
330 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
331 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
332 2738543012 Acidovorax sp. CF301 Isolate Unclassified
333 2816332133 Acidovorax radicis 2721A Isolate Unclassified
334 2831864461 Roseateles noduli HZ7 Isolate Nodule
335 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.82
Metatranscriptomes 0.26
Isolates 1.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.24
Nodule 0.64
Rhizoplane 2.82
Rhizosphere 73.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10000165 3300028794 Bacteria 162589
2 JGI25152J39213_1003301 3300002773 Bacteria 5572
3 Ga0006778J45830_1043737 3300003162 Bacteria 2521
4 JGI25153J46596_10032509 3300003215 Bacteria 1739
5 rootH1_10004883 3300003316 Bacteria 3025
6 rootL2_10007939 3300003322 Bacteria 2182
7 rootL2_10010936 3300003322 Bacteria 2397
8 rootH1_10033580 3300003323 Bacteria 2552
9 rootH1_10066579 3300003323 Bacteria 2281
10 Ga0055525_1000031 3300003759 Bacteria 314909
11 Ga0055526_1001897 3300003771 Bacteria 14503
12 Ga0055526_1009578 3300003771 Bacteria 4636
13 Ga0055524_1000125 3300003775 Bacteria 90042
14 Ga0055524_1000584 3300003775 Bacteria 26505
15 Ga0055524_1001070 3300003775 Bacteria 16821
16 Ga0055530_10013159 3300003791 Bacteria 2838
17 Ga0055540_1000011 3300003792 Bacteria 282927
18 Ga0055531_10001237 3300003794 Bacteria 19445
19 Ga0055531_10005816 3300003794 Bacteria 7136
20 Ga0055531_10008368 3300003794 Bacteria 5471
21 Ga0055531_10018465 3300003794 Bacteria 2875
22 Ga0055543_1002628 3300004625 Bacteria 5792
23 Ga0065165_1000153 3300005262 Bacteria 120209
24 Ga0065165_1000967 3300005262 Bacteria 36011
25 Ga0070658_10099611 3300005327 Bacteria 2401
26 Ga0070658_10411882 3300005327 Bacteria 1162
27 Ga0070676_10011630 3300005328 Bacteria 4786
28 Ga0070676_10014267 3300005328 Bacteria 4365
29 Ga0070676_10014455 3300005328 Bacteria 4338
30 Ga0070676_10017068 3300005328 Bacteria 4013
31 Ga0070676_10046116 3300005328 Bacteria 2540
32 Ga0070683_100059780 3300005329 Bacteria 3541
33 Ga0070690_100075990 3300005330 Bacteria 2190
34 Ga0070670_100002757 3300005331 Bacteria 14508
35 Ga0070670_100048474 3300005331 Bacteria 3655
36 Ga0070670_100059093 3300005331 Bacteria 3291
37 Ga0070670_100067542 3300005331 Bacteria 3067
38 Ga0070670_100086572 3300005331 Bacteria 2692
39 Ga0070670_100155007 3300005331 Bacteria 1983
40 Ga0070670_100178785 3300005331 Bacteria 1842
41 Ga0070670_100186600 3300005331 Bacteria 1800
42 Ga0070670_100220411 3300005331 Bacteria 1650
43 Ga0070670_100227659 3300005331 Bacteria 1622
44 Ga0070677_10003395 3300005333 Bacteria 5133
45 Ga0070677_10023248 3300005333 Bacteria 2293
46 Ga0070677_10029223 3300005333 Bacteria 2088
47 Ga0068869_100002864 3300005334 Bacteria 10467
48 Ga0068869_100017061 3300005334 Bacteria 4912
49 Ga0068869_100028356 3300005334 Bacteria 3911
50 Ga0068869_100115180 3300005334 Bacteria 2050
51 Ga0070666_10006918 3300005335 Bacteria 6989
52 Ga0070666_10026581 3300005335 Bacteria 3783
53 Ga0068868_100001133 3300005338 Bacteria 18221
54 Ga0068868_100078671 3300005338 Bacteria 2640
55 Ga0068868_100089477 3300005338 Bacteria 2478
56 Ga0068868_100145349 3300005338 Bacteria 1949
57 Ga0068868_100174310 3300005338 Bacteria 1782
58 Ga0070660_100094428 3300005339 Bacteria 2363
59 Ga0070660_100101281 3300005339 Bacteria 2282
60 Ga0070689_100014673 3300005340 Bacteria 5697
61 Ga0070687_100008524 3300005343 Bacteria 4350
62 Ga0070661_100001108 3300005344 Bacteria 18946
63 Ga0070661_100036758 3300005344 Bacteria 3559
64 Ga0070661_100165176 3300005344 Bacteria 1678
65 Ga0070668_100016361 3300005347 Bacteria 5545
66 Ga0070668_100028237 3300005347 Bacteria 4260
67 Ga0070669_100001532 3300005353 Bacteria 16719
68 Ga0070669_100002753 3300005353 Bacteria 12687
69 Ga0070669_100015492 3300005353 Bacteria 5434
70 Ga0070669_100078864 3300005353 Bacteria 2448
71 Ga0070675_100001678 3300005354 Bacteria 16335
72 Ga0070675_100011301 3300005354 Bacteria 6987
73 Ga0070675_100019824 3300005354 Bacteria 5364
74 Ga0070675_100043670 3300005354 Bacteria 3664
75 Ga0070675_100102841 3300005354 Bacteria 2408
76 Ga0070671_100001183 3300005355 Bacteria 19526
77 Ga0070671_100006504 3300005355 Bacteria 9343
78 Ga0070671_100077692 3300005355 Bacteria 2774
79 Ga0070671_100103681 3300005355 Bacteria 2386
80 Ga0070671_100119573 3300005355 Bacteria 2217
81 Ga0070674_100056392 3300005356 Bacteria 2724
82 Ga0070673_100011122 3300005364 Bacteria 6135
83 Ga0070673_100049786 3300005364 Bacteria 3272
84 Ga0070673_100056699 3300005364 Bacteria 3092
85 Ga0070673_100193832 3300005364 Bacteria 1747
86 Ga0070673_100262058 3300005364 Bacteria 1510
87 Ga0070688_100103424 3300005365 Bacteria 1882
88 Ga0070659_100001014 3300005366 Bacteria 20566
89 Ga0070659_100109764 3300005366 Bacteria 2227
90 Ga0070667_100003099 3300005367 Bacteria 14303
91 Ga0070667_100051883 3300005367 Bacteria 3459
92 Ga0070667_100056797 3300005367 Bacteria 3307
93 Ga0070663_100001510 3300005455 Bacteria 12793
94 Ga0070663_100054249 3300005455 Bacteria 2864
95 Ga0070663_100124571 3300005455 Bacteria 1950
96 Ga0070678_100001686 3300005456 Bacteria 11852
97 Ga0070678_100096623 3300005456 Bacteria 2279
98 Ga0070678_100113466 3300005456 Bacteria 2124
99 Ga0070678_100226734 3300005456 Bacteria 1556
100 Ga0070678_100251002 3300005456 Bacteria 1483
101 Ga0070662_100016436 3300005457 Bacteria 4970
102 Ga0070662_100056316 3300005457 Bacteria 2854
103 Ga0070662_100083166 3300005457 Bacteria 2389
104 Ga0070662_100202526 3300005457 Bacteria 1576
105 Ga0070681_10205668 3300005458 Bacteria 1886
106 Ga0068867_100000249 3300005459 Bacteria 35572
107 Ga0068867_100030842 3300005459 Bacteria 3867
108 Ga0068867_100039910 3300005459 Bacteria 3423
109 Ga0068867_100105329 3300005459 Bacteria 2160
110 Ga0068867_100137283 3300005459 Bacteria 1908
111 Ga0068867_100202684 3300005459 Bacteria 1589
112 Ga0068867_100432452 3300005459 Bacteria 1117
113 Ga0070706_100009139 3300005467 Bacteria 9228
114 Ga0070707_100112873 3300005468 Bacteria 2636
115 Ga0070699_100108622 3300005518 Bacteria 2435
116 Ga0070679_100022790 3300005530 Bacteria 6125
117 Ga0070684_100173770 3300005535 Bacteria 1957
118 Ga0068853_100039042 3300005539 Bacteria 4048
119 Ga0068853_100054015 3300005539 Bacteria 3461
120 Ga0068853_100084122 3300005539 Bacteria 2788
121 Ga0068853_100208958 3300005539 Bacteria 1778
122 Ga0068853_100228523 3300005539 Bacteria 1701
123 Ga0070672_100000520 3300005543 Bacteria 22520
124 Ga0070672_100002627 3300005543 Bacteria 11487
125 Ga0070672_100009192 3300005543 Bacteria 6802
126 Ga0070672_100033799 3300005543 Bacteria 3876
127 Ga0070672_100084573 3300005543 Bacteria 2548
128 Ga0070672_100114219 3300005543 Bacteria 2204
129 Ga0070672_100139974 3300005543 Bacteria 1995
130 Ga0070693_100041257 3300005547 Bacteria 2595
131 Ga0070665_100193872 3300005548 Bacteria 2032
132 Ga0068855_100038599 3300005563 Bacteria 5673
133 Ga0070664_100006317 3300005564 Bacteria 9561
134 Ga0070664_100017715 3300005564 Bacteria 5852
135 Ga0070664_100041315 3300005564 Bacteria 3891
136 Ga0070664_100088129 3300005564 Bacteria 2683
137 Ga0070664_100193351 3300005564 Bacteria 1813
138 Ga0070664_100218576 3300005564 Bacteria 1704
139 Ga0068857_100017919 3300005577 Bacteria 6211
140 Ga0068857_100154617 3300005577 Bacteria 2079
141 Ga0068854_100032410 3300005578 Bacteria 3636
142 Ga0068854_100095281 3300005578 Bacteria 2221
143 Ga0068854_100199047 3300005578 Bacteria 1574
144 Ga0068854_100333872 3300005578 Bacteria 1236
145 Ga0068856_100064257 3300005614 Bacteria 3626
146 Ga0068856_100187838 3300005614 Bacteria 2080
147 Ga0070702_100084134 3300005615 Bacteria 1913
148 Ga0068852_100018167 3300005616 Bacteria 5536
149 Ga0068852_100036379 3300005616 Bacteria 4118
150 Ga0068852_100065922 3300005616 Bacteria 3161
151 Ga0068852_100069222 3300005616 Bacteria 3092
152 Ga0068852_100090376 3300005616 Bacteria 2738
153 Ga0068852_100121020 3300005616 Bacteria 2396
154 Ga0068852_100124413 3300005616 Bacteria 2365
155 Ga0068852_100129187 3300005616 Bacteria 2325
156 Ga0068859_100003078 3300005617 Bacteria 16916
157 Ga0068859_100037434 3300005617 Bacteria 4868
158 Ga0068859_100077782 3300005617 Bacteria 3358
159 Ga0068859_100319414 3300005617 Bacteria 1647
160 Ga0068864_100006255 3300005618 Bacteria 9765
161 Ga0068864_100019315 3300005618 Bacteria 5697
162 Ga0068864_100025526 3300005618 Bacteria 4978
163 Ga0068864_100039034 3300005618 Bacteria 4057
164 Ga0068864_100093563 3300005618 Bacteria 2655
165 Ga0068864_100115785 3300005618 Bacteria 2391
166 Ga0068864_100118254 3300005618 Bacteria 2366
167 Ga0068864_100148461 3300005618 Bacteria 2121
168 Ga0068864_100249809 3300005618 Bacteria 1646
169 Ga0068866_10031455 3300005718 Bacteria 2557
170 Ga0068861_100008114 3300005719 Bacteria 7223
171 Ga0068861_100021717 3300005719 Bacteria 4615
172 Ga0068861_100340171 3300005719 Bacteria 1313
173 Ga0068851_10003111 3300005834 Bacteria 7354
174 Ga0068851_10025182 3300005834 Bacteria 2918
175 Ga0068851_10025809 3300005834 Bacteria 2884
176 Ga0068870_10075079 3300005840 Bacteria 1854
177 Ga0068863_100039903 3300005841 Bacteria 4464
178 Ga0068863_100049085 3300005841 Bacteria 4002
179 Ga0068863_100071620 3300005841 Bacteria 3279
180 Ga0068863_100163834 3300005841 Bacteria 2131
181 Ga0068863_100219908 3300005841 Bacteria 1830
182 Ga0068863_100227611 3300005841 Bacteria 1798
183 Ga0068858_100005755 3300005842 Bacteria 12111
184 Ga0068858_100032427 3300005842 Bacteria 4851
185 Ga0068858_100398690 3300005842 Bacteria 1322
186 Ga0068860_100000445 3300005843 Bacteria 52236
187 Ga0068860_100003813 3300005843 Bacteria 15505
188 Ga0068860_100108275 3300005843 Bacteria 2656
189 Ga0068860_100169273 3300005843 Bacteria 2110
190 Ga0068862_100090173 3300005844 Bacteria 2668
191 Ga0068862_100109919 3300005844 Bacteria 2419
192 Ga0068862_100259872 3300005844 Bacteria 1585
193 Ga0075368_10013976 3300006042 Bacteria 2956
194 Ga0075363_100033022 3300006048 Bacteria 2692
195 Ga0075363_100036868 3300006048 Bacteria 2566
196 Ga0075364_10019981 3300006051 Bacteria 4210
197 Ga0075364_10205451 3300006051 Bacteria 1336
198 Ga0075362_10001681 3300006177 Bacteria 7173
199 Ga0075362_10003465 3300006177 Bacteria 5521
200 Ga0075362_10005489 3300006177 Bacteria 4646
201 Ga0075362_10036609 3300006177 Bacteria 2147
202 Ga0075367_10006872 3300006178 Bacteria 5789
203 Ga0075367_10029470 3300006178 Bacteria 3140
204 Ga0075367_10034806 3300006178 Bacteria 2912
205 Ga0075367_10067362 3300006178 Bacteria 2146
206 Ga0075367_10081321 3300006178 Bacteria 1960
207 Ga0075367_10102872 3300006178 Bacteria 1748
208 Ga0075366_10000618 3300006195 Bacteria 16716
209 Ga0075366_10003352 3300006195 Bacteria 8430
210 Ga0075366_10003362 3300006195 Bacteria 8420
211 Ga0075366_10010384 3300006195 Bacteria 5227
212 Ga0075366_10019185 3300006195 Bacteria 3953
213 Ga0075366_10055032 3300006195 Bacteria 2363
214 Ga0075366_10066562 3300006195 Bacteria 2143
215 Ga0075366_10102492 3300006195 Bacteria 1718
216 Ga0097621_100012583 3300006237 Bacteria 6276
217 Ga0097621_100012787 3300006237 Bacteria 6236
218 Ga0075370_10000087 3300006353 Bacteria 28459
219 Ga0075370_10000794 3300006353 Bacteria 12622
220 Ga0075370_10004191 3300006353 Bacteria 6961
221 Ga0075370_10009741 3300006353 Bacteria 5003
222 Ga0075370_10009866 3300006353 Bacteria 4974
223 Ga0075370_10019906 3300006353 Bacteria 3658
224 Ga0075370_10034425 3300006353 Bacteria 2839
225 Ga0068871_100024807 3300006358 Bacteria 4654
226 Ga0068871_100296801 3300006358 Bacteria 1417
227 Ga0075429_100001289 3300006880 Bacteria 20430
228 Ga0068865_100058561 3300006881 Bacteria 2691
229 Ga0068865_100299790 3300006881 Bacteria 1286
230 Ga0097620_100003078 3300006931 Bacteria 16916
231 Ga0097620_100037434 3300006931 Bacteria 4868
232 Ga0097620_100077785 3300006931 Bacteria 3358
233 Ga0097620_100319413 3300006931 Bacteria 1647
234 Ga0099823_1000031 3300006944 Bacteria 69036
235 Ga0079104_1000910 3300006946 Bacteria 23895
236 Ga0075435_100093700 3300007076 Bacteria 2482
237 Ga0105240_10073828 3300009093 Bacteria 4212
238 Ga0105240_10134300 3300009093 Bacteria 2964
239 Ga0105245_10080768 3300009098 Bacteria 2971
240 Ga0105245_10223226 3300009098 Bacteria 1819
241 Ga0114129_10011675 3300009147 Bacteria 12502
242 Ga0105243_10002157 3300009148 Bacteria 16630
243 Ga0105243_10064374 3300009148 Bacteria 2942
244 Ga0105243_10188143 3300009148 Bacteria 1801
245 Ga0105242_10041090 3300009176 Bacteria 3728
246 Ga0105248_10086678 3300009177 Bacteria 3523
247 Ga0105248_10211862 3300009177 Bacteria 2183
248 Ga0105248_10487619 3300009177 Bacteria 1389
249 Ga0105237_10000977 3300009545 Bacteria 38396
250 Ga0105237_10058104 3300009545 Bacteria 3871
251 Ga0105237_10213087 3300009545 Bacteria 1931
252 Ga0105238_10198934 3300009551 Bacteria 1979
253 Ga0105238_10205534 3300009551 Bacteria 1945
254 Ga0105249_10029233 3300009553 Bacteria 4976
255 Ga0105249_10086785 3300009553 Bacteria 2918
256 Ga0105239_10001185 3300010375 Bacteria 35747
257 Ga0105239_10022851 3300010375 Bacteria 6894
258 Ga0157319_1000016 3300012497 Bacteria 127256
259 Ga0157373_10206933 3300013100 Bacteria 1383
260 Ga0157378_10278437 3300013297 Bacteria 1612
261 Ga0163162_10053438 3300013306 Bacteria 4060
262 Ga0163162_10114857 3300013306 Bacteria 2792
263 Ga0163162_10503128 3300013306 Bacteria 1342
264 Ga0157372_10059132 3300013307 Bacteria 4286
265 Ga0157372_10092341 3300013307 Bacteria 3443
266 Ga0157375_10015275 3300013308 Bacteria 6871
267 Ga0157375_10037631 3300013308 Bacteria 4637
268 Ga0157375_10046145 3300013308 Bacteria 4246
269 Ga0157375_10054582 3300013308 Bacteria 3935
270 Ga0157375_10087545 3300013308 Bacteria 3167
271 Ga0157375_10139422 3300013308 Bacteria 2551
272 Ga0157375_10167035 3300013308 Bacteria 2346
273 Ga0157375_10471118 3300013308 Bacteria 1421
274 Ga0163163_10020211 3300014325 Bacteria 6267
275 Ga0163163_10149615 3300014325 Bacteria 2379
276 Ga0163163_10315275 3300014325 Bacteria 1617
277 Ga0157380_10057685 3300014326 Bacteria 3093
278 Ga0157380_10074589 3300014326 Bacteria 2754
279 Ga0157380_10211598 3300014326 Bacteria 1728
280 Ga0157377_10000016 3300014745 Bacteria 190613
281 Ga0157377_10008754 3300014745 Bacteria 4948
282 Ga0157377_10052007 3300014745 Bacteria 2312
283 Ga0157377_10151510 3300014745 Bacteria 1434
284 Ga0157379_10009007 3300014968 Bacteria 8699
285 Ga0157379_10055066 3300014968 Bacteria 3554
286 Ga0157379_10070019 3300014968 Bacteria 3138
287 Ga0157379_10091256 3300014968 Bacteria 2733
288 Ga0157379_10111449 3300014968 Bacteria 2458
289 Ga0157379_10112128 3300014968 Bacteria 2450
290 Ga0157379_10267385 3300014968 Bacteria 1554
291 Ga0157376_10086217 3300014969 Bacteria 2707
292 Ga0163161_10056187 3300017792 Bacteria 2859
293 Ga0163161_10068912 3300017792 Bacteria 2585
294 Ga0163161_10233268 3300017792 Bacteria 1429
295 Ga0213872_10000049 3300021361 Bacteria 109094
296 Ga0213872_10000102 3300021361 Bacteria 79440
297 Ga0209563_100044 3300025230 Bacteria 396812
298 Ga0209129_1000027 3300025258 Bacteria 409587
299 Ga0209565_1007169 3300025263 Bacteria 3034
300 Ga0209673_1006467 3300025273 Bacteria 5653
301 Ga0209673_1010412 3300025273 Bacteria 3922
302 Ga0209673_1018592 3300025273 Bacteria 2521
303 Ga0209564_1000008 3300025295 Bacteria 953227
304 Ga0209564_1000139 3300025295 Bacteria 180328
305 Ga0209758_1000052 3300025297 Bacteria 338962
306 Ga0209758_1000146 3300025297 Bacteria 169246
307 Ga0209050_1000532 3300025298 Bacteria 63063
308 Ga0209050_1001517 3300025298 Bacteria 24485
309 Ga0209050_1028513 3300025298 Bacteria 1809
310 Ga0209256_1000113 3300025299 Bacteria 175296
311 Ga0209256_1000579 3300025299 Bacteria 52079
312 Ga0209256_1002065 3300025299 Bacteria 17709
313 Ga0209051_1000020 3300025303 Bacteria 508628
314 Ga0209051_1002125 3300025303 Bacteria 14777
315 Ga0209051_1041164 3300025303 Bacteria 1647
316 Ga0209257_1000085 3300025304 Bacteria 291117
317 Ga0209257_1000984 3300025304 Bacteria 38671
318 Ga0209257_1002626 3300025304 Bacteria 17340
319 Ga0207656_10028413 3300025321 Bacteria 2296
320 Ga0207656_10029065 3300025321 Bacteria 2273
321 Ga0207682_10004155 3300025893 Bacteria 6130
322 Ga0207682_10008094 3300025893 Bacteria 4169
323 Ga0207682_10009281 3300025893 Bacteria 3886
324 Ga0207682_10043938 3300025893 Bacteria 1830
325 Ga0207642_10005313 3300025899 Bacteria 4195
326 Ga0207688_10059765 3300025901 Bacteria 2146
327 Ga0207688_10067615 3300025901 Bacteria 2022
328 Ga0207645_10002448 3300025907 Bacteria 14610
329 Ga0207645_10005113 3300025907 Bacteria 9597
330 Ga0207645_10015574 3300025907 Bacteria 5048
331 Ga0207645_10057894 3300025907 Bacteria 2474
332 Ga0207645_10062738 3300025907 Bacteria 2374
333 Ga0207645_10266202 3300025907 Bacteria 1136
334 Ga0207643_10023508 3300025908 Bacteria 3398
335 Ga0207643_10081487 3300025908 Bacteria 1876
336 Ga0207643_10103095 3300025908 Bacteria 1674
337 Ga0207705_10201660 3300025909 Bacteria 1507
338 Ga0207684_10028585 3300025910 Bacteria 4750
339 Ga0207707_10271576 3300025912 Bacteria 1469
340 Ga0207695_10032492 3300025913 Bacteria 5710
341 Ga0207695_10143657 3300025913 Bacteria 2332
342 Ga0207695_10271316 3300025913 Bacteria 1592
343 Ga0207671_10001232 3300025914 Bacteria 30245
344 Ga0207671_10034406 3300025914 Bacteria 3764
345 Ga0207671_10060100 3300025914 Bacteria 2819
346 Ga0207662_10001761 3300025918 Bacteria 10629
347 Ga0207657_10100243 3300025919 Bacteria 2405
348 Ga0207657_10187864 3300025919 Bacteria 1668
349 Ga0207657_10310379 3300025919 Bacteria 1248
350 Ga0207649_10000951 3300025920 Bacteria 18067
351 Ga0207649_10225918 3300025920 Bacteria 1336
352 Ga0207649_10227304 3300025920 Bacteria 1332
353 Ga0207652_10224815 3300025921 Bacteria 1691
354 Ga0207681_10002612 3300025923 Bacteria 11407
355 Ga0207681_10008325 3300025923 Bacteria 6342
356 Ga0207681_10011935 3300025923 Bacteria 5351
357 Ga0207681_10106581 3300025923 Bacteria 2031
358 Ga0207694_10088667 3300025924 Bacteria 2439
359 Ga0207650_10000265 3300025925 Bacteria 55786
360 Ga0207650_10129883 3300025925 Bacteria 1970
361 Ga0207650_10159638 3300025925 Bacteria 1785
362 Ga0207650_10174275 3300025925 Bacteria 1711
363 Ga0207650_10209810 3300025925 Bacteria 1564
364 Ga0207650_10259213 3300025925 Bacteria 1410
365 Ga0207659_10000148 3300025926 Bacteria 41151
366 Ga0207659_10001017 3300025926 Bacteria 16659
367 Ga0207659_10027599 3300025926 Bacteria 3847
368 Ga0207659_10035382 3300025926 Bacteria 3452
369 Ga0207659_10123532 3300025926 Bacteria 1987
370 Ga0207687_10056350 3300025927 Bacteria 2757
371 Ga0207687_10135782 3300025927 Bacteria 1860
372 Ga0207687_10170983 3300025927 Bacteria 1676
373 Ga0207644_10003304 3300025931 Bacteria 10422
374 Ga0207644_10003662 3300025931 Bacteria 9961
375 Ga0207644_10074286 3300025931 Bacteria 2495
376 Ga0207644_10107447 3300025931 Bacteria 2105
377 Ga0207644_10140139 3300025931 Bacteria 1861
378 Ga0207644_10231593 3300025931 Bacteria 1468
379 Ga0207644_10482452 3300025931 Bacteria 1021
380 Ga0207690_10000658 3300025932 Bacteria 22107
381 Ga0207690_10088726 3300025932 Bacteria 2179
382 Ga0207690_10102125 3300025932 Bacteria 2050
383 Ga0207706_10002472 3300025933 Bacteria 18012
384 Ga0207706_10013431 3300025933 Bacteria 7443
385 Ga0207706_10020055 3300025933 Bacteria 6007
386 Ga0207706_10041334 3300025933 Bacteria 4087
387 Ga0207706_10078193 3300025933 Bacteria 2910
388 Ga0207706_10097917 3300025933 Bacteria 2580
389 Ga0207706_10102445 3300025933 Bacteria 2519
390 Ga0207706_10234327 3300025933 Bacteria 1605
391 Ga0207706_10276132 3300025933 Bacteria 1466
392 Ga0207706_10293736 3300025933 Bacteria 1417
393 Ga0207686_10021221 3300025934 Bacteria 3724
394 Ga0207709_10013052 3300025935 Bacteria 4579
395 Ga0207709_10020837 3300025935 Bacteria 3703
396 Ga0207670_10011706 3300025936 Bacteria 5104
397 Ga0207669_10001827 3300025937 Bacteria 9013
398 Ga0207669_10004257 3300025937 Bacteria 6282
399 Ga0207704_10003873 3300025938 Bacteria 6801
400 Ga0207704_10105562 3300025938 Bacteria 1890
401 Ga0207704_10143746 3300025938 Bacteria 1673
402 Ga0207665_10203706 3300025939 Bacteria 1443
403 Ga0207691_10006813 3300025940 Bacteria 11017
404 Ga0207691_10012845 3300025940 Bacteria 8017
405 Ga0207691_10036950 3300025940 Bacteria 4524
406 Ga0207691_10041310 3300025940 Bacteria 4259
407 Ga0207691_10064816 3300025940 Bacteria 3309
408 Ga0207691_10117222 3300025940 Bacteria 2363
409 Ga0207691_10178063 3300025940 Bacteria 1859
410 Ga0207691_10211130 3300025940 Bacteria 1686
411 Ga0207691_10360397 3300025940 Bacteria 1243
412 Ga0207711_10013979 3300025941 Bacteria 6667
413 Ga0207711_10046363 3300025941 Bacteria 3714
414 Ga0207711_10110881 3300025941 Bacteria 2440
415 Ga0207689_10023881 3300025942 Bacteria 5128
416 Ga0207689_10054773 3300025942 Bacteria 3284
417 Ga0207689_10065185 3300025942 Bacteria 2996
418 Ga0207661_10346524 3300025944 Bacteria 1339
419 Ga0207679_10003109 3300025945 Bacteria 10278
420 Ga0207679_10025467 3300025945 Bacteria 4069
421 Ga0207679_10113354 3300025945 Bacteria 2145
422 Ga0207679_10295449 3300025945 Bacteria 1394
423 Ga0207667_10317458 3300025949 Bacteria 1591
424 Ga0207651_10000774 3300025960 Bacteria 13772
425 Ga0207651_10006277 3300025960 Bacteria 6199
426 Ga0207651_10161802 3300025960 Bacteria 1755
427 Ga0207651_10255251 3300025960 Bacteria 1436
428 Ga0207712_10081002 3300025961 Bacteria 2363
429 Ga0207640_10080785 3300025981 Bacteria 2220
430 Ga0207640_10102012 3300025981 Bacteria 2015
431 Ga0207640_10102454 3300025981 Bacteria 2011
432 Ga0207640_10119109 3300025981 Bacteria 1887
433 Ga0207640_10323532 3300025981 Bacteria 1229
434 Ga0207658_10031796 3300025986 Bacteria 3751
435 Ga0207658_10113956 3300025986 Bacteria 2143
436 Ga0207658_10114328 3300025986 Bacteria 2140
437 Ga0207677_10004551 3300026023 Bacteria 7457
438 Ga0207677_10040303 3300026023 Bacteria 3078
439 Ga0207677_10053415 3300026023 Bacteria 2750
440 Ga0207677_10089332 3300026023 Bacteria 2236
441 Ga0207677_10116471 3300026023 Bacteria 2001
442 Ga0207677_10219499 3300026023 Bacteria 1524
443 Ga0207677_10231121 3300026023 Bacteria 1490
444 Ga0207677_10337531 3300026023 Bacteria 1258
445 Ga0207677_10429827 3300026023 Bacteria 1127
446 Ga0207703_10005338 3300026035 Bacteria 10351
447 Ga0207703_10081655 3300026035 Bacteria 2695
448 Ga0207639_10018810 3300026041 Bacteria 4914
449 Ga0207639_10032057 3300026041 Bacteria 3866
450 Ga0207639_10037230 3300026041 Bacteria 3612
451 Ga0207639_10079016 3300026041 Bacteria 2599
452 Ga0207639_10351855 3300026041 Bacteria 1316
453 Ga0207678_10008084 3300026067 Bacteria 9275
454 Ga0207678_10068087 3300026067 Bacteria 3055
455 Ga0207678_10219167 3300026067 Bacteria 1629
456 Ga0207708_10059128 3300026075 Bacteria 2925
457 Ga0207708_10088454 3300026075 Bacteria 2386
458 Ga0207702_10066788 3300026078 Bacteria 3084
459 Ga0207702_10085730 3300026078 Bacteria 2745
460 Ga0207702_10158058 3300026078 Bacteria 2068
461 Ga0207641_10005111 3300026088 Bacteria 11237
462 Ga0207641_10016302 3300026088 Bacteria 6085
463 Ga0207641_10175792 3300026088 Bacteria 1957
464 Ga0207641_10214096 3300026088 Bacteria 1783
465 Ga0207641_10411546 3300026088 Bacteria 1300
466 Ga0207648_10000515 3300026089 Bacteria 43207
467 Ga0207648_10005196 3300026089 Bacteria 13182
468 Ga0207648_10027880 3300026089 Bacteria 5011
469 Ga0207648_10027914 3300026089 Bacteria 5008
470 Ga0207648_10032958 3300026089 Bacteria 4571
471 Ga0207648_10115103 3300026089 Bacteria 2363
472 Ga0207648_10139297 3300026089 Bacteria 2138
473 Ga0207648_10213218 3300026089 Bacteria 1715
474 Ga0207648_10315926 3300026089 Bacteria 1403
475 Ga0207676_10001704 3300026095 Bacteria 16203
476 Ga0207676_10004154 3300026095 Bacteria 10228
477 Ga0207676_10007217 3300026095 Bacteria 7868
478 Ga0207676_10019993 3300026095 Bacteria 4892
479 Ga0207676_10047634 3300026095 Bacteria 3323
480 Ga0207676_10286595 3300026095 Bacteria 1497
481 Ga0207676_10341092 3300026095 Bacteria 1382
482 Ga0207674_10006659 3300026116 Bacteria 13573
483 Ga0207674_10038357 3300026116 Bacteria 4973
484 Ga0207674_10105195 3300026116 Bacteria 2801
485 Ga0207675_100028181 3300026118 Bacteria 5229
486 Ga0207675_100072379 3300026118 Bacteria 3224
487 Ga0207675_100088048 3300026118 Bacteria 2916
488 Ga0207675_100167079 3300026118 Bacteria 2101
489 Ga0207683_10003775 3300026121 Bacteria 13135
490 Ga0207683_10013304 3300026121 Bacteria 7015
491 Ga0207683_10094165 3300026121 Bacteria 2669
492 Ga0207683_10118230 3300026121 Bacteria 2378
493 Ga0207683_10169935 3300026121 Bacteria 1974
494 Ga0207683_10206002 3300026121 Bacteria 1789
495 Ga0207698_10024593 3300026142 Bacteria 4230
496 Ga0207698_10028487 3300026142 Bacteria 3983
497 Ga0207698_10033338 3300026142 Bacteria 3742
498 Ga0207698_10058144 3300026142 Bacteria 2995
499 Ga0207698_10125414 3300026142 Bacteria 2182
500 Ga0207698_10129028 3300026142 Bacteria 2157
501 Ga0207698_10248099 3300026142 Bacteria 1627
502 Ga0207698_10269479 3300026142 Bacteria 1569
503 Ga0207698_10546512 3300026142 Bacteria 1134
504 Ga0209281_1000195 3300027111 Bacteria 139144
505 Ga0209389_1070620 3300027296 Bacteria 1922
506 Ga0268266_10065494 3300028379 Bacteria 3141
507 Ga0268265_10049114 3300028380 Bacteria 3171
508 Ga0268265_10341117 3300028380 Bacteria 1364
509 Ga0268264_10001473 3300028381 Bacteria 21971
510 Ga0268264_10019269 3300028381 Bacteria 5576
511 Ga0268264_10114106 3300028381 Bacteria 2371
512 Ga0268264_10171451 3300028381 Bacteria 1963
513 Ga0307517_10002354 3300028786 Bacteria 30505
514 Ga0307517_10068641 3300028786 Bacteria 3225
515 Ga0307517_10084204 3300028786 Bacteria 2679
516 Ga0307517_10170202 3300028786 Bacteria 1434
517 Ga0307515_10014346 3300028794 Bacteria 14704
518 Ga0307515_10020693 3300028794 Bacteria 11719
519 Ga0307515_10038563 3300028794 Bacteria 7637
520 Ga0307515_10087834 3300028794 Bacteria 3939
521 Ga0307515_10094478 3300028794 Bacteria 3693
522 Ga0307515_10100680 3300028794 Bacteria 3496
523 Ga0307515_10271922 3300028794 Bacteria 1414
524 Ga0307512_10016010 3300030522 Bacteria 6930
525 Ga0265328_10006037 3300031239 Bacteria 5157
526 Ga0265331_10028316 3300031250 Bacteria 2802
527 Ga0265327_10000328 3300031251 Bacteria 90489
528 Ga0265327_10001872 3300031251 Bacteria 24338
529 Ga0265316_10000456 3300031344 Bacteria 46381
530 Ga0307513_10007838 3300031456 Bacteria 13772
531 Ga0307513_10218402 3300031456 Bacteria 1730
532 Ga0307513_10480824 3300031456 Bacteria 962
533 Ga0307509_10000234 3300031507 Bacteria 89398
534 Ga0307509_10008275 3300031507 Bacteria 13292
535 Ga0307509_10034833 3300031507 Bacteria 5530
536 Ga0307509_10037292 3300031507 Bacteria 5315
537 Ga0307509_10229739 3300031507 Bacteria 1659
538 Ga0307408_100033429 3300031548 Bacteria 3593
539 Ga0307408_100099417 3300031548 Bacteria 2214
540 Ga0307408_100192762 3300031548 Bacteria 1643
541 Ga0307508_10004454 3300031616 Bacteria 13689
542 Ga0307508_10013271 3300031616 Bacteria 7536
543 Ga0307508_10107856 3300031616 Bacteria 2384
544 Ga0307514_10074199 3300031649 Bacteria 2540
545 Ga0307514_10109866 3300031649 Bacteria 1957
546 Ga0307516_10000398 3300031730 Bacteria 56825
547 Ga0307516_10003842 3300031730 Bacteria 19022
548 Ga0307516_10007334 3300031730 Bacteria 12692
549 Ga0307516_10181847 3300031730 Bacteria 1835
550 Ga0307516_10200947 3300031730 Bacteria 1713
551 Ga0307516_10204209 3300031730 Bacteria 1694
552 Ga0307516_10217469 3300031730 Bacteria 1622
553 Ga0307405_10000483 3300031731 Bacteria 14957
554 Ga0307405_10008281 3300031731 Bacteria 5262
555 Ga0307413_10143937 3300031824 Bacteria 1651
556 Ga0307410_10037140 3300031852 Bacteria 3179
557 Ga0307406_10062958 3300031901 Bacteria 2401
558 Ga0307406_10087180 3300031901 Bacteria 2092
559 Ga0307406_10090995 3300031901 Bacteria 2054
560 Ga0307412_10153526 3300031911 Bacteria 1702
561 Ga0307409_100120312 3300031995 Bacteria 2222
562 Ga0307409_100152324 3300031995 Bacteria 2009
563 Ga0307416_100020315 3300032002 Bacteria 4736
564 Ga0307416_100037404 3300032002 Bacteria 3734
565 Ga0307416_100123122 3300032002 Bacteria 2317
566 Ga0307411_10000973 3300032005 Bacteria 10988
567 Ga0307415_100002786 3300032126 Bacteria 8753
568 Ga0307415_100283139 3300032126 Bacteria 1364
569 Ga0307507_10047905 3300033179 Bacteria 4167
570 Ga0307507_10177038 3300033179 Bacteria 1534
571 Ga0307510_10022775 3300033180 Bacteria 7267
572 Ga0307510_10044484 3300033180 Bacteria 4808
573 Ga0307510_10097014 3300033180 Bacteria 2760
574 Ga0373928_0041039 3300035084 Bacteria 1063
575 Ga0373944_0029355 3300035089 Bacteria 1644
576 Ga0373923_0133908 3300035111 Bacteria 1116
577 Ga0373945_0008375 3300035116 Bacteria 3367
578 Ga0373957_0019754 3300035120 Bacteria 2374
579 Ga0373960_0028126 3300035121 Bacteria 1549
580 Ga0373946_0121976 3300035171 Bacteria 1191
581 Ga0373924_0043376 3300035410 Bacteria 1847
582 Ga0373931_0005090 3300035691 Bacteria 6049
583 Ga0373931_0027975 3300035691 Bacteria 2882
584 Ga0373935_0315349 3300035692 Bacteria 1108
585 Ga0373937_0047573 3300036401 Bacteria 3925
586 Ga0373937_0218207 3300036401 Bacteria 1795
587 Ga0373925_0034840 3300037068 Bacteria 3712
588 Ga0373925_0086216 3300037068 Bacteria 2395
589 Ga0395900_0000131 3300037418 Bacteria 125554
590 Ga0395898_0001654 3300037466 Bacteria 30082
591 Ga0395898_0365304 3300037466 Bacteria 1376
592 Ga0395905_0000140 3300037471 Bacteria 120221
593 Ga0395905_0004070 3300037471 Bacteria 15324
594 Ga0395905_0018902 3300037471 Bacteria 6535
595 Ga0395905_0043045 3300037471 Bacteria 4236
596 Ga0395905_0068289 3300037471 Bacteria 3329
597 Ga0436365_0456964 3300039437 Bacteria 2267
598 Ga0436361_0082864 3300039447 Bacteria 107951
599 Ga0436361_0175308 3300039447 Bacteria 1229
600 Ga0436361_0614815 3300039447 Bacteria 45728
601 Ga0436363_1434407 3300039450 Bacteria 3129
602 Ga0451789_0080764 3300041443 Bacteria 2022
603 Ga0451793_0005031 3300041452 Bacteria 1655
604 Ga0451800_1501964 3300041459 Bacteria 2180
605 Ga0451804_0854854 3300041463 Bacteria 1536
606 Ga0439455_0080172 3300042012 Bacteria 886
607 Ga0439446_0020343 3300042156 Bacteria 1869
608 Ga0439459_0006666 3300042438 Bacteria 1930
609 Ga0439464_0043592 3300042439 Bacteria 1283
610 Ga0450918_000036 3300042531 Bacteria 26790
611 Ga0451577_0001120 3300042876 Bacteria 38005
612 Ga0451577_0006947 3300042876 Bacteria 11183
613 Ga0451577_0037816 3300042876 Bacteria 4343
614 Ga0466969_0000056 3300044656 Bacteria 59381
615 Ga0466969_0052727 3300044656 Bacteria 1997
616 Ga0466972_0000390 3300044658 Bacteria 23451
617 Ga0466972_0003819 3300044658 Bacteria 7493
618 Ga0466972_0050284 3300044658 Bacteria 2012
619 Ga0466965_0055253 3300044683 Bacteria 1975
620 Ga0466965_0061812 3300044683 Bacteria 1872
621 Ga0466965_0071667 3300044683 Bacteria 1743
622 Ga0466966_0004701 3300044684 Bacteria 8985
623 Ga0466961_0175759 3300044693 Bacteria 1330
624 Ga0466963_0002329 3300044694 Bacteria 10589
625 Ga0466964_0008533 3300044706 Bacteria 3851
626 Ga0466964_0073446 3300044706 Bacteria 1452
627 Ga0453684_0262759 3300044712 Bacteria 1976
628 Ga0453684_0469264 3300044712 Bacteria 1398
629 Ga0466970_0028913 3300044765 Bacteria 2915
630 Ga0466970_0056461 3300044765 Bacteria 2098
631 Ga0466960_0139994 3300044901 Bacteria 1284
632 Ga0466959_0001826 3300045049 Bacteria 13354
633 Ga0466959_0032449 3300045049 Bacteria 3865
634 Ga0451576_0003772 3300045051 Bacteria 20437
635 Ga0451576_0081999 3300045051 Bacteria 3354
636 Ga0451576_0508039 3300045051 Bacteria 1266
637 Ga0495592_0000291 3300046454 Bacteria 42990
638 Ga0495629_0295475 3300046459 Bacteria 1110
639 Ga0495638_0040561 3300046460 Bacteria 2950
640 Ga0495638_0118630 3300046460 Bacteria 1565
641 Ga0495653_0202900 3300046463 Bacteria 1345
642 Ga0495650_0002299 3300046471 Bacteria 15858
643 Ga0495580_0102474 3300046472 Bacteria 1990
644 Ga0495583_0053587 3300046506 Bacteria 1830
645 Ga0495606_0134096 3300046507 Bacteria 1469
646 Ga0495610_0006772 3300046512 Bacteria 7777
647 Ga0495618_0192970 3300046514 Bacteria 1291
648 Ga0495620_0033952 3300046515 Bacteria 2310
649 Ga0495620_0082584 3300046515 Bacteria 1298
650 Ga0495628_0038033 3300046516 Bacteria 3855
651 Ga0495630_0065659 3300046517 Bacteria 2727
652 Ga0495631_0078120 3300046518 Bacteria 1429
653 Ga0495632_0002939 3300046519 Bacteria 12506
654 Ga0495632_0004622 3300046519 Bacteria 9321
655 Ga0495632_0034875 3300046519 Bacteria 2572
656 Ga0495632_0049744 3300046519 Bacteria 2070
657 Ga0495643_0033027 3300046522 Bacteria 2867
658 Ga0495652_0340510 3300046529 Bacteria 1078
659 Ga0495621_0001985 3300046539 Bacteria 5382
660 Ga0495597_0012158 3300046542 Bacteria 4159
661 Ga0495622_0039466 3300046557 Bacteria 2199
662 Ga0495625_0003235 3300046660 Bacteria 16485
663 Ga0495625_0008404 3300046660 Bacteria 8813
664 Ga0495635_0130790 3300046663 Bacteria 1711
665 Ga0495647_0004652 3300046681 Bacteria 4473
666 Ga0495658_0039352 3300046683 Bacteria 2623
667 Ga0495649_0006191 3300046694 Bacteria 7471
668 Ga0495674_0117455 3300047319 Bacteria 2250
669 Ga0495676_0062944 3300047321 Bacteria 2894
670 Ga0495687_000500 3300047443 Bacteria 47248
671 Ga0495687_004213 3300047443 Bacteria 9863
672 Ga0495684_0178237 3300047471 Bacteria 1577
673 Ga0495686_0004579 3300047472 Bacteria 11287
674 Ga0495686_0070436 3300047472 Bacteria 2155
675 Ga0495602_0108358 3300048088 Bacteria 2262
676 Ga0495615_0009959 3300048090 Bacteria 1885
677 Ga0495626_0068301 3300048091 Bacteria 1603
678 Ga0496100_0045934 3300048903 Bacteria 2805
679 Ga0496101_0135237 3300048904 Bacteria 1875
680 Ga0496105_0191531 3300048908 Bacteria 1672
681 Ga0496106_0005397 3300048909 Bacteria 9454
682 Ga0496106_0048548 3300048909 Bacteria 3196
683 Ga0496107_0029760 3300048910 Bacteria 3888
684 Ga0496108_0021012 3300048911 Bacteria 5366
685 Ga0496108_0030229 3300048911 Bacteria 4489
686 Ga0496108_0067918 3300048911 Bacteria 3007
687 Ga0496109_0033646 3300048912 Bacteria 4611
688 Ga0496109_0161275 3300048912 Bacteria 2101
689 Ga0496109_0357229 3300048912 Bacteria 1380
690 Ga0496110_0169675 3300048913 Bacteria 1979
691 Ga0496110_0206768 3300048913 Bacteria 1784
692 Ga0496110_0227151 3300048913 Bacteria 1697
693 Ga0496112_0243110 3300048915 Bacteria 1752
694 Ga0496113_0095302 3300048916 Bacteria 2300
695 Ga0496114_0191409 3300048917 Bacteria 1790
696 Ga0496121_0020827 3300048924 Bacteria 6462
697 Ga0496124_0000786 3300048927 Bacteria 51804
698 Ga0496124_0020618 3300048927 Bacteria 6084
699 Ga0496125_0013748 3300048928 Bacteria 7935
700 Ga0496125_0101321 3300048928 Bacteria 2120
701 Ga0501308_000249 3300049128 Bacteria 3160
702 Ga0501298_022602 3300049521 Bacteria 1186
703 Ga0501043_0000149 3300049579 Bacteria 65122
704 Ga0501046_0000092 3300049580 Bacteria 97456
705 Ga0501047_0000028 3300049581 Bacteria 220279
706 Ga0501048_0009579 3300049582 Bacteria 7271
707 Ga0501198_000025 3300049649 Bacteria 66985
708 Ga0501222_000033 3300049662 Bacteria 55105
709 Ga0501266_004365 3300049763 Bacteria 1750
710 Ga0501045_0000170 3300049824 Bacteria 35617
711 nmdc:mga03683_17309_c1 3300050489 Bacteria 2727
712 nmdc:mga03683_3783_c1 3300050489 Bacteria 4935
713 nmdc:mga03683_85418_c1 3300050489 Bacteria 1369
714 nmdc:mga03n38_59282_c1 3300050490 Bacteria 1737
715 nmdc:mga00v17_91914_c1 3300050491 Bacteria 1907
716 nmdc:mga0k408_155059_c1 3300050493 Bacteria 1364
717 nmdc:mga0k408_155942_c1 3300050493 Bacteria 1360
718 nmdc:mga0k408_176186_c1 3300050493 Bacteria 1275
719 nmdc:mga0k408_25211_c1 3300050493 Bacteria 3367
720 nmdc:mga0k408_311592_c1 3300050493 Bacteria 939
721 nmdc:mga0k408_3397_c1 3300050493 Bacteria 8435
722 nmdc:mga0k408_355_c1 3300050493 Bacteria 25188
723 nmdc:mga0k408_3626_c1 3300050493 Bacteria 8169
724 nmdc:mga0k408_39694_c1 3300050493 Bacteria 2706
725 nmdc:mga0k408_4604_c1 3300050493 Bacteria 7314
726 nmdc:mga0k408_5230_c1 3300050493 Bacteria 6888
727 nmdc:mga0k408_5904_c1 3300050493 Bacteria 6530
728 nmdc:mga0k408_61849_c1 3300050493 Bacteria 2177
729 nmdc:mga0k408_7403_c1 3300050493 Bacteria 5861
730 nmdc:mga0k408_84277_c1 3300050493 Bacteria 1865
731 nmdc:mga0k408_887_c1 3300050493 Bacteria 16392
732 nmdc:mga06z11_118871_c1 3300050494 Bacteria 1472
733 nmdc:mga06z11_15743_c1 3300050494 Bacteria 3384
734 nmdc:mga06z11_48066_c1 3300050494 Bacteria 2170
735 nmdc:mga07m45_12176_c1 3300050496 Bacteria 4539
736 nmdc:mga07m45_207402_c1 3300050496 Bacteria 1140
737 nmdc:mga07m45_259208_c1 3300050496 Bacteria 1012
738 nmdc:mga07m45_31570_c1 3300050496 Bacteria 2936
739 nmdc:mga07m45_31586_c1 3300050496 Bacteria 2935
740 nmdc:mga07m45_4980_c1 3300050496 Bacteria 6559
741 nmdc:mga07m45_67_c1 3300050496 Bacteria 40608
742 nmdc:mga07m45_70513_c1 3300050496 Bacteria 1988
743 nmdc:mga07m45_9417_c1 3300050496 Bacteria 5067
744 nmdc:mga05p37_103040_c1 3300050507 Bacteria 3513
745 nmdc:mga09592_4802_c1 3300050508 Bacteria 10952
746 nmdc:mga0qj67_28953_c1 3300050509 Bacteria 4300
747 nmdc:mga0n895_70045_c1 3300050512 Bacteria 3475
748 nmdc:mga0rr50_104604_c1 3300050513 Bacteria 2230
749 nmdc:mga0sz30_123062_c1 3300050516 Bacteria 1141
750 nmdc:mga0sz30_16889_c1 3300050516 Bacteria 2904
751 Ga0495619_0059888 3300053085 Bacteria 2530
752 Ga0500578_0000213 3300053086 Bacteria 71211
753 Ga0500644_0049144 3300053088 Bacteria 1438
754 Ga0500651_0032774 3300053093 Bacteria 3275
755 Ga0500594_0003064 3300053118 Bacteria 3659
756 Ga0500652_000839 3300053131 Bacteria 10178
757 Ga0500658_0002883 3300053134 Bacteria 6601
758 Ga0500559_0000214 3300053136 Bacteria 46366
759 Ga0500568_0011383 3300053139 Bacteria 4133
760 Ga0500590_041434 3300053148 Bacteria 2368
761 Ga0500604_0032043 3300053151 Bacteria 1546
762 Ga0500619_000325 3300053154 Bacteria 9276
763 Ga0500622_0001490 3300053156 Bacteria 18621
764 Ga0500622_0003145 3300053156 Bacteria 11307
765 Ga0500636_0165183 3300053177 Bacteria 1203
766 Ga0500645_004966 3300053730 Bacteria 4990
767 2587724859 2585428057 Bacteria 6737412
768 2587736734 2585428058 Bacteria 6853932
769 2587755614 2585428062 Bacteria 6842168
770 2588295344 2588253510 Bacteria 6901809
771 2643970216 2643221592 Bacteria 6608788
772 2644058780 2643221609 Bacteria 6756331
773 2644071022 2643221611 Bacteria 6820941
774 2644142386 2643221625 Bacteria 6512927
775 2644246995 2643221644 Bacteria 6865017
776 2644275148 2643221648 Bacteria 6521465
777 2644303986 2643221654 Bacteria 5273570
778 2739245210 2738543012 Bacteria 7115078
779 2816471552 2816332133 Bacteria 7249298
780 2831865506 2831864461 Bacteria 6502356
781 2886850507 2886848708 Bacteria 5632523
782 Ga0307515_10000165
783 JGI25152J39213_1003301
784 Ga0006778J45830_1043737
785 JGI25153J46596_10032509
786 rootH1_10004883
787 rootL2_10007939
788 rootL2_10010936
789 rootH1_10033580
790 rootH1_10066579
791 Ga0055525_1000031
792 Ga0055526_1001897
793 Ga0055526_1009578
794 Ga0055524_1000125
795 Ga0055524_1000584
796 Ga0055524_1001070
797 Ga0055530_10013159
798 Ga0055540_1000011
799 Ga0055531_10001237
800 Ga0055531_10005816
801 Ga0055531_10008368
802 Ga0055531_10018465
803 Ga0055543_1002628
804 Ga0065165_1000153
805 Ga0065165_1000967
806 Ga0070658_10099611
807 Ga0070658_10411882
808 Ga0070676_10011630
809 Ga0070676_10014267
810 Ga0070676_10014455
811 Ga0070676_10017068
812 Ga0070676_10046116
813 Ga0070683_100059780
814 Ga0070690_100075990
815 Ga0070670_100002757
816 Ga0070670_100048474
817 Ga0070670_100059093
818 Ga0070670_100067542
819 Ga0070670_100086572
820 Ga0070670_100155007
821 Ga0070670_100178785
822 Ga0070670_100186600
823 Ga0070670_100220411
824 Ga0070670_100227659
825 Ga0070677_10003395
826 Ga0070677_10023248
827 Ga0070677_10029223
828 Ga0068869_100002864
829 Ga0068869_100017061
830 Ga0068869_100028356
831 Ga0068869_100115180
832 Ga0070666_10006918
833 Ga0070666_10026581
834 Ga0068868_100001133
835 Ga0068868_100078671
836 Ga0068868_100089477
837 Ga0068868_100145349
838 Ga0068868_100174310
839 Ga0070660_100094428
840 Ga0070660_100101281
841 Ga0070689_100014673
842 Ga0070687_100008524
843 Ga0070661_100001108
844 Ga0070661_100036758
845 Ga0070661_100165176
846 Ga0070668_100016361
847 Ga0070668_100028237
848 Ga0070669_100001532
849 Ga0070669_100002753
850 Ga0070669_100015492
851 Ga0070669_100078864
852 Ga0070675_100001678
853 Ga0070675_100011301
854 Ga0070675_100019824
855 Ga0070675_100043670
856 Ga0070675_100102841
857 Ga0070671_100001183
858 Ga0070671_100006504
859 Ga0070671_100077692
860 Ga0070671_100103681
861 Ga0070671_100119573
862 Ga0070674_100056392
863 Ga0070673_100011122
864 Ga0070673_100049786
865 Ga0070673_100056699
866 Ga0070673_100193832
867 Ga0070673_100262058
868 Ga0070688_100103424
869 Ga0070659_100001014
870 Ga0070659_100109764
871 Ga0070667_100003099
872 Ga0070667_100051883
873 Ga0070667_100056797
874 Ga0070663_100001510
875 Ga0070663_100054249
876 Ga0070663_100124571
877 Ga0070678_100001686
878 Ga0070678_100096623
879 Ga0070678_100113466
880 Ga0070678_100226734
881 Ga0070678_100251002
882 Ga0070662_100016436
883 Ga0070662_100056316
884 Ga0070662_100083166
885 Ga0070662_100202526
886 Ga0070681_10205668
887 Ga0068867_100000249
888 Ga0068867_100030842
889 Ga0068867_100039910
890 Ga0068867_100105329
891 Ga0068867_100137283
892 Ga0068867_100202684
893 Ga0068867_100432452
894 Ga0070706_100009139
895 Ga0070707_100112873
896 Ga0070699_100108622
897 Ga0070679_100022790
898 Ga0070684_100173770
899 Ga0068853_100039042
900 Ga0068853_100054015
901 Ga0068853_100084122
902 Ga0068853_100208958
903 Ga0068853_100228523
904 Ga0070672_100000520
905 Ga0070672_100002627
906 Ga0070672_100009192
907 Ga0070672_100033799
908 Ga0070672_100084573
909 Ga0070672_100114219
910 Ga0070672_100139974
911 Ga0070693_100041257
912 Ga0070665_100193872
913 Ga0068855_100038599
914 Ga0070664_100006317
915 Ga0070664_100017715
916 Ga0070664_100041315
917 Ga0070664_100088129
918 Ga0070664_100193351
919 Ga0070664_100218576
920 Ga0068857_100017919
921 Ga0068857_100154617
922 Ga0068854_100032410
923 Ga0068854_100095281
924 Ga0068854_100199047
925 Ga0068854_100333872
926 Ga0068856_100064257
927 Ga0068856_100187838
928 Ga0070702_100084134
929 Ga0068852_100018167
930 Ga0068852_100036379
931 Ga0068852_100065922
932 Ga0068852_100069222
933 Ga0068852_100090376
934 Ga0068852_100121020
935 Ga0068852_100124413
936 Ga0068852_100129187
937 Ga0068859_100003078
938 Ga0068859_100037434
939 Ga0068859_100077782
940 Ga0068859_100319414
941 Ga0068864_100006255
942 Ga0068864_100019315
943 Ga0068864_100025526
944 Ga0068864_100039034
945 Ga0068864_100093563
946 Ga0068864_100115785
947 Ga0068864_100118254
948 Ga0068864_100148461
949 Ga0068864_100249809
950 Ga0068866_10031455
951 Ga0068861_100008114
952 Ga0068861_100021717
953 Ga0068861_100340171
954 Ga0068851_10003111
955 Ga0068851_10025182
956 Ga0068851_10025809
957 Ga0068870_10075079
958 Ga0068863_100039903
959 Ga0068863_100049085
960 Ga0068863_100071620
961 Ga0068863_100163834
962 Ga0068863_100219908
963 Ga0068863_100227611
964 Ga0068858_100005755
965 Ga0068858_100032427
966 Ga0068858_100398690
967 Ga0068860_100000445
968 Ga0068860_100003813
969 Ga0068860_100108275
970 Ga0068860_100169273
971 Ga0068862_100090173
972 Ga0068862_100109919
973 Ga0068862_100259872
974 Ga0075368_10013976
975 Ga0075363_100033022
976 Ga0075363_100036868
977 Ga0075364_10019981
978 Ga0075364_10205451
979 Ga0075362_10001681
980 Ga0075362_10003465
981 Ga0075362_10005489
982 Ga0075362_10036609
983 Ga0075367_10006872
984 Ga0075367_10029470
985 Ga0075367_10034806
986 Ga0075367_10067362
987 Ga0075367_10081321
988 Ga0075367_10102872
989 Ga0075366_10000618
990 Ga0075366_10003352
991 Ga0075366_10003362
992 Ga0075366_10010384
993 Ga0075366_10019185
994 Ga0075366_10055032
995 Ga0075366_10066562
996 Ga0075366_10102492
997 Ga0097621_100012583
998 Ga0097621_100012787
999 Ga0075370_10000087
1000 Ga0075370_10000794
1001 Ga0075370_10004191
1002 Ga0075370_10009741
1003 Ga0075370_10009866
1004 Ga0075370_10019906
1005 Ga0075370_10034425
1006 Ga0068871_100024807
1007 Ga0068871_100296801
1008 Ga0075429_100001289
1009 Ga0068865_100058561
1010 Ga0068865_100299790
1011 Ga0097620_100003078
1012 Ga0097620_100037434
1013 Ga0097620_100077785
1014 Ga0097620_100319413
1015 Ga0099823_1000031
1016 Ga0079104_1000910
1017 Ga0075435_100093700
1018 Ga0105240_10073828
1019 Ga0105240_10134300
1020 Ga0105245_10080768
1021 Ga0105245_10223226
1022 Ga0114129_10011675
1023 Ga0105243_10002157
1024 Ga0105243_10064374
1025 Ga0105243_10188143
1026 Ga0105242_10041090
1027 Ga0105248_10086678
1028 Ga0105248_10211862
1029 Ga0105248_10487619
1030 Ga0105237_10000977
1031 Ga0105237_10058104
1032 Ga0105237_10213087
1033 Ga0105238_10198934
1034 Ga0105238_10205534
1035 Ga0105249_10029233
1036 Ga0105249_10086785
1037 Ga0105239_10001185
1038 Ga0105239_10022851
1039 Ga0157319_1000016
1040 Ga0157373_10206933
1041 Ga0157378_10278437
1042 Ga0163162_10053438
1043 Ga0163162_10114857
1044 Ga0163162_10503128
1045 Ga0157372_10059132
1046 Ga0157372_10092341
1047 Ga0157375_10015275
1048 Ga0157375_10037631
1049 Ga0157375_10046145
1050 Ga0157375_10054582
1051 Ga0157375_10087545
1052 Ga0157375_10139422
1053 Ga0157375_10167035
1054 Ga0157375_10471118
1055 Ga0163163_10020211
1056 Ga0163163_10149615
1057 Ga0163163_10315275
1058 Ga0157380_10057685
1059 Ga0157380_10074589
1060 Ga0157380_10211598
1061 Ga0157377_10000016
1062 Ga0157377_10008754
1063 Ga0157377_10052007
1064 Ga0157377_10151510
1065 Ga0157379_10009007
1066 Ga0157379_10055066
1067 Ga0157379_10070019
1068 Ga0157379_10091256
1069 Ga0157379_10111449
1070 Ga0157379_10112128
1071 Ga0157379_10267385
1072 Ga0157376_10086217
1073 Ga0163161_10056187
1074 Ga0163161_10068912
1075 Ga0163161_10233268
1076 Ga0213872_10000049
1077 Ga0213872_10000102
1078 Ga0209563_100044
1079 Ga0209129_1000027
1080 Ga0209565_1007169
1081 Ga0209673_1006467
1082 Ga0209673_1010412
1083 Ga0209673_1018592
1084 Ga0209564_1000008
1085 Ga0209564_1000139
1086 Ga0209758_1000052
1087 Ga0209758_1000146
1088 Ga0209050_1000532
1089 Ga0209050_1001517
1090 Ga0209050_1028513
1091 Ga0209256_1000113
1092 Ga0209256_1000579
1093 Ga0209256_1002065
1094 Ga0209051_1000020
1095 Ga0209051_1002125
1096 Ga0209051_1041164
1097 Ga0209257_1000085
1098 Ga0209257_1000984
1099 Ga0209257_1002626
1100 Ga0207656_10028413
1101 Ga0207656_10029065
1102 Ga0207682_10004155
1103 Ga0207682_10008094
1104 Ga0207682_10009281
1105 Ga0207682_10043938
1106 Ga0207642_10005313
1107 Ga0207688_10059765
1108 Ga0207688_10067615
1109 Ga0207645_10002448
1110 Ga0207645_10005113
1111 Ga0207645_10015574
1112 Ga0207645_10057894
1113 Ga0207645_10062738
1114 Ga0207645_10266202
1115 Ga0207643_10023508
1116 Ga0207643_10081487
1117 Ga0207643_10103095
1118 Ga0207705_10201660
1119 Ga0207684_10028585
1120 Ga0207707_10271576
1121 Ga0207695_10032492
1122 Ga0207695_10143657
1123 Ga0207695_10271316
1124 Ga0207671_10001232
1125 Ga0207671_10034406
1126 Ga0207671_10060100
1127 Ga0207662_10001761
1128 Ga0207657_10100243
1129 Ga0207657_10187864
1130 Ga0207657_10310379
1131 Ga0207649_10000951
1132 Ga0207649_10225918
1133 Ga0207649_10227304
1134 Ga0207652_10224815
1135 Ga0207681_10002612
1136 Ga0207681_10008325
1137 Ga0207681_10011935
1138 Ga0207681_10106581
1139 Ga0207694_10088667
1140 Ga0207650_10000265
1141 Ga0207650_10129883
1142 Ga0207650_10159638
1143 Ga0207650_10174275
1144 Ga0207650_10209810
1145 Ga0207650_10259213
1146 Ga0207659_10000148
1147 Ga0207659_10001017
1148 Ga0207659_10027599
1149 Ga0207659_10035382
1150 Ga0207659_10123532
1151 Ga0207687_10056350
1152 Ga0207687_10135782
1153 Ga0207687_10170983
1154 Ga0207644_10003304
1155 Ga0207644_10003662
1156 Ga0207644_10074286
1157 Ga0207644_10107447
1158 Ga0207644_10140139
1159 Ga0207644_10231593
1160 Ga0207644_10482452
1161 Ga0207690_10000658
1162 Ga0207690_10088726
1163 Ga0207690_10102125
1164 Ga0207706_10002472
1165 Ga0207706_10013431
1166 Ga0207706_10020055
1167 Ga0207706_10041334
1168 Ga0207706_10078193
1169 Ga0207706_10097917
1170 Ga0207706_10102445
1171 Ga0207706_10234327
1172 Ga0207706_10276132
1173 Ga0207706_10293736
1174 Ga0207686_10021221
1175 Ga0207709_10013052
1176 Ga0207709_10020837
1177 Ga0207670_10011706
1178 Ga0207669_10001827
1179 Ga0207669_10004257
1180 Ga0207704_10003873
1181 Ga0207704_10105562
1182 Ga0207704_10143746
1183 Ga0207665_10203706
1184 Ga0207691_10006813
1185 Ga0207691_10012845
1186 Ga0207691_10036950
1187 Ga0207691_10041310
1188 Ga0207691_10064816
1189 Ga0207691_10117222
1190 Ga0207691_10178063
1191 Ga0207691_10211130
1192 Ga0207691_10360397
1193 Ga0207711_10013979
1194 Ga0207711_10046363
1195 Ga0207711_10110881
1196 Ga0207689_10023881
1197 Ga0207689_10054773
1198 Ga0207689_10065185
1199 Ga0207661_10346524
1200 Ga0207679_10003109
1201 Ga0207679_10025467
1202 Ga0207679_10113354
1203 Ga0207679_10295449
1204 Ga0207667_10317458
1205 Ga0207651_10000774
1206 Ga0207651_10006277
1207 Ga0207651_10161802
1208 Ga0207651_10255251
1209 Ga0207712_10081002
1210 Ga0207640_10080785
1211 Ga0207640_10102012
1212 Ga0207640_10102454
1213 Ga0207640_10119109
1214 Ga0207640_10323532
1215 Ga0207658_10031796
1216 Ga0207658_10113956
1217 Ga0207658_10114328
1218 Ga0207677_10004551
1219 Ga0207677_10040303
1220 Ga0207677_10053415
1221 Ga0207677_10089332
1222 Ga0207677_10116471
1223 Ga0207677_10219499
1224 Ga0207677_10231121
1225 Ga0207677_10337531
1226 Ga0207677_10429827
1227 Ga0207703_10005338
1228 Ga0207703_10081655
1229 Ga0207639_10018810
1230 Ga0207639_10032057
1231 Ga0207639_10037230
1232 Ga0207639_10079016
1233 Ga0207639_10351855
1234 Ga0207678_10008084
1235 Ga0207678_10068087
1236 Ga0207678_10219167
1237 Ga0207708_10059128
1238 Ga0207708_10088454
1239 Ga0207702_10066788
1240 Ga0207702_10085730
1241 Ga0207702_10158058
1242 Ga0207641_10005111
1243 Ga0207641_10016302
1244 Ga0207641_10175792
1245 Ga0207641_10214096
1246 Ga0207641_10411546
1247 Ga0207648_10000515
1248 Ga0207648_10005196
1249 Ga0207648_10027880
1250 Ga0207648_10027914
1251 Ga0207648_10032958
1252 Ga0207648_10115103
1253 Ga0207648_10139297
1254 Ga0207648_10213218
1255 Ga0207648_10315926
1256 Ga0207676_10001704
1257 Ga0207676_10004154
1258 Ga0207676_10007217
1259 Ga0207676_10019993
1260 Ga0207676_10047634
1261 Ga0207676_10286595
1262 Ga0207676_10341092
1263 Ga0207674_10006659
1264 Ga0207674_10038357
1265 Ga0207674_10105195
1266 Ga0207675_100028181
1267 Ga0207675_100072379
1268 Ga0207675_100088048
1269 Ga0207675_100167079
1270 Ga0207683_10003775
1271 Ga0207683_10013304
1272 Ga0207683_10094165
1273 Ga0207683_10118230
1274 Ga0207683_10169935
1275 Ga0207683_10206002
1276 Ga0207698_10024593
1277 Ga0207698_10028487
1278 Ga0207698_10033338
1279 Ga0207698_10058144
1280 Ga0207698_10125414
1281 Ga0207698_10129028
1282 Ga0207698_10248099
1283 Ga0207698_10269479
1284 Ga0207698_10546512
1285 Ga0209281_1000195
1286 Ga0209389_1070620
1287 Ga0268266_10065494
1288 Ga0268265_10049114
1289 Ga0268265_10341117
1290 Ga0268264_10001473
1291 Ga0268264_10019269
1292 Ga0268264_10114106
1293 Ga0268264_10171451
1294 Ga0307517_10002354
1295 Ga0307517_10068641
1296 Ga0307517_10084204
1297 Ga0307517_10170202
1298 Ga0307515_10014346
1299 Ga0307515_10020693
1300 Ga0307515_10038563
1301 Ga0307515_10087834
1302 Ga0307515_10094478
1303 Ga0307515_10100680
1304 Ga0307515_10271922
1305 Ga0307512_10016010
1306 Ga0265328_10006037
1307 Ga0265331_10028316
1308 Ga0265327_10000328
1309 Ga0265327_10001872
1310 Ga0265316_10000456
1311 Ga0307513_10007838
1312 Ga0307513_10218402
1313 Ga0307513_10480824
1314 Ga0307509_10000234
1315 Ga0307509_10008275
1316 Ga0307509_10034833
1317 Ga0307509_10037292
1318 Ga0307509_10229739
1319 Ga0307408_100033429
1320 Ga0307408_100099417
1321 Ga0307408_100192762
1322 Ga0307508_10004454
1323 Ga0307508_10013271
1324 Ga0307508_10107856
1325 Ga0307514_10074199
1326 Ga0307514_10109866
1327 Ga0307516_10000398
1328 Ga0307516_10003842
1329 Ga0307516_10007334
1330 Ga0307516_10181847
1331 Ga0307516_10200947
1332 Ga0307516_10204209
1333 Ga0307516_10217469
1334 Ga0307405_10000483
1335 Ga0307405_10008281
1336 Ga0307413_10143937
1337 Ga0307410_10037140
1338 Ga0307406_10062958
1339 Ga0307406_10087180
1340 Ga0307406_10090995
1341 Ga0307412_10153526
1342 Ga0307409_100120312
1343 Ga0307409_100152324
1344 Ga0307416_100020315
1345 Ga0307416_100037404
1346 Ga0307416_100123122
1347 Ga0307411_10000973
1348 Ga0307415_100002786
1349 Ga0307415_100283139
1350 Ga0307507_10047905
1351 Ga0307507_10177038
1352 Ga0307510_10022775
1353 Ga0307510_10044484
1354 Ga0307510_10097014
1355 Ga0373928_0041039
1356 Ga0373944_0029355
1357 Ga0373923_0133908
1358 Ga0373945_0008375
1359 Ga0373957_0019754
1360 Ga0373960_0028126
1361 Ga0373946_0121976
1362 Ga0373924_0043376
1363 Ga0373931_0005090
1364 Ga0373931_0027975
1365 Ga0373935_0315349
1366 Ga0373937_0047573
1367 Ga0373937_0218207
1368 Ga0373925_0034840
1369 Ga0373925_0086216
1370 Ga0395900_0000131
1371 Ga0395898_0001654
1372 Ga0395898_0365304
1373 Ga0395905_0000140
1374 Ga0395905_0004070
1375 Ga0395905_0018902
1376 Ga0395905_0043045
1377 Ga0395905_0068289
1378 Ga0436365_0456964
1379 Ga0436361_0082864
1380 Ga0436361_0175308
1381 Ga0436361_0614815
1382 Ga0436363_1434407
1383 Ga0451789_0080764
1384 Ga0451793_0005031
1385 Ga0451800_1501964
1386 Ga0451804_0854854
1387 Ga0439455_0080172
1388 Ga0439446_0020343
1389 Ga0439459_0006666
1390 Ga0439464_0043592
1391 Ga0450918_000036
1392 Ga0451577_0001120
1393 Ga0451577_0006947
1394 Ga0451577_0037816
1395 Ga0466969_0000056
1396 Ga0466969_0052727
1397 Ga0466972_0000390
1398 Ga0466972_0003819
1399 Ga0466972_0050284
1400 Ga0466965_0055253
1401 Ga0466965_0061812
1402 Ga0466965_0071667
1403 Ga0466966_0004701
1404 Ga0466961_0175759
1405 Ga0466963_0002329
1406 Ga0466964_0008533
1407 Ga0466964_0073446
1408 Ga0453684_0262759
1409 Ga0453684_0469264
1410 Ga0466970_0028913
1411 Ga0466970_0056461
1412 Ga0466960_0139994
1413 Ga0466959_0001826
1414 Ga0466959_0032449
1415 Ga0451576_0003772
1416 Ga0451576_0081999
1417 Ga0451576_0508039
1418 Ga0495592_0000291
1419 Ga0495629_0295475
1420 Ga0495638_0040561
1421 Ga0495638_0118630
1422 Ga0495653_0202900
1423 Ga0495650_0002299
1424 Ga0495580_0102474
1425 Ga0495583_0053587
1426 Ga0495606_0134096
1427 Ga0495610_0006772
1428 Ga0495618_0192970
1429 Ga0495620_0033952
1430 Ga0495620_0082584
1431 Ga0495628_0038033
1432 Ga0495630_0065659
1433 Ga0495631_0078120
1434 Ga0495632_0002939
1435 Ga0495632_0004622
1436 Ga0495632_0034875
1437 Ga0495632_0049744
1438 Ga0495643_0033027
1439 Ga0495652_0340510
1440 Ga0495621_0001985
1441 Ga0495597_0012158
1442 Ga0495622_0039466
1443 Ga0495625_0003235
1444 Ga0495625_0008404
1445 Ga0495635_0130790
1446 Ga0495647_0004652
1447 Ga0495658_0039352
1448 Ga0495649_0006191
1449 Ga0495674_0117455
1450 Ga0495676_0062944
1451 Ga0495687_000500
1452 Ga0495687_004213
1453 Ga0495684_0178237
1454 Ga0495686_0004579
1455 Ga0495686_0070436
1456 Ga0495602_0108358
1457 Ga0495615_0009959
1458 Ga0495626_0068301
1459 Ga0496100_0045934
1460 Ga0496101_0135237
1461 Ga0496105_0191531
1462 Ga0496106_0005397
1463 Ga0496106_0048548
1464 Ga0496107_0029760
1465 Ga0496108_0021012
1466 Ga0496108_0030229
1467 Ga0496108_0067918
1468 Ga0496109_0033646
1469 Ga0496109_0161275
1470 Ga0496109_0357229
1471 Ga0496110_0169675
1472 Ga0496110_0206768
1473 Ga0496110_0227151
1474 Ga0496112_0243110
1475 Ga0496113_0095302
1476 Ga0496114_0191409
1477 Ga0496121_0020827
1478 Ga0496124_0000786
1479 Ga0496124_0020618
1480 Ga0496125_0013748
1481 Ga0496125_0101321
1482 Ga0501308_000249
1483 Ga0501298_022602
1484 Ga0501043_0000149
1485 Ga0501046_0000092
1486 Ga0501047_0000028
1487 Ga0501048_0009579
1488 Ga0501198_000025
1489 Ga0501222_000033
1490 Ga0501266_004365
1491 Ga0501045_0000170
1492 nmdc:mga03683_17309_c1
1493 nmdc:mga03683_3783_c1
1494 nmdc:mga03683_85418_c1
1495 nmdc:mga03n38_59282_c1
1496 nmdc:mga00v17_91914_c1
1497 nmdc:mga0k408_155059_c1
1498 nmdc:mga0k408_155942_c1
1499 nmdc:mga0k408_176186_c1
1500 nmdc:mga0k408_25211_c1
1501 nmdc:mga0k408_311592_c1
1502 nmdc:mga0k408_3397_c1
1503 nmdc:mga0k408_355_c1
1504 nmdc:mga0k408_3626_c1
1505 nmdc:mga0k408_39694_c1
1506 nmdc:mga0k408_4604_c1
1507 nmdc:mga0k408_5230_c1
1508 nmdc:mga0k408_5904_c1
1509 nmdc:mga0k408_61849_c1
1510 nmdc:mga0k408_7403_c1
1511 nmdc:mga0k408_84277_c1
1512 nmdc:mga0k408_887_c1
1513 nmdc:mga06z11_118871_c1
1514 nmdc:mga06z11_15743_c1
1515 nmdc:mga06z11_48066_c1
1516 nmdc:mga07m45_12176_c1
1517 nmdc:mga07m45_207402_c1
1518 nmdc:mga07m45_259208_c1
1519 nmdc:mga07m45_31570_c1
1520 nmdc:mga07m45_31586_c1
1521 nmdc:mga07m45_4980_c1
1522 nmdc:mga07m45_67_c1
1523 nmdc:mga07m45_70513_c1
1524 nmdc:mga07m45_9417_c1
1525 nmdc:mga05p37_103040_c1
1526 nmdc:mga09592_4802_c1
1527 nmdc:mga0qj67_28953_c1
1528 nmdc:mga0n895_70045_c1
1529 nmdc:mga0rr50_104604_c1
1530 nmdc:mga0sz30_123062_c1
1531 nmdc:mga0sz30_16889_c1
1532 Ga0495619_0059888
1533 Ga0500578_0000213
1534 Ga0500644_0049144
1535 Ga0500651_0032774
1536 Ga0500594_0003064
1537 Ga0500652_000839
1538 Ga0500658_0002883
1539 Ga0500559_0000214
1540 Ga0500568_0011383
1541 Ga0500590_041434
1542 Ga0500604_0032043
1543 Ga0500619_000325
1544 Ga0500622_0001490
1545 Ga0500622_0003145
1546 Ga0500636_0165183
1547 Ga0500645_004966
1548 2587724859
1549 2587736734
1550 2587755614
1551 2588295344
1552 2643970216
1553 2644058780
1554 2644071022
1555 2644142386
1556 2644246995
1557 2644275148
1558 2644303986
1559 2739245210
1560 2816471552
1561 2831865506
1562 2886850507

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00348

polyprenyl_synt

Polyprenyl synthetase

45

307

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3krf-assembly1.cif.gz_D mint heterotetrameric geranyl pyrophosphate synthase in complex with magnesium, ipp, and dmaspp (i) 0.9499 6 295
5ayp-assembly1.cif.gz_A crystal structure of bacillus stearothermophilus farnesyl pyrophosphate synthase 0.9491 4 293
3krp-assembly3.cif.gz_D mint heterotetrameric geranyl pyrophosphate synthase in complex with magnesium and gpp 0.9464 6 295
5ayp-assembly1.cif.gz_A crystal structure of bacillus stearothermophilus farnesyl pyrophosphate synthase 0.942 4 293
7lbj-assembly1.cif.gz_B crystal structure of octaprenyl diphosphate synthase from stenotrophomonas maltophilia 0.9416 4 295
ID Description Score Start End Superfamily
5aypA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9491 4 293 1.10.600.10
5aypA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.942 4 293 1.10.600.10
1rqjB00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9313 6 295 1.10.600.10
af_A0A0P0V0B7_118_416_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9201 6 295 1.10.600.10
3m0gA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9168 6 292 1.10.600.10
ID Description Score Start End GO Terms
AF-A0A254N7X3-F1-model_v4 Polyprenyl synthetase 0.9806 38 295 GO:0004659
GO:0005737
GO:0008299
AF-A0A2R4E113-F1-model_v4 deleted 0.9765 65 295
AF-A0A3N1WVU2-F1-model_v4 Farnesyl diphosphate synthase 0.9744 6 295 GO:0004659
GO:0008299
AF-A0A254N7X3-F1-model_v4 Polyprenyl synthetase 0.9731 38 295 GO:0004659
GO:0005737
GO:0008299
AF-A0A372EL17-F1-model_v4 Polyprenyl synthetase family protein 0.9691 1 295 GO:0004659
GO:0005737
GO:0008299

Map