F480569

General Info

Members Datasets Scaffolds Average Seq Length
781 445 703 150

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0123048|Ga0395899_0123048_310_789
Length 159
Sequence MTAPRVAQPRLVVDFDKLLTMAGADLGATDWLEITQDRVNLFADATDDHQWIHVDPERAKDGPFGAPIAHGFLTLSLLIPFWGELFDVEGVTTKVNYGLDRVRFTSPVKVGSKVRMLGQIAEVSEVKGAGAQIKVNATIEIEGQERPAVVAEFLARFYK

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
3 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
4 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
5 2643221597 Microbacterium sp. Root180 Isolate Unclassified
6 2643221647 Streptomyces sp. Root369 Isolate Unclassified
7 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
8 2643221714 Streptomyces sp. Root264 Isolate Unclassified
9 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
10 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
11 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
12 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
13 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
14 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
15 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
16 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
17 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
18 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
19 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
20 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
21 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
22 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
23 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
24 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
25 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
26 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
27 2862574272 Streptomyces sp. AcE210 Isolate Nodule
28 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
29 2867428634 Streptomyces sp. RP5T Isolate Unclassified
30 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
31 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
32 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
33 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
34 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
35 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
36 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
37 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
38 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
39 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
40 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
41 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
42 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
43 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
44 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
45 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
46 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
47 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
48 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
49 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
50 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
51 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
52 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
53 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
54 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
55 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
56 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
57 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
58 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
59 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
60 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
61 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
62 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
63 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
64 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
65 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
66 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
67 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
68 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
69 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
70 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
71 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
72 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
73 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
74 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
75 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
76 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
77 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
78 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
79 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
80 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
81 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
82 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
83 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
84 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
85 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
95 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
96 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
101 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
102 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
119 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
120 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
123 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
159 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
160 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
161 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
166 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
167 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
181 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
189 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
190 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
191 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
192 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
193 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
194 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
195 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
196 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
197 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
198 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
199 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
200 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
201 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
202 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
203 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
204 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
205 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
206 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
207 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
208 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
209 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
210 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
211 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
212 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
213 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
214 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
215 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
216 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
217 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
218 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
219 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
220 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
221 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
222 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
223 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
224 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
225 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
226 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
227 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
228 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
233 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
234 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
237 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
238 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
239 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
240 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
241 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
242 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
243 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
244 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
245 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
246 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
247 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
248 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
249 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
250 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
253 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
254 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
255 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
259 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
260 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
261 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
262 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
263 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
264 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
265 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
266 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
267 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
268 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
269 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
270 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
271 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
272 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
273 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
274 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
275 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
276 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
277 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
278 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
279 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
280 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
281 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
282 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
283 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
284 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
285 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
286 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
287 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
288 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
289 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
290 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
291 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
292 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
293 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
294 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
295 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
296 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
297 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
298 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
299 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
300 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
301 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
302 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
303 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
304 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
305 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
306 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
307 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
308 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
309 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
310 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
313 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
314 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
315 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
316 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
317 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
318 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
319 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
320 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
321 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
322 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
323 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
324 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
325 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
326 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
327 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
328 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
329 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
330 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
331 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
332 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
333 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
334 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
335 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
336 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
337 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
338 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
339 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
340 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
341 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
342 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
343 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
347 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
371 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
372 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
373 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
374 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
375 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
376 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
377 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
378 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
379 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
380 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
381 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
382 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
384 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
385 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
386 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
387 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
388 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
389 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
390 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
391 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
392 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
393 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
394 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
395 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
396 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
397 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
398 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
399 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
400 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
401 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
402 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
403 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
404 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
405 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
406 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
407 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
408 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
409 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
410 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
411 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
412 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
413 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
414 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
415 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
416 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
417 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
418 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
419 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
420 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
421 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
422 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
423 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
424 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
425 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
426 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
427 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
428 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
429 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
434 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
435 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
436 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
437 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
438 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
439 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
440 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
441 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
442 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
443 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
444 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
445 8054727385 Micromonospora alfalfae MED01 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.71
Metatranscriptomes 2.3
Isolates 9.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.96
Nodule 0.64
Rhizoplane 4.35
Rhizosphere 75.42
Stem 0
Stem Tuber 0.13
Unclassified 10.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10022416 3300001989 Bacteria 2240
2 JGI24737J22298_10107585 3300001990 Bacteria 826
3 JGI24735J21928_10091439 3300002067 Bacteria 872
4 JGI24738J21930_10073941 3300002075 Bacteria 708
5 JGI25160J50197_1021111 3300003354 Bacteria 1945
6 JGI25160J50197_1021183 3300003354 Bacteria 1940
7 Ga0055542_1008192 3300003762 Bacteria 2060
8 Ga0065714_10032115 3300005288 Bacteria 1094
9 Ga0065714_10070825 3300005288 Bacteria 3754
10 Ga0065714_10095341 3300005288 Bacteria 1789
11 Ga0065714_10096532 3300005288 Bacteria 1754
12 Ga0065712_10156388 3300005290 Bacteria 1332
13 Ga0070670_100269497 3300005331 Bacteria 1485
14 Ga0070677_10060718 3300005333 Bacteria 1558
15 Ga0070666_10002269 3300005335 Bacteria 11616
16 Ga0070666_10447732 3300005335 Bacteria 932
17 Ga0070668_100039209 3300005347 Bacteria 3623
18 Ga0070668_100265087 3300005347 Bacteria 1430
19 Ga0070675_100064772 3300005354 Bacteria 3021
20 Ga0070671_100004562 3300005355 Bacteria 10971
21 Ga0070671_100214555 3300005355 Bacteria 1633
22 Ga0070674_100004502 3300005356 Bacteria 7952
23 Ga0070673_100042527 3300005364 Bacteria 3504
24 Ga0070673_101449030 3300005364 Bacteria 647
25 Ga0070667_100096351 3300005367 Bacteria 2551
26 Ga0070698_101188237 3300005471 Bacteria 712
27 Ga0070672_100095555 3300005543 Bacteria 2403
28 Ga0070665_100122008 3300005548 Bacteria 2608
29 Ga0070665_100362641 3300005548 Bacteria 1455
30 Ga0068856_100094109 3300005614 Bacteria 2983
31 Ga0068864_100023949 3300005618 Bacteria 5131
32 Ga0068870_10292500 3300005840 Bacteria 1025
33 Ga0068863_100500960 3300005841 Bacteria 1196
34 Ga0081455_10303849 3300005937 Bacteria 1143
35 Ga0075365_10064376 3300006038 Bacteria 2456
36 Ga0075365_10087589 3300006038 Bacteria 2117
37 Ga0075365_10240289 3300006038 Bacteria 1272
38 Ga0075365_10467485 3300006038 Bacteria 891
39 Ga0075368_10004371 3300006042 Bacteria 4785
40 Ga0075364_10013237 3300006051 Bacteria 5064
41 Ga0075432_10216997 3300006058 Bacteria 763
42 Ga0075367_10000434 3300006178 Bacteria 15538
43 Ga0075367_10527346 3300006178 Bacteria 750
44 Ga0075369_10006180 3300006186 Bacteria 4520
45 Ga0075369_10103748 3300006186 Bacteria 1277
46 Ga0075429_100291719 3300006880 Bacteria 1428
47 Ga0099826_10048198 3300006948 Bacteria 2885
48 Ga0105251_10078766 3300009011 Bacteria 1526
49 Ga0105244_10013281 3300009036 Bacteria 4823
50 Ga0105244_10029982 3300009036 Bacteria 2899
51 Ga0105244_10032502 3300009036 Bacteria 2761
52 Ga0114129_10004812 3300009147 Bacteria 19081
53 Ga0114129_11305114 3300009147 Bacteria 899
54 Ga0105243_10054006 3300009148 Bacteria 3188
55 Ga0105243_10233148 3300009148 Bacteria 1634
56 Ga0105242_10288171 3300009176 Bacteria 1494
57 Ga0105242_10363794 3300009176 Bacteria 1339
58 Ga0105248_10000710 3300009177 Bacteria 37689
59 Ga0105248_10033988 3300009177 Bacteria 5700
60 Ga0105237_10163014 3300009545 Bacteria 2228
61 Ga0105239_10495401 3300010375 Bacteria 1389
62 Ga0105246_10034863 3300011119 Bacteria 3358
63 Ga0105246_10053677 3300011119 Bacteria 2775
64 Ga0105246_10110337 3300011119 Bacteria 2020
65 Ga0105246_10128160 3300011119 Bacteria 1891
66 Ga0105246_10314261 3300011119 Bacteria 1270
67 Ga0105246_11174564 3300011119 Bacteria 705
68 Ga0157373_10014861 3300013100 Bacteria 5701
69 Ga0157371_10426476 3300013102 Bacteria 973
70 Ga0157371_10757235 3300013102 Bacteria 730
71 Ga0157369_10033375 3300013105 Bacteria 5657
72 Ga0157369_10339903 3300013105 Bacteria 1559
73 Ga0163162_10081450 3300013306 Bacteria 3308
74 Ga0157372_10179178 3300013307 Bacteria 2453
75 Ga0157375_10189265 3300013308 Bacteria 2212
76 Ga0163163_10008428 3300014325 Bacteria 9159
77 Ga0182008_10025649 3300014497 Bacteria 2994
78 Ga0182006_1026052 3300015261 Bacteria 2397
79 Ga0182007_10001776 3300015262 Bacteria 11267
80 Ga0183367_1001 3300015688 Bacteria 1225545
81 Ga0163161_10792209 3300017792 Bacteria 796
82 Ga0213875_10014079 3300021388 Bacteria 3910
83 Ga0209148_1004731 3300025254 Bacteria 3272
84 Ga0209148_1016153 3300025254 Bacteria 1289
85 Ga0207426_1005303 3300025302 Bacteria 5935
86 Ga0209051_1030266 3300025303 Bacteria 2103
87 Ga0207697_10000412 3300025315 Bacteria 24182
88 Ga0207697_10000464 3300025315 Bacteria 22857
89 Ga0207655_1004337 3300025728 Bacteria 10109
90 Ga0207655_1011840 3300025728 Bacteria 5153
91 Ga0207655_1065198 3300025728 Bacteria 1384
92 Ga0207713_1074250 3300025735 Bacteria 1245
93 Ga0207682_10004974 3300025893 Bacteria 5456
94 Ga0207688_10047132 3300025901 Bacteria 2407
95 Ga0207680_10067585 3300025903 Bacteria 2202
96 Ga0207647_10006249 3300025904 Bacteria 8679
97 Ga0207647_10105977 3300025904 Bacteria 1665
98 Ga0207645_10003534 3300025907 Bacteria 11823
99 Ga0207643_10055583 3300025908 Bacteria 2251
100 Ga0207671_10103954 3300025914 Bacteria 2154
101 Ga0207681_10025179 3300025923 Bacteria 3824
102 Ga0207650_10063598 3300025925 Bacteria 2759
103 Ga0207650_10148713 3300025925 Bacteria 1847
104 Ga0207659_10014484 3300025926 Bacteria 5088
105 Ga0207687_10092445 3300025927 Bacteria 2209
106 Ga0207644_10124615 3300025931 Bacteria 1965
107 Ga0207644_10148260 3300025931 Bacteria 1813
108 Ga0207686_10222520 3300025934 Bacteria 1364
109 Ga0207686_10562836 3300025934 Bacteria 893
110 Ga0207709_10156541 3300025935 Bacteria 1584
111 Ga0207669_10013767 3300025937 Bacteria 4032
112 Ga0207691_10001950 3300025940 Bacteria 20152
113 Ga0207711_10000398 3300025941 Bacteria 45914
114 Ga0207711_10140047 3300025941 Bacteria 2176
115 Ga0207667_10524641 3300025949 Bacteria 1200
116 Ga0207651_10040419 3300025960 Bacteria 3085
117 Ga0207712_10527227 3300025961 Bacteria 1013
118 Ga0207668_10029555 3300025972 Bacteria 3593
119 Ga0207668_10241810 3300025972 Bacteria 1461
120 Ga0207658_10004961 3300025986 Bacteria 9176
121 Ga0207639_11125898 3300026041 Bacteria 736
122 Ga0207702_10128157 3300026078 Bacteria 2281
123 Ga0207641_10353841 3300026088 Bacteria 1400
124 Ga0207641_10624395 3300026088 Bacteria 1057
125 Ga0207676_10034653 3300026095 Bacteria 3823
126 Ga0209813_10004127 3300027866 Bacteria 3449
127 Ga0207428_10054253 3300027907 Bacteria 3193
128 Ga0268266_10422410 3300028379 Bacteria 1263
129 Ga0268266_10805624 3300028379 Bacteria 907
130 Ga0307517_10006022 3300028786 Bacteria 18070
131 Ga0307517_10006310 3300028786 Bacteria 17596
132 Ga0307515_10000441 3300028794 Bacteria 99819
133 Ga0307511_10000078 3300030521 Bacteria 81896
134 Ga0307511_10027884 3300030521 Bacteria 5146
135 Ga0307512_10002991 3300030522 Bacteria 20377
136 Ga0307512_10044256 3300030522 Bacteria 3662
137 Ga0307512_10222007 3300030522 Bacteria 986
138 Ga0307513_10002116 3300031456 Bacteria 27860
139 Ga0307513_10022839 3300031456 Bacteria 7339
140 Ga0307513_10085929 3300031456 Bacteria 3227
141 Ga0307513_10342752 3300031456 Bacteria 1244
142 Ga0307509_10086034 3300031507 Bacteria 3233
143 Ga0307509_10092633 3300031507 Bacteria 3088
144 Ga0307509_10105905 3300031507 Bacteria 2832
145 Ga0307509_10259050 3300031507 Bacteria 1516
146 Ga0307408_100010705 3300031548 Bacteria 6050
147 Ga0307408_100027835 3300031548 Bacteria 3899
148 Ga0307408_100035995 3300031548 Bacteria 3476
149 Ga0307408_100154421 3300031548 Bacteria 1815
150 Ga0307408_100170889 3300031548 Bacteria 1735
151 Ga0307508_10010698 3300031616 Bacteria 8387
152 Ga0307508_10219605 3300031616 Bacteria 1500
153 Ga0307508_10302913 3300031616 Bacteria 1191
154 Ga0307514_10054370 3300031649 Bacteria 3084
155 Ga0307514_10100603 3300031649 Bacteria 2077
156 Ga0307514_10294059 3300031649 Bacteria 916
157 Ga0307514_10368325 3300031649 Bacteria 754
158 Ga0307516_10218051 3300031730 Bacteria 1619
159 Ga0307405_10010781 3300031731 Bacteria 4754
160 Ga0307405_10020383 3300031731 Bacteria 3704
161 Ga0307405_10048076 3300031731 Bacteria 2629
162 Ga0307405_10783132 3300031731 Bacteria 797
163 Ga0307413_10080964 3300031824 Bacteria 2081
164 Ga0307413_10189163 3300031824 Bacteria 1476
165 Ga0307413_10401942 3300031824 Bacteria 1073
166 Ga0307518_10014202 3300031838 Bacteria 5690
167 Ga0307518_10111619 3300031838 Bacteria 1947
168 Ga0307410_10004832 3300031852 Bacteria 7039
169 Ga0307410_10005726 3300031852 Bacteria 6619
170 Ga0307410_10124464 3300031852 Bacteria 1885
171 Ga0307410_10127411 3300031852 Bacteria 1865
172 Ga0307410_10206902 3300031852 Bacteria 1501
173 Ga0307406_10000260 3300031901 Bacteria 31960
174 Ga0307406_10052336 3300031901 Bacteria 2597
175 Ga0307406_11315990 3300031901 Bacteria 631
176 Ga0307407_10010735 3300031903 Bacteria 4330
177 Ga0307407_10014824 3300031903 Bacteria 3830
178 Ga0307407_10033544 3300031903 Bacteria 2802
179 Ga0307407_10128152 3300031903 Bacteria 1619
180 Ga0307412_10014340 3300031911 Bacteria 4671
181 Ga0307412_10019875 3300031911 Bacteria 4077
182 Ga0307412_10095888 3300031911 Bacteria 2086
183 Ga0307412_11373419 3300031911 Bacteria 638
184 Ga0307409_100004513 3300031995 Bacteria 7836
185 Ga0307409_100025309 3300031995 Bacteria 4159
186 Ga0307409_100362348 3300031995 Bacteria 1372
187 Ga0307409_100399464 3300031995 Bacteria 1312
188 Ga0307409_100433311 3300031995 Bacteria 1264
189 Ga0307409_100506405 3300031995 Bacteria 1177
190 Ga0307409_100628921 3300031995 Bacteria 1064
191 Ga0307416_100004263 3300032002 Bacteria 8588
192 Ga0307416_100013845 3300032002 Bacteria 5498
193 Ga0307416_100149219 3300032002 Bacteria 2141
194 Ga0307416_100179944 3300032002 Bacteria 1980
195 Ga0307416_100235966 3300032002 Bacteria 1768
196 Ga0307416_100369713 3300032002 Bacteria 1459
197 Ga0307416_102050660 3300032002 Bacteria 674
198 Ga0307414_10071158 3300032004 Bacteria 2508
199 Ga0307414_10128679 3300032004 Bacteria 1961
200 Ga0307414_10957245 3300032004 Bacteria 787
201 Ga0307411_10159211 3300032005 Bacteria 1688
202 Ga0307411_10316001 3300032005 Bacteria 1259
203 Ga0307415_100616398 3300032126 Bacteria 968
204 Ga0307415_100708144 3300032126 Bacteria 909
205 Ga0307507_10014173 3300033179 Bacteria 9543
206 Ga0307507_10049696 3300033179 Bacteria 4059
207 Ga0307507_10342860 3300033179 Bacteria 884
208 Ga0307510_10018716 3300033180 Bacteria 8138
209 Ga0307510_10220371 3300033180 Bacteria 1409
210 Ga0395899_0006498 3300037312 Bacteria 9057
211 Ga0395899_0123048 3300037312 Bacteria 1856
212 Ga0395899_0285854 3300037312 Bacteria 1120
213 Ga0395900_0021768 3300037418 Bacteria 6555
214 Ga0395900_0115912 3300037418 Bacteria 2749
215 Ga0395900_0137022 3300037418 Bacteria 2508
216 Ga0395900_0388892 3300037418 Bacteria 1361
217 Ga0395898_0005196 3300037466 Bacteria 14074
218 Ga0395898_0005339 3300037466 Bacteria 13893
219 Ga0395898_0014229 3300037466 Bacteria 8179
220 Ga0395898_0125480 3300037466 Bacteria 2459
221 Ga0395898_0141104 3300037466 Bacteria 2306
222 Ga0395898_0192705 3300037466 Bacteria 1947
223 Ga0395905_0031908 3300037471 Bacteria 4956
224 Ga0395905_0036918 3300037471 Bacteria 4590
225 Ga0395905_0408133 3300037471 Bacteria 1254
226 Ga0436364_0460308 3300037853 Bacteria 5443
227 Ga0395901_0004781 3300038443 Bacteria 13667
228 Ga0395901_0093943 3300038443 Bacteria 3141
229 Ga0395901_0115025 3300038443 Bacteria 2825
230 Ga0395901_0128743 3300038443 Bacteria 2661
231 Ga0395901_0675443 3300038443 Bacteria 1033
232 Ga0439436_0000674 3300041404 Bacteria 9163
233 Ga0439436_0001517 3300041404 Bacteria 6747
234 Ga0439436_0022429 3300041404 Bacteria 1870
235 Ga0439438_015554 3300041405 Bacteria 2235
236 Ga0439438_032003 3300041405 Bacteria 1396
237 Ga0439439_0001987 3300041406 Bacteria 4245
238 Ga0439439_0010900 3300041406 Bacteria 2180
239 Ga0439439_0020330 3300041406 Bacteria 1651
240 Ga0439447_096006 3300041407 Bacteria 681
241 Ga0439466_0002356 3300041411 Bacteria 7405
242 Ga0451793_0902738 3300041452 Bacteria 638
243 Ga0451800_0099299 3300041459 Bacteria 696
244 Ga0451807_1784448 3300041486 Bacteria 763
245 Ga0451843_1323196 3300041509 Bacteria 679
246 Ga0451843_1661877 3300041509 Bacteria 646
247 Ga0451853_0041647 3300041512 Bacteria 1053
248 Ga0451853_0551214 3300041512 Bacteria 5322
249 Ga0451853_1235510 3300041512 Bacteria 1214
250 Ga0451853_2416279 3300041512 Bacteria 725
251 Ga0439431_0117664 3300041997 Bacteria 740
252 Ga0439433_0000244 3300041999 Bacteria 9092
253 Ga0439433_0000621 3300041999 Bacteria 6764
254 Ga0439433_0023570 3300041999 Bacteria 1385
255 Ga0439442_000177 3300042002 Bacteria 16193
256 Ga0439442_000461 3300042002 Bacteria 9280
257 Ga0439442_000602 3300042002 Bacteria 7758
258 Ga0439442_001218 3300042002 Bacteria 5115
259 Ga0439442_008031 3300042002 Bacteria 2134
260 Ga0439448_0002008 3300042005 Bacteria 5435
261 Ga0439432_059060 3300042006 Bacteria 1185
262 Ga0439432_215879 3300042006 Bacteria 554
263 Ga0439449_0001345 3300042007 Bacteria 9628
264 Ga0439449_0001787 3300042007 Bacteria 8464
265 Ga0439449_0018526 3300042007 Bacteria 2613
266 Ga0439449_0047321 3300042007 Bacteria 1593
267 Ga0439449_0143415 3300042007 Bacteria 889
268 Ga0439455_0007567 3300042012 Bacteria 2301
269 Ga0439457_000160 3300042014 Bacteria 17392
270 Ga0439457_003062 3300042014 Bacteria 4626
271 Ga0439457_006602 3300042014 Bacteria 2828
272 Ga0439457_009717 3300042014 Bacteria 2231
273 Ga0439462_0008371 3300042015 Bacteria 2606
274 Ga0439462_0028777 3300042015 Bacteria 1469
275 Ga0450919_017143 3300042121 Bacteria 817
276 Ga0450920_000125 3300042122 Bacteria 10438
277 Ga0450920_053415 3300042122 Bacteria 812
278 Ga0450894_000018 3300042131 Bacteria 23505
279 Ga0450898_002345 3300042134 Bacteria 2637
280 Ga0450899_004593 3300042135 Bacteria 1478
281 Ga0450903_001349 3300042138 Bacteria 4590
282 Ga0450906_045875 3300042145 Bacteria 771
283 Ga0450907_000222 3300042146 Bacteria 19774
284 Ga0439458_0000209 3300042157 Bacteria 13705
285 Ga0439458_0038764 3300042157 Bacteria 1151
286 Ga0439434_0019212 3300042435 Bacteria 2048
287 Ga0450918_008388 3300042531 Bacteria 1814
288 Ga0466969_0004293 3300044656 Bacteria 7584
289 Ga0466969_0187890 3300044656 Bacteria 945
290 Ga0466972_0003388 3300044658 Bacteria 7903
291 Ga0466972_0004342 3300044658 Bacteria 7085
292 Ga0466965_0001808 3300044683 Bacteria 8870
293 Ga0466965_0029978 3300044683 Bacteria 2649
294 Ga0466965_0045104 3300044683 Bacteria 2180
295 Ga0466966_0010922 3300044684 Bacteria 6030
296 Ga0466966_0050526 3300044684 Bacteria 2644
297 Ga0466961_0002778 3300044693 Bacteria 10881
298 Ga0466961_0028380 3300044693 Bacteria 3598
299 Ga0466961_0111138 3300044693 Bacteria 1724
300 Ga0466961_0200447 3300044693 Bacteria 1235
301 Ga0466963_0000949 3300044694 Bacteria 14861
302 Ga0466963_0184201 3300044694 Bacteria 1458
303 Ga0466971_0000294 3300044719 Bacteria 19117
304 Ga0466971_0071271 3300044719 Bacteria 1578
305 Ga0466971_0208312 3300044719 Bacteria 924
306 Ga0466968_0045533 3300044735 Bacteria 1862
307 Ga0466970_0001385 3300044765 Bacteria 11683
308 Ga0466970_0058297 3300044765 Bacteria 2067
309 Ga0466970_0168892 3300044765 Bacteria 1212
310 Ga0466957_0000752 3300044842 Bacteria 16515
311 Ga0466960_0070020 3300044901 Bacteria 1744
312 Ga0466960_0073699 3300044901 Bacteria 1704
313 Ga0466959_0006963 3300045049 Bacteria 7900
314 Ga0466959_0560877 3300045049 Bacteria 770
315 Ga0466958_0037735 3300045836 Bacteria 2895
316 Ga0466958_0582812 3300045836 Bacteria 727
317 Ga0466967_0008755 3300045976 Bacteria 7455
318 Ga0466967_0070648 3300045976 Bacteria 3124
319 Ga0495592_0027299 3300046454 Bacteria 4329
320 Ga0495592_0033670 3300046454 Bacteria 3864
321 Ga0495603_0066929 3300046455 Bacteria 2116
322 Ga0495603_0095950 3300046455 Bacteria 1732
323 Ga0495603_0269113 3300046455 Bacteria 980
324 Ga0495590_0089424 3300046457 Bacteria 1089
325 Ga0495629_0009641 3300046459 Bacteria 7053
326 Ga0495629_0130143 3300046459 Bacteria 1753
327 Ga0495629_0181123 3300046459 Bacteria 1460
328 Ga0495638_0238348 3300046460 Bacteria 1008
329 Ga0495651_0019860 3300046462 Bacteria 5210
330 Ga0495651_0020501 3300046462 Bacteria 5132
331 Ga0495651_0063023 3300046462 Bacteria 2835
332 Ga0495653_0019851 3300046463 Bacteria 5447
333 Ga0495650_0000546 3300046471 Bacteria 53831
334 Ga0495650_0003187 3300046471 Bacteria 12224
335 Ga0495650_0063387 3300046471 Bacteria 1474
336 Ga0495580_0017553 3300046472 Bacteria 5349
337 Ga0495580_0019062 3300046472 Bacteria 5101
338 Ga0495580_0197621 3300046472 Bacteria 1386
339 Ga0495582_0033939 3300046473 Bacteria 2806
340 Ga0495605_0007297 3300046474 Bacteria 6279
341 Ga0495605_0404418 3300046474 Bacteria 567
342 Ga0495639_0023328 3300046475 Bacteria 2718
343 Ga0495662_0001106 3300046476 Bacteria 13271
344 Ga0495662_0003749 3300046476 Bacteria 7662
345 Ga0495662_0014964 3300046476 Bacteria 3769
346 Ga0495664_0000944 3300046477 Bacteria 14940
347 Ga0495664_0003495 3300046477 Bacteria 8557
348 Ga0495585_0056783 3300046492 Bacteria 2161
349 Ga0495585_0058063 3300046492 Bacteria 2135
350 Ga0495585_0073027 3300046492 Bacteria 1868
351 Ga0495594_0031678 3300046499 Bacteria 2867
352 Ga0495594_0071436 3300046499 Bacteria 1930
353 Ga0495594_0200556 3300046499 Bacteria 1137
354 Ga0495594_0252323 3300046499 Bacteria 1005
355 Ga0495607_0074060 3300046501 Bacteria 1891
356 Ga0495583_0067092 3300046506 Bacteria 1585
357 Ga0495583_0126737 3300046506 Bacteria 1071
358 Ga0495606_0011656 3300046507 Bacteria 7143
359 Ga0495608_0038091 3300046511 Bacteria 3231
360 Ga0495610_0049125 3300046512 Bacteria 2067
361 Ga0495610_0264893 3300046512 Bacteria 675
362 Ga0495616_0034668 3300046513 Bacteria 2618
363 Ga0495618_0071521 3300046514 Bacteria 2207
364 Ga0495618_0197349 3300046514 Bacteria 1274
365 Ga0495620_0059732 3300046515 Bacteria 1592
366 Ga0495620_0063354 3300046515 Bacteria 1533
367 Ga0495620_0186575 3300046515 Bacteria 801
368 Ga0495628_0009491 3300046516 Bacteria 8306
369 Ga0495628_0119453 3300046516 Bacteria 2023
370 Ga0495628_0474891 3300046516 Bacteria 905
371 Ga0495630_0112967 3300046517 Bacteria 2057
372 Ga0495631_0004500 3300046518 Bacteria 7409
373 Ga0495631_0020553 3300046518 Bacteria 3084
374 Ga0495631_0405693 3300046518 Bacteria 580
375 Ga0495632_0028377 3300046519 Bacteria 2921
376 Ga0495637_0011728 3300046520 Bacteria 4206
377 Ga0495643_0015471 3300046522 Bacteria 4507
378 Ga0495643_0021595 3300046522 Bacteria 3691
379 Ga0495643_0218012 3300046522 Bacteria 907
380 Ga0495643_0324793 3300046522 Bacteria 695
381 Ga0495644_0282447 3300046523 Bacteria 648
382 Ga0495663_0051533 3300046525 Bacteria 1275
383 Ga0495666_0001706 3300046526 Bacteria 10856
384 Ga0495666_0014223 3300046526 Bacteria 3965
385 Ga0495642_0018991 3300046528 Bacteria 2692
386 Ga0495652_0135094 3300046529 Bacteria 1947
387 Ga0495652_0151885 3300046529 Bacteria 1808
388 Ga0495652_0213392 3300046529 Bacteria 1455
389 Ga0495652_0447181 3300046529 Bacteria 905
390 Ga0495665_0051007 3300046531 Bacteria 2192
391 Ga0495665_0052305 3300046531 Bacteria 2162
392 Ga0495640_0004901 3300046533 Bacteria 10642
393 Ga0495640_0119508 3300046533 Bacteria 1714
394 Ga0495586_0016082 3300046535 Bacteria 3981
395 Ga0495586_0042314 3300046535 Bacteria 2453
396 Ga0495586_0158607 3300046535 Bacteria 1275
397 Ga0495586_0300947 3300046535 Bacteria 919
398 Ga0495586_0813105 3300046535 Bacteria 539
399 Ga0495587_0005723 3300046536 Bacteria 8099
400 Ga0495587_0017657 3300046536 Bacteria 4430
401 Ga0495621_0210382 3300046539 Bacteria 785
402 Ga0495597_0061951 3300046542 Bacteria 1628
403 Ga0495645_0001887 3300046543 Bacteria 14246
404 Ga0495645_0011669 3300046543 Bacteria 6186
405 Ga0495645_0013935 3300046543 Bacteria 5699
406 Ga0495645_0147148 3300046543 Bacteria 1640
407 Ga0495622_0094613 3300046557 Bacteria 1371
408 Ga0495622_0129063 3300046557 Bacteria 1152
409 Ga0495633_0010590 3300046558 Bacteria 5025
410 Ga0495667_0021005 3300046559 Bacteria 4403
411 Ga0495667_0263332 3300046559 Bacteria 1096
412 Ga0495656_0000824 3300046615 Bacteria 9975
413 Ga0495656_0076739 3300046615 Bacteria 1498
414 Ga0495656_0099734 3300046615 Bacteria 1341
415 Ga0495668_0011623 3300046616 Bacteria 5265
416 Ga0495668_0021391 3300046616 Bacteria 3709
417 Ga0495634_0003733 3300046642 Bacteria 12131
418 Ga0495634_0072823 3300046642 Bacteria 2259
419 Ga0495634_0095140 3300046642 Bacteria 1929
420 Ga0495611_0047008 3300046648 Bacteria 1936
421 Ga0495611_0092495 3300046648 Bacteria 1398
422 Ga0495611_0300197 3300046648 Bacteria 740
423 Ga0495625_0003398 3300046660 Bacteria 15934
424 Ga0495625_0082137 3300046660 Bacteria 2241
425 Ga0495625_0132201 3300046660 Bacteria 1690
426 Ga0495625_0157267 3300046660 Bacteria 1524
427 Ga0495635_0019722 3300046663 Bacteria 4696
428 Ga0495635_0067921 3300046663 Bacteria 2444
429 Ga0495659_0001350 3300046664 Bacteria 8432
430 Ga0495661_0150276 3300046665 Bacteria 1259
431 Ga0495588_0000457 3300046674 Bacteria 20545
432 Ga0495588_0304120 3300046674 Bacteria 839
433 Ga0495657_0009095 3300046675 Bacteria 7550
434 Ga0495657_0082483 3300046675 Bacteria 2077
435 Ga0495657_0125780 3300046675 Bacteria 1610
436 Ga0495657_0239046 3300046675 Bacteria 1096
437 Ga0495599_0090721 3300046678 Bacteria 1906
438 Ga0495599_0292368 3300046678 Bacteria 985
439 Ga0495623_0057784 3300046679 Bacteria 2439
440 Ga0495623_0258735 3300046679 Bacteria 976
441 Ga0495646_0006326 3300046680 Bacteria 7513
442 Ga0495646_0147915 3300046680 Bacteria 1308
443 Ga0495646_0403827 3300046680 Bacteria 710
444 Ga0495658_0127343 3300046683 Bacteria 1547
445 Ga0495613_0008940 3300046689 Bacteria 7434
446 Ga0495613_0028895 3300046689 Bacteria 4123
447 Ga0495613_0045655 3300046689 Bacteria 3239
448 Ga0495613_0063712 3300046689 Bacteria 2696
449 Ga0495670_0000592 3300046691 Bacteria 17270
450 Ga0495670_0058317 3300046691 Bacteria 1938
451 Ga0495670_0228477 3300046691 Bacteria 989
452 Ga0495671_0037936 3300046692 Bacteria 2435
453 Ga0495649_0198706 3300046694 Bacteria 1042
454 Ga0495589_0001319 3300046794 Bacteria 14568
455 Ga0495589_0018296 3300046794 Bacteria 3594
456 Ga0495589_0021412 3300046794 Bacteria 3304
457 Ga0495589_0041917 3300046794 Bacteria 2282
458 Ga0495589_0052568 3300046794 Bacteria 2012
459 Ga0495589_0350472 3300046794 Bacteria 680
460 Ga0495600_0013998 3300046809 Bacteria 5055
461 Ga0495600_0022370 3300046809 Bacteria 4057
462 Ga0495600_0106144 3300046809 Bacteria 1830
463 Ga0495600_0281739 3300046809 Bacteria 1052
464 Ga0495600_0377197 3300046809 Bacteria 885
465 Ga0495660_0028052 3300046810 Bacteria 3183
466 Ga0495581_0020074 3300047315 Bacteria 3879
467 Ga0495581_0020881 3300047315 Bacteria 3800
468 Ga0495581_0048637 3300047315 Bacteria 2448
469 Ga0495581_0185057 3300047315 Bacteria 1218
470 Ga0495581_0188964 3300047315 Bacteria 1204
471 Ga0495604_0003998 3300047317 Bacteria 11732
472 Ga0495604_0124992 3300047317 Bacteria 1856
473 Ga0495636_0000549 3300047318 Bacteria 13794
474 Ga0495636_0039582 3300047318 Bacteria 1953
475 Ga0495674_0021729 3300047319 Bacteria 5931
476 Ga0495672_0270509 3300047320 Bacteria 816
477 Ga0495676_0019198 3300047321 Bacteria 6014
478 Ga0495676_0021214 3300047321 Bacteria 5679
479 Ga0495676_0038263 3300047321 Bacteria 3985
480 Ga0495676_0038606 3300047321 Bacteria 3964
481 Ga0495676_0055233 3300047321 Bacteria 3150
482 Ga0495676_0118273 3300047321 Bacteria 1932
483 Ga0495680_0627722 3300047322 Bacteria 716
484 Ga0495680_0972827 3300047322 Bacteria 544
485 Ga0495683_0025708 3300047323 Bacteria 3016
486 Ga0495683_0029820 3300047323 Bacteria 2787
487 Ga0495683_0103639 3300047323 Bacteria 1365
488 Ga0495687_003569 3300047443 Bacteria 11163
489 Ga0495687_005167 3300047443 Bacteria 8447
490 Ga0495687_027206 3300047443 Bacteria 2679
491 Ga0495675_0073327 3300047444 Bacteria 2159
492 Ga0495675_0080058 3300047444 Bacteria 2057
493 Ga0495675_0094195 3300047444 Bacteria 1878
494 Ga0495675_0435364 3300047444 Bacteria 760
495 Ga0495679_027516 3300047446 Bacteria 1875
496 Ga0495685_000946 3300047447 Bacteria 8788
497 Ga0495685_003370 3300047447 Bacteria 5096
498 Ga0495685_027572 3300047447 Bacteria 1954
499 Ga0495685_056773 3300047447 Bacteria 1323
500 Ga0495685_100898 3300047447 Bacteria 953
501 Ga0495685_212743 3300047447 Bacteria 618
502 Ga0495681_0000568 3300047470 Bacteria 28235
503 Ga0495681_0012674 3300047470 Bacteria 4941
504 Ga0495681_0016496 3300047470 Bacteria 4136
505 Ga0495681_0139148 3300047470 Bacteria 1027
506 Ga0495684_0057400 3300047471 Bacteria 2967
507 Ga0495684_0112105 3300047471 Bacteria 2057
508 Ga0495686_0022865 3300047472 Bacteria 4131
509 Ga0495686_0062562 3300047472 Bacteria 2308
510 Ga0495686_0063219 3300047472 Bacteria 2294
511 Ga0495593_0000284 3300047673 Bacteria 27640
512 Ga0495593_0021565 3300047673 Bacteria 3596
513 Ga0495593_0035318 3300047673 Bacteria 2715
514 Ga0495593_0067969 3300047673 Bacteria 1854
515 Ga0495602_0028059 3300048088 Bacteria 5396
516 Ga0495602_0053551 3300048088 Bacteria 3572
517 Ga0495602_0110671 3300048088 Bacteria 2232
518 Ga0495614_0094292 3300048089 Bacteria 1304
519 Ga0495614_0097791 3300048089 Bacteria 1280
520 Ga0495615_0103327 3300048090 Bacteria 807
521 Ga0495626_0039038 3300048091 Bacteria 2248
522 Ga0496101_0102816 3300048904 Bacteria 2140
523 Ga0496101_1326643 3300048904 Bacteria 562
524 Ga0496102_0001162 3300048905 Bacteria 24059
525 Ga0496102_0155601 3300048905 Bacteria 2149
526 Ga0496103_0013661 3300048906 Bacteria 4817
527 Ga0496103_0032272 3300048906 Bacteria 3195
528 Ga0496103_0067388 3300048906 Bacteria 2235
529 Ga0496104_0005983 3300048907 Bacteria 10657
530 Ga0496104_0147830 3300048907 Bacteria 2256
531 Ga0496104_1686106 3300048907 Bacteria 536
532 Ga0496105_0162405 3300048908 Bacteria 1834
533 Ga0496105_0171982 3300048908 Bacteria 1776
534 Ga0496106_0022157 3300048909 Bacteria 4717
535 Ga0496106_0038336 3300048909 Bacteria 3586
536 Ga0496107_0035233 3300048910 Bacteria 3587
537 Ga0496107_0701654 3300048910 Bacteria 744
538 Ga0496108_0049563 3300048911 Bacteria 3512
539 Ga0496108_0099586 3300048911 Bacteria 2478
540 Ga0496109_0030900 3300048912 Bacteria 4802
541 Ga0496109_0056531 3300048912 Bacteria 3580
542 Ga0496109_0821190 3300048912 Bacteria 868
543 Ga0496110_0346089 3300048913 Bacteria 1354
544 Ga0496111_0074255 3300048914 Bacteria 2477
545 Ga0496112_0481751 3300048915 Bacteria 1177
546 Ga0496113_0081478 3300048916 Bacteria 2481
547 Ga0496113_0338611 3300048916 Bacteria 1206
548 Ga0496114_0067809 3300048917 Bacteria 2993
549 Ga0496114_0226770 3300048917 Bacteria 1641
550 Ga0496115_0018277 3300048918 Bacteria 5379
551 Ga0496115_0455782 3300048918 Bacteria 1032
552 Ga0496116_0403434 3300048919 Bacteria 604
553 Ga0496117_0026452 3300048920 Bacteria 4539
554 Ga0496118_0009260 3300048921 Bacteria 9989
555 Ga0496119_0007391 3300048922 Bacteria 9910
556 Ga0496119_0225093 3300048922 Bacteria 958
557 Ga0496120_0006761 3300048923 Bacteria 8709
558 Ga0496122_0000358 3300048925 Bacteria 98103
559 Ga0496122_0087985 3300048925 Bacteria 2131
560 Ga0496123_0000280 3300048926 Bacteria 100544
561 Ga0496124_0015167 3300048927 Bacteria 7401
562 Ga0496124_0019241 3300048927 Bacteria 6364
563 Ga0496124_0096797 3300048927 Bacteria 2397
564 Ga0496125_0018179 3300048928 Bacteria 6680
565 Ga0496125_0029138 3300048928 Bacteria 4968
566 Ga0496126_0042674 3300048929 Bacteria 4187
567 Ga0496126_0499539 3300048929 Bacteria 972
568 Ga0501306_027925 3300049127 Bacteria 824
569 Ga0501309_011899 3300049129 Bacteria 1140
570 Ga0501307_025657 3300049162 Bacteria 792
571 Ga0495678_200504 3300049459 Bacteria 615
572 Ga0501315_034410 3300049531 Bacteria 744
573 Ga0501317_005023 3300049533 Bacteria 1401
574 Ga0501317_009295 3300049533 Bacteria 1151
575 Ga0501318_001314 3300049534 Bacteria 1917
576 Ga0501318_022387 3300049534 Bacteria 810
577 Ga0501320_017138 3300049536 Bacteria 807
578 Ga0501321_075312 3300049537 Bacteria 531
579 Ga0501324_018119 3300049540 Bacteria 703
580 Ga0501325_011144 3300049541 Bacteria 826
581 Ga0501333_005582 3300049549 Bacteria 820
582 Ga0501340_023326 3300049556 Bacteria 530
583 Ga0501031_0008351 3300049568 Bacteria 6732
584 Ga0501031_0042282 3300049568 Bacteria 2975
585 Ga0501032_0004814 3300049569 Bacteria 10121
586 Ga0501033_0090186 3300049570 Bacteria 2242
587 Ga0501033_0115404 3300049570 Bacteria 1951
588 Ga0501034_0000488 3300049571 Bacteria 64385
589 Ga0501034_0001465 3300049571 Bacteria 31253
590 Ga0501034_1252833 3300049571 Bacteria 619
591 Ga0501036_0006415 3300049572 Bacteria 9549
592 Ga0501036_0017106 3300049572 Bacteria 6060
593 Ga0501036_0265300 3300049572 Bacteria 1438
594 Ga0501037_0003133 3300049573 Bacteria 11997
595 Ga0501037_0167088 3300049573 Bacteria 1566
596 Ga0501037_0475643 3300049573 Bacteria 850
597 Ga0501038_0016070 3300049574 Bacteria 6795
598 Ga0501038_0040593 3300049574 Bacteria 4062
599 Ga0501038_0086285 3300049574 Bacteria 2637
600 Ga0501039_0052491 3300049575 Bacteria 3154
601 Ga0501039_0093818 3300049575 Bacteria 2339
602 Ga0501041_0073140 3300049577 Bacteria 2106
603 Ga0501042_0005133 3300049578 Bacteria 8403
604 Ga0501043_0000363 3300049579 Bacteria 41190
605 Ga0501043_0008415 3300049579 Bacteria 8125
606 Ga0501043_0149732 3300049579 Bacteria 1826
607 Ga0501046_0004043 3300049580 Bacteria 13386
608 Ga0501046_0152351 3300049580 Bacteria 1744
609 Ga0501047_0000720 3300049581 Bacteria 34413
610 Ga0501047_0002947 3300049581 Bacteria 16127
611 Ga0501047_0060375 3300049581 Bacteria 3659
612 Ga0501047_0310186 3300049581 Bacteria 1418
613 Ga0501048_0006956 3300049582 Bacteria 8595
614 Ga0501067_0011256 3300049583 Bacteria 4951
615 Ga0501068_0116236 3300049584 Bacteria 1666
616 Ga0501069_0204957 3300049585 Bacteria 1143
617 Ga0501071_0025839 3300049587 Bacteria 4116
618 Ga0501072_0001490 3300049588 Bacteria 17533
619 Ga0501072_0561122 3300049588 Bacteria 901
620 Ga0501073_0014287 3300049589 Bacteria 5767
621 Ga0501073_0052732 3300049589 Bacteria 2848
622 Ga0501073_0552588 3300049589 Bacteria 795
623 Ga0501073_0708921 3300049589 Bacteria 694
624 Ga0501074_0097166 3300049590 Bacteria 2108
625 Ga0501076_0013874 3300049592 Bacteria 6051
626 Ga0501077_0009715 3300049593 Bacteria 5981
627 Ga0501079_1563897 3300049741 Bacteria 519
628 Ga0501080_0071179 3300049742 Bacteria 3234
629 Ga0501080_0304974 3300049742 Bacteria 1444
630 Ga0501083_0011002 3300049744 Bacteria 6359
631 Ga0501035_0000875 3300049822 Bacteria 32012
632 Ga0501035_0005206 3300049822 Bacteria 12308
633 Ga0501035_0031238 3300049822 Bacteria 4851
634 Ga0501035_0179403 3300049822 Bacteria 1825
635 Ga0501044_0000958 3300049823 Bacteria 34677
636 Ga0501044_0017668 3300049823 Bacteria 7649
637 Ga0501044_0577873 3300049823 Bacteria 1018
638 nmdc:mga00v17_15360_c1 3300050491 Bacteria 4297
639 nmdc:mga00v17_38569_c1 3300050491 Bacteria 2857
640 nmdc:mga0yw44_212529_c1 3300050492 Bacteria 1280
641 nmdc:mga0yw44_36456_c1 3300050492 Bacteria 2898
642 nmdc:mga0yw44_419387_c1 3300050492 Bacteria 906
643 nmdc:mga0yw44_77801_c1 3300050492 Bacteria 2073
644 nmdc:mga06z11_2052_c1 3300050494 Bacteria 7645
645 nmdc:mga04h51_1501_c1 3300050495 Bacteria 5400
646 nmdc:mga04h51_312293_c1 3300050495 Bacteria 643
647 nmdc:mga07m45_156808_c1 3300050496 Bacteria 1321
648 nmdc:mga05p37_5161_c1 3300050507 Bacteria 15308
649 nmdc:mga09592_237704_c1 3300050508 Bacteria 1578
650 nmdc:mga0sz30_30327_c1 3300050516 Bacteria 2234
651 Ga0495601_0008658 3300053077 Bacteria 6005
652 Ga0495612_0086778 3300053078 Bacteria 1320
653 Ga0500610_0060495 3300053079 Bacteria 1977
654 Ga0500635_0000668 3300053080 Bacteria 8690
655 Ga0500635_0271834 3300053080 Bacteria 666
656 Ga0495655_0211332 3300053083 Bacteria 638
657 Ga0495619_0033451 3300053085 Bacteria 3339
658 Ga0495619_0033872 3300053085 Bacteria 3318
659 Ga0500578_0057615 3300053086 Bacteria 2483
660 Ga0500578_0134918 3300053086 Bacteria 1546
661 Ga0500647_0285797 3300053091 Bacteria 711
662 Ga0500583_0065722 3300053092 Bacteria 1724
663 Ga0500583_0084407 3300053092 Bacteria 1539
664 Ga0500583_0364142 3300053092 Bacteria 699
665 Ga0500651_0140657 3300053093 Bacteria 1455
666 Ga0500566_0012041 3300053094 Bacteria 5094
667 Ga0500641_0041936 3300053096 Bacteria 1853
668 Ga0500650_0236364 3300053098 Bacteria 823
669 Ga0500654_047066 3300053099 Bacteria 2371
670 Ga0500660_048922 3300053100 Bacteria 2104
671 Ga0500553_095001 3300053101 Bacteria 1300
672 Ga0500556_0000972 3300053104 Bacteria 15260
673 Ga0500556_0248689 3300053104 Bacteria 700
674 Ga0500558_226084 3300053106 Bacteria 632
675 Ga0500560_096532 3300053107 Bacteria 989
676 Ga0500560_276697 3300053107 Bacteria 512
677 Ga0500562_000664 3300053108 Bacteria 8337
678 Ga0500572_106979 3300053111 Bacteria 897
679 Ga0500593_045541 3300053117 Bacteria 1955
680 Ga0500594_0019000 3300053118 Bacteria 1699
681 Ga0500628_004401 3300053129 Bacteria 2333
682 Ga0500652_001663 3300053131 Bacteria 6757
683 Ga0500655_007644 3300053133 Bacteria 1946
684 Ga0500658_0013764 3300053134 Bacteria 2991
685 Ga0500559_0000267 3300053136 Bacteria 40699
686 Ga0500561_0000925 3300053137 Bacteria 4692
687 Ga0500573_0040943 3300053140 Bacteria 2675
688 Ga0500573_0186478 3300053140 Bacteria 1111
689 Ga0500573_0298807 3300053140 Bacteria 806
690 Ga0500579_055102 3300053143 Bacteria 2403
691 Ga0500600_0029849 3300053149 Bacteria 3214
692 Ga0500616_0010508 3300053153 Bacteria 5536
693 Ga0500616_0061858 3300053153 Bacteria 1936
694 Ga0500624_010546 3300053157 Bacteria 1333
695 Ga0500633_0002958 3300053160 Bacteria 3613
696 Ga0500634_0046269 3300053161 Bacteria 2351
697 Ga0501084_0009201 3300054114 Bacteria 8168
698 Ga0587098_013179 3300059604 Bacteria 958
699 Ga0587106_049867 3300059605 Bacteria 739
700 Ga0587067_035372 3300059640 Bacteria 945
701 Ga0587068_028813 3300059641 Bacteria 952
702 Ga0501082_0006857 3300060353 Bacteria 9849
703 Ga0466962_0028070 3300061719 Bacteria 2697

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049568 Ga0501031_0042282 Ga0501031_0042282_1672_2139 119
2 3300037312 Ga0395899_0006498 Ga0395899_0006498_5576_6037 125
3 3300037418 Ga0395900_0115912 Ga0395900_0115912_928_1389 125
4 3300037466 Ga0395898_0005196 Ga0395898_0005196_12685_13146 125
5 3300038443 Ga0395901_0004781 Ga0395901_0004781_12278_12739 125
6 3300044656 Ga0466969_0187890 Ga0466969_0187890_353_814 125
7 3300005288 Ga0065714_10095341 Ga0065714_100953412 130
8 3300011119 Ga0105246_10110337 Ga0105246_101103372 131
9 3300013102 Ga0157371_10757235 Ga0157371_107572352 131
10 3300025904 Ga0207647_10105977 Ga0207647_101059772 131
11 3300046535 Ga0495586_0813105 Ga0495586_0813105_14_469 131
12 3300048904 Ga0496101_1326643 Ga0496101_1326643_71_526 131
13 3300048905 Ga0496102_0001162 Ga0496102_0001162_3866_4321 131
14 3300048906 Ga0496103_0032272 Ga0496103_0032272_964_1419 131
15 3300048909 Ga0496106_0038336 Ga0496106_0038336_1140_1595 131
16 3300048910 Ga0496107_0701654 Ga0496107_0701654_82_537 131
17 3300048912 Ga0496109_0821190 Ga0496109_0821190_55_510 131
18 3300048915 Ga0496112_0481751 Ga0496112_0481751_421_876 131
19 3300048916 Ga0496113_0081478 Ga0496113_0081478_1512_1967 131
20 3300046472 Ga0495580_0017553 Ga0495580_0017553_3711_4166 138
21 iso_pu_bacteria 2899370129 2899376518 138
22 3300030522 Ga0307512_10044256 Ga0307512_100442563 139
23 3300031456 Ga0307513_10342752 Ga0307513_103427522 139
24 3300031649 Ga0307514_10054370 Ga0307514_100543702 139
25 3300044656 Ga0466969_0004293 Ga0466969_0004293_4547_5002 139
26 3300044658 Ga0466972_0003388 Ga0466972_0003388_5000_5455 139
27 3300044683 Ga0466965_0029978 Ga0466965_0029978_2031_2486 139
28 3300044684 Ga0466966_0050526 Ga0466966_0050526_191_646 139
29 3300044693 Ga0466961_0028380 Ga0466961_0028380_88_543 139
30 3300044719 Ga0466971_0208312 Ga0466971_0208312_374_829 139
31 3300044735 Ga0466968_0045533 Ga0466968_0045533_1018_1473 139
32 3300046455 Ga0495603_0095950 Ga0495603_0095950_637_1107 140
33 3300047321 Ga0495676_0019198 Ga0495676_0019198_3775_4245 140
34 iso_pu_bacteria 2643221597 2643997798 140
35 iso_pu_bacteria 2831935698 2831937717 140
36 iso_pu_bacteria 2868088558 2868095546 140
37 iso_pu_bacteria 8003870546 8003873696 140
38 iso_pu_bacteria 8054727385 8054734112 140
39 3300044765 Ga0466970_0058297 Ga0466970_0058297_1162_1617 141
40 iso_pu_bacteria 2582581313 2585311236 141
41 iso_pu_bacteria 2582581314 2585311876 141
42 iso_pu_bacteria 2616644814 2616693506 141
43 iso_pu_bacteria 2643221647 2644266478 141
44 iso_pu_bacteria 2643221678 2644438037 141
45 iso_pu_bacteria 2643221714 2644631925 141
46 iso_pu_bacteria 2775506735 2775658807 141
47 iso_pu_bacteria 2784746763 2785339895 141
48 iso_pu_bacteria 2784746768 2785372827 141
49 iso_pu_bacteria 2786546132 2786675149 141
50 iso_pu_bacteria 2791355406 2793977318 141
51 iso_pu_bacteria 2808606357 2808829599 141
52 iso_pu_bacteria 2808606359 2808845180 141
53 iso_pu_bacteria 2808606360 2808850771 141
54 iso_pu_bacteria 2808606366 2808876703 141
55 iso_pu_bacteria 2808606371 2808898215 141
56 iso_pu_bacteria 2808606375 2808914775 141
57 iso_pu_bacteria 2811994871 2812318704 141
58 iso_pu_bacteria 2811994879 2812354519 141
59 iso_pu_bacteria 2852635781 2852636140 141
60 iso_pu_bacteria 2857740372 2857740906 141
61 iso_pu_bacteria 2862281513 2862283200 141
62 iso_pu_bacteria 2862382967 2862385710 141
63 iso_pu_bacteria 2862574272 2862576750 141
64 iso_pu_bacteria 2863404153 2863410105 141
65 iso_pu_bacteria 2867428634 2867428868 141
66 iso_pu_bacteria 2877676314 2877677866 141
67 iso_pu_bacteria 2904497146 2904501486 141
68 iso_pu_bacteria 2904776348 2904778114 141
69 iso_pu_bacteria 2912715099 2912716129 141
70 iso_pu_bacteria 2919034639 2919035460 141
71 iso_pu_bacteria 2919468124 2919471012 141
72 iso_pu_bacteria 2919538618 2919539324 141
73 iso_pu_bacteria 2932426870 2932427876 141
74 iso_pu_bacteria 2933418574 2933422358 141
75 iso_pu_bacteria 2939598168 2939601885 141
76 iso_pu_bacteria 2939647034 2939650318 141
77 iso_pu_bacteria 2939674588 2939677746 141
78 iso_pu_bacteria 2945920336 2945923174 141
79 iso_pu_bacteria 2945941187 2945945129 141
80 iso_pu_bacteria 2945956166 2945959092 141
81 iso_pu_bacteria 2946037020 2946041113 141
82 iso_pu_bacteria 2946064051 2946071148 141
83 iso_pu_bacteria 2946072368 2946079045 141
84 iso_pu_bacteria 2947224130 2947225586 141
85 iso_pu_bacteria 2954002825 2954009760 141
86 iso_pu_bacteria 2954380949 2954382654 141
87 iso_pu_bacteria 2954673503 2954680226 141
88 iso_pu_bacteria 2954682443 2954683925 141
89 iso_pu_bacteria 2954691527 2954693476 141
90 iso_pu_bacteria 2954701450 2954708570 141
91 iso_pu_bacteria 2954711539 2954713142 141
92 iso_pu_bacteria 2954721474 2954723102 141
93 iso_pu_bacteria 2954731030 2954738727 141
94 iso_pu_bacteria 2954740390 2954742009 141
95 iso_pu_bacteria 2954749733 2954757585 141
96 iso_pu_bacteria 2954759201 2954760987 141
97 iso_pu_bacteria 2990059506 2990065458 141
98 iso_pu_bacteria 2997600082 2997601242 141
99 iso_pu_bacteria 3006493962 3006501707 141
100 iso_pu_bacteria 8008558824 8008564126 141
101 iso_pu_bacteria 8008574985 8008581973 141
102 iso_pu_bacteria 8047893842 8047903486 141
103 iso_pu_bacteria 8048127548 8048133336 141
104 iso_pu_bacteria 8048356638 8048356744 141
105 iso_pu_bacteria 8048369669 8048379076 141
106 iso_pu_bacteria 8048379754 8048388181 141
107 iso_pu_bacteria 8048406513 8048410858 141
108 iso_pu_bacteria 8054107350 8054108629 141
109 3300041404 Ga0439436_0022429 Ga0439436_0022429_810_1265 142
110 3300041406 Ga0439439_0010900 Ga0439439_0010900_1696_2151 142
111 3300041999 Ga0439433_0023570 Ga0439433_0023570_752_1207 142
112 3300042002 Ga0439442_008031 Ga0439442_008031_331_786 142
113 3300042007 Ga0439449_0018526 Ga0439449_0018526_1499_1954 142
114 3300042014 Ga0439457_006602 Ga0439457_006602_1092_1547 142
115 3300053080 Ga0500635_0271834 Ga0500635_0271834_57_512 142
116 3300031507 Ga0307509_10105905 Ga0307509_101059052 143
117 3300041512 Ga0451853_0551214 Ga0451853_0551214_3600_4055 143
118 3300041512 Ga0451853_2416279 Ga0451853_2416279_123_572 143
119 3300042007 Ga0439449_0001345 Ga0439449_0001345_5923_6378 143
120 3300046660 Ga0495625_0157267 Ga0495625_0157267_170_625 143
121 3300059605 Ga0587106_049867 Ga0587106_049867_76_531 143
122 3300003762 Ga0055542_1008192 Ga0055542_10081922 144
123 3300005288 Ga0065714_10032115 Ga0065714_100321152 144
124 3300005288 Ga0065714_10070825 Ga0065714_100708254 144
125 3300005288 Ga0065714_10096532 Ga0065714_100965322 144
126 3300005290 Ga0065712_10156388 Ga0065712_101563882 144
127 3300005331 Ga0070670_100269497 Ga0070670_1002694972 144
128 3300005333 Ga0070677_10060718 Ga0070677_100607181 144
129 3300005335 Ga0070666_10002269 Ga0070666_1000226910 144
130 3300005335 Ga0070666_10447732 Ga0070666_104477322 144
131 3300005347 Ga0070668_100039209 Ga0070668_1000392093 144
132 3300005347 Ga0070668_100265087 Ga0070668_1002650871 144
133 3300005354 Ga0070675_100064772 Ga0070675_1000647722 144
134 3300005355 Ga0070671_100004562 Ga0070671_1000045622 144
135 3300005355 Ga0070671_100214555 Ga0070671_1002145552 144
136 3300005356 Ga0070674_100004502 Ga0070674_1000045028 144
137 3300005364 Ga0070673_100042527 Ga0070673_1000425272 144
138 3300005364 Ga0070673_101449030 Ga0070673_1014490301 144
139 3300005367 Ga0070667_100096351 Ga0070667_1000963512 144
140 3300005471 Ga0070698_101188237 Ga0070698_1011882371 144
141 3300005543 Ga0070672_100095555 Ga0070672_1000955552 144
142 3300005548 Ga0070665_100122008 Ga0070665_1001220083 144
143 3300005548 Ga0070665_100362641 Ga0070665_1003626412 144
144 3300005618 Ga0068864_100023949 Ga0068864_1000239495 144
145 3300005840 Ga0068870_10292500 Ga0068870_102925002 144
146 3300005841 Ga0068863_100500960 Ga0068863_1005009601 144
147 3300006038 Ga0075365_10064376 Ga0075365_100643763 144
148 3300006038 Ga0075365_10087589 Ga0075365_100875892 144
149 3300006038 Ga0075365_10240289 Ga0075365_102402892 144
150 3300006051 Ga0075364_10013237 Ga0075364_100132375 144
151 3300006058 Ga0075432_10216997 Ga0075432_102169972 144
152 3300006178 Ga0075367_10527346 Ga0075367_105273461 144
153 3300006186 Ga0075369_10006180 Ga0075369_100061802 144
154 3300006186 Ga0075369_10103748 Ga0075369_101037482 144
155 3300006880 Ga0075429_100291719 Ga0075429_1002917192 144
156 3300009011 Ga0105251_10078766 Ga0105251_100787662 144
157 3300009036 Ga0105244_10013281 Ga0105244_100132813 144
158 3300009036 Ga0105244_10029982 Ga0105244_100299822 144
159 3300009036 Ga0105244_10032502 Ga0105244_100325023 144
160 3300009147 Ga0114129_10004812 Ga0114129_1000481212 144
161 3300009147 Ga0114129_11305114 Ga0114129_113051141 144
162 3300009148 Ga0105243_10054006 Ga0105243_100540062 144
163 3300009176 Ga0105242_10288171 Ga0105242_102881712 144
164 3300009176 Ga0105242_10363794 Ga0105242_103637942 144
165 3300009177 Ga0105248_10000710 Ga0105248_1000071023 144
166 3300009177 Ga0105248_10033988 Ga0105248_100339882 144
167 3300009545 Ga0105237_10163014 Ga0105237_101630142 144
168 3300011119 Ga0105246_10034863 Ga0105246_100348633 144
169 3300011119 Ga0105246_10053677 Ga0105246_100536772 144
170 3300011119 Ga0105246_10128160 Ga0105246_101281602 144
171 3300011119 Ga0105246_10314261 Ga0105246_103142612 144
172 3300013100 Ga0157373_10014861 Ga0157373_100148616 144
173 3300013102 Ga0157371_10426476 Ga0157371_104264762 144
174 3300013105 Ga0157369_10033375 Ga0157369_100333751 144
175 3300013306 Ga0163162_10081450 Ga0163162_100814502 144
176 3300013308 Ga0157375_10189265 Ga0157375_101892653 144
177 3300014325 Ga0163163_10008428 Ga0163163_100084283 144
178 3300017792 Ga0163161_10792209 Ga0163161_107922091 144
179 3300025254 Ga0209148_1004731 Ga0209148_10047312 144
180 3300025254 Ga0209148_1016153 Ga0209148_10161532 144
181 3300025303 Ga0209051_1030266 Ga0209051_10302663 144
182 3300025315 Ga0207697_10000412 Ga0207697_1000041213 144
183 3300025315 Ga0207697_10000464 Ga0207697_1000046415 144
184 3300025728 Ga0207655_1004337 Ga0207655_10043376 144
185 3300025728 Ga0207655_1011840 Ga0207655_10118404 144
186 3300025728 Ga0207655_1065198 Ga0207655_10651982 144
187 3300025735 Ga0207713_1074250 Ga0207713_10742501 144
188 3300025893 Ga0207682_10004974 Ga0207682_100049747 144
189 3300025901 Ga0207688_10047132 Ga0207688_100471323 144
190 3300025903 Ga0207680_10067585 Ga0207680_100675852 144
191 3300025907 Ga0207645_10003534 Ga0207645_1000353412 144
192 3300025908 Ga0207643_10055583 Ga0207643_100555833 144
193 3300025914 Ga0207671_10103954 Ga0207671_101039542 144
194 3300025923 Ga0207681_10025179 Ga0207681_100251791 144
195 3300025925 Ga0207650_10063598 Ga0207650_100635982 144
196 3300025925 Ga0207650_10148713 Ga0207650_101487131 144
197 3300025926 Ga0207659_10014484 Ga0207659_100144845 144
198 3300025927 Ga0207687_10092445 Ga0207687_100924452 144
199 3300025931 Ga0207644_10124615 Ga0207644_101246152 144
200 3300025931 Ga0207644_10148260 Ga0207644_101482602 144
201 3300025934 Ga0207686_10222520 Ga0207686_102225202 144
202 3300025934 Ga0207686_10562836 Ga0207686_105628362 144
203 3300025935 Ga0207709_10156541 Ga0207709_101565412 144
204 3300025937 Ga0207669_10013767 Ga0207669_100137674 144
205 3300025940 Ga0207691_10001950 Ga0207691_1000195010 144
206 3300025941 Ga0207711_10000398 Ga0207711_1000039829 144
207 3300025941 Ga0207711_10140047 Ga0207711_101400471 144
208 3300025960 Ga0207651_10040419 Ga0207651_100404192 144
209 3300025972 Ga0207668_10029555 Ga0207668_100295553 144
210 3300025972 Ga0207668_10241810 Ga0207668_102418102 144
211 3300025986 Ga0207658_10004961 Ga0207658_100049618 144
212 3300026088 Ga0207641_10353841 Ga0207641_103538412 144
213 3300026088 Ga0207641_10624395 Ga0207641_106243952 144
214 3300026095 Ga0207676_10034653 Ga0207676_100346534 144
215 3300027907 Ga0207428_10054253 Ga0207428_100542532 144
216 3300028379 Ga0268266_10422410 Ga0268266_104224102 144
217 3300028379 Ga0268266_10805624 Ga0268266_108056241 144
218 3300031456 Ga0307513_10002116 Ga0307513_100021163 144
219 3300031548 Ga0307408_100010705 Ga0307408_1000107055 144
220 3300031548 Ga0307408_100027835 Ga0307408_1000278352 144
221 3300031548 Ga0307408_100035995 Ga0307408_1000359953 144
222 3300031548 Ga0307408_100154421 Ga0307408_1001544212 144
223 3300031548 Ga0307408_100170889 Ga0307408_1001708891 144
224 3300031649 Ga0307514_10294059 Ga0307514_102940592 144
225 3300031731 Ga0307405_10010781 Ga0307405_100107812 144
226 3300031731 Ga0307405_10020383 Ga0307405_100203833 144
227 3300031731 Ga0307405_10048076 Ga0307405_100480762 144
228 3300031731 Ga0307405_10783132 Ga0307405_107831321 144
229 3300031824 Ga0307413_10080964 Ga0307413_100809642 144
230 3300031824 Ga0307413_10189163 Ga0307413_101891631 144
231 3300031824 Ga0307413_10401942 Ga0307413_104019422 144
232 3300031852 Ga0307410_10004832 Ga0307410_100048326 144
233 3300031852 Ga0307410_10005726 Ga0307410_100057265 144
234 3300031852 Ga0307410_10124464 Ga0307410_101244642 144
235 3300031852 Ga0307410_10127411 Ga0307410_101274112 144
236 3300031852 Ga0307410_10206902 Ga0307410_102069022 144
237 3300031901 Ga0307406_10000260 Ga0307406_1000026011 144
238 3300031901 Ga0307406_10052336 Ga0307406_100523363 144
239 3300031901 Ga0307406_11315990 Ga0307406_113159902 144
240 3300031903 Ga0307407_10010735 Ga0307407_100107354 144
241 3300031903 Ga0307407_10014824 Ga0307407_100148243 144
242 3300031903 Ga0307407_10033544 Ga0307407_100335442 144
243 3300031903 Ga0307407_10128152 Ga0307407_101281522 144
244 3300031911 Ga0307412_10014340 Ga0307412_100143403 144
245 3300031911 Ga0307412_10019875 Ga0307412_100198753 144
246 3300031911 Ga0307412_10095888 Ga0307412_100958882 144
247 3300031911 Ga0307412_11373419 Ga0307412_113734192 144
248 3300031995 Ga0307409_100004513 Ga0307409_1000045134 144
249 3300031995 Ga0307409_100025309 Ga0307409_1000253092 144
250 3300031995 Ga0307409_100362348 Ga0307409_1003623482 144
251 3300031995 Ga0307409_100399464 Ga0307409_1003994642 144
252 3300031995 Ga0307409_100433311 Ga0307409_1004333112 144
253 3300031995 Ga0307409_100506405 Ga0307409_1005064052 144
254 3300031995 Ga0307409_100628921 Ga0307409_1006289212 144
255 3300032002 Ga0307416_100004263 Ga0307416_1000042635 144
256 3300032002 Ga0307416_100013845 Ga0307416_1000138453 144
257 3300032002 Ga0307416_100149219 Ga0307416_1001492193 144
258 3300032002 Ga0307416_100179944 Ga0307416_1001799442 144
259 3300032002 Ga0307416_100235966 Ga0307416_1002359662 144
260 3300032002 Ga0307416_100369713 Ga0307416_1003697131 144
261 3300032002 Ga0307416_102050660 Ga0307416_1020506602 144
262 3300032004 Ga0307414_10071158 Ga0307414_100711582 144
263 3300032004 Ga0307414_10128679 Ga0307414_101286792 144
264 3300032004 Ga0307414_10957245 Ga0307414_109572452 144
265 3300032005 Ga0307411_10159211 Ga0307411_101592112 144
266 3300032005 Ga0307411_10316001 Ga0307411_103160012 144
267 3300032126 Ga0307415_100616398 Ga0307415_1006163981 144
268 3300032126 Ga0307415_100708144 Ga0307415_1007081442 144
269 3300037312 Ga0395899_0123048 Ga0395899_0123048_310_789 144
270 3300037312 Ga0395899_0285854 Ga0395899_0285854_434_889 144
271 3300037418 Ga0395900_0021768 Ga0395900_0021768_6011_6484 144
272 3300037418 Ga0395900_0388892 Ga0395900_0388892_763_1242 144
273 3300037466 Ga0395898_0125480 Ga0395898_0125480_1871_2326 144
274 3300037466 Ga0395898_0141104 Ga0395898_0141104_717_1178 144
275 3300037466 Ga0395898_0192705 Ga0395898_0192705_29_502 144
276 3300037471 Ga0395905_0031908 Ga0395905_0031908_2578_3057 144
277 3300037471 Ga0395905_0036918 Ga0395905_0036918_1711_2184 144
278 3300038443 Ga0395901_0115025 Ga0395901_0115025_1124_1597 144
279 3300038443 Ga0395901_0128743 Ga0395901_0128743_273_752 144
280 3300038443 Ga0395901_0675443 Ga0395901_0675443_356_811 144
281 3300041404 Ga0439436_0000674 Ga0439436_0000674_7595_8050 144
282 3300041404 Ga0439436_0001517 Ga0439436_0001517_2731_3186 144
283 3300041405 Ga0439438_015554 Ga0439438_015554_782_1237 144
284 3300041405 Ga0439438_032003 Ga0439438_032003_777_1232 144
285 3300041406 Ga0439439_0020330 Ga0439439_0020330_1133_1588 144
286 3300041407 Ga0439447_096006 Ga0439447_096006_83_538 144
287 3300041411 Ga0439466_0002356 Ga0439466_0002356_4958_5413 144
288 3300041452 Ga0451793_0902738 Ga0451793_0902738_71_526 144
289 3300041509 Ga0451843_1323196 Ga0451843_1323196_116_568 144
290 3300041512 Ga0451853_0041647 Ga0451853_0041647_10_465 144
291 3300041997 Ga0439431_0117664 Ga0439431_0117664_201_656 144
292 3300041999 Ga0439433_0000244 Ga0439433_0000244_1243_1698 144
293 3300041999 Ga0439433_0000621 Ga0439433_0000621_4288_4743 144
294 3300042002 Ga0439442_000177 Ga0439442_000177_6997_7452 144
295 3300042002 Ga0439442_000461 Ga0439442_000461_3089_3544 144
296 3300042002 Ga0439442_000602 Ga0439442_000602_1154_1609 144
297 3300042002 Ga0439442_001218 Ga0439442_001218_3567_4022 144
298 3300042006 Ga0439432_059060 Ga0439432_059060_55_510 144
299 3300042006 Ga0439432_215879 Ga0439432_215879_64_519 144
300 3300042007 Ga0439449_0001787 Ga0439449_0001787_5839_6294 144
301 3300042007 Ga0439449_0047321 Ga0439449_0047321_549_1004 144
302 3300042007 Ga0439449_0143415 Ga0439449_0143415_78_533 144
303 3300042014 Ga0439457_003062 Ga0439457_003062_2050_2505 144
304 3300042014 Ga0439457_009717 Ga0439457_009717_412_867 144
305 3300042015 Ga0439462_0008371 Ga0439462_0008371_758_1213 144
306 3300042015 Ga0439462_0028777 Ga0439462_0028777_533_988 144
307 3300042121 Ga0450919_017143 Ga0450919_017143_246_701 144
308 3300042122 Ga0450920_000125 Ga0450920_000125_4734_5189 144
309 3300042122 Ga0450920_053415 Ga0450920_053415_60_515 144
310 3300042145 Ga0450906_045875 Ga0450906_045875_290_745 144
311 3300042146 Ga0450907_000222 Ga0450907_000222_18040_18495 144
312 3300042435 Ga0439434_0019212 Ga0439434_0019212_468_923 144
313 3300042531 Ga0450918_008388 Ga0450918_008388_1182_1637 144
314 3300044683 Ga0466965_0045104 Ga0466965_0045104_1004_1459 144
315 3300044901 Ga0466960_0070020 Ga0466960_0070020_641_1096 144
316 3300046457 Ga0495590_0089424 Ga0495590_0089424_621_1076 144
317 3300046459 Ga0495629_0130143 Ga0495629_0130143_530_985 144
318 3300046471 Ga0495650_0000546 Ga0495650_0000546_36374_36826 144
319 3300046471 Ga0495650_0003187 Ga0495650_0003187_5526_5981 144
320 3300046471 Ga0495650_0063387 Ga0495650_0063387_748_1200 144
321 3300046472 Ga0495580_0197621 Ga0495580_0197621_191_646 144
322 3300046475 Ga0495639_0023328 Ga0495639_0023328_1228_1683 144
323 3300046499 Ga0495594_0200556 Ga0495594_0200556_405_860 144
324 3300046506 Ga0495583_0126737 Ga0495583_0126737_40_495 144
325 3300046512 Ga0495610_0264893 Ga0495610_0264893_203_658 144
326 3300046515 Ga0495620_0063354 Ga0495620_0063354_27_479 144
327 3300046515 Ga0495620_0186575 Ga0495620_0186575_72_524 144
328 3300046518 Ga0495631_0020553 Ga0495631_0020553_1104_1559 144
329 3300046518 Ga0495631_0405693 Ga0495631_0405693_34_486 144
330 3300046522 Ga0495643_0218012 Ga0495643_0218012_125_577 144
331 3300046523 Ga0495644_0282447 Ga0495644_0282447_85_543 144
332 3300046525 Ga0495663_0051533 Ga0495663_0051533_325_780 144
333 3300046528 Ga0495642_0018991 Ga0495642_0018991_1859_2314 144
334 3300046531 Ga0495665_0052305 Ga0495665_0052305_1609_2064 144
335 3300046535 Ga0495586_0042314 Ga0495586_0042314_709_1164 144
336 3300046535 Ga0495586_0158607 Ga0495586_0158607_95_550 144
337 3300046539 Ga0495621_0210382 Ga0495621_0210382_38_493 144
338 3300046543 Ga0495645_0147148 Ga0495645_0147148_959_1414 144
339 3300046557 Ga0495622_0129063 Ga0495622_0129063_37_492 144
340 3300046558 Ga0495633_0010590 Ga0495633_0010590_149_604 144
341 3300046615 Ga0495656_0000824 Ga0495656_0000824_5559_6014 144
342 3300046615 Ga0495656_0076739 Ga0495656_0076739_683_1135 144
343 3300046615 Ga0495656_0099734 Ga0495656_0099734_41_499 144
344 3300046616 Ga0495668_0011623 Ga0495668_0011623_1770_2225 144
345 3300046664 Ga0495659_0001350 Ga0495659_0001350_5459_5914 144
346 3300046674 Ga0495588_0304120 Ga0495588_0304120_279_734 144
347 3300046691 Ga0495670_0000592 Ga0495670_0000592_4785_5240 144
348 3300046794 Ga0495589_0350472 Ga0495589_0350472_179_634 144
349 3300046809 Ga0495600_0013998 Ga0495600_0013998_2936_3391 144
350 3300047315 Ga0495581_0048637 Ga0495581_0048637_17_472 144
351 3300047315 Ga0495581_0188964 Ga0495581_0188964_430_885 144
352 3300047318 Ga0495636_0000549 Ga0495636_0000549_1313_1768 144
353 3300047447 Ga0495685_212743 Ga0495685_212743_46_501 144
354 3300047470 Ga0495681_0012674 Ga0495681_0012674_1870_2325 144
355 3300047470 Ga0495681_0139148 Ga0495681_0139148_225_677 144
356 3300047673 Ga0495593_0021565 Ga0495593_0021565_1399_1854 144
357 3300048090 Ga0495615_0103327 Ga0495615_0103327_154_609 144
358 3300048904 Ga0496101_0102816 Ga0496101_0102816_1125_1580 144
359 3300048905 Ga0496102_0155601 Ga0496102_0155601_1535_1987 144
360 3300048906 Ga0496103_0013661 Ga0496103_0013661_1653_2108 144
361 3300048906 Ga0496103_0067388 Ga0496103_0067388_1160_1615 144
362 3300048907 Ga0496104_0005983 Ga0496104_0005983_9294_9746 144
363 3300048907 Ga0496104_0147830 Ga0496104_0147830_775_1230 144
364 3300048907 Ga0496104_1686106 Ga0496104_1686106_62_514 144
365 3300048908 Ga0496105_0162405 Ga0496105_0162405_681_1133 144
366 3300048908 Ga0496105_0171982 Ga0496105_0171982_894_1346 144
367 3300048909 Ga0496106_0022157 Ga0496106_0022157_2518_2973 144
368 3300048910 Ga0496107_0035233 Ga0496107_0035233_1847_2302 144
369 3300048911 Ga0496108_0049563 Ga0496108_0049563_2123_2578 144
370 3300048911 Ga0496108_0099586 Ga0496108_0099586_286_738 144
371 3300048912 Ga0496109_0030900 Ga0496109_0030900_2750_3202 144
372 3300048912 Ga0496109_0056531 Ga0496109_0056531_2929_3384 144
373 3300048913 Ga0496110_0346089 Ga0496110_0346089_243_695 144
374 3300048914 Ga0496111_0074255 Ga0496111_0074255_1624_2076 144
375 3300048916 Ga0496113_0338611 Ga0496113_0338611_537_989 144
376 3300048917 Ga0496114_0067809 Ga0496114_0067809_1995_2450 144
377 3300048917 Ga0496114_0226770 Ga0496114_0226770_732_1184 144
378 3300048918 Ga0496115_0018277 Ga0496115_0018277_1253_1708 144
379 3300048918 Ga0496115_0455782 Ga0496115_0455782_101_553 144
380 3300048919 Ga0496116_0403434 Ga0496116_0403434_70_522 144
381 3300048920 Ga0496117_0026452 Ga0496117_0026452_2582_3034 144
382 3300048921 Ga0496118_0009260 Ga0496118_0009260_3759_4211 144
383 3300048922 Ga0496119_0007391 Ga0496119_0007391_4006_4458 144
384 3300048922 Ga0496119_0225093 Ga0496119_0225093_101_556 144
385 3300048923 Ga0496120_0006761 Ga0496120_0006761_3934_4386 144
386 3300048925 Ga0496122_0000358 Ga0496122_0000358_4199_4651 144
387 3300048925 Ga0496122_0087985 Ga0496122_0087985_1069_1521 144
388 3300048926 Ga0496123_0000280 Ga0496123_0000280_4252_4704 144
389 3300048927 Ga0496124_0015167 Ga0496124_0015167_4496_4948 144
390 3300048927 Ga0496124_0019241 Ga0496124_0019241_5434_5889 144
391 3300048927 Ga0496124_0096797 Ga0496124_0096797_308_760 144
392 3300048928 Ga0496125_0018179 Ga0496125_0018179_3110_3562 144
393 3300048928 Ga0496125_0029138 Ga0496125_0029138_3050_3502 144
394 3300048929 Ga0496126_0042674 Ga0496126_0042674_2017_2469 144
395 3300048929 Ga0496126_0499539 Ga0496126_0499539_55_507 144
396 3300049127 Ga0501306_027925 Ga0501306_027925_222_677 144
397 3300049129 Ga0501309_011899 Ga0501309_011899_206_661 144
398 3300049162 Ga0501307_025657 Ga0501307_025657_261_716 144
399 3300049531 Ga0501315_034410 Ga0501315_034410_231_686 144
400 3300049533 Ga0501317_005023 Ga0501317_005023_390_845 144
401 3300049533 Ga0501317_009295 Ga0501317_009295_75_530 144
402 3300049534 Ga0501318_001314 Ga0501318_001314_898_1353 144
403 3300049534 Ga0501318_022387 Ga0501318_022387_330_785 144
404 3300049536 Ga0501320_017138 Ga0501320_017138_279_734 144
405 3300049537 Ga0501321_075312 Ga0501321_075312_38_493 144
406 3300049540 Ga0501324_018119 Ga0501324_018119_139_594 144
407 3300049541 Ga0501325_011144 Ga0501325_011144_26_481 144
408 3300049549 Ga0501333_005582 Ga0501333_005582_34_489 144
409 3300049556 Ga0501340_023326 Ga0501340_023326_30_485 144
410 3300049571 Ga0501034_0000488 Ga0501034_0000488_37710_38165 144
411 3300049584 Ga0501068_0116236 Ga0501068_0116236_613_1065 144
412 3300049588 Ga0501072_0561122 Ga0501072_0561122_416_871 144
413 3300049589 Ga0501073_0014287 Ga0501073_0014287_4757_5212 144
414 3300049741 Ga0501079_1563897 Ga0501079_1563897_46_498 144
415 3300050491 nmdc:mga00v17_15360_c1 nmdc:mga00v17_15360_c1_799_1254 144
416 3300050491 nmdc:mga00v17_38569_c1 nmdc:mga00v17_38569_c1_973_1425 144
417 3300050492 nmdc:mga0yw44_212529_c1 nmdc:mga0yw44_212529_c1_163_618 144
418 3300050492 nmdc:mga0yw44_36456_c1 nmdc:mga0yw44_36456_c1_1029_1481 144
419 3300050492 nmdc:mga0yw44_77801_c1 nmdc:mga0yw44_77801_c1_455_910 144
420 3300050507 nmdc:mga05p37_5161_c1 nmdc:mga05p37_5161_c1_8956_9411 144
421 3300050508 nmdc:mga09592_237704_c1 nmdc:mga09592_237704_c1_500_955 144
422 3300050516 nmdc:mga0sz30_30327_c1 nmdc:mga0sz30_30327_c1_1700_2152 144
423 3300053080 Ga0500635_0000668 Ga0500635_0000668_932_1390 144
424 3300053092 Ga0500583_0065722 Ga0500583_0065722_25_480 144
425 3300053096 Ga0500641_0041936 Ga0500641_0041936_72_527 144
426 3300053104 Ga0500556_0000972 Ga0500556_0000972_3747_4202 144
427 3300053108 Ga0500562_000664 Ga0500562_000664_6809_7264 144
428 3300053117 Ga0500593_045541 Ga0500593_045541_361_816 144
429 3300053118 Ga0500594_0019000 Ga0500594_0019000_449_904 144
430 3300053133 Ga0500655_007644 Ga0500655_007644_1108_1563 144
431 3300053136 Ga0500559_0000267 Ga0500559_0000267_4950_5405 144
432 3300053153 Ga0500616_0061858 Ga0500616_0061858_708_1163 144
433 3300059604 Ga0587098_013179 Ga0587098_013179_229_684 144
434 3300059640 Ga0587067_035372 Ga0587067_035372_287_742 144
435 3300059641 Ga0587068_028813 Ga0587068_028813_279_734 144
436 iso_pu_bacteria 2537561592 2537900231 144
437 iso_pu_bacteria 2919051321 2919055020 144
438 3300001989 JGI24739J22299_10022416 JGI24739J22299_100224162 145
439 3300001990 JGI24737J22298_10107585 JGI24737J22298_101075851 145
440 3300002067 JGI24735J21928_10091439 JGI24735J21928_100914392 145
441 3300002075 JGI24738J21930_10073941 JGI24738J21930_100739412 145
442 3300003354 JGI25160J50197_1021111 JGI25160J50197_10211112 145
443 3300003354 JGI25160J50197_1021183 JGI25160J50197_10211832 145
444 3300005614 Ga0068856_100094109 Ga0068856_1000941092 145
445 3300005937 Ga0081455_10303849 Ga0081455_103038492 145
446 3300006038 Ga0075365_10467485 Ga0075365_104674851 145
447 3300006042 Ga0075368_10004371 Ga0075368_100043714 145
448 3300006178 Ga0075367_10000434 Ga0075367_100004348 145
449 3300006948 Ga0099826_10048198 Ga0099826_100481982 145
450 3300009148 Ga0105243_10233148 Ga0105243_102331482 145
451 3300010375 Ga0105239_10495401 Ga0105239_104954012 145
452 3300011119 Ga0105246_11174564 Ga0105246_111745641 145
453 3300013105 Ga0157369_10339903 Ga0157369_103399032 145
454 3300013307 Ga0157372_10179178 Ga0157372_101791783 145
455 3300014497 Ga0182008_10025649 Ga0182008_100256493 145
456 3300015261 Ga0182006_1026052 Ga0182006_10260523 145
457 3300015262 Ga0182007_10001776 Ga0182007_100017764 145
458 3300015688 Ga0183367_1001 Ga0183367_1001745 145
459 3300021388 Ga0213875_10014079 Ga0213875_100140792 145
460 3300025302 Ga0207426_1005303 Ga0207426_10053036 145
461 3300025904 Ga0207647_10006249 Ga0207647_100062495 145
462 3300025949 Ga0207667_10524641 Ga0207667_105246412 145
463 3300025961 Ga0207712_10527227 Ga0207712_105272272 145
464 3300026041 Ga0207639_11125898 Ga0207639_111258981 145
465 3300026078 Ga0207702_10128157 Ga0207702_101281573 145
466 3300027866 Ga0209813_10004127 Ga0209813_100041273 145
467 3300028786 Ga0307517_10006022 Ga0307517_100060228 145
468 3300028786 Ga0307517_10006310 Ga0307517_1000631018 145
469 3300028794 Ga0307515_10000441 Ga0307515_1000044168 145
470 3300030521 Ga0307511_10000078 Ga0307511_1000007858 145
471 3300030521 Ga0307511_10027884 Ga0307511_100278842 145
472 3300030522 Ga0307512_10002991 Ga0307512_100029915 145
473 3300030522 Ga0307512_10222007 Ga0307512_102220072 145
474 3300031456 Ga0307513_10022839 Ga0307513_100228394 145
475 3300031456 Ga0307513_10085929 Ga0307513_100859293 145
476 3300031507 Ga0307509_10086034 Ga0307509_100860344 145
477 3300031507 Ga0307509_10092633 Ga0307509_100926334 145
478 3300031507 Ga0307509_10259050 Ga0307509_102590502 145
479 3300031616 Ga0307508_10010698 Ga0307508_100106988 145
480 3300031616 Ga0307508_10219605 Ga0307508_102196052 145
481 3300031616 Ga0307508_10302913 Ga0307508_103029132 145
482 3300031649 Ga0307514_10100603 Ga0307514_101006032 145
483 3300031649 Ga0307514_10368325 Ga0307514_103683252 145
484 3300031730 Ga0307516_10218051 Ga0307516_102180511 145
485 3300031838 Ga0307518_10014202 Ga0307518_100142026 145
486 3300031838 Ga0307518_10111619 Ga0307518_101116192 145
487 3300033179 Ga0307507_10014173 Ga0307507_100141736 145
488 3300033179 Ga0307507_10049696 Ga0307507_100496962 145
489 3300033179 Ga0307507_10342860 Ga0307507_103428602 145
490 3300033180 Ga0307510_10018716 Ga0307510_100187166 145
491 3300033180 Ga0307510_10220371 Ga0307510_102203712 145
492 3300037418 Ga0395900_0137022 Ga0395900_0137022_1615_2070 145
493 3300037466 Ga0395898_0005339 Ga0395898_0005339_8737_9192 145
494 3300037466 Ga0395898_0014229 Ga0395898_0014229_4997_5452 145
495 3300037471 Ga0395905_0408133 Ga0395905_0408133_466_921 145
496 3300037853 Ga0436364_0460308 Ga0436364_0460308_1914_2384 145
497 3300038443 Ga0395901_0093943 Ga0395901_0093943_266_721 145
498 3300041406 Ga0439439_0001987 Ga0439439_0001987_2313_2768 145
499 3300041459 Ga0451800_0099299 Ga0451800_0099299_25_480 145
500 3300041486 Ga0451807_1784448 Ga0451807_1784448_52_507 145
501 3300041509 Ga0451843_1661877 Ga0451843_1661877_76_531 145
502 3300041512 Ga0451853_1235510 Ga0451853_1235510_361_816 145
503 3300042005 Ga0439448_0002008 Ga0439448_0002008_2506_2961 145
504 3300042012 Ga0439455_0007567 Ga0439455_0007567_456_911 145
505 3300042014 Ga0439457_000160 Ga0439457_000160_5296_5751 145
506 3300042131 Ga0450894_000018 Ga0450894_000018_21454_21909 145
507 3300042134 Ga0450898_002345 Ga0450898_002345_1274_1729 145
508 3300042135 Ga0450899_004593 Ga0450899_004593_611_1066 145
509 3300042138 Ga0450903_001349 Ga0450903_001349_3601_4056 145
510 3300042157 Ga0439458_0000209 Ga0439458_0000209_11963_12418 145
511 3300042157 Ga0439458_0038764 Ga0439458_0038764_287_742 145
512 3300044658 Ga0466972_0004342 Ga0466972_0004342_1043_1498 145
513 3300044683 Ga0466965_0001808 Ga0466965_0001808_4797_5252 145
514 3300044684 Ga0466966_0010922 Ga0466966_0010922_5070_5525 145
515 3300044693 Ga0466961_0002778 Ga0466961_0002778_6833_7288 145
516 3300044693 Ga0466961_0111138 Ga0466961_0111138_694_1149 145
517 3300044693 Ga0466961_0200447 Ga0466961_0200447_59_514 145
518 3300044694 Ga0466963_0000949 Ga0466963_0000949_7968_8423 145
519 3300044694 Ga0466963_0184201 Ga0466963_0184201_36_491 145
520 3300044719 Ga0466971_0000294 Ga0466971_0000294_12095_12550 145
521 3300044719 Ga0466971_0071271 Ga0466971_0071271_68_523 145
522 3300044765 Ga0466970_0001385 Ga0466970_0001385_4778_5233 145
523 3300044765 Ga0466970_0168892 Ga0466970_0168892_234_689 145
524 3300044842 Ga0466957_0000752 Ga0466957_0000752_13521_13976 145
525 3300044901 Ga0466960_0073699 Ga0466960_0073699_808_1263 145
526 3300045049 Ga0466959_0006963 Ga0466959_0006963_2668_3123 145
527 3300045049 Ga0466959_0560877 Ga0466959_0560877_181_636 145
528 3300045836 Ga0466958_0037735 Ga0466958_0037735_1481_1936 145
529 3300045836 Ga0466958_0582812 Ga0466958_0582812_187_642 145
530 3300045976 Ga0466967_0008755 Ga0466967_0008755_529_984 145
531 3300045976 Ga0466967_0070648 Ga0466967_0070648_2302_2757 145
532 3300046454 Ga0495592_0027299 Ga0495592_0027299_1734_2201 145
533 3300046454 Ga0495592_0033670 Ga0495592_0033670_806_1261 145
534 3300046455 Ga0495603_0066929 Ga0495603_0066929_1389_1844 145
535 3300046455 Ga0495603_0269113 Ga0495603_0269113_325_780 145
536 3300046459 Ga0495629_0009641 Ga0495629_0009641_566_1021 145
537 3300046459 Ga0495629_0181123 Ga0495629_0181123_621_1076 145
538 3300046460 Ga0495638_0238348 Ga0495638_0238348_479_934 145
539 3300046462 Ga0495651_0019860 Ga0495651_0019860_270_725 145
540 3300046462 Ga0495651_0020501 Ga0495651_0020501_3931_4398 145
541 3300046462 Ga0495651_0063023 Ga0495651_0063023_2334_2789 145
542 3300046463 Ga0495653_0019851 Ga0495653_0019851_2225_2692 145
543 3300046472 Ga0495580_0019062 Ga0495580_0019062_537_1004 145
544 3300046473 Ga0495582_0033939 Ga0495582_0033939_1907_2362 145
545 3300046474 Ga0495605_0007297 Ga0495605_0007297_2825_3280 145
546 3300046474 Ga0495605_0404418 Ga0495605_0404418_45_500 145
547 3300046476 Ga0495662_0001106 Ga0495662_0001106_8605_9060 145
548 3300046476 Ga0495662_0003749 Ga0495662_0003749_4414_4881 145
549 3300046476 Ga0495662_0014964 Ga0495662_0014964_3251_3706 145
550 3300046477 Ga0495664_0000944 Ga0495664_0000944_9774_10229 145
551 3300046477 Ga0495664_0003495 Ga0495664_0003495_7538_8005 145
552 3300046492 Ga0495585_0056783 Ga0495585_0056783_1568_2023 145
553 3300046492 Ga0495585_0058063 Ga0495585_0058063_1344_1799 145
554 3300046492 Ga0495585_0073027 Ga0495585_0073027_125_580 145
555 3300046499 Ga0495594_0031678 Ga0495594_0031678_1104_1559 145
556 3300046499 Ga0495594_0071436 Ga0495594_0071436_631_1086 145
557 3300046499 Ga0495594_0252323 Ga0495594_0252323_352_807 145
558 3300046501 Ga0495607_0074060 Ga0495607_0074060_758_1213 145
559 3300046506 Ga0495583_0067092 Ga0495583_0067092_992_1447 145
560 3300046507 Ga0495606_0011656 Ga0495606_0011656_3319_3774 145
561 3300046511 Ga0495608_0038091 Ga0495608_0038091_1985_2452 145
562 3300046512 Ga0495610_0049125 Ga0495610_0049125_313_768 145
563 3300046513 Ga0495616_0034668 Ga0495616_0034668_175_630 145
564 3300046514 Ga0495618_0071521 Ga0495618_0071521_1379_1834 145
565 3300046514 Ga0495618_0197349 Ga0495618_0197349_466_921 145
566 3300046515 Ga0495620_0059732 Ga0495620_0059732_12_467 145
567 3300046516 Ga0495628_0009491 Ga0495628_0009491_4578_5045 145
568 3300046516 Ga0495628_0119453 Ga0495628_0119453_527_982 145
569 3300046516 Ga0495628_0474891 Ga0495628_0474891_295_750 145
570 3300046517 Ga0495630_0112967 Ga0495630_0112967_1009_1476 145
571 3300046518 Ga0495631_0004500 Ga0495631_0004500_4032_4487 145
572 3300046519 Ga0495632_0028377 Ga0495632_0028377_834_1289 145
573 3300046520 Ga0495637_0011728 Ga0495637_0011728_3539_3994 145
574 3300046522 Ga0495643_0015471 Ga0495643_0015471_249_704 145
575 3300046522 Ga0495643_0021595 Ga0495643_0021595_2131_2586 145
576 3300046522 Ga0495643_0324793 Ga0495643_0324793_140_595 145
577 3300046526 Ga0495666_0001706 Ga0495666_0001706_4099_4566 145
578 3300046526 Ga0495666_0014223 Ga0495666_0014223_2316_2771 145
579 3300046529 Ga0495652_0135094 Ga0495652_0135094_166_621 145
580 3300046529 Ga0495652_0151885 Ga0495652_0151885_582_1049 145
581 3300046529 Ga0495652_0213392 Ga0495652_0213392_773_1228 145
582 3300046529 Ga0495652_0447181 Ga0495652_0447181_273_728 145
583 3300046531 Ga0495665_0051007 Ga0495665_0051007_1128_1595 145
584 3300046533 Ga0495640_0004901 Ga0495640_0004901_9573_10028 145
585 3300046533 Ga0495640_0119508 Ga0495640_0119508_925_1392 145
586 3300046535 Ga0495586_0016082 Ga0495586_0016082_371_838 145
587 3300046535 Ga0495586_0300947 Ga0495586_0300947_166_621 145
588 3300046536 Ga0495587_0005723 Ga0495587_0005723_2674_3129 145
589 3300046536 Ga0495587_0017657 Ga0495587_0017657_3382_3849 145
590 3300046542 Ga0495597_0061951 Ga0495597_0061951_1033_1488 145
591 3300046543 Ga0495645_0001887 Ga0495645_0001887_7009_7476 145
592 3300046543 Ga0495645_0011669 Ga0495645_0011669_3974_4429 145
593 3300046543 Ga0495645_0013935 Ga0495645_0013935_4074_4529 145
594 3300046557 Ga0495622_0094613 Ga0495622_0094613_207_662 145
595 3300046559 Ga0495667_0021005 Ga0495667_0021005_1584_2051 145
596 3300046559 Ga0495667_0263332 Ga0495667_0263332_89_544 145
597 3300046616 Ga0495668_0021391 Ga0495668_0021391_1233_1688 145
598 3300046642 Ga0495634_0003733 Ga0495634_0003733_4712_5167 145
599 3300046642 Ga0495634_0072823 Ga0495634_0072823_1432_1887 145
600 3300046642 Ga0495634_0095140 Ga0495634_0095140_582_1049 145
601 3300046648 Ga0495611_0047008 Ga0495611_0047008_492_947 145
602 3300046648 Ga0495611_0092495 Ga0495611_0092495_144_599 145
603 3300046648 Ga0495611_0300197 Ga0495611_0300197_253_708 145
604 3300046660 Ga0495625_0003398 Ga0495625_0003398_9390_9845 145
605 3300046660 Ga0495625_0082137 Ga0495625_0082137_365_820 145
606 3300046660 Ga0495625_0132201 Ga0495625_0132201_927_1382 145
607 3300046663 Ga0495635_0019722 Ga0495635_0019722_2662_3117 145
608 3300046663 Ga0495635_0067921 Ga0495635_0067921_800_1267 145
609 3300046665 Ga0495661_0150276 Ga0495661_0150276_663_1118 145
610 3300046674 Ga0495588_0000457 Ga0495588_0000457_15453_15908 145
611 3300046675 Ga0495657_0009095 Ga0495657_0009095_6324_6791 145
612 3300046675 Ga0495657_0082483 Ga0495657_0082483_957_1412 145
613 3300046675 Ga0495657_0125780 Ga0495657_0125780_789_1244 145
614 3300046675 Ga0495657_0239046 Ga0495657_0239046_246_701 145
615 3300046678 Ga0495599_0090721 Ga0495599_0090721_553_1020 145
616 3300046678 Ga0495599_0292368 Ga0495599_0292368_162_617 145
617 3300046679 Ga0495623_0057784 Ga0495623_0057784_735_1202 145
618 3300046679 Ga0495623_0258735 Ga0495623_0258735_79_534 145
619 3300046680 Ga0495646_0006326 Ga0495646_0006326_6729_7184 145
620 3300046680 Ga0495646_0147915 Ga0495646_0147915_289_756 145
621 3300046680 Ga0495646_0403827 Ga0495646_0403827_52_507 145
622 3300046683 Ga0495658_0127343 Ga0495658_0127343_494_949 145
623 3300046689 Ga0495613_0008940 Ga0495613_0008940_512_967 145
624 3300046689 Ga0495613_0028895 Ga0495613_0028895_1699_2154 145
625 3300046689 Ga0495613_0045655 Ga0495613_0045655_760_1227 145
626 3300046689 Ga0495613_0063712 Ga0495613_0063712_1353_1808 145
627 3300046691 Ga0495670_0058317 Ga0495670_0058317_119_574 145
628 3300046691 Ga0495670_0228477 Ga0495670_0228477_206_661 145
629 3300046692 Ga0495671_0037936 Ga0495671_0037936_446_901 145
630 3300046694 Ga0495649_0198706 Ga0495649_0198706_82_537 145
631 3300046794 Ga0495589_0001319 Ga0495589_0001319_835_1290 145
632 3300046794 Ga0495589_0018296 Ga0495589_0018296_64_519 145
633 3300046794 Ga0495589_0021412 Ga0495589_0021412_1937_2392 145
634 3300046794 Ga0495589_0041917 Ga0495589_0041917_341_796 145
635 3300046794 Ga0495589_0052568 Ga0495589_0052568_877_1332 145
636 3300046809 Ga0495600_0022370 Ga0495600_0022370_2225_2692 145
637 3300046809 Ga0495600_0106144 Ga0495600_0106144_199_654 145
638 3300046809 Ga0495600_0281739 Ga0495600_0281739_560_1015 145
639 3300046809 Ga0495600_0377197 Ga0495600_0377197_76_531 145
640 3300046810 Ga0495660_0028052 Ga0495660_0028052_2626_3081 145
641 3300047315 Ga0495581_0020074 Ga0495581_0020074_2249_2704 145
642 3300047315 Ga0495581_0020881 Ga0495581_0020881_932_1399 145
643 3300047315 Ga0495581_0185057 Ga0495581_0185057_610_1065 145
644 3300047317 Ga0495604_0003998 Ga0495604_0003998_8157_8624 145
645 3300047317 Ga0495604_0124992 Ga0495604_0124992_1159_1614 145
646 3300047318 Ga0495636_0039582 Ga0495636_0039582_1187_1642 145
647 3300047319 Ga0495674_0021729 Ga0495674_0021729_2013_2480 145
648 3300047320 Ga0495672_0270509 Ga0495672_0270509_128_583 145
649 3300047321 Ga0495676_0021214 Ga0495676_0021214_1643_2098 145
650 3300047321 Ga0495676_0038263 Ga0495676_0038263_2691_3146 145
651 3300047321 Ga0495676_0038606 Ga0495676_0038606_2571_3026 145
652 3300047321 Ga0495676_0055233 Ga0495676_0055233_1053_1508 145
653 3300047321 Ga0495676_0118273 Ga0495676_0118273_786_1241 145
654 3300047322 Ga0495680_0627722 Ga0495680_0627722_142_597 145
655 3300047322 Ga0495680_0972827 Ga0495680_0972827_68_523 145
656 3300047323 Ga0495683_0025708 Ga0495683_0025708_2057_2512 145
657 3300047323 Ga0495683_0029820 Ga0495683_0029820_1510_1965 145
658 3300047323 Ga0495683_0103639 Ga0495683_0103639_582_1037 145
659 3300047443 Ga0495687_003569 Ga0495687_003569_8039_8494 145
660 3300047443 Ga0495687_005167 Ga0495687_005167_7842_8297 145
661 3300047443 Ga0495687_027206 Ga0495687_027206_176_631 145
662 3300047444 Ga0495675_0073327 Ga0495675_0073327_673_1128 145
663 3300047444 Ga0495675_0080058 Ga0495675_0080058_582_1049 145
664 3300047444 Ga0495675_0094195 Ga0495675_0094195_973_1428 145
665 3300047444 Ga0495675_0435364 Ga0495675_0435364_115_570 145
666 3300047446 Ga0495679_027516 Ga0495679_027516_1353_1808 145
667 3300047447 Ga0495685_000946 Ga0495685_000946_1593_2048 145
668 3300047447 Ga0495685_003370 Ga0495685_003370_1850_2305 145
669 3300047447 Ga0495685_027572 Ga0495685_027572_148_603 145
670 3300047447 Ga0495685_056773 Ga0495685_056773_504_959 145
671 3300047447 Ga0495685_100898 Ga0495685_100898_338_793 145
672 3300047470 Ga0495681_0000568 Ga0495681_0000568_20362_20817 145
673 3300047470 Ga0495681_0016496 Ga0495681_0016496_274_729 145
674 3300047471 Ga0495684_0057400 Ga0495684_0057400_1076_1531 145
675 3300047471 Ga0495684_0112105 Ga0495684_0112105_1009_1476 145
676 3300047472 Ga0495686_0022865 Ga0495686_0022865_3081_3536 145
677 3300047472 Ga0495686_0062562 Ga0495686_0062562_1156_1611 145
678 3300047472 Ga0495686_0063219 Ga0495686_0063219_1447_1902 145
679 3300047673 Ga0495593_0000284 Ga0495593_0000284_25743_26198 145
680 3300047673 Ga0495593_0035318 Ga0495593_0035318_63_518 145
681 3300047673 Ga0495593_0067969 Ga0495593_0067969_373_828 145
682 3300048088 Ga0495602_0028059 Ga0495602_0028059_1187_1642 145
683 3300048088 Ga0495602_0053551 Ga0495602_0053551_582_1049 145
684 3300048088 Ga0495602_0110671 Ga0495602_0110671_163_618 145
685 3300048089 Ga0495614_0094292 Ga0495614_0094292_506_961 145
686 3300048089 Ga0495614_0097791 Ga0495614_0097791_507_962 145
687 3300048091 Ga0495626_0039038 Ga0495626_0039038_377_832 145
688 3300049459 Ga0495678_200504 Ga0495678_200504_16_471 145
689 3300049568 Ga0501031_0008351 Ga0501031_0008351_6107_6574 145
690 3300049569 Ga0501032_0004814 Ga0501032_0004814_2171_2638 145
691 3300049570 Ga0501033_0090186 Ga0501033_0090186_970_1425 145
692 3300049570 Ga0501033_0115404 Ga0501033_0115404_1388_1855 145
693 3300049571 Ga0501034_0001465 Ga0501034_0001465_27822_28289 145
694 3300049571 Ga0501034_1252833 Ga0501034_1252833_112_579 145
695 3300049572 Ga0501036_0006415 Ga0501036_0006415_2965_3432 145
696 3300049572 Ga0501036_0017106 Ga0501036_0017106_1789_2256 145
697 3300049572 Ga0501036_0265300 Ga0501036_0265300_62_517 145
698 3300049573 Ga0501037_0003133 Ga0501037_0003133_7641_8108 145
699 3300049573 Ga0501037_0167088 Ga0501037_0167088_335_802 145
700 3300049573 Ga0501037_0475643 Ga0501037_0475643_202_669 145
701 3300049574 Ga0501038_0016070 Ga0501038_0016070_6118_6585 145
702 3300049574 Ga0501038_0040593 Ga0501038_0040593_3381_3848 145
703 3300049574 Ga0501038_0086285 Ga0501038_0086285_921_1376 145
704 3300049575 Ga0501039_0052491 Ga0501039_0052491_2015_2482 145
705 3300049575 Ga0501039_0093818 Ga0501039_0093818_1257_1724 145
706 3300049577 Ga0501041_0073140 Ga0501041_0073140_863_1330 145
707 3300049578 Ga0501042_0005133 Ga0501042_0005133_168_635 145
708 3300049579 Ga0501043_0000363 Ga0501043_0000363_2965_3432 145
709 3300049579 Ga0501043_0008415 Ga0501043_0008415_7037_7504 145
710 3300049579 Ga0501043_0149732 Ga0501043_0149732_448_903 145
711 3300049580 Ga0501046_0004043 Ga0501046_0004043_3889_4356 145
712 3300049580 Ga0501046_0152351 Ga0501046_0152351_629_1096 145
713 3300049581 Ga0501047_0000720 Ga0501047_0000720_83_550 145
714 3300049581 Ga0501047_0002947 Ga0501047_0002947_5890_6357 145
715 3300049581 Ga0501047_0060375 Ga0501047_0060375_1534_1989 145
716 3300049581 Ga0501047_0310186 Ga0501047_0310186_79_534 145
717 3300049582 Ga0501048_0006956 Ga0501048_0006956_6283_6750 145
718 3300049583 Ga0501067_0011256 Ga0501067_0011256_725_1192 145
719 3300049585 Ga0501069_0204957 Ga0501069_0204957_466_933 145
720 3300049587 Ga0501071_0025839 Ga0501071_0025839_3008_3475 145
721 3300049588 Ga0501072_0001490 Ga0501072_0001490_16815_17282 145
722 3300049589 Ga0501073_0052732 Ga0501073_0052732_782_1237 145
723 3300049589 Ga0501073_0552588 Ga0501073_0552588_24_491 145
724 3300049589 Ga0501073_0708921 Ga0501073_0708921_26_493 145
725 3300049590 Ga0501074_0097166 Ga0501074_0097166_1176_1643 145
726 3300049592 Ga0501076_0013874 Ga0501076_0013874_884_1351 145
727 3300049593 Ga0501077_0009715 Ga0501077_0009715_3067_3534 145
728 3300049742 Ga0501080_0071179 Ga0501080_0071179_211_678 145
729 3300049742 Ga0501080_0304974 Ga0501080_0304974_682_1137 145
730 3300049744 Ga0501083_0011002 Ga0501083_0011002_4298_4765 145
731 3300049822 Ga0501035_0000875 Ga0501035_0000875_211_678 145
732 3300049822 Ga0501035_0005206 Ga0501035_0005206_8436_8903 145
733 3300049822 Ga0501035_0031238 Ga0501035_0031238_1155_1610 145
734 3300049822 Ga0501035_0179403 Ga0501035_0179403_438_893 145
735 3300049823 Ga0501044_0000958 Ga0501044_0000958_211_678 145
736 3300049823 Ga0501044_0017668 Ga0501044_0017668_3141_3608 145
737 3300049823 Ga0501044_0577873 Ga0501044_0577873_400_855 145
738 3300050492 nmdc:mga0yw44_419387_c1 nmdc:mga0yw44_419387_c1_100_555 145
739 3300050494 nmdc:mga06z11_2052_c1 nmdc:mga06z11_2052_c1_1676_2131 145
740 3300050495 nmdc:mga04h51_1501_c1 nmdc:mga04h51_1501_c1_3377_3832 145
741 3300050495 nmdc:mga04h51_312293_c1 nmdc:mga04h51_312293_c1_176_631 145
742 3300050496 nmdc:mga07m45_156808_c1 nmdc:mga07m45_156808_c1_322_777 145
743 3300053077 Ga0495601_0008658 Ga0495601_0008658_4228_4695 145
744 3300053078 Ga0495612_0086778 Ga0495612_0086778_192_659 145
745 3300053079 Ga0500610_0060495 Ga0500610_0060495_840_1295 145
746 3300053083 Ga0495655_0211332 Ga0495655_0211332_23_478 145
747 3300053085 Ga0495619_0033451 Ga0495619_0033451_2385_2840 145
748 3300053085 Ga0495619_0033872 Ga0495619_0033872_863_1330 145
749 3300053086 Ga0500578_0057615 Ga0500578_0057615_1050_1505 145
750 3300053086 Ga0500578_0134918 Ga0500578_0134918_268_723 145
751 3300053091 Ga0500647_0285797 Ga0500647_0285797_177_632 145
752 3300053092 Ga0500583_0084407 Ga0500583_0084407_590_1051 145
753 3300053092 Ga0500583_0364142 Ga0500583_0364142_234_689 145
754 3300053093 Ga0500651_0140657 Ga0500651_0140657_786_1241 145
755 3300053094 Ga0500566_0012041 Ga0500566_0012041_1016_1471 145
756 3300053098 Ga0500650_0236364 Ga0500650_0236364_72_527 145
757 3300053099 Ga0500654_047066 Ga0500654_047066_277_732 145
758 3300053100 Ga0500660_048922 Ga0500660_048922_1365_1820 145
759 3300053101 Ga0500553_095001 Ga0500553_095001_89_544 145
760 3300053104 Ga0500556_0248689 Ga0500556_0248689_159_614 145
761 3300053106 Ga0500558_226084 Ga0500558_226084_28_483 145
762 3300053107 Ga0500560_096532 Ga0500560_096532_373_828 145
763 3300053107 Ga0500560_276697 Ga0500560_276697_12_467 145
764 3300053111 Ga0500572_106979 Ga0500572_106979_164_619 145
765 3300053129 Ga0500628_004401 Ga0500628_004401_287_742 145
766 3300053131 Ga0500652_001663 Ga0500652_001663_4554_5009 145
767 3300053134 Ga0500658_0013764 Ga0500658_0013764_953_1408 145
768 3300053137 Ga0500561_0000925 Ga0500561_0000925_2295_2750 145
769 3300053140 Ga0500573_0040943 Ga0500573_0040943_643_1098 145
770 3300053140 Ga0500573_0186478 Ga0500573_0186478_105_560 145
771 3300053140 Ga0500573_0298807 Ga0500573_0298807_188_643 145
772 3300053143 Ga0500579_055102 Ga0500579_055102_821_1276 145
773 3300053149 Ga0500600_0029849 Ga0500600_0029849_1825_2280 145
774 3300053153 Ga0500616_0010508 Ga0500616_0010508_4423_4878 145
775 3300053157 Ga0500624_010546 Ga0500624_010546_265_720 145
776 3300053160 Ga0500633_0002958 Ga0500633_0002958_1749_2204 145
777 3300053161 Ga0500634_0046269 Ga0500634_0046269_394_849 145
778 3300054114 Ga0501084_0009201 Ga0501084_0009201_6107_6574 145
779 3300060353 Ga0501082_0006857 Ga0501082_0006857_2416_2883 145
780 3300061719 Ga0466962_0028070 Ga0466962_0028070_634_1089 145
781 iso_pu_bacteria 2997451912 2997455097 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

17

144

0.86

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

20

151

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c2i-assembly1.cif.gz_B structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis 0.9111 3 143
2c2i-assembly1.cif.gz_B structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis 0.8814 3 143
3ir3-assembly1.cif.gz_B crystal structure of human 3-hydroxyacyl-thioester dehydratase 2 (htd2) 0.8076 15 141
3fzx-assembly1.cif.gz_A-2 crystal structure of a putative exported protein with ymcc-like fold (bf2203) from bacteroides fragilis nctc 9343 at 2.22 a resolution 0.8056 101 144
4xy5-assembly1.cif.gz_A crystal structure of mutant (asp52ala) hypothetical thioesterase protein sp_1851 from streptococcus pneumoniae tigr4 0.7972 20 143
ID Description Score Start End Superfamily
2c2iB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8977 3 143 3.10.129.10
af_B0G197_51_201_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8749 4 144 3.10.129.10
2c2iB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8685 3 143 3.10.129.10
af_B0G197_51_201_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8468 4 144 3.10.129.10
4gwhA00 Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain 0.8412 89 143 2.40.160.210
ID Description Score Start End GO Terms
AF-A0A3D3UIU8-F1-model_v4 Dehydratase 0.9839 78 144
AF-A0A6J7MXR6-F1-model_v4 Unannotated protein 0.9739 63 145
AF-A0A6L6ESY3-F1-model_v4 Dehydratase 0.9735 55 145
AF-A0A524NTT2-F1-model_v4 Dehydratase 0.9699 77 144
AF-A0A2V9Z8F8-F1-model_v4 MaoC-like domain-containing protein 0.9688 69 145

Feature Viewer

pLDDT pTM Quality
91.66 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map