F480569
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 781 | 445 | 703 | 150 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0123048|Ga0395899_0123048_310_789 |
| Length | 159 |
| Sequence | MTAPRVAQPRLVVDFDKLLTMAGADLGATDWLEITQDRVNLFADATDDHQWIHVDPERAKDGPFGAPIAHGFLTLSLLIPFWGELFDVEGVTTKVNYGLDRVRFTSPVKVGSKVRMLGQIAEVSEVKGAGAQIKVNATIEIEGQERPAVVAEFLARFYK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 2 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 3 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 4 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 5 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 6 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 7 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 8 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 9 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 10 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 11 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 12 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 13 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 14 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 15 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 16 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 17 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 18 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 19 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 20 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 21 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 22 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 23 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 24 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 25 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 26 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 27 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 28 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 29 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 30 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 31 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 32 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 33 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 34 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 35 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 36 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 37 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 38 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 39 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 40 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 41 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 42 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 43 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 44 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 45 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 46 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 47 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 48 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 49 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 50 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 51 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 52 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 53 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 54 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 55 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 56 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 57 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 58 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 59 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 60 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 61 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 62 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 63 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 64 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 65 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 66 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 67 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 68 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 69 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 70 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 71 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 72 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 73 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 74 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 75 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 76 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 89 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 90 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 93 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 94 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 95 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 96 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 97 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 98 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 101 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 118 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 123 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 159 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 160 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 161 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 162 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 163 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 164 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 165 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 166 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 167 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 168 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 170 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 171 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 172 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 173 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 174 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 178 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 179 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 180 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 181 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 182 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 183 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 184 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 187 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 188 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 189 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 190 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 191 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 192 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 193 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 197 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 198 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 199 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 200 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 201 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 202 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 203 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 204 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 205 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 206 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 207 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 208 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 209 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 210 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 211 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 212 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 213 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 214 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 215 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 216 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 217 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 218 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 219 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 220 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 221 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 222 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 223 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 224 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 225 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 226 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 227 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 228 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 229 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 230 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 231 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 232 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 320 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 321 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 322 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 323 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 324 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 325 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 328 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 329 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 330 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 331 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 332 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 333 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 334 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 335 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 336 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 337 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 338 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 339 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 340 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 341 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 342 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 343 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 385 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 386 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 387 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 388 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 389 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 392 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 395 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 396 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 399 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 400 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 401 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 402 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 403 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 404 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 405 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 406 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 407 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 408 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 409 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 410 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 411 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 412 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 413 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 414 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 415 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 416 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 417 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 418 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 419 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 420 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 421 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 422 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 423 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 424 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 425 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 426 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 427 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 428 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 435 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 436 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 437 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 438 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 439 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 440 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 441 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 442 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 443 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 444 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 445 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.71 |
| Metatranscriptomes | 2.3 |
| Isolates | 9.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.96 |
| Nodule | 0.64 |
| Rhizoplane | 4.35 |
| Rhizosphere | 75.42 |
| Stem | 0 |
| Stem Tuber | 0.13 |
| Unclassified | 10.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10022416 | 3300001989 | Bacteria | 2240 |
| 2 | JGI24737J22298_10107585 | 3300001990 | Bacteria | 826 |
| 3 | JGI24735J21928_10091439 | 3300002067 | Bacteria | 872 |
| 4 | JGI24738J21930_10073941 | 3300002075 | Bacteria | 708 |
| 5 | JGI25160J50197_1021111 | 3300003354 | Bacteria | 1945 |
| 6 | JGI25160J50197_1021183 | 3300003354 | Bacteria | 1940 |
| 7 | Ga0055542_1008192 | 3300003762 | Bacteria | 2060 |
| 8 | Ga0065714_10032115 | 3300005288 | Bacteria | 1094 |
| 9 | Ga0065714_10070825 | 3300005288 | Bacteria | 3754 |
| 10 | Ga0065714_10095341 | 3300005288 | Bacteria | 1789 |
| 11 | Ga0065714_10096532 | 3300005288 | Bacteria | 1754 |
| 12 | Ga0065712_10156388 | 3300005290 | Bacteria | 1332 |
| 13 | Ga0070670_100269497 | 3300005331 | Bacteria | 1485 |
| 14 | Ga0070677_10060718 | 3300005333 | Bacteria | 1558 |
| 15 | Ga0070666_10002269 | 3300005335 | Bacteria | 11616 |
| 16 | Ga0070666_10447732 | 3300005335 | Bacteria | 932 |
| 17 | Ga0070668_100039209 | 3300005347 | Bacteria | 3623 |
| 18 | Ga0070668_100265087 | 3300005347 | Bacteria | 1430 |
| 19 | Ga0070675_100064772 | 3300005354 | Bacteria | 3021 |
| 20 | Ga0070671_100004562 | 3300005355 | Bacteria | 10971 |
| 21 | Ga0070671_100214555 | 3300005355 | Bacteria | 1633 |
| 22 | Ga0070674_100004502 | 3300005356 | Bacteria | 7952 |
| 23 | Ga0070673_100042527 | 3300005364 | Bacteria | 3504 |
| 24 | Ga0070673_101449030 | 3300005364 | Bacteria | 647 |
| 25 | Ga0070667_100096351 | 3300005367 | Bacteria | 2551 |
| 26 | Ga0070698_101188237 | 3300005471 | Bacteria | 712 |
| 27 | Ga0070672_100095555 | 3300005543 | Bacteria | 2403 |
| 28 | Ga0070665_100122008 | 3300005548 | Bacteria | 2608 |
| 29 | Ga0070665_100362641 | 3300005548 | Bacteria | 1455 |
| 30 | Ga0068856_100094109 | 3300005614 | Bacteria | 2983 |
| 31 | Ga0068864_100023949 | 3300005618 | Bacteria | 5131 |
| 32 | Ga0068870_10292500 | 3300005840 | Bacteria | 1025 |
| 33 | Ga0068863_100500960 | 3300005841 | Bacteria | 1196 |
| 34 | Ga0081455_10303849 | 3300005937 | Bacteria | 1143 |
| 35 | Ga0075365_10064376 | 3300006038 | Bacteria | 2456 |
| 36 | Ga0075365_10087589 | 3300006038 | Bacteria | 2117 |
| 37 | Ga0075365_10240289 | 3300006038 | Bacteria | 1272 |
| 38 | Ga0075365_10467485 | 3300006038 | Bacteria | 891 |
| 39 | Ga0075368_10004371 | 3300006042 | Bacteria | 4785 |
| 40 | Ga0075364_10013237 | 3300006051 | Bacteria | 5064 |
| 41 | Ga0075432_10216997 | 3300006058 | Bacteria | 763 |
| 42 | Ga0075367_10000434 | 3300006178 | Bacteria | 15538 |
| 43 | Ga0075367_10527346 | 3300006178 | Bacteria | 750 |
| 44 | Ga0075369_10006180 | 3300006186 | Bacteria | 4520 |
| 45 | Ga0075369_10103748 | 3300006186 | Bacteria | 1277 |
| 46 | Ga0075429_100291719 | 3300006880 | Bacteria | 1428 |
| 47 | Ga0099826_10048198 | 3300006948 | Bacteria | 2885 |
| 48 | Ga0105251_10078766 | 3300009011 | Bacteria | 1526 |
| 49 | Ga0105244_10013281 | 3300009036 | Bacteria | 4823 |
| 50 | Ga0105244_10029982 | 3300009036 | Bacteria | 2899 |
| 51 | Ga0105244_10032502 | 3300009036 | Bacteria | 2761 |
| 52 | Ga0114129_10004812 | 3300009147 | Bacteria | 19081 |
| 53 | Ga0114129_11305114 | 3300009147 | Bacteria | 899 |
| 54 | Ga0105243_10054006 | 3300009148 | Bacteria | 3188 |
| 55 | Ga0105243_10233148 | 3300009148 | Bacteria | 1634 |
| 56 | Ga0105242_10288171 | 3300009176 | Bacteria | 1494 |
| 57 | Ga0105242_10363794 | 3300009176 | Bacteria | 1339 |
| 58 | Ga0105248_10000710 | 3300009177 | Bacteria | 37689 |
| 59 | Ga0105248_10033988 | 3300009177 | Bacteria | 5700 |
| 60 | Ga0105237_10163014 | 3300009545 | Bacteria | 2228 |
| 61 | Ga0105239_10495401 | 3300010375 | Bacteria | 1389 |
| 62 | Ga0105246_10034863 | 3300011119 | Bacteria | 3358 |
| 63 | Ga0105246_10053677 | 3300011119 | Bacteria | 2775 |
| 64 | Ga0105246_10110337 | 3300011119 | Bacteria | 2020 |
| 65 | Ga0105246_10128160 | 3300011119 | Bacteria | 1891 |
| 66 | Ga0105246_10314261 | 3300011119 | Bacteria | 1270 |
| 67 | Ga0105246_11174564 | 3300011119 | Bacteria | 705 |
| 68 | Ga0157373_10014861 | 3300013100 | Bacteria | 5701 |
| 69 | Ga0157371_10426476 | 3300013102 | Bacteria | 973 |
| 70 | Ga0157371_10757235 | 3300013102 | Bacteria | 730 |
| 71 | Ga0157369_10033375 | 3300013105 | Bacteria | 5657 |
| 72 | Ga0157369_10339903 | 3300013105 | Bacteria | 1559 |
| 73 | Ga0163162_10081450 | 3300013306 | Bacteria | 3308 |
| 74 | Ga0157372_10179178 | 3300013307 | Bacteria | 2453 |
| 75 | Ga0157375_10189265 | 3300013308 | Bacteria | 2212 |
| 76 | Ga0163163_10008428 | 3300014325 | Bacteria | 9159 |
| 77 | Ga0182008_10025649 | 3300014497 | Bacteria | 2994 |
| 78 | Ga0182006_1026052 | 3300015261 | Bacteria | 2397 |
| 79 | Ga0182007_10001776 | 3300015262 | Bacteria | 11267 |
| 80 | Ga0183367_1001 | 3300015688 | Bacteria | 1225545 |
| 81 | Ga0163161_10792209 | 3300017792 | Bacteria | 796 |
| 82 | Ga0213875_10014079 | 3300021388 | Bacteria | 3910 |
| 83 | Ga0209148_1004731 | 3300025254 | Bacteria | 3272 |
| 84 | Ga0209148_1016153 | 3300025254 | Bacteria | 1289 |
| 85 | Ga0207426_1005303 | 3300025302 | Bacteria | 5935 |
| 86 | Ga0209051_1030266 | 3300025303 | Bacteria | 2103 |
| 87 | Ga0207697_10000412 | 3300025315 | Bacteria | 24182 |
| 88 | Ga0207697_10000464 | 3300025315 | Bacteria | 22857 |
| 89 | Ga0207655_1004337 | 3300025728 | Bacteria | 10109 |
| 90 | Ga0207655_1011840 | 3300025728 | Bacteria | 5153 |
| 91 | Ga0207655_1065198 | 3300025728 | Bacteria | 1384 |
| 92 | Ga0207713_1074250 | 3300025735 | Bacteria | 1245 |
| 93 | Ga0207682_10004974 | 3300025893 | Bacteria | 5456 |
| 94 | Ga0207688_10047132 | 3300025901 | Bacteria | 2407 |
| 95 | Ga0207680_10067585 | 3300025903 | Bacteria | 2202 |
| 96 | Ga0207647_10006249 | 3300025904 | Bacteria | 8679 |
| 97 | Ga0207647_10105977 | 3300025904 | Bacteria | 1665 |
| 98 | Ga0207645_10003534 | 3300025907 | Bacteria | 11823 |
| 99 | Ga0207643_10055583 | 3300025908 | Bacteria | 2251 |
| 100 | Ga0207671_10103954 | 3300025914 | Bacteria | 2154 |
| 101 | Ga0207681_10025179 | 3300025923 | Bacteria | 3824 |
| 102 | Ga0207650_10063598 | 3300025925 | Bacteria | 2759 |
| 103 | Ga0207650_10148713 | 3300025925 | Bacteria | 1847 |
| 104 | Ga0207659_10014484 | 3300025926 | Bacteria | 5088 |
| 105 | Ga0207687_10092445 | 3300025927 | Bacteria | 2209 |
| 106 | Ga0207644_10124615 | 3300025931 | Bacteria | 1965 |
| 107 | Ga0207644_10148260 | 3300025931 | Bacteria | 1813 |
| 108 | Ga0207686_10222520 | 3300025934 | Bacteria | 1364 |
| 109 | Ga0207686_10562836 | 3300025934 | Bacteria | 893 |
| 110 | Ga0207709_10156541 | 3300025935 | Bacteria | 1584 |
| 111 | Ga0207669_10013767 | 3300025937 | Bacteria | 4032 |
| 112 | Ga0207691_10001950 | 3300025940 | Bacteria | 20152 |
| 113 | Ga0207711_10000398 | 3300025941 | Bacteria | 45914 |
| 114 | Ga0207711_10140047 | 3300025941 | Bacteria | 2176 |
| 115 | Ga0207667_10524641 | 3300025949 | Bacteria | 1200 |
| 116 | Ga0207651_10040419 | 3300025960 | Bacteria | 3085 |
| 117 | Ga0207712_10527227 | 3300025961 | Bacteria | 1013 |
| 118 | Ga0207668_10029555 | 3300025972 | Bacteria | 3593 |
| 119 | Ga0207668_10241810 | 3300025972 | Bacteria | 1461 |
| 120 | Ga0207658_10004961 | 3300025986 | Bacteria | 9176 |
| 121 | Ga0207639_11125898 | 3300026041 | Bacteria | 736 |
| 122 | Ga0207702_10128157 | 3300026078 | Bacteria | 2281 |
| 123 | Ga0207641_10353841 | 3300026088 | Bacteria | 1400 |
| 124 | Ga0207641_10624395 | 3300026088 | Bacteria | 1057 |
| 125 | Ga0207676_10034653 | 3300026095 | Bacteria | 3823 |
| 126 | Ga0209813_10004127 | 3300027866 | Bacteria | 3449 |
| 127 | Ga0207428_10054253 | 3300027907 | Bacteria | 3193 |
| 128 | Ga0268266_10422410 | 3300028379 | Bacteria | 1263 |
| 129 | Ga0268266_10805624 | 3300028379 | Bacteria | 907 |
| 130 | Ga0307517_10006022 | 3300028786 | Bacteria | 18070 |
| 131 | Ga0307517_10006310 | 3300028786 | Bacteria | 17596 |
| 132 | Ga0307515_10000441 | 3300028794 | Bacteria | 99819 |
| 133 | Ga0307511_10000078 | 3300030521 | Bacteria | 81896 |
| 134 | Ga0307511_10027884 | 3300030521 | Bacteria | 5146 |
| 135 | Ga0307512_10002991 | 3300030522 | Bacteria | 20377 |
| 136 | Ga0307512_10044256 | 3300030522 | Bacteria | 3662 |
| 137 | Ga0307512_10222007 | 3300030522 | Bacteria | 986 |
| 138 | Ga0307513_10002116 | 3300031456 | Bacteria | 27860 |
| 139 | Ga0307513_10022839 | 3300031456 | Bacteria | 7339 |
| 140 | Ga0307513_10085929 | 3300031456 | Bacteria | 3227 |
| 141 | Ga0307513_10342752 | 3300031456 | Bacteria | 1244 |
| 142 | Ga0307509_10086034 | 3300031507 | Bacteria | 3233 |
| 143 | Ga0307509_10092633 | 3300031507 | Bacteria | 3088 |
| 144 | Ga0307509_10105905 | 3300031507 | Bacteria | 2832 |
| 145 | Ga0307509_10259050 | 3300031507 | Bacteria | 1516 |
| 146 | Ga0307408_100010705 | 3300031548 | Bacteria | 6050 |
| 147 | Ga0307408_100027835 | 3300031548 | Bacteria | 3899 |
| 148 | Ga0307408_100035995 | 3300031548 | Bacteria | 3476 |
| 149 | Ga0307408_100154421 | 3300031548 | Bacteria | 1815 |
| 150 | Ga0307408_100170889 | 3300031548 | Bacteria | 1735 |
| 151 | Ga0307508_10010698 | 3300031616 | Bacteria | 8387 |
| 152 | Ga0307508_10219605 | 3300031616 | Bacteria | 1500 |
| 153 | Ga0307508_10302913 | 3300031616 | Bacteria | 1191 |
| 154 | Ga0307514_10054370 | 3300031649 | Bacteria | 3084 |
| 155 | Ga0307514_10100603 | 3300031649 | Bacteria | 2077 |
| 156 | Ga0307514_10294059 | 3300031649 | Bacteria | 916 |
| 157 | Ga0307514_10368325 | 3300031649 | Bacteria | 754 |
| 158 | Ga0307516_10218051 | 3300031730 | Bacteria | 1619 |
| 159 | Ga0307405_10010781 | 3300031731 | Bacteria | 4754 |
| 160 | Ga0307405_10020383 | 3300031731 | Bacteria | 3704 |
| 161 | Ga0307405_10048076 | 3300031731 | Bacteria | 2629 |
| 162 | Ga0307405_10783132 | 3300031731 | Bacteria | 797 |
| 163 | Ga0307413_10080964 | 3300031824 | Bacteria | 2081 |
| 164 | Ga0307413_10189163 | 3300031824 | Bacteria | 1476 |
| 165 | Ga0307413_10401942 | 3300031824 | Bacteria | 1073 |
| 166 | Ga0307518_10014202 | 3300031838 | Bacteria | 5690 |
| 167 | Ga0307518_10111619 | 3300031838 | Bacteria | 1947 |
| 168 | Ga0307410_10004832 | 3300031852 | Bacteria | 7039 |
| 169 | Ga0307410_10005726 | 3300031852 | Bacteria | 6619 |
| 170 | Ga0307410_10124464 | 3300031852 | Bacteria | 1885 |
| 171 | Ga0307410_10127411 | 3300031852 | Bacteria | 1865 |
| 172 | Ga0307410_10206902 | 3300031852 | Bacteria | 1501 |
| 173 | Ga0307406_10000260 | 3300031901 | Bacteria | 31960 |
| 174 | Ga0307406_10052336 | 3300031901 | Bacteria | 2597 |
| 175 | Ga0307406_11315990 | 3300031901 | Bacteria | 631 |
| 176 | Ga0307407_10010735 | 3300031903 | Bacteria | 4330 |
| 177 | Ga0307407_10014824 | 3300031903 | Bacteria | 3830 |
| 178 | Ga0307407_10033544 | 3300031903 | Bacteria | 2802 |
| 179 | Ga0307407_10128152 | 3300031903 | Bacteria | 1619 |
| 180 | Ga0307412_10014340 | 3300031911 | Bacteria | 4671 |
| 181 | Ga0307412_10019875 | 3300031911 | Bacteria | 4077 |
| 182 | Ga0307412_10095888 | 3300031911 | Bacteria | 2086 |
| 183 | Ga0307412_11373419 | 3300031911 | Bacteria | 638 |
| 184 | Ga0307409_100004513 | 3300031995 | Bacteria | 7836 |
| 185 | Ga0307409_100025309 | 3300031995 | Bacteria | 4159 |
| 186 | Ga0307409_100362348 | 3300031995 | Bacteria | 1372 |
| 187 | Ga0307409_100399464 | 3300031995 | Bacteria | 1312 |
| 188 | Ga0307409_100433311 | 3300031995 | Bacteria | 1264 |
| 189 | Ga0307409_100506405 | 3300031995 | Bacteria | 1177 |
| 190 | Ga0307409_100628921 | 3300031995 | Bacteria | 1064 |
| 191 | Ga0307416_100004263 | 3300032002 | Bacteria | 8588 |
| 192 | Ga0307416_100013845 | 3300032002 | Bacteria | 5498 |
| 193 | Ga0307416_100149219 | 3300032002 | Bacteria | 2141 |
| 194 | Ga0307416_100179944 | 3300032002 | Bacteria | 1980 |
| 195 | Ga0307416_100235966 | 3300032002 | Bacteria | 1768 |
| 196 | Ga0307416_100369713 | 3300032002 | Bacteria | 1459 |
| 197 | Ga0307416_102050660 | 3300032002 | Bacteria | 674 |
| 198 | Ga0307414_10071158 | 3300032004 | Bacteria | 2508 |
| 199 | Ga0307414_10128679 | 3300032004 | Bacteria | 1961 |
| 200 | Ga0307414_10957245 | 3300032004 | Bacteria | 787 |
| 201 | Ga0307411_10159211 | 3300032005 | Bacteria | 1688 |
| 202 | Ga0307411_10316001 | 3300032005 | Bacteria | 1259 |
| 203 | Ga0307415_100616398 | 3300032126 | Bacteria | 968 |
| 204 | Ga0307415_100708144 | 3300032126 | Bacteria | 909 |
| 205 | Ga0307507_10014173 | 3300033179 | Bacteria | 9543 |
| 206 | Ga0307507_10049696 | 3300033179 | Bacteria | 4059 |
| 207 | Ga0307507_10342860 | 3300033179 | Bacteria | 884 |
| 208 | Ga0307510_10018716 | 3300033180 | Bacteria | 8138 |
| 209 | Ga0307510_10220371 | 3300033180 | Bacteria | 1409 |
| 210 | Ga0395899_0006498 | 3300037312 | Bacteria | 9057 |
| 211 | Ga0395899_0123048 | 3300037312 | Bacteria | 1856 |
| 212 | Ga0395899_0285854 | 3300037312 | Bacteria | 1120 |
| 213 | Ga0395900_0021768 | 3300037418 | Bacteria | 6555 |
| 214 | Ga0395900_0115912 | 3300037418 | Bacteria | 2749 |
| 215 | Ga0395900_0137022 | 3300037418 | Bacteria | 2508 |
| 216 | Ga0395900_0388892 | 3300037418 | Bacteria | 1361 |
| 217 | Ga0395898_0005196 | 3300037466 | Bacteria | 14074 |
| 218 | Ga0395898_0005339 | 3300037466 | Bacteria | 13893 |
| 219 | Ga0395898_0014229 | 3300037466 | Bacteria | 8179 |
| 220 | Ga0395898_0125480 | 3300037466 | Bacteria | 2459 |
| 221 | Ga0395898_0141104 | 3300037466 | Bacteria | 2306 |
| 222 | Ga0395898_0192705 | 3300037466 | Bacteria | 1947 |
| 223 | Ga0395905_0031908 | 3300037471 | Bacteria | 4956 |
| 224 | Ga0395905_0036918 | 3300037471 | Bacteria | 4590 |
| 225 | Ga0395905_0408133 | 3300037471 | Bacteria | 1254 |
| 226 | Ga0436364_0460308 | 3300037853 | Bacteria | 5443 |
| 227 | Ga0395901_0004781 | 3300038443 | Bacteria | 13667 |
| 228 | Ga0395901_0093943 | 3300038443 | Bacteria | 3141 |
| 229 | Ga0395901_0115025 | 3300038443 | Bacteria | 2825 |
| 230 | Ga0395901_0128743 | 3300038443 | Bacteria | 2661 |
| 231 | Ga0395901_0675443 | 3300038443 | Bacteria | 1033 |
| 232 | Ga0439436_0000674 | 3300041404 | Bacteria | 9163 |
| 233 | Ga0439436_0001517 | 3300041404 | Bacteria | 6747 |
| 234 | Ga0439436_0022429 | 3300041404 | Bacteria | 1870 |
| 235 | Ga0439438_015554 | 3300041405 | Bacteria | 2235 |
| 236 | Ga0439438_032003 | 3300041405 | Bacteria | 1396 |
| 237 | Ga0439439_0001987 | 3300041406 | Bacteria | 4245 |
| 238 | Ga0439439_0010900 | 3300041406 | Bacteria | 2180 |
| 239 | Ga0439439_0020330 | 3300041406 | Bacteria | 1651 |
| 240 | Ga0439447_096006 | 3300041407 | Bacteria | 681 |
| 241 | Ga0439466_0002356 | 3300041411 | Bacteria | 7405 |
| 242 | Ga0451793_0902738 | 3300041452 | Bacteria | 638 |
| 243 | Ga0451800_0099299 | 3300041459 | Bacteria | 696 |
| 244 | Ga0451807_1784448 | 3300041486 | Bacteria | 763 |
| 245 | Ga0451843_1323196 | 3300041509 | Bacteria | 679 |
| 246 | Ga0451843_1661877 | 3300041509 | Bacteria | 646 |
| 247 | Ga0451853_0041647 | 3300041512 | Bacteria | 1053 |
| 248 | Ga0451853_0551214 | 3300041512 | Bacteria | 5322 |
| 249 | Ga0451853_1235510 | 3300041512 | Bacteria | 1214 |
| 250 | Ga0451853_2416279 | 3300041512 | Bacteria | 725 |
| 251 | Ga0439431_0117664 | 3300041997 | Bacteria | 740 |
| 252 | Ga0439433_0000244 | 3300041999 | Bacteria | 9092 |
| 253 | Ga0439433_0000621 | 3300041999 | Bacteria | 6764 |
| 254 | Ga0439433_0023570 | 3300041999 | Bacteria | 1385 |
| 255 | Ga0439442_000177 | 3300042002 | Bacteria | 16193 |
| 256 | Ga0439442_000461 | 3300042002 | Bacteria | 9280 |
| 257 | Ga0439442_000602 | 3300042002 | Bacteria | 7758 |
| 258 | Ga0439442_001218 | 3300042002 | Bacteria | 5115 |
| 259 | Ga0439442_008031 | 3300042002 | Bacteria | 2134 |
| 260 | Ga0439448_0002008 | 3300042005 | Bacteria | 5435 |
| 261 | Ga0439432_059060 | 3300042006 | Bacteria | 1185 |
| 262 | Ga0439432_215879 | 3300042006 | Bacteria | 554 |
| 263 | Ga0439449_0001345 | 3300042007 | Bacteria | 9628 |
| 264 | Ga0439449_0001787 | 3300042007 | Bacteria | 8464 |
| 265 | Ga0439449_0018526 | 3300042007 | Bacteria | 2613 |
| 266 | Ga0439449_0047321 | 3300042007 | Bacteria | 1593 |
| 267 | Ga0439449_0143415 | 3300042007 | Bacteria | 889 |
| 268 | Ga0439455_0007567 | 3300042012 | Bacteria | 2301 |
| 269 | Ga0439457_000160 | 3300042014 | Bacteria | 17392 |
| 270 | Ga0439457_003062 | 3300042014 | Bacteria | 4626 |
| 271 | Ga0439457_006602 | 3300042014 | Bacteria | 2828 |
| 272 | Ga0439457_009717 | 3300042014 | Bacteria | 2231 |
| 273 | Ga0439462_0008371 | 3300042015 | Bacteria | 2606 |
| 274 | Ga0439462_0028777 | 3300042015 | Bacteria | 1469 |
| 275 | Ga0450919_017143 | 3300042121 | Bacteria | 817 |
| 276 | Ga0450920_000125 | 3300042122 | Bacteria | 10438 |
| 277 | Ga0450920_053415 | 3300042122 | Bacteria | 812 |
| 278 | Ga0450894_000018 | 3300042131 | Bacteria | 23505 |
| 279 | Ga0450898_002345 | 3300042134 | Bacteria | 2637 |
| 280 | Ga0450899_004593 | 3300042135 | Bacteria | 1478 |
| 281 | Ga0450903_001349 | 3300042138 | Bacteria | 4590 |
| 282 | Ga0450906_045875 | 3300042145 | Bacteria | 771 |
| 283 | Ga0450907_000222 | 3300042146 | Bacteria | 19774 |
| 284 | Ga0439458_0000209 | 3300042157 | Bacteria | 13705 |
| 285 | Ga0439458_0038764 | 3300042157 | Bacteria | 1151 |
| 286 | Ga0439434_0019212 | 3300042435 | Bacteria | 2048 |
| 287 | Ga0450918_008388 | 3300042531 | Bacteria | 1814 |
| 288 | Ga0466969_0004293 | 3300044656 | Bacteria | 7584 |
| 289 | Ga0466969_0187890 | 3300044656 | Bacteria | 945 |
| 290 | Ga0466972_0003388 | 3300044658 | Bacteria | 7903 |
| 291 | Ga0466972_0004342 | 3300044658 | Bacteria | 7085 |
| 292 | Ga0466965_0001808 | 3300044683 | Bacteria | 8870 |
| 293 | Ga0466965_0029978 | 3300044683 | Bacteria | 2649 |
| 294 | Ga0466965_0045104 | 3300044683 | Bacteria | 2180 |
| 295 | Ga0466966_0010922 | 3300044684 | Bacteria | 6030 |
| 296 | Ga0466966_0050526 | 3300044684 | Bacteria | 2644 |
| 297 | Ga0466961_0002778 | 3300044693 | Bacteria | 10881 |
| 298 | Ga0466961_0028380 | 3300044693 | Bacteria | 3598 |
| 299 | Ga0466961_0111138 | 3300044693 | Bacteria | 1724 |
| 300 | Ga0466961_0200447 | 3300044693 | Bacteria | 1235 |
| 301 | Ga0466963_0000949 | 3300044694 | Bacteria | 14861 |
| 302 | Ga0466963_0184201 | 3300044694 | Bacteria | 1458 |
| 303 | Ga0466971_0000294 | 3300044719 | Bacteria | 19117 |
| 304 | Ga0466971_0071271 | 3300044719 | Bacteria | 1578 |
| 305 | Ga0466971_0208312 | 3300044719 | Bacteria | 924 |
| 306 | Ga0466968_0045533 | 3300044735 | Bacteria | 1862 |
| 307 | Ga0466970_0001385 | 3300044765 | Bacteria | 11683 |
| 308 | Ga0466970_0058297 | 3300044765 | Bacteria | 2067 |
| 309 | Ga0466970_0168892 | 3300044765 | Bacteria | 1212 |
| 310 | Ga0466957_0000752 | 3300044842 | Bacteria | 16515 |
| 311 | Ga0466960_0070020 | 3300044901 | Bacteria | 1744 |
| 312 | Ga0466960_0073699 | 3300044901 | Bacteria | 1704 |
| 313 | Ga0466959_0006963 | 3300045049 | Bacteria | 7900 |
| 314 | Ga0466959_0560877 | 3300045049 | Bacteria | 770 |
| 315 | Ga0466958_0037735 | 3300045836 | Bacteria | 2895 |
| 316 | Ga0466958_0582812 | 3300045836 | Bacteria | 727 |
| 317 | Ga0466967_0008755 | 3300045976 | Bacteria | 7455 |
| 318 | Ga0466967_0070648 | 3300045976 | Bacteria | 3124 |
| 319 | Ga0495592_0027299 | 3300046454 | Bacteria | 4329 |
| 320 | Ga0495592_0033670 | 3300046454 | Bacteria | 3864 |
| 321 | Ga0495603_0066929 | 3300046455 | Bacteria | 2116 |
| 322 | Ga0495603_0095950 | 3300046455 | Bacteria | 1732 |
| 323 | Ga0495603_0269113 | 3300046455 | Bacteria | 980 |
| 324 | Ga0495590_0089424 | 3300046457 | Bacteria | 1089 |
| 325 | Ga0495629_0009641 | 3300046459 | Bacteria | 7053 |
| 326 | Ga0495629_0130143 | 3300046459 | Bacteria | 1753 |
| 327 | Ga0495629_0181123 | 3300046459 | Bacteria | 1460 |
| 328 | Ga0495638_0238348 | 3300046460 | Bacteria | 1008 |
| 329 | Ga0495651_0019860 | 3300046462 | Bacteria | 5210 |
| 330 | Ga0495651_0020501 | 3300046462 | Bacteria | 5132 |
| 331 | Ga0495651_0063023 | 3300046462 | Bacteria | 2835 |
| 332 | Ga0495653_0019851 | 3300046463 | Bacteria | 5447 |
| 333 | Ga0495650_0000546 | 3300046471 | Bacteria | 53831 |
| 334 | Ga0495650_0003187 | 3300046471 | Bacteria | 12224 |
| 335 | Ga0495650_0063387 | 3300046471 | Bacteria | 1474 |
| 336 | Ga0495580_0017553 | 3300046472 | Bacteria | 5349 |
| 337 | Ga0495580_0019062 | 3300046472 | Bacteria | 5101 |
| 338 | Ga0495580_0197621 | 3300046472 | Bacteria | 1386 |
| 339 | Ga0495582_0033939 | 3300046473 | Bacteria | 2806 |
| 340 | Ga0495605_0007297 | 3300046474 | Bacteria | 6279 |
| 341 | Ga0495605_0404418 | 3300046474 | Bacteria | 567 |
| 342 | Ga0495639_0023328 | 3300046475 | Bacteria | 2718 |
| 343 | Ga0495662_0001106 | 3300046476 | Bacteria | 13271 |
| 344 | Ga0495662_0003749 | 3300046476 | Bacteria | 7662 |
| 345 | Ga0495662_0014964 | 3300046476 | Bacteria | 3769 |
| 346 | Ga0495664_0000944 | 3300046477 | Bacteria | 14940 |
| 347 | Ga0495664_0003495 | 3300046477 | Bacteria | 8557 |
| 348 | Ga0495585_0056783 | 3300046492 | Bacteria | 2161 |
| 349 | Ga0495585_0058063 | 3300046492 | Bacteria | 2135 |
| 350 | Ga0495585_0073027 | 3300046492 | Bacteria | 1868 |
| 351 | Ga0495594_0031678 | 3300046499 | Bacteria | 2867 |
| 352 | Ga0495594_0071436 | 3300046499 | Bacteria | 1930 |
| 353 | Ga0495594_0200556 | 3300046499 | Bacteria | 1137 |
| 354 | Ga0495594_0252323 | 3300046499 | Bacteria | 1005 |
| 355 | Ga0495607_0074060 | 3300046501 | Bacteria | 1891 |
| 356 | Ga0495583_0067092 | 3300046506 | Bacteria | 1585 |
| 357 | Ga0495583_0126737 | 3300046506 | Bacteria | 1071 |
| 358 | Ga0495606_0011656 | 3300046507 | Bacteria | 7143 |
| 359 | Ga0495608_0038091 | 3300046511 | Bacteria | 3231 |
| 360 | Ga0495610_0049125 | 3300046512 | Bacteria | 2067 |
| 361 | Ga0495610_0264893 | 3300046512 | Bacteria | 675 |
| 362 | Ga0495616_0034668 | 3300046513 | Bacteria | 2618 |
| 363 | Ga0495618_0071521 | 3300046514 | Bacteria | 2207 |
| 364 | Ga0495618_0197349 | 3300046514 | Bacteria | 1274 |
| 365 | Ga0495620_0059732 | 3300046515 | Bacteria | 1592 |
| 366 | Ga0495620_0063354 | 3300046515 | Bacteria | 1533 |
| 367 | Ga0495620_0186575 | 3300046515 | Bacteria | 801 |
| 368 | Ga0495628_0009491 | 3300046516 | Bacteria | 8306 |
| 369 | Ga0495628_0119453 | 3300046516 | Bacteria | 2023 |
| 370 | Ga0495628_0474891 | 3300046516 | Bacteria | 905 |
| 371 | Ga0495630_0112967 | 3300046517 | Bacteria | 2057 |
| 372 | Ga0495631_0004500 | 3300046518 | Bacteria | 7409 |
| 373 | Ga0495631_0020553 | 3300046518 | Bacteria | 3084 |
| 374 | Ga0495631_0405693 | 3300046518 | Bacteria | 580 |
| 375 | Ga0495632_0028377 | 3300046519 | Bacteria | 2921 |
| 376 | Ga0495637_0011728 | 3300046520 | Bacteria | 4206 |
| 377 | Ga0495643_0015471 | 3300046522 | Bacteria | 4507 |
| 378 | Ga0495643_0021595 | 3300046522 | Bacteria | 3691 |
| 379 | Ga0495643_0218012 | 3300046522 | Bacteria | 907 |
| 380 | Ga0495643_0324793 | 3300046522 | Bacteria | 695 |
| 381 | Ga0495644_0282447 | 3300046523 | Bacteria | 648 |
| 382 | Ga0495663_0051533 | 3300046525 | Bacteria | 1275 |
| 383 | Ga0495666_0001706 | 3300046526 | Bacteria | 10856 |
| 384 | Ga0495666_0014223 | 3300046526 | Bacteria | 3965 |
| 385 | Ga0495642_0018991 | 3300046528 | Bacteria | 2692 |
| 386 | Ga0495652_0135094 | 3300046529 | Bacteria | 1947 |
| 387 | Ga0495652_0151885 | 3300046529 | Bacteria | 1808 |
| 388 | Ga0495652_0213392 | 3300046529 | Bacteria | 1455 |
| 389 | Ga0495652_0447181 | 3300046529 | Bacteria | 905 |
| 390 | Ga0495665_0051007 | 3300046531 | Bacteria | 2192 |
| 391 | Ga0495665_0052305 | 3300046531 | Bacteria | 2162 |
| 392 | Ga0495640_0004901 | 3300046533 | Bacteria | 10642 |
| 393 | Ga0495640_0119508 | 3300046533 | Bacteria | 1714 |
| 394 | Ga0495586_0016082 | 3300046535 | Bacteria | 3981 |
| 395 | Ga0495586_0042314 | 3300046535 | Bacteria | 2453 |
| 396 | Ga0495586_0158607 | 3300046535 | Bacteria | 1275 |
| 397 | Ga0495586_0300947 | 3300046535 | Bacteria | 919 |
| 398 | Ga0495586_0813105 | 3300046535 | Bacteria | 539 |
| 399 | Ga0495587_0005723 | 3300046536 | Bacteria | 8099 |
| 400 | Ga0495587_0017657 | 3300046536 | Bacteria | 4430 |
| 401 | Ga0495621_0210382 | 3300046539 | Bacteria | 785 |
| 402 | Ga0495597_0061951 | 3300046542 | Bacteria | 1628 |
| 403 | Ga0495645_0001887 | 3300046543 | Bacteria | 14246 |
| 404 | Ga0495645_0011669 | 3300046543 | Bacteria | 6186 |
| 405 | Ga0495645_0013935 | 3300046543 | Bacteria | 5699 |
| 406 | Ga0495645_0147148 | 3300046543 | Bacteria | 1640 |
| 407 | Ga0495622_0094613 | 3300046557 | Bacteria | 1371 |
| 408 | Ga0495622_0129063 | 3300046557 | Bacteria | 1152 |
| 409 | Ga0495633_0010590 | 3300046558 | Bacteria | 5025 |
| 410 | Ga0495667_0021005 | 3300046559 | Bacteria | 4403 |
| 411 | Ga0495667_0263332 | 3300046559 | Bacteria | 1096 |
| 412 | Ga0495656_0000824 | 3300046615 | Bacteria | 9975 |
| 413 | Ga0495656_0076739 | 3300046615 | Bacteria | 1498 |
| 414 | Ga0495656_0099734 | 3300046615 | Bacteria | 1341 |
| 415 | Ga0495668_0011623 | 3300046616 | Bacteria | 5265 |
| 416 | Ga0495668_0021391 | 3300046616 | Bacteria | 3709 |
| 417 | Ga0495634_0003733 | 3300046642 | Bacteria | 12131 |
| 418 | Ga0495634_0072823 | 3300046642 | Bacteria | 2259 |
| 419 | Ga0495634_0095140 | 3300046642 | Bacteria | 1929 |
| 420 | Ga0495611_0047008 | 3300046648 | Bacteria | 1936 |
| 421 | Ga0495611_0092495 | 3300046648 | Bacteria | 1398 |
| 422 | Ga0495611_0300197 | 3300046648 | Bacteria | 740 |
| 423 | Ga0495625_0003398 | 3300046660 | Bacteria | 15934 |
| 424 | Ga0495625_0082137 | 3300046660 | Bacteria | 2241 |
| 425 | Ga0495625_0132201 | 3300046660 | Bacteria | 1690 |
| 426 | Ga0495625_0157267 | 3300046660 | Bacteria | 1524 |
| 427 | Ga0495635_0019722 | 3300046663 | Bacteria | 4696 |
| 428 | Ga0495635_0067921 | 3300046663 | Bacteria | 2444 |
| 429 | Ga0495659_0001350 | 3300046664 | Bacteria | 8432 |
| 430 | Ga0495661_0150276 | 3300046665 | Bacteria | 1259 |
| 431 | Ga0495588_0000457 | 3300046674 | Bacteria | 20545 |
| 432 | Ga0495588_0304120 | 3300046674 | Bacteria | 839 |
| 433 | Ga0495657_0009095 | 3300046675 | Bacteria | 7550 |
| 434 | Ga0495657_0082483 | 3300046675 | Bacteria | 2077 |
| 435 | Ga0495657_0125780 | 3300046675 | Bacteria | 1610 |
| 436 | Ga0495657_0239046 | 3300046675 | Bacteria | 1096 |
| 437 | Ga0495599_0090721 | 3300046678 | Bacteria | 1906 |
| 438 | Ga0495599_0292368 | 3300046678 | Bacteria | 985 |
| 439 | Ga0495623_0057784 | 3300046679 | Bacteria | 2439 |
| 440 | Ga0495623_0258735 | 3300046679 | Bacteria | 976 |
| 441 | Ga0495646_0006326 | 3300046680 | Bacteria | 7513 |
| 442 | Ga0495646_0147915 | 3300046680 | Bacteria | 1308 |
| 443 | Ga0495646_0403827 | 3300046680 | Bacteria | 710 |
| 444 | Ga0495658_0127343 | 3300046683 | Bacteria | 1547 |
| 445 | Ga0495613_0008940 | 3300046689 | Bacteria | 7434 |
| 446 | Ga0495613_0028895 | 3300046689 | Bacteria | 4123 |
| 447 | Ga0495613_0045655 | 3300046689 | Bacteria | 3239 |
| 448 | Ga0495613_0063712 | 3300046689 | Bacteria | 2696 |
| 449 | Ga0495670_0000592 | 3300046691 | Bacteria | 17270 |
| 450 | Ga0495670_0058317 | 3300046691 | Bacteria | 1938 |
| 451 | Ga0495670_0228477 | 3300046691 | Bacteria | 989 |
| 452 | Ga0495671_0037936 | 3300046692 | Bacteria | 2435 |
| 453 | Ga0495649_0198706 | 3300046694 | Bacteria | 1042 |
| 454 | Ga0495589_0001319 | 3300046794 | Bacteria | 14568 |
| 455 | Ga0495589_0018296 | 3300046794 | Bacteria | 3594 |
| 456 | Ga0495589_0021412 | 3300046794 | Bacteria | 3304 |
| 457 | Ga0495589_0041917 | 3300046794 | Bacteria | 2282 |
| 458 | Ga0495589_0052568 | 3300046794 | Bacteria | 2012 |
| 459 | Ga0495589_0350472 | 3300046794 | Bacteria | 680 |
| 460 | Ga0495600_0013998 | 3300046809 | Bacteria | 5055 |
| 461 | Ga0495600_0022370 | 3300046809 | Bacteria | 4057 |
| 462 | Ga0495600_0106144 | 3300046809 | Bacteria | 1830 |
| 463 | Ga0495600_0281739 | 3300046809 | Bacteria | 1052 |
| 464 | Ga0495600_0377197 | 3300046809 | Bacteria | 885 |
| 465 | Ga0495660_0028052 | 3300046810 | Bacteria | 3183 |
| 466 | Ga0495581_0020074 | 3300047315 | Bacteria | 3879 |
| 467 | Ga0495581_0020881 | 3300047315 | Bacteria | 3800 |
| 468 | Ga0495581_0048637 | 3300047315 | Bacteria | 2448 |
| 469 | Ga0495581_0185057 | 3300047315 | Bacteria | 1218 |
| 470 | Ga0495581_0188964 | 3300047315 | Bacteria | 1204 |
| 471 | Ga0495604_0003998 | 3300047317 | Bacteria | 11732 |
| 472 | Ga0495604_0124992 | 3300047317 | Bacteria | 1856 |
| 473 | Ga0495636_0000549 | 3300047318 | Bacteria | 13794 |
| 474 | Ga0495636_0039582 | 3300047318 | Bacteria | 1953 |
| 475 | Ga0495674_0021729 | 3300047319 | Bacteria | 5931 |
| 476 | Ga0495672_0270509 | 3300047320 | Bacteria | 816 |
| 477 | Ga0495676_0019198 | 3300047321 | Bacteria | 6014 |
| 478 | Ga0495676_0021214 | 3300047321 | Bacteria | 5679 |
| 479 | Ga0495676_0038263 | 3300047321 | Bacteria | 3985 |
| 480 | Ga0495676_0038606 | 3300047321 | Bacteria | 3964 |
| 481 | Ga0495676_0055233 | 3300047321 | Bacteria | 3150 |
| 482 | Ga0495676_0118273 | 3300047321 | Bacteria | 1932 |
| 483 | Ga0495680_0627722 | 3300047322 | Bacteria | 716 |
| 484 | Ga0495680_0972827 | 3300047322 | Bacteria | 544 |
| 485 | Ga0495683_0025708 | 3300047323 | Bacteria | 3016 |
| 486 | Ga0495683_0029820 | 3300047323 | Bacteria | 2787 |
| 487 | Ga0495683_0103639 | 3300047323 | Bacteria | 1365 |
| 488 | Ga0495687_003569 | 3300047443 | Bacteria | 11163 |
| 489 | Ga0495687_005167 | 3300047443 | Bacteria | 8447 |
| 490 | Ga0495687_027206 | 3300047443 | Bacteria | 2679 |
| 491 | Ga0495675_0073327 | 3300047444 | Bacteria | 2159 |
| 492 | Ga0495675_0080058 | 3300047444 | Bacteria | 2057 |
| 493 | Ga0495675_0094195 | 3300047444 | Bacteria | 1878 |
| 494 | Ga0495675_0435364 | 3300047444 | Bacteria | 760 |
| 495 | Ga0495679_027516 | 3300047446 | Bacteria | 1875 |
| 496 | Ga0495685_000946 | 3300047447 | Bacteria | 8788 |
| 497 | Ga0495685_003370 | 3300047447 | Bacteria | 5096 |
| 498 | Ga0495685_027572 | 3300047447 | Bacteria | 1954 |
| 499 | Ga0495685_056773 | 3300047447 | Bacteria | 1323 |
| 500 | Ga0495685_100898 | 3300047447 | Bacteria | 953 |
| 501 | Ga0495685_212743 | 3300047447 | Bacteria | 618 |
| 502 | Ga0495681_0000568 | 3300047470 | Bacteria | 28235 |
| 503 | Ga0495681_0012674 | 3300047470 | Bacteria | 4941 |
| 504 | Ga0495681_0016496 | 3300047470 | Bacteria | 4136 |
| 505 | Ga0495681_0139148 | 3300047470 | Bacteria | 1027 |
| 506 | Ga0495684_0057400 | 3300047471 | Bacteria | 2967 |
| 507 | Ga0495684_0112105 | 3300047471 | Bacteria | 2057 |
| 508 | Ga0495686_0022865 | 3300047472 | Bacteria | 4131 |
| 509 | Ga0495686_0062562 | 3300047472 | Bacteria | 2308 |
| 510 | Ga0495686_0063219 | 3300047472 | Bacteria | 2294 |
| 511 | Ga0495593_0000284 | 3300047673 | Bacteria | 27640 |
| 512 | Ga0495593_0021565 | 3300047673 | Bacteria | 3596 |
| 513 | Ga0495593_0035318 | 3300047673 | Bacteria | 2715 |
| 514 | Ga0495593_0067969 | 3300047673 | Bacteria | 1854 |
| 515 | Ga0495602_0028059 | 3300048088 | Bacteria | 5396 |
| 516 | Ga0495602_0053551 | 3300048088 | Bacteria | 3572 |
| 517 | Ga0495602_0110671 | 3300048088 | Bacteria | 2232 |
| 518 | Ga0495614_0094292 | 3300048089 | Bacteria | 1304 |
| 519 | Ga0495614_0097791 | 3300048089 | Bacteria | 1280 |
| 520 | Ga0495615_0103327 | 3300048090 | Bacteria | 807 |
| 521 | Ga0495626_0039038 | 3300048091 | Bacteria | 2248 |
| 522 | Ga0496101_0102816 | 3300048904 | Bacteria | 2140 |
| 523 | Ga0496101_1326643 | 3300048904 | Bacteria | 562 |
| 524 | Ga0496102_0001162 | 3300048905 | Bacteria | 24059 |
| 525 | Ga0496102_0155601 | 3300048905 | Bacteria | 2149 |
| 526 | Ga0496103_0013661 | 3300048906 | Bacteria | 4817 |
| 527 | Ga0496103_0032272 | 3300048906 | Bacteria | 3195 |
| 528 | Ga0496103_0067388 | 3300048906 | Bacteria | 2235 |
| 529 | Ga0496104_0005983 | 3300048907 | Bacteria | 10657 |
| 530 | Ga0496104_0147830 | 3300048907 | Bacteria | 2256 |
| 531 | Ga0496104_1686106 | 3300048907 | Bacteria | 536 |
| 532 | Ga0496105_0162405 | 3300048908 | Bacteria | 1834 |
| 533 | Ga0496105_0171982 | 3300048908 | Bacteria | 1776 |
| 534 | Ga0496106_0022157 | 3300048909 | Bacteria | 4717 |
| 535 | Ga0496106_0038336 | 3300048909 | Bacteria | 3586 |
| 536 | Ga0496107_0035233 | 3300048910 | Bacteria | 3587 |
| 537 | Ga0496107_0701654 | 3300048910 | Bacteria | 744 |
| 538 | Ga0496108_0049563 | 3300048911 | Bacteria | 3512 |
| 539 | Ga0496108_0099586 | 3300048911 | Bacteria | 2478 |
| 540 | Ga0496109_0030900 | 3300048912 | Bacteria | 4802 |
| 541 | Ga0496109_0056531 | 3300048912 | Bacteria | 3580 |
| 542 | Ga0496109_0821190 | 3300048912 | Bacteria | 868 |
| 543 | Ga0496110_0346089 | 3300048913 | Bacteria | 1354 |
| 544 | Ga0496111_0074255 | 3300048914 | Bacteria | 2477 |
| 545 | Ga0496112_0481751 | 3300048915 | Bacteria | 1177 |
| 546 | Ga0496113_0081478 | 3300048916 | Bacteria | 2481 |
| 547 | Ga0496113_0338611 | 3300048916 | Bacteria | 1206 |
| 548 | Ga0496114_0067809 | 3300048917 | Bacteria | 2993 |
| 549 | Ga0496114_0226770 | 3300048917 | Bacteria | 1641 |
| 550 | Ga0496115_0018277 | 3300048918 | Bacteria | 5379 |
| 551 | Ga0496115_0455782 | 3300048918 | Bacteria | 1032 |
| 552 | Ga0496116_0403434 | 3300048919 | Bacteria | 604 |
| 553 | Ga0496117_0026452 | 3300048920 | Bacteria | 4539 |
| 554 | Ga0496118_0009260 | 3300048921 | Bacteria | 9989 |
| 555 | Ga0496119_0007391 | 3300048922 | Bacteria | 9910 |
| 556 | Ga0496119_0225093 | 3300048922 | Bacteria | 958 |
| 557 | Ga0496120_0006761 | 3300048923 | Bacteria | 8709 |
| 558 | Ga0496122_0000358 | 3300048925 | Bacteria | 98103 |
| 559 | Ga0496122_0087985 | 3300048925 | Bacteria | 2131 |
| 560 | Ga0496123_0000280 | 3300048926 | Bacteria | 100544 |
| 561 | Ga0496124_0015167 | 3300048927 | Bacteria | 7401 |
| 562 | Ga0496124_0019241 | 3300048927 | Bacteria | 6364 |
| 563 | Ga0496124_0096797 | 3300048927 | Bacteria | 2397 |
| 564 | Ga0496125_0018179 | 3300048928 | Bacteria | 6680 |
| 565 | Ga0496125_0029138 | 3300048928 | Bacteria | 4968 |
| 566 | Ga0496126_0042674 | 3300048929 | Bacteria | 4187 |
| 567 | Ga0496126_0499539 | 3300048929 | Bacteria | 972 |
| 568 | Ga0501306_027925 | 3300049127 | Bacteria | 824 |
| 569 | Ga0501309_011899 | 3300049129 | Bacteria | 1140 |
| 570 | Ga0501307_025657 | 3300049162 | Bacteria | 792 |
| 571 | Ga0495678_200504 | 3300049459 | Bacteria | 615 |
| 572 | Ga0501315_034410 | 3300049531 | Bacteria | 744 |
| 573 | Ga0501317_005023 | 3300049533 | Bacteria | 1401 |
| 574 | Ga0501317_009295 | 3300049533 | Bacteria | 1151 |
| 575 | Ga0501318_001314 | 3300049534 | Bacteria | 1917 |
| 576 | Ga0501318_022387 | 3300049534 | Bacteria | 810 |
| 577 | Ga0501320_017138 | 3300049536 | Bacteria | 807 |
| 578 | Ga0501321_075312 | 3300049537 | Bacteria | 531 |
| 579 | Ga0501324_018119 | 3300049540 | Bacteria | 703 |
| 580 | Ga0501325_011144 | 3300049541 | Bacteria | 826 |
| 581 | Ga0501333_005582 | 3300049549 | Bacteria | 820 |
| 582 | Ga0501340_023326 | 3300049556 | Bacteria | 530 |
| 583 | Ga0501031_0008351 | 3300049568 | Bacteria | 6732 |
| 584 | Ga0501031_0042282 | 3300049568 | Bacteria | 2975 |
| 585 | Ga0501032_0004814 | 3300049569 | Bacteria | 10121 |
| 586 | Ga0501033_0090186 | 3300049570 | Bacteria | 2242 |
| 587 | Ga0501033_0115404 | 3300049570 | Bacteria | 1951 |
| 588 | Ga0501034_0000488 | 3300049571 | Bacteria | 64385 |
| 589 | Ga0501034_0001465 | 3300049571 | Bacteria | 31253 |
| 590 | Ga0501034_1252833 | 3300049571 | Bacteria | 619 |
| 591 | Ga0501036_0006415 | 3300049572 | Bacteria | 9549 |
| 592 | Ga0501036_0017106 | 3300049572 | Bacteria | 6060 |
| 593 | Ga0501036_0265300 | 3300049572 | Bacteria | 1438 |
| 594 | Ga0501037_0003133 | 3300049573 | Bacteria | 11997 |
| 595 | Ga0501037_0167088 | 3300049573 | Bacteria | 1566 |
| 596 | Ga0501037_0475643 | 3300049573 | Bacteria | 850 |
| 597 | Ga0501038_0016070 | 3300049574 | Bacteria | 6795 |
| 598 | Ga0501038_0040593 | 3300049574 | Bacteria | 4062 |
| 599 | Ga0501038_0086285 | 3300049574 | Bacteria | 2637 |
| 600 | Ga0501039_0052491 | 3300049575 | Bacteria | 3154 |
| 601 | Ga0501039_0093818 | 3300049575 | Bacteria | 2339 |
| 602 | Ga0501041_0073140 | 3300049577 | Bacteria | 2106 |
| 603 | Ga0501042_0005133 | 3300049578 | Bacteria | 8403 |
| 604 | Ga0501043_0000363 | 3300049579 | Bacteria | 41190 |
| 605 | Ga0501043_0008415 | 3300049579 | Bacteria | 8125 |
| 606 | Ga0501043_0149732 | 3300049579 | Bacteria | 1826 |
| 607 | Ga0501046_0004043 | 3300049580 | Bacteria | 13386 |
| 608 | Ga0501046_0152351 | 3300049580 | Bacteria | 1744 |
| 609 | Ga0501047_0000720 | 3300049581 | Bacteria | 34413 |
| 610 | Ga0501047_0002947 | 3300049581 | Bacteria | 16127 |
| 611 | Ga0501047_0060375 | 3300049581 | Bacteria | 3659 |
| 612 | Ga0501047_0310186 | 3300049581 | Bacteria | 1418 |
| 613 | Ga0501048_0006956 | 3300049582 | Bacteria | 8595 |
| 614 | Ga0501067_0011256 | 3300049583 | Bacteria | 4951 |
| 615 | Ga0501068_0116236 | 3300049584 | Bacteria | 1666 |
| 616 | Ga0501069_0204957 | 3300049585 | Bacteria | 1143 |
| 617 | Ga0501071_0025839 | 3300049587 | Bacteria | 4116 |
| 618 | Ga0501072_0001490 | 3300049588 | Bacteria | 17533 |
| 619 | Ga0501072_0561122 | 3300049588 | Bacteria | 901 |
| 620 | Ga0501073_0014287 | 3300049589 | Bacteria | 5767 |
| 621 | Ga0501073_0052732 | 3300049589 | Bacteria | 2848 |
| 622 | Ga0501073_0552588 | 3300049589 | Bacteria | 795 |
| 623 | Ga0501073_0708921 | 3300049589 | Bacteria | 694 |
| 624 | Ga0501074_0097166 | 3300049590 | Bacteria | 2108 |
| 625 | Ga0501076_0013874 | 3300049592 | Bacteria | 6051 |
| 626 | Ga0501077_0009715 | 3300049593 | Bacteria | 5981 |
| 627 | Ga0501079_1563897 | 3300049741 | Bacteria | 519 |
| 628 | Ga0501080_0071179 | 3300049742 | Bacteria | 3234 |
| 629 | Ga0501080_0304974 | 3300049742 | Bacteria | 1444 |
| 630 | Ga0501083_0011002 | 3300049744 | Bacteria | 6359 |
| 631 | Ga0501035_0000875 | 3300049822 | Bacteria | 32012 |
| 632 | Ga0501035_0005206 | 3300049822 | Bacteria | 12308 |
| 633 | Ga0501035_0031238 | 3300049822 | Bacteria | 4851 |
| 634 | Ga0501035_0179403 | 3300049822 | Bacteria | 1825 |
| 635 | Ga0501044_0000958 | 3300049823 | Bacteria | 34677 |
| 636 | Ga0501044_0017668 | 3300049823 | Bacteria | 7649 |
| 637 | Ga0501044_0577873 | 3300049823 | Bacteria | 1018 |
| 638 | nmdc:mga00v17_15360_c1 | 3300050491 | Bacteria | 4297 |
| 639 | nmdc:mga00v17_38569_c1 | 3300050491 | Bacteria | 2857 |
| 640 | nmdc:mga0yw44_212529_c1 | 3300050492 | Bacteria | 1280 |
| 641 | nmdc:mga0yw44_36456_c1 | 3300050492 | Bacteria | 2898 |
| 642 | nmdc:mga0yw44_419387_c1 | 3300050492 | Bacteria | 906 |
| 643 | nmdc:mga0yw44_77801_c1 | 3300050492 | Bacteria | 2073 |
| 644 | nmdc:mga06z11_2052_c1 | 3300050494 | Bacteria | 7645 |
| 645 | nmdc:mga04h51_1501_c1 | 3300050495 | Bacteria | 5400 |
| 646 | nmdc:mga04h51_312293_c1 | 3300050495 | Bacteria | 643 |
| 647 | nmdc:mga07m45_156808_c1 | 3300050496 | Bacteria | 1321 |
| 648 | nmdc:mga05p37_5161_c1 | 3300050507 | Bacteria | 15308 |
| 649 | nmdc:mga09592_237704_c1 | 3300050508 | Bacteria | 1578 |
| 650 | nmdc:mga0sz30_30327_c1 | 3300050516 | Bacteria | 2234 |
| 651 | Ga0495601_0008658 | 3300053077 | Bacteria | 6005 |
| 652 | Ga0495612_0086778 | 3300053078 | Bacteria | 1320 |
| 653 | Ga0500610_0060495 | 3300053079 | Bacteria | 1977 |
| 654 | Ga0500635_0000668 | 3300053080 | Bacteria | 8690 |
| 655 | Ga0500635_0271834 | 3300053080 | Bacteria | 666 |
| 656 | Ga0495655_0211332 | 3300053083 | Bacteria | 638 |
| 657 | Ga0495619_0033451 | 3300053085 | Bacteria | 3339 |
| 658 | Ga0495619_0033872 | 3300053085 | Bacteria | 3318 |
| 659 | Ga0500578_0057615 | 3300053086 | Bacteria | 2483 |
| 660 | Ga0500578_0134918 | 3300053086 | Bacteria | 1546 |
| 661 | Ga0500647_0285797 | 3300053091 | Bacteria | 711 |
| 662 | Ga0500583_0065722 | 3300053092 | Bacteria | 1724 |
| 663 | Ga0500583_0084407 | 3300053092 | Bacteria | 1539 |
| 664 | Ga0500583_0364142 | 3300053092 | Bacteria | 699 |
| 665 | Ga0500651_0140657 | 3300053093 | Bacteria | 1455 |
| 666 | Ga0500566_0012041 | 3300053094 | Bacteria | 5094 |
| 667 | Ga0500641_0041936 | 3300053096 | Bacteria | 1853 |
| 668 | Ga0500650_0236364 | 3300053098 | Bacteria | 823 |
| 669 | Ga0500654_047066 | 3300053099 | Bacteria | 2371 |
| 670 | Ga0500660_048922 | 3300053100 | Bacteria | 2104 |
| 671 | Ga0500553_095001 | 3300053101 | Bacteria | 1300 |
| 672 | Ga0500556_0000972 | 3300053104 | Bacteria | 15260 |
| 673 | Ga0500556_0248689 | 3300053104 | Bacteria | 700 |
| 674 | Ga0500558_226084 | 3300053106 | Bacteria | 632 |
| 675 | Ga0500560_096532 | 3300053107 | Bacteria | 989 |
| 676 | Ga0500560_276697 | 3300053107 | Bacteria | 512 |
| 677 | Ga0500562_000664 | 3300053108 | Bacteria | 8337 |
| 678 | Ga0500572_106979 | 3300053111 | Bacteria | 897 |
| 679 | Ga0500593_045541 | 3300053117 | Bacteria | 1955 |
| 680 | Ga0500594_0019000 | 3300053118 | Bacteria | 1699 |
| 681 | Ga0500628_004401 | 3300053129 | Bacteria | 2333 |
| 682 | Ga0500652_001663 | 3300053131 | Bacteria | 6757 |
| 683 | Ga0500655_007644 | 3300053133 | Bacteria | 1946 |
| 684 | Ga0500658_0013764 | 3300053134 | Bacteria | 2991 |
| 685 | Ga0500559_0000267 | 3300053136 | Bacteria | 40699 |
| 686 | Ga0500561_0000925 | 3300053137 | Bacteria | 4692 |
| 687 | Ga0500573_0040943 | 3300053140 | Bacteria | 2675 |
| 688 | Ga0500573_0186478 | 3300053140 | Bacteria | 1111 |
| 689 | Ga0500573_0298807 | 3300053140 | Bacteria | 806 |
| 690 | Ga0500579_055102 | 3300053143 | Bacteria | 2403 |
| 691 | Ga0500600_0029849 | 3300053149 | Bacteria | 3214 |
| 692 | Ga0500616_0010508 | 3300053153 | Bacteria | 5536 |
| 693 | Ga0500616_0061858 | 3300053153 | Bacteria | 1936 |
| 694 | Ga0500624_010546 | 3300053157 | Bacteria | 1333 |
| 695 | Ga0500633_0002958 | 3300053160 | Bacteria | 3613 |
| 696 | Ga0500634_0046269 | 3300053161 | Bacteria | 2351 |
| 697 | Ga0501084_0009201 | 3300054114 | Bacteria | 8168 |
| 698 | Ga0587098_013179 | 3300059604 | Bacteria | 958 |
| 699 | Ga0587106_049867 | 3300059605 | Bacteria | 739 |
| 700 | Ga0587067_035372 | 3300059640 | Bacteria | 945 |
| 701 | Ga0587068_028813 | 3300059641 | Bacteria | 952 |
| 702 | Ga0501082_0006857 | 3300060353 | Bacteria | 9849 |
| 703 | Ga0466962_0028070 | 3300061719 | Bacteria | 2697 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049568 | Ga0501031_0042282 | Ga0501031_0042282_1672_2139 | 119 |
| 2 | 3300037312 | Ga0395899_0006498 | Ga0395899_0006498_5576_6037 | 125 |
| 3 | 3300037418 | Ga0395900_0115912 | Ga0395900_0115912_928_1389 | 125 |
| 4 | 3300037466 | Ga0395898_0005196 | Ga0395898_0005196_12685_13146 | 125 |
| 5 | 3300038443 | Ga0395901_0004781 | Ga0395901_0004781_12278_12739 | 125 |
| 6 | 3300044656 | Ga0466969_0187890 | Ga0466969_0187890_353_814 | 125 |
| 7 | 3300005288 | Ga0065714_10095341 | Ga0065714_100953412 | 130 |
| 8 | 3300011119 | Ga0105246_10110337 | Ga0105246_101103372 | 131 |
| 9 | 3300013102 | Ga0157371_10757235 | Ga0157371_107572352 | 131 |
| 10 | 3300025904 | Ga0207647_10105977 | Ga0207647_101059772 | 131 |
| 11 | 3300046535 | Ga0495586_0813105 | Ga0495586_0813105_14_469 | 131 |
| 12 | 3300048904 | Ga0496101_1326643 | Ga0496101_1326643_71_526 | 131 |
| 13 | 3300048905 | Ga0496102_0001162 | Ga0496102_0001162_3866_4321 | 131 |
| 14 | 3300048906 | Ga0496103_0032272 | Ga0496103_0032272_964_1419 | 131 |
| 15 | 3300048909 | Ga0496106_0038336 | Ga0496106_0038336_1140_1595 | 131 |
| 16 | 3300048910 | Ga0496107_0701654 | Ga0496107_0701654_82_537 | 131 |
| 17 | 3300048912 | Ga0496109_0821190 | Ga0496109_0821190_55_510 | 131 |
| 18 | 3300048915 | Ga0496112_0481751 | Ga0496112_0481751_421_876 | 131 |
| 19 | 3300048916 | Ga0496113_0081478 | Ga0496113_0081478_1512_1967 | 131 |
| 20 | 3300046472 | Ga0495580_0017553 | Ga0495580_0017553_3711_4166 | 138 |
| 21 | iso_pu_bacteria | 2899370129 | 2899376518 | 138 |
| 22 | 3300030522 | Ga0307512_10044256 | Ga0307512_100442563 | 139 |
| 23 | 3300031456 | Ga0307513_10342752 | Ga0307513_103427522 | 139 |
| 24 | 3300031649 | Ga0307514_10054370 | Ga0307514_100543702 | 139 |
| 25 | 3300044656 | Ga0466969_0004293 | Ga0466969_0004293_4547_5002 | 139 |
| 26 | 3300044658 | Ga0466972_0003388 | Ga0466972_0003388_5000_5455 | 139 |
| 27 | 3300044683 | Ga0466965_0029978 | Ga0466965_0029978_2031_2486 | 139 |
| 28 | 3300044684 | Ga0466966_0050526 | Ga0466966_0050526_191_646 | 139 |
| 29 | 3300044693 | Ga0466961_0028380 | Ga0466961_0028380_88_543 | 139 |
| 30 | 3300044719 | Ga0466971_0208312 | Ga0466971_0208312_374_829 | 139 |
| 31 | 3300044735 | Ga0466968_0045533 | Ga0466968_0045533_1018_1473 | 139 |
| 32 | 3300046455 | Ga0495603_0095950 | Ga0495603_0095950_637_1107 | 140 |
| 33 | 3300047321 | Ga0495676_0019198 | Ga0495676_0019198_3775_4245 | 140 |
| 34 | iso_pu_bacteria | 2643221597 | 2643997798 | 140 |
| 35 | iso_pu_bacteria | 2831935698 | 2831937717 | 140 |
| 36 | iso_pu_bacteria | 2868088558 | 2868095546 | 140 |
| 37 | iso_pu_bacteria | 8003870546 | 8003873696 | 140 |
| 38 | iso_pu_bacteria | 8054727385 | 8054734112 | 140 |
| 39 | 3300044765 | Ga0466970_0058297 | Ga0466970_0058297_1162_1617 | 141 |
| 40 | iso_pu_bacteria | 2582581313 | 2585311236 | 141 |
| 41 | iso_pu_bacteria | 2582581314 | 2585311876 | 141 |
| 42 | iso_pu_bacteria | 2616644814 | 2616693506 | 141 |
| 43 | iso_pu_bacteria | 2643221647 | 2644266478 | 141 |
| 44 | iso_pu_bacteria | 2643221678 | 2644438037 | 141 |
| 45 | iso_pu_bacteria | 2643221714 | 2644631925 | 141 |
| 46 | iso_pu_bacteria | 2775506735 | 2775658807 | 141 |
| 47 | iso_pu_bacteria | 2784746763 | 2785339895 | 141 |
| 48 | iso_pu_bacteria | 2784746768 | 2785372827 | 141 |
| 49 | iso_pu_bacteria | 2786546132 | 2786675149 | 141 |
| 50 | iso_pu_bacteria | 2791355406 | 2793977318 | 141 |
| 51 | iso_pu_bacteria | 2808606357 | 2808829599 | 141 |
| 52 | iso_pu_bacteria | 2808606359 | 2808845180 | 141 |
| 53 | iso_pu_bacteria | 2808606360 | 2808850771 | 141 |
| 54 | iso_pu_bacteria | 2808606366 | 2808876703 | 141 |
| 55 | iso_pu_bacteria | 2808606371 | 2808898215 | 141 |
| 56 | iso_pu_bacteria | 2808606375 | 2808914775 | 141 |
| 57 | iso_pu_bacteria | 2811994871 | 2812318704 | 141 |
| 58 | iso_pu_bacteria | 2811994879 | 2812354519 | 141 |
| 59 | iso_pu_bacteria | 2852635781 | 2852636140 | 141 |
| 60 | iso_pu_bacteria | 2857740372 | 2857740906 | 141 |
| 61 | iso_pu_bacteria | 2862281513 | 2862283200 | 141 |
| 62 | iso_pu_bacteria | 2862382967 | 2862385710 | 141 |
| 63 | iso_pu_bacteria | 2862574272 | 2862576750 | 141 |
| 64 | iso_pu_bacteria | 2863404153 | 2863410105 | 141 |
| 65 | iso_pu_bacteria | 2867428634 | 2867428868 | 141 |
| 66 | iso_pu_bacteria | 2877676314 | 2877677866 | 141 |
| 67 | iso_pu_bacteria | 2904497146 | 2904501486 | 141 |
| 68 | iso_pu_bacteria | 2904776348 | 2904778114 | 141 |
| 69 | iso_pu_bacteria | 2912715099 | 2912716129 | 141 |
| 70 | iso_pu_bacteria | 2919034639 | 2919035460 | 141 |
| 71 | iso_pu_bacteria | 2919468124 | 2919471012 | 141 |
| 72 | iso_pu_bacteria | 2919538618 | 2919539324 | 141 |
| 73 | iso_pu_bacteria | 2932426870 | 2932427876 | 141 |
| 74 | iso_pu_bacteria | 2933418574 | 2933422358 | 141 |
| 75 | iso_pu_bacteria | 2939598168 | 2939601885 | 141 |
| 76 | iso_pu_bacteria | 2939647034 | 2939650318 | 141 |
| 77 | iso_pu_bacteria | 2939674588 | 2939677746 | 141 |
| 78 | iso_pu_bacteria | 2945920336 | 2945923174 | 141 |
| 79 | iso_pu_bacteria | 2945941187 | 2945945129 | 141 |
| 80 | iso_pu_bacteria | 2945956166 | 2945959092 | 141 |
| 81 | iso_pu_bacteria | 2946037020 | 2946041113 | 141 |
| 82 | iso_pu_bacteria | 2946064051 | 2946071148 | 141 |
| 83 | iso_pu_bacteria | 2946072368 | 2946079045 | 141 |
| 84 | iso_pu_bacteria | 2947224130 | 2947225586 | 141 |
| 85 | iso_pu_bacteria | 2954002825 | 2954009760 | 141 |
| 86 | iso_pu_bacteria | 2954380949 | 2954382654 | 141 |
| 87 | iso_pu_bacteria | 2954673503 | 2954680226 | 141 |
| 88 | iso_pu_bacteria | 2954682443 | 2954683925 | 141 |
| 89 | iso_pu_bacteria | 2954691527 | 2954693476 | 141 |
| 90 | iso_pu_bacteria | 2954701450 | 2954708570 | 141 |
| 91 | iso_pu_bacteria | 2954711539 | 2954713142 | 141 |
| 92 | iso_pu_bacteria | 2954721474 | 2954723102 | 141 |
| 93 | iso_pu_bacteria | 2954731030 | 2954738727 | 141 |
| 94 | iso_pu_bacteria | 2954740390 | 2954742009 | 141 |
| 95 | iso_pu_bacteria | 2954749733 | 2954757585 | 141 |
| 96 | iso_pu_bacteria | 2954759201 | 2954760987 | 141 |
| 97 | iso_pu_bacteria | 2990059506 | 2990065458 | 141 |
| 98 | iso_pu_bacteria | 2997600082 | 2997601242 | 141 |
| 99 | iso_pu_bacteria | 3006493962 | 3006501707 | 141 |
| 100 | iso_pu_bacteria | 8008558824 | 8008564126 | 141 |
| 101 | iso_pu_bacteria | 8008574985 | 8008581973 | 141 |
| 102 | iso_pu_bacteria | 8047893842 | 8047903486 | 141 |
| 103 | iso_pu_bacteria | 8048127548 | 8048133336 | 141 |
| 104 | iso_pu_bacteria | 8048356638 | 8048356744 | 141 |
| 105 | iso_pu_bacteria | 8048369669 | 8048379076 | 141 |
| 106 | iso_pu_bacteria | 8048379754 | 8048388181 | 141 |
| 107 | iso_pu_bacteria | 8048406513 | 8048410858 | 141 |
| 108 | iso_pu_bacteria | 8054107350 | 8054108629 | 141 |
| 109 | 3300041404 | Ga0439436_0022429 | Ga0439436_0022429_810_1265 | 142 |
| 110 | 3300041406 | Ga0439439_0010900 | Ga0439439_0010900_1696_2151 | 142 |
| 111 | 3300041999 | Ga0439433_0023570 | Ga0439433_0023570_752_1207 | 142 |
| 112 | 3300042002 | Ga0439442_008031 | Ga0439442_008031_331_786 | 142 |
| 113 | 3300042007 | Ga0439449_0018526 | Ga0439449_0018526_1499_1954 | 142 |
| 114 | 3300042014 | Ga0439457_006602 | Ga0439457_006602_1092_1547 | 142 |
| 115 | 3300053080 | Ga0500635_0271834 | Ga0500635_0271834_57_512 | 142 |
| 116 | 3300031507 | Ga0307509_10105905 | Ga0307509_101059052 | 143 |
| 117 | 3300041512 | Ga0451853_0551214 | Ga0451853_0551214_3600_4055 | 143 |
| 118 | 3300041512 | Ga0451853_2416279 | Ga0451853_2416279_123_572 | 143 |
| 119 | 3300042007 | Ga0439449_0001345 | Ga0439449_0001345_5923_6378 | 143 |
| 120 | 3300046660 | Ga0495625_0157267 | Ga0495625_0157267_170_625 | 143 |
| 121 | 3300059605 | Ga0587106_049867 | Ga0587106_049867_76_531 | 143 |
| 122 | 3300003762 | Ga0055542_1008192 | Ga0055542_10081922 | 144 |
| 123 | 3300005288 | Ga0065714_10032115 | Ga0065714_100321152 | 144 |
| 124 | 3300005288 | Ga0065714_10070825 | Ga0065714_100708254 | 144 |
| 125 | 3300005288 | Ga0065714_10096532 | Ga0065714_100965322 | 144 |
| 126 | 3300005290 | Ga0065712_10156388 | Ga0065712_101563882 | 144 |
| 127 | 3300005331 | Ga0070670_100269497 | Ga0070670_1002694972 | 144 |
| 128 | 3300005333 | Ga0070677_10060718 | Ga0070677_100607181 | 144 |
| 129 | 3300005335 | Ga0070666_10002269 | Ga0070666_1000226910 | 144 |
| 130 | 3300005335 | Ga0070666_10447732 | Ga0070666_104477322 | 144 |
| 131 | 3300005347 | Ga0070668_100039209 | Ga0070668_1000392093 | 144 |
| 132 | 3300005347 | Ga0070668_100265087 | Ga0070668_1002650871 | 144 |
| 133 | 3300005354 | Ga0070675_100064772 | Ga0070675_1000647722 | 144 |
| 134 | 3300005355 | Ga0070671_100004562 | Ga0070671_1000045622 | 144 |
| 135 | 3300005355 | Ga0070671_100214555 | Ga0070671_1002145552 | 144 |
| 136 | 3300005356 | Ga0070674_100004502 | Ga0070674_1000045028 | 144 |
| 137 | 3300005364 | Ga0070673_100042527 | Ga0070673_1000425272 | 144 |
| 138 | 3300005364 | Ga0070673_101449030 | Ga0070673_1014490301 | 144 |
| 139 | 3300005367 | Ga0070667_100096351 | Ga0070667_1000963512 | 144 |
| 140 | 3300005471 | Ga0070698_101188237 | Ga0070698_1011882371 | 144 |
| 141 | 3300005543 | Ga0070672_100095555 | Ga0070672_1000955552 | 144 |
| 142 | 3300005548 | Ga0070665_100122008 | Ga0070665_1001220083 | 144 |
| 143 | 3300005548 | Ga0070665_100362641 | Ga0070665_1003626412 | 144 |
| 144 | 3300005618 | Ga0068864_100023949 | Ga0068864_1000239495 | 144 |
| 145 | 3300005840 | Ga0068870_10292500 | Ga0068870_102925002 | 144 |
| 146 | 3300005841 | Ga0068863_100500960 | Ga0068863_1005009601 | 144 |
| 147 | 3300006038 | Ga0075365_10064376 | Ga0075365_100643763 | 144 |
| 148 | 3300006038 | Ga0075365_10087589 | Ga0075365_100875892 | 144 |
| 149 | 3300006038 | Ga0075365_10240289 | Ga0075365_102402892 | 144 |
| 150 | 3300006051 | Ga0075364_10013237 | Ga0075364_100132375 | 144 |
| 151 | 3300006058 | Ga0075432_10216997 | Ga0075432_102169972 | 144 |
| 152 | 3300006178 | Ga0075367_10527346 | Ga0075367_105273461 | 144 |
| 153 | 3300006186 | Ga0075369_10006180 | Ga0075369_100061802 | 144 |
| 154 | 3300006186 | Ga0075369_10103748 | Ga0075369_101037482 | 144 |
| 155 | 3300006880 | Ga0075429_100291719 | Ga0075429_1002917192 | 144 |
| 156 | 3300009011 | Ga0105251_10078766 | Ga0105251_100787662 | 144 |
| 157 | 3300009036 | Ga0105244_10013281 | Ga0105244_100132813 | 144 |
| 158 | 3300009036 | Ga0105244_10029982 | Ga0105244_100299822 | 144 |
| 159 | 3300009036 | Ga0105244_10032502 | Ga0105244_100325023 | 144 |
| 160 | 3300009147 | Ga0114129_10004812 | Ga0114129_1000481212 | 144 |
| 161 | 3300009147 | Ga0114129_11305114 | Ga0114129_113051141 | 144 |
| 162 | 3300009148 | Ga0105243_10054006 | Ga0105243_100540062 | 144 |
| 163 | 3300009176 | Ga0105242_10288171 | Ga0105242_102881712 | 144 |
| 164 | 3300009176 | Ga0105242_10363794 | Ga0105242_103637942 | 144 |
| 165 | 3300009177 | Ga0105248_10000710 | Ga0105248_1000071023 | 144 |
| 166 | 3300009177 | Ga0105248_10033988 | Ga0105248_100339882 | 144 |
| 167 | 3300009545 | Ga0105237_10163014 | Ga0105237_101630142 | 144 |
| 168 | 3300011119 | Ga0105246_10034863 | Ga0105246_100348633 | 144 |
| 169 | 3300011119 | Ga0105246_10053677 | Ga0105246_100536772 | 144 |
| 170 | 3300011119 | Ga0105246_10128160 | Ga0105246_101281602 | 144 |
| 171 | 3300011119 | Ga0105246_10314261 | Ga0105246_103142612 | 144 |
| 172 | 3300013100 | Ga0157373_10014861 | Ga0157373_100148616 | 144 |
| 173 | 3300013102 | Ga0157371_10426476 | Ga0157371_104264762 | 144 |
| 174 | 3300013105 | Ga0157369_10033375 | Ga0157369_100333751 | 144 |
| 175 | 3300013306 | Ga0163162_10081450 | Ga0163162_100814502 | 144 |
| 176 | 3300013308 | Ga0157375_10189265 | Ga0157375_101892653 | 144 |
| 177 | 3300014325 | Ga0163163_10008428 | Ga0163163_100084283 | 144 |
| 178 | 3300017792 | Ga0163161_10792209 | Ga0163161_107922091 | 144 |
| 179 | 3300025254 | Ga0209148_1004731 | Ga0209148_10047312 | 144 |
| 180 | 3300025254 | Ga0209148_1016153 | Ga0209148_10161532 | 144 |
| 181 | 3300025303 | Ga0209051_1030266 | Ga0209051_10302663 | 144 |
| 182 | 3300025315 | Ga0207697_10000412 | Ga0207697_1000041213 | 144 |
| 183 | 3300025315 | Ga0207697_10000464 | Ga0207697_1000046415 | 144 |
| 184 | 3300025728 | Ga0207655_1004337 | Ga0207655_10043376 | 144 |
| 185 | 3300025728 | Ga0207655_1011840 | Ga0207655_10118404 | 144 |
| 186 | 3300025728 | Ga0207655_1065198 | Ga0207655_10651982 | 144 |
| 187 | 3300025735 | Ga0207713_1074250 | Ga0207713_10742501 | 144 |
| 188 | 3300025893 | Ga0207682_10004974 | Ga0207682_100049747 | 144 |
| 189 | 3300025901 | Ga0207688_10047132 | Ga0207688_100471323 | 144 |
| 190 | 3300025903 | Ga0207680_10067585 | Ga0207680_100675852 | 144 |
| 191 | 3300025907 | Ga0207645_10003534 | Ga0207645_1000353412 | 144 |
| 192 | 3300025908 | Ga0207643_10055583 | Ga0207643_100555833 | 144 |
| 193 | 3300025914 | Ga0207671_10103954 | Ga0207671_101039542 | 144 |
| 194 | 3300025923 | Ga0207681_10025179 | Ga0207681_100251791 | 144 |
| 195 | 3300025925 | Ga0207650_10063598 | Ga0207650_100635982 | 144 |
| 196 | 3300025925 | Ga0207650_10148713 | Ga0207650_101487131 | 144 |
| 197 | 3300025926 | Ga0207659_10014484 | Ga0207659_100144845 | 144 |
| 198 | 3300025927 | Ga0207687_10092445 | Ga0207687_100924452 | 144 |
| 199 | 3300025931 | Ga0207644_10124615 | Ga0207644_101246152 | 144 |
| 200 | 3300025931 | Ga0207644_10148260 | Ga0207644_101482602 | 144 |
| 201 | 3300025934 | Ga0207686_10222520 | Ga0207686_102225202 | 144 |
| 202 | 3300025934 | Ga0207686_10562836 | Ga0207686_105628362 | 144 |
| 203 | 3300025935 | Ga0207709_10156541 | Ga0207709_101565412 | 144 |
| 204 | 3300025937 | Ga0207669_10013767 | Ga0207669_100137674 | 144 |
| 205 | 3300025940 | Ga0207691_10001950 | Ga0207691_1000195010 | 144 |
| 206 | 3300025941 | Ga0207711_10000398 | Ga0207711_1000039829 | 144 |
| 207 | 3300025941 | Ga0207711_10140047 | Ga0207711_101400471 | 144 |
| 208 | 3300025960 | Ga0207651_10040419 | Ga0207651_100404192 | 144 |
| 209 | 3300025972 | Ga0207668_10029555 | Ga0207668_100295553 | 144 |
| 210 | 3300025972 | Ga0207668_10241810 | Ga0207668_102418102 | 144 |
| 211 | 3300025986 | Ga0207658_10004961 | Ga0207658_100049618 | 144 |
| 212 | 3300026088 | Ga0207641_10353841 | Ga0207641_103538412 | 144 |
| 213 | 3300026088 | Ga0207641_10624395 | Ga0207641_106243952 | 144 |
| 214 | 3300026095 | Ga0207676_10034653 | Ga0207676_100346534 | 144 |
| 215 | 3300027907 | Ga0207428_10054253 | Ga0207428_100542532 | 144 |
| 216 | 3300028379 | Ga0268266_10422410 | Ga0268266_104224102 | 144 |
| 217 | 3300028379 | Ga0268266_10805624 | Ga0268266_108056241 | 144 |
| 218 | 3300031456 | Ga0307513_10002116 | Ga0307513_100021163 | 144 |
| 219 | 3300031548 | Ga0307408_100010705 | Ga0307408_1000107055 | 144 |
| 220 | 3300031548 | Ga0307408_100027835 | Ga0307408_1000278352 | 144 |
| 221 | 3300031548 | Ga0307408_100035995 | Ga0307408_1000359953 | 144 |
| 222 | 3300031548 | Ga0307408_100154421 | Ga0307408_1001544212 | 144 |
| 223 | 3300031548 | Ga0307408_100170889 | Ga0307408_1001708891 | 144 |
| 224 | 3300031649 | Ga0307514_10294059 | Ga0307514_102940592 | 144 |
| 225 | 3300031731 | Ga0307405_10010781 | Ga0307405_100107812 | 144 |
| 226 | 3300031731 | Ga0307405_10020383 | Ga0307405_100203833 | 144 |
| 227 | 3300031731 | Ga0307405_10048076 | Ga0307405_100480762 | 144 |
| 228 | 3300031731 | Ga0307405_10783132 | Ga0307405_107831321 | 144 |
| 229 | 3300031824 | Ga0307413_10080964 | Ga0307413_100809642 | 144 |
| 230 | 3300031824 | Ga0307413_10189163 | Ga0307413_101891631 | 144 |
| 231 | 3300031824 | Ga0307413_10401942 | Ga0307413_104019422 | 144 |
| 232 | 3300031852 | Ga0307410_10004832 | Ga0307410_100048326 | 144 |
| 233 | 3300031852 | Ga0307410_10005726 | Ga0307410_100057265 | 144 |
| 234 | 3300031852 | Ga0307410_10124464 | Ga0307410_101244642 | 144 |
| 235 | 3300031852 | Ga0307410_10127411 | Ga0307410_101274112 | 144 |
| 236 | 3300031852 | Ga0307410_10206902 | Ga0307410_102069022 | 144 |
| 237 | 3300031901 | Ga0307406_10000260 | Ga0307406_1000026011 | 144 |
| 238 | 3300031901 | Ga0307406_10052336 | Ga0307406_100523363 | 144 |
| 239 | 3300031901 | Ga0307406_11315990 | Ga0307406_113159902 | 144 |
| 240 | 3300031903 | Ga0307407_10010735 | Ga0307407_100107354 | 144 |
| 241 | 3300031903 | Ga0307407_10014824 | Ga0307407_100148243 | 144 |
| 242 | 3300031903 | Ga0307407_10033544 | Ga0307407_100335442 | 144 |
| 243 | 3300031903 | Ga0307407_10128152 | Ga0307407_101281522 | 144 |
| 244 | 3300031911 | Ga0307412_10014340 | Ga0307412_100143403 | 144 |
| 245 | 3300031911 | Ga0307412_10019875 | Ga0307412_100198753 | 144 |
| 246 | 3300031911 | Ga0307412_10095888 | Ga0307412_100958882 | 144 |
| 247 | 3300031911 | Ga0307412_11373419 | Ga0307412_113734192 | 144 |
| 248 | 3300031995 | Ga0307409_100004513 | Ga0307409_1000045134 | 144 |
| 249 | 3300031995 | Ga0307409_100025309 | Ga0307409_1000253092 | 144 |
| 250 | 3300031995 | Ga0307409_100362348 | Ga0307409_1003623482 | 144 |
| 251 | 3300031995 | Ga0307409_100399464 | Ga0307409_1003994642 | 144 |
| 252 | 3300031995 | Ga0307409_100433311 | Ga0307409_1004333112 | 144 |
| 253 | 3300031995 | Ga0307409_100506405 | Ga0307409_1005064052 | 144 |
| 254 | 3300031995 | Ga0307409_100628921 | Ga0307409_1006289212 | 144 |
| 255 | 3300032002 | Ga0307416_100004263 | Ga0307416_1000042635 | 144 |
| 256 | 3300032002 | Ga0307416_100013845 | Ga0307416_1000138453 | 144 |
| 257 | 3300032002 | Ga0307416_100149219 | Ga0307416_1001492193 | 144 |
| 258 | 3300032002 | Ga0307416_100179944 | Ga0307416_1001799442 | 144 |
| 259 | 3300032002 | Ga0307416_100235966 | Ga0307416_1002359662 | 144 |
| 260 | 3300032002 | Ga0307416_100369713 | Ga0307416_1003697131 | 144 |
| 261 | 3300032002 | Ga0307416_102050660 | Ga0307416_1020506602 | 144 |
| 262 | 3300032004 | Ga0307414_10071158 | Ga0307414_100711582 | 144 |
| 263 | 3300032004 | Ga0307414_10128679 | Ga0307414_101286792 | 144 |
| 264 | 3300032004 | Ga0307414_10957245 | Ga0307414_109572452 | 144 |
| 265 | 3300032005 | Ga0307411_10159211 | Ga0307411_101592112 | 144 |
| 266 | 3300032005 | Ga0307411_10316001 | Ga0307411_103160012 | 144 |
| 267 | 3300032126 | Ga0307415_100616398 | Ga0307415_1006163981 | 144 |
| 268 | 3300032126 | Ga0307415_100708144 | Ga0307415_1007081442 | 144 |
| 269 | 3300037312 | Ga0395899_0123048 | Ga0395899_0123048_310_789 | 144 |
| 270 | 3300037312 | Ga0395899_0285854 | Ga0395899_0285854_434_889 | 144 |
| 271 | 3300037418 | Ga0395900_0021768 | Ga0395900_0021768_6011_6484 | 144 |
| 272 | 3300037418 | Ga0395900_0388892 | Ga0395900_0388892_763_1242 | 144 |
| 273 | 3300037466 | Ga0395898_0125480 | Ga0395898_0125480_1871_2326 | 144 |
| 274 | 3300037466 | Ga0395898_0141104 | Ga0395898_0141104_717_1178 | 144 |
| 275 | 3300037466 | Ga0395898_0192705 | Ga0395898_0192705_29_502 | 144 |
| 276 | 3300037471 | Ga0395905_0031908 | Ga0395905_0031908_2578_3057 | 144 |
| 277 | 3300037471 | Ga0395905_0036918 | Ga0395905_0036918_1711_2184 | 144 |
| 278 | 3300038443 | Ga0395901_0115025 | Ga0395901_0115025_1124_1597 | 144 |
| 279 | 3300038443 | Ga0395901_0128743 | Ga0395901_0128743_273_752 | 144 |
| 280 | 3300038443 | Ga0395901_0675443 | Ga0395901_0675443_356_811 | 144 |
| 281 | 3300041404 | Ga0439436_0000674 | Ga0439436_0000674_7595_8050 | 144 |
| 282 | 3300041404 | Ga0439436_0001517 | Ga0439436_0001517_2731_3186 | 144 |
| 283 | 3300041405 | Ga0439438_015554 | Ga0439438_015554_782_1237 | 144 |
| 284 | 3300041405 | Ga0439438_032003 | Ga0439438_032003_777_1232 | 144 |
| 285 | 3300041406 | Ga0439439_0020330 | Ga0439439_0020330_1133_1588 | 144 |
| 286 | 3300041407 | Ga0439447_096006 | Ga0439447_096006_83_538 | 144 |
| 287 | 3300041411 | Ga0439466_0002356 | Ga0439466_0002356_4958_5413 | 144 |
| 288 | 3300041452 | Ga0451793_0902738 | Ga0451793_0902738_71_526 | 144 |
| 289 | 3300041509 | Ga0451843_1323196 | Ga0451843_1323196_116_568 | 144 |
| 290 | 3300041512 | Ga0451853_0041647 | Ga0451853_0041647_10_465 | 144 |
| 291 | 3300041997 | Ga0439431_0117664 | Ga0439431_0117664_201_656 | 144 |
| 292 | 3300041999 | Ga0439433_0000244 | Ga0439433_0000244_1243_1698 | 144 |
| 293 | 3300041999 | Ga0439433_0000621 | Ga0439433_0000621_4288_4743 | 144 |
| 294 | 3300042002 | Ga0439442_000177 | Ga0439442_000177_6997_7452 | 144 |
| 295 | 3300042002 | Ga0439442_000461 | Ga0439442_000461_3089_3544 | 144 |
| 296 | 3300042002 | Ga0439442_000602 | Ga0439442_000602_1154_1609 | 144 |
| 297 | 3300042002 | Ga0439442_001218 | Ga0439442_001218_3567_4022 | 144 |
| 298 | 3300042006 | Ga0439432_059060 | Ga0439432_059060_55_510 | 144 |
| 299 | 3300042006 | Ga0439432_215879 | Ga0439432_215879_64_519 | 144 |
| 300 | 3300042007 | Ga0439449_0001787 | Ga0439449_0001787_5839_6294 | 144 |
| 301 | 3300042007 | Ga0439449_0047321 | Ga0439449_0047321_549_1004 | 144 |
| 302 | 3300042007 | Ga0439449_0143415 | Ga0439449_0143415_78_533 | 144 |
| 303 | 3300042014 | Ga0439457_003062 | Ga0439457_003062_2050_2505 | 144 |
| 304 | 3300042014 | Ga0439457_009717 | Ga0439457_009717_412_867 | 144 |
| 305 | 3300042015 | Ga0439462_0008371 | Ga0439462_0008371_758_1213 | 144 |
| 306 | 3300042015 | Ga0439462_0028777 | Ga0439462_0028777_533_988 | 144 |
| 307 | 3300042121 | Ga0450919_017143 | Ga0450919_017143_246_701 | 144 |
| 308 | 3300042122 | Ga0450920_000125 | Ga0450920_000125_4734_5189 | 144 |
| 309 | 3300042122 | Ga0450920_053415 | Ga0450920_053415_60_515 | 144 |
| 310 | 3300042145 | Ga0450906_045875 | Ga0450906_045875_290_745 | 144 |
| 311 | 3300042146 | Ga0450907_000222 | Ga0450907_000222_18040_18495 | 144 |
| 312 | 3300042435 | Ga0439434_0019212 | Ga0439434_0019212_468_923 | 144 |
| 313 | 3300042531 | Ga0450918_008388 | Ga0450918_008388_1182_1637 | 144 |
| 314 | 3300044683 | Ga0466965_0045104 | Ga0466965_0045104_1004_1459 | 144 |
| 315 | 3300044901 | Ga0466960_0070020 | Ga0466960_0070020_641_1096 | 144 |
| 316 | 3300046457 | Ga0495590_0089424 | Ga0495590_0089424_621_1076 | 144 |
| 317 | 3300046459 | Ga0495629_0130143 | Ga0495629_0130143_530_985 | 144 |
| 318 | 3300046471 | Ga0495650_0000546 | Ga0495650_0000546_36374_36826 | 144 |
| 319 | 3300046471 | Ga0495650_0003187 | Ga0495650_0003187_5526_5981 | 144 |
| 320 | 3300046471 | Ga0495650_0063387 | Ga0495650_0063387_748_1200 | 144 |
| 321 | 3300046472 | Ga0495580_0197621 | Ga0495580_0197621_191_646 | 144 |
| 322 | 3300046475 | Ga0495639_0023328 | Ga0495639_0023328_1228_1683 | 144 |
| 323 | 3300046499 | Ga0495594_0200556 | Ga0495594_0200556_405_860 | 144 |
| 324 | 3300046506 | Ga0495583_0126737 | Ga0495583_0126737_40_495 | 144 |
| 325 | 3300046512 | Ga0495610_0264893 | Ga0495610_0264893_203_658 | 144 |
| 326 | 3300046515 | Ga0495620_0063354 | Ga0495620_0063354_27_479 | 144 |
| 327 | 3300046515 | Ga0495620_0186575 | Ga0495620_0186575_72_524 | 144 |
| 328 | 3300046518 | Ga0495631_0020553 | Ga0495631_0020553_1104_1559 | 144 |
| 329 | 3300046518 | Ga0495631_0405693 | Ga0495631_0405693_34_486 | 144 |
| 330 | 3300046522 | Ga0495643_0218012 | Ga0495643_0218012_125_577 | 144 |
| 331 | 3300046523 | Ga0495644_0282447 | Ga0495644_0282447_85_543 | 144 |
| 332 | 3300046525 | Ga0495663_0051533 | Ga0495663_0051533_325_780 | 144 |
| 333 | 3300046528 | Ga0495642_0018991 | Ga0495642_0018991_1859_2314 | 144 |
| 334 | 3300046531 | Ga0495665_0052305 | Ga0495665_0052305_1609_2064 | 144 |
| 335 | 3300046535 | Ga0495586_0042314 | Ga0495586_0042314_709_1164 | 144 |
| 336 | 3300046535 | Ga0495586_0158607 | Ga0495586_0158607_95_550 | 144 |
| 337 | 3300046539 | Ga0495621_0210382 | Ga0495621_0210382_38_493 | 144 |
| 338 | 3300046543 | Ga0495645_0147148 | Ga0495645_0147148_959_1414 | 144 |
| 339 | 3300046557 | Ga0495622_0129063 | Ga0495622_0129063_37_492 | 144 |
| 340 | 3300046558 | Ga0495633_0010590 | Ga0495633_0010590_149_604 | 144 |
| 341 | 3300046615 | Ga0495656_0000824 | Ga0495656_0000824_5559_6014 | 144 |
| 342 | 3300046615 | Ga0495656_0076739 | Ga0495656_0076739_683_1135 | 144 |
| 343 | 3300046615 | Ga0495656_0099734 | Ga0495656_0099734_41_499 | 144 |
| 344 | 3300046616 | Ga0495668_0011623 | Ga0495668_0011623_1770_2225 | 144 |
| 345 | 3300046664 | Ga0495659_0001350 | Ga0495659_0001350_5459_5914 | 144 |
| 346 | 3300046674 | Ga0495588_0304120 | Ga0495588_0304120_279_734 | 144 |
| 347 | 3300046691 | Ga0495670_0000592 | Ga0495670_0000592_4785_5240 | 144 |
| 348 | 3300046794 | Ga0495589_0350472 | Ga0495589_0350472_179_634 | 144 |
| 349 | 3300046809 | Ga0495600_0013998 | Ga0495600_0013998_2936_3391 | 144 |
| 350 | 3300047315 | Ga0495581_0048637 | Ga0495581_0048637_17_472 | 144 |
| 351 | 3300047315 | Ga0495581_0188964 | Ga0495581_0188964_430_885 | 144 |
| 352 | 3300047318 | Ga0495636_0000549 | Ga0495636_0000549_1313_1768 | 144 |
| 353 | 3300047447 | Ga0495685_212743 | Ga0495685_212743_46_501 | 144 |
| 354 | 3300047470 | Ga0495681_0012674 | Ga0495681_0012674_1870_2325 | 144 |
| 355 | 3300047470 | Ga0495681_0139148 | Ga0495681_0139148_225_677 | 144 |
| 356 | 3300047673 | Ga0495593_0021565 | Ga0495593_0021565_1399_1854 | 144 |
| 357 | 3300048090 | Ga0495615_0103327 | Ga0495615_0103327_154_609 | 144 |
| 358 | 3300048904 | Ga0496101_0102816 | Ga0496101_0102816_1125_1580 | 144 |
| 359 | 3300048905 | Ga0496102_0155601 | Ga0496102_0155601_1535_1987 | 144 |
| 360 | 3300048906 | Ga0496103_0013661 | Ga0496103_0013661_1653_2108 | 144 |
| 361 | 3300048906 | Ga0496103_0067388 | Ga0496103_0067388_1160_1615 | 144 |
| 362 | 3300048907 | Ga0496104_0005983 | Ga0496104_0005983_9294_9746 | 144 |
| 363 | 3300048907 | Ga0496104_0147830 | Ga0496104_0147830_775_1230 | 144 |
| 364 | 3300048907 | Ga0496104_1686106 | Ga0496104_1686106_62_514 | 144 |
| 365 | 3300048908 | Ga0496105_0162405 | Ga0496105_0162405_681_1133 | 144 |
| 366 | 3300048908 | Ga0496105_0171982 | Ga0496105_0171982_894_1346 | 144 |
| 367 | 3300048909 | Ga0496106_0022157 | Ga0496106_0022157_2518_2973 | 144 |
| 368 | 3300048910 | Ga0496107_0035233 | Ga0496107_0035233_1847_2302 | 144 |
| 369 | 3300048911 | Ga0496108_0049563 | Ga0496108_0049563_2123_2578 | 144 |
| 370 | 3300048911 | Ga0496108_0099586 | Ga0496108_0099586_286_738 | 144 |
| 371 | 3300048912 | Ga0496109_0030900 | Ga0496109_0030900_2750_3202 | 144 |
| 372 | 3300048912 | Ga0496109_0056531 | Ga0496109_0056531_2929_3384 | 144 |
| 373 | 3300048913 | Ga0496110_0346089 | Ga0496110_0346089_243_695 | 144 |
| 374 | 3300048914 | Ga0496111_0074255 | Ga0496111_0074255_1624_2076 | 144 |
| 375 | 3300048916 | Ga0496113_0338611 | Ga0496113_0338611_537_989 | 144 |
| 376 | 3300048917 | Ga0496114_0067809 | Ga0496114_0067809_1995_2450 | 144 |
| 377 | 3300048917 | Ga0496114_0226770 | Ga0496114_0226770_732_1184 | 144 |
| 378 | 3300048918 | Ga0496115_0018277 | Ga0496115_0018277_1253_1708 | 144 |
| 379 | 3300048918 | Ga0496115_0455782 | Ga0496115_0455782_101_553 | 144 |
| 380 | 3300048919 | Ga0496116_0403434 | Ga0496116_0403434_70_522 | 144 |
| 381 | 3300048920 | Ga0496117_0026452 | Ga0496117_0026452_2582_3034 | 144 |
| 382 | 3300048921 | Ga0496118_0009260 | Ga0496118_0009260_3759_4211 | 144 |
| 383 | 3300048922 | Ga0496119_0007391 | Ga0496119_0007391_4006_4458 | 144 |
| 384 | 3300048922 | Ga0496119_0225093 | Ga0496119_0225093_101_556 | 144 |
| 385 | 3300048923 | Ga0496120_0006761 | Ga0496120_0006761_3934_4386 | 144 |
| 386 | 3300048925 | Ga0496122_0000358 | Ga0496122_0000358_4199_4651 | 144 |
| 387 | 3300048925 | Ga0496122_0087985 | Ga0496122_0087985_1069_1521 | 144 |
| 388 | 3300048926 | Ga0496123_0000280 | Ga0496123_0000280_4252_4704 | 144 |
| 389 | 3300048927 | Ga0496124_0015167 | Ga0496124_0015167_4496_4948 | 144 |
| 390 | 3300048927 | Ga0496124_0019241 | Ga0496124_0019241_5434_5889 | 144 |
| 391 | 3300048927 | Ga0496124_0096797 | Ga0496124_0096797_308_760 | 144 |
| 392 | 3300048928 | Ga0496125_0018179 | Ga0496125_0018179_3110_3562 | 144 |
| 393 | 3300048928 | Ga0496125_0029138 | Ga0496125_0029138_3050_3502 | 144 |
| 394 | 3300048929 | Ga0496126_0042674 | Ga0496126_0042674_2017_2469 | 144 |
| 395 | 3300048929 | Ga0496126_0499539 | Ga0496126_0499539_55_507 | 144 |
| 396 | 3300049127 | Ga0501306_027925 | Ga0501306_027925_222_677 | 144 |
| 397 | 3300049129 | Ga0501309_011899 | Ga0501309_011899_206_661 | 144 |
| 398 | 3300049162 | Ga0501307_025657 | Ga0501307_025657_261_716 | 144 |
| 399 | 3300049531 | Ga0501315_034410 | Ga0501315_034410_231_686 | 144 |
| 400 | 3300049533 | Ga0501317_005023 | Ga0501317_005023_390_845 | 144 |
| 401 | 3300049533 | Ga0501317_009295 | Ga0501317_009295_75_530 | 144 |
| 402 | 3300049534 | Ga0501318_001314 | Ga0501318_001314_898_1353 | 144 |
| 403 | 3300049534 | Ga0501318_022387 | Ga0501318_022387_330_785 | 144 |
| 404 | 3300049536 | Ga0501320_017138 | Ga0501320_017138_279_734 | 144 |
| 405 | 3300049537 | Ga0501321_075312 | Ga0501321_075312_38_493 | 144 |
| 406 | 3300049540 | Ga0501324_018119 | Ga0501324_018119_139_594 | 144 |
| 407 | 3300049541 | Ga0501325_011144 | Ga0501325_011144_26_481 | 144 |
| 408 | 3300049549 | Ga0501333_005582 | Ga0501333_005582_34_489 | 144 |
| 409 | 3300049556 | Ga0501340_023326 | Ga0501340_023326_30_485 | 144 |
| 410 | 3300049571 | Ga0501034_0000488 | Ga0501034_0000488_37710_38165 | 144 |
| 411 | 3300049584 | Ga0501068_0116236 | Ga0501068_0116236_613_1065 | 144 |
| 412 | 3300049588 | Ga0501072_0561122 | Ga0501072_0561122_416_871 | 144 |
| 413 | 3300049589 | Ga0501073_0014287 | Ga0501073_0014287_4757_5212 | 144 |
| 414 | 3300049741 | Ga0501079_1563897 | Ga0501079_1563897_46_498 | 144 |
| 415 | 3300050491 | nmdc:mga00v17_15360_c1 | nmdc:mga00v17_15360_c1_799_1254 | 144 |
| 416 | 3300050491 | nmdc:mga00v17_38569_c1 | nmdc:mga00v17_38569_c1_973_1425 | 144 |
| 417 | 3300050492 | nmdc:mga0yw44_212529_c1 | nmdc:mga0yw44_212529_c1_163_618 | 144 |
| 418 | 3300050492 | nmdc:mga0yw44_36456_c1 | nmdc:mga0yw44_36456_c1_1029_1481 | 144 |
| 419 | 3300050492 | nmdc:mga0yw44_77801_c1 | nmdc:mga0yw44_77801_c1_455_910 | 144 |
| 420 | 3300050507 | nmdc:mga05p37_5161_c1 | nmdc:mga05p37_5161_c1_8956_9411 | 144 |
| 421 | 3300050508 | nmdc:mga09592_237704_c1 | nmdc:mga09592_237704_c1_500_955 | 144 |
| 422 | 3300050516 | nmdc:mga0sz30_30327_c1 | nmdc:mga0sz30_30327_c1_1700_2152 | 144 |
| 423 | 3300053080 | Ga0500635_0000668 | Ga0500635_0000668_932_1390 | 144 |
| 424 | 3300053092 | Ga0500583_0065722 | Ga0500583_0065722_25_480 | 144 |
| 425 | 3300053096 | Ga0500641_0041936 | Ga0500641_0041936_72_527 | 144 |
| 426 | 3300053104 | Ga0500556_0000972 | Ga0500556_0000972_3747_4202 | 144 |
| 427 | 3300053108 | Ga0500562_000664 | Ga0500562_000664_6809_7264 | 144 |
| 428 | 3300053117 | Ga0500593_045541 | Ga0500593_045541_361_816 | 144 |
| 429 | 3300053118 | Ga0500594_0019000 | Ga0500594_0019000_449_904 | 144 |
| 430 | 3300053133 | Ga0500655_007644 | Ga0500655_007644_1108_1563 | 144 |
| 431 | 3300053136 | Ga0500559_0000267 | Ga0500559_0000267_4950_5405 | 144 |
| 432 | 3300053153 | Ga0500616_0061858 | Ga0500616_0061858_708_1163 | 144 |
| 433 | 3300059604 | Ga0587098_013179 | Ga0587098_013179_229_684 | 144 |
| 434 | 3300059640 | Ga0587067_035372 | Ga0587067_035372_287_742 | 144 |
| 435 | 3300059641 | Ga0587068_028813 | Ga0587068_028813_279_734 | 144 |
| 436 | iso_pu_bacteria | 2537561592 | 2537900231 | 144 |
| 437 | iso_pu_bacteria | 2919051321 | 2919055020 | 144 |
| 438 | 3300001989 | JGI24739J22299_10022416 | JGI24739J22299_100224162 | 145 |
| 439 | 3300001990 | JGI24737J22298_10107585 | JGI24737J22298_101075851 | 145 |
| 440 | 3300002067 | JGI24735J21928_10091439 | JGI24735J21928_100914392 | 145 |
| 441 | 3300002075 | JGI24738J21930_10073941 | JGI24738J21930_100739412 | 145 |
| 442 | 3300003354 | JGI25160J50197_1021111 | JGI25160J50197_10211112 | 145 |
| 443 | 3300003354 | JGI25160J50197_1021183 | JGI25160J50197_10211832 | 145 |
| 444 | 3300005614 | Ga0068856_100094109 | Ga0068856_1000941092 | 145 |
| 445 | 3300005937 | Ga0081455_10303849 | Ga0081455_103038492 | 145 |
| 446 | 3300006038 | Ga0075365_10467485 | Ga0075365_104674851 | 145 |
| 447 | 3300006042 | Ga0075368_10004371 | Ga0075368_100043714 | 145 |
| 448 | 3300006178 | Ga0075367_10000434 | Ga0075367_100004348 | 145 |
| 449 | 3300006948 | Ga0099826_10048198 | Ga0099826_100481982 | 145 |
| 450 | 3300009148 | Ga0105243_10233148 | Ga0105243_102331482 | 145 |
| 451 | 3300010375 | Ga0105239_10495401 | Ga0105239_104954012 | 145 |
| 452 | 3300011119 | Ga0105246_11174564 | Ga0105246_111745641 | 145 |
| 453 | 3300013105 | Ga0157369_10339903 | Ga0157369_103399032 | 145 |
| 454 | 3300013307 | Ga0157372_10179178 | Ga0157372_101791783 | 145 |
| 455 | 3300014497 | Ga0182008_10025649 | Ga0182008_100256493 | 145 |
| 456 | 3300015261 | Ga0182006_1026052 | Ga0182006_10260523 | 145 |
| 457 | 3300015262 | Ga0182007_10001776 | Ga0182007_100017764 | 145 |
| 458 | 3300015688 | Ga0183367_1001 | Ga0183367_1001745 | 145 |
| 459 | 3300021388 | Ga0213875_10014079 | Ga0213875_100140792 | 145 |
| 460 | 3300025302 | Ga0207426_1005303 | Ga0207426_10053036 | 145 |
| 461 | 3300025904 | Ga0207647_10006249 | Ga0207647_100062495 | 145 |
| 462 | 3300025949 | Ga0207667_10524641 | Ga0207667_105246412 | 145 |
| 463 | 3300025961 | Ga0207712_10527227 | Ga0207712_105272272 | 145 |
| 464 | 3300026041 | Ga0207639_11125898 | Ga0207639_111258981 | 145 |
| 465 | 3300026078 | Ga0207702_10128157 | Ga0207702_101281573 | 145 |
| 466 | 3300027866 | Ga0209813_10004127 | Ga0209813_100041273 | 145 |
| 467 | 3300028786 | Ga0307517_10006022 | Ga0307517_100060228 | 145 |
| 468 | 3300028786 | Ga0307517_10006310 | Ga0307517_1000631018 | 145 |
| 469 | 3300028794 | Ga0307515_10000441 | Ga0307515_1000044168 | 145 |
| 470 | 3300030521 | Ga0307511_10000078 | Ga0307511_1000007858 | 145 |
| 471 | 3300030521 | Ga0307511_10027884 | Ga0307511_100278842 | 145 |
| 472 | 3300030522 | Ga0307512_10002991 | Ga0307512_100029915 | 145 |
| 473 | 3300030522 | Ga0307512_10222007 | Ga0307512_102220072 | 145 |
| 474 | 3300031456 | Ga0307513_10022839 | Ga0307513_100228394 | 145 |
| 475 | 3300031456 | Ga0307513_10085929 | Ga0307513_100859293 | 145 |
| 476 | 3300031507 | Ga0307509_10086034 | Ga0307509_100860344 | 145 |
| 477 | 3300031507 | Ga0307509_10092633 | Ga0307509_100926334 | 145 |
| 478 | 3300031507 | Ga0307509_10259050 | Ga0307509_102590502 | 145 |
| 479 | 3300031616 | Ga0307508_10010698 | Ga0307508_100106988 | 145 |
| 480 | 3300031616 | Ga0307508_10219605 | Ga0307508_102196052 | 145 |
| 481 | 3300031616 | Ga0307508_10302913 | Ga0307508_103029132 | 145 |
| 482 | 3300031649 | Ga0307514_10100603 | Ga0307514_101006032 | 145 |
| 483 | 3300031649 | Ga0307514_10368325 | Ga0307514_103683252 | 145 |
| 484 | 3300031730 | Ga0307516_10218051 | Ga0307516_102180511 | 145 |
| 485 | 3300031838 | Ga0307518_10014202 | Ga0307518_100142026 | 145 |
| 486 | 3300031838 | Ga0307518_10111619 | Ga0307518_101116192 | 145 |
| 487 | 3300033179 | Ga0307507_10014173 | Ga0307507_100141736 | 145 |
| 488 | 3300033179 | Ga0307507_10049696 | Ga0307507_100496962 | 145 |
| 489 | 3300033179 | Ga0307507_10342860 | Ga0307507_103428602 | 145 |
| 490 | 3300033180 | Ga0307510_10018716 | Ga0307510_100187166 | 145 |
| 491 | 3300033180 | Ga0307510_10220371 | Ga0307510_102203712 | 145 |
| 492 | 3300037418 | Ga0395900_0137022 | Ga0395900_0137022_1615_2070 | 145 |
| 493 | 3300037466 | Ga0395898_0005339 | Ga0395898_0005339_8737_9192 | 145 |
| 494 | 3300037466 | Ga0395898_0014229 | Ga0395898_0014229_4997_5452 | 145 |
| 495 | 3300037471 | Ga0395905_0408133 | Ga0395905_0408133_466_921 | 145 |
| 496 | 3300037853 | Ga0436364_0460308 | Ga0436364_0460308_1914_2384 | 145 |
| 497 | 3300038443 | Ga0395901_0093943 | Ga0395901_0093943_266_721 | 145 |
| 498 | 3300041406 | Ga0439439_0001987 | Ga0439439_0001987_2313_2768 | 145 |
| 499 | 3300041459 | Ga0451800_0099299 | Ga0451800_0099299_25_480 | 145 |
| 500 | 3300041486 | Ga0451807_1784448 | Ga0451807_1784448_52_507 | 145 |
| 501 | 3300041509 | Ga0451843_1661877 | Ga0451843_1661877_76_531 | 145 |
| 502 | 3300041512 | Ga0451853_1235510 | Ga0451853_1235510_361_816 | 145 |
| 503 | 3300042005 | Ga0439448_0002008 | Ga0439448_0002008_2506_2961 | 145 |
| 504 | 3300042012 | Ga0439455_0007567 | Ga0439455_0007567_456_911 | 145 |
| 505 | 3300042014 | Ga0439457_000160 | Ga0439457_000160_5296_5751 | 145 |
| 506 | 3300042131 | Ga0450894_000018 | Ga0450894_000018_21454_21909 | 145 |
| 507 | 3300042134 | Ga0450898_002345 | Ga0450898_002345_1274_1729 | 145 |
| 508 | 3300042135 | Ga0450899_004593 | Ga0450899_004593_611_1066 | 145 |
| 509 | 3300042138 | Ga0450903_001349 | Ga0450903_001349_3601_4056 | 145 |
| 510 | 3300042157 | Ga0439458_0000209 | Ga0439458_0000209_11963_12418 | 145 |
| 511 | 3300042157 | Ga0439458_0038764 | Ga0439458_0038764_287_742 | 145 |
| 512 | 3300044658 | Ga0466972_0004342 | Ga0466972_0004342_1043_1498 | 145 |
| 513 | 3300044683 | Ga0466965_0001808 | Ga0466965_0001808_4797_5252 | 145 |
| 514 | 3300044684 | Ga0466966_0010922 | Ga0466966_0010922_5070_5525 | 145 |
| 515 | 3300044693 | Ga0466961_0002778 | Ga0466961_0002778_6833_7288 | 145 |
| 516 | 3300044693 | Ga0466961_0111138 | Ga0466961_0111138_694_1149 | 145 |
| 517 | 3300044693 | Ga0466961_0200447 | Ga0466961_0200447_59_514 | 145 |
| 518 | 3300044694 | Ga0466963_0000949 | Ga0466963_0000949_7968_8423 | 145 |
| 519 | 3300044694 | Ga0466963_0184201 | Ga0466963_0184201_36_491 | 145 |
| 520 | 3300044719 | Ga0466971_0000294 | Ga0466971_0000294_12095_12550 | 145 |
| 521 | 3300044719 | Ga0466971_0071271 | Ga0466971_0071271_68_523 | 145 |
| 522 | 3300044765 | Ga0466970_0001385 | Ga0466970_0001385_4778_5233 | 145 |
| 523 | 3300044765 | Ga0466970_0168892 | Ga0466970_0168892_234_689 | 145 |
| 524 | 3300044842 | Ga0466957_0000752 | Ga0466957_0000752_13521_13976 | 145 |
| 525 | 3300044901 | Ga0466960_0073699 | Ga0466960_0073699_808_1263 | 145 |
| 526 | 3300045049 | Ga0466959_0006963 | Ga0466959_0006963_2668_3123 | 145 |
| 527 | 3300045049 | Ga0466959_0560877 | Ga0466959_0560877_181_636 | 145 |
| 528 | 3300045836 | Ga0466958_0037735 | Ga0466958_0037735_1481_1936 | 145 |
| 529 | 3300045836 | Ga0466958_0582812 | Ga0466958_0582812_187_642 | 145 |
| 530 | 3300045976 | Ga0466967_0008755 | Ga0466967_0008755_529_984 | 145 |
| 531 | 3300045976 | Ga0466967_0070648 | Ga0466967_0070648_2302_2757 | 145 |
| 532 | 3300046454 | Ga0495592_0027299 | Ga0495592_0027299_1734_2201 | 145 |
| 533 | 3300046454 | Ga0495592_0033670 | Ga0495592_0033670_806_1261 | 145 |
| 534 | 3300046455 | Ga0495603_0066929 | Ga0495603_0066929_1389_1844 | 145 |
| 535 | 3300046455 | Ga0495603_0269113 | Ga0495603_0269113_325_780 | 145 |
| 536 | 3300046459 | Ga0495629_0009641 | Ga0495629_0009641_566_1021 | 145 |
| 537 | 3300046459 | Ga0495629_0181123 | Ga0495629_0181123_621_1076 | 145 |
| 538 | 3300046460 | Ga0495638_0238348 | Ga0495638_0238348_479_934 | 145 |
| 539 | 3300046462 | Ga0495651_0019860 | Ga0495651_0019860_270_725 | 145 |
| 540 | 3300046462 | Ga0495651_0020501 | Ga0495651_0020501_3931_4398 | 145 |
| 541 | 3300046462 | Ga0495651_0063023 | Ga0495651_0063023_2334_2789 | 145 |
| 542 | 3300046463 | Ga0495653_0019851 | Ga0495653_0019851_2225_2692 | 145 |
| 543 | 3300046472 | Ga0495580_0019062 | Ga0495580_0019062_537_1004 | 145 |
| 544 | 3300046473 | Ga0495582_0033939 | Ga0495582_0033939_1907_2362 | 145 |
| 545 | 3300046474 | Ga0495605_0007297 | Ga0495605_0007297_2825_3280 | 145 |
| 546 | 3300046474 | Ga0495605_0404418 | Ga0495605_0404418_45_500 | 145 |
| 547 | 3300046476 | Ga0495662_0001106 | Ga0495662_0001106_8605_9060 | 145 |
| 548 | 3300046476 | Ga0495662_0003749 | Ga0495662_0003749_4414_4881 | 145 |
| 549 | 3300046476 | Ga0495662_0014964 | Ga0495662_0014964_3251_3706 | 145 |
| 550 | 3300046477 | Ga0495664_0000944 | Ga0495664_0000944_9774_10229 | 145 |
| 551 | 3300046477 | Ga0495664_0003495 | Ga0495664_0003495_7538_8005 | 145 |
| 552 | 3300046492 | Ga0495585_0056783 | Ga0495585_0056783_1568_2023 | 145 |
| 553 | 3300046492 | Ga0495585_0058063 | Ga0495585_0058063_1344_1799 | 145 |
| 554 | 3300046492 | Ga0495585_0073027 | Ga0495585_0073027_125_580 | 145 |
| 555 | 3300046499 | Ga0495594_0031678 | Ga0495594_0031678_1104_1559 | 145 |
| 556 | 3300046499 | Ga0495594_0071436 | Ga0495594_0071436_631_1086 | 145 |
| 557 | 3300046499 | Ga0495594_0252323 | Ga0495594_0252323_352_807 | 145 |
| 558 | 3300046501 | Ga0495607_0074060 | Ga0495607_0074060_758_1213 | 145 |
| 559 | 3300046506 | Ga0495583_0067092 | Ga0495583_0067092_992_1447 | 145 |
| 560 | 3300046507 | Ga0495606_0011656 | Ga0495606_0011656_3319_3774 | 145 |
| 561 | 3300046511 | Ga0495608_0038091 | Ga0495608_0038091_1985_2452 | 145 |
| 562 | 3300046512 | Ga0495610_0049125 | Ga0495610_0049125_313_768 | 145 |
| 563 | 3300046513 | Ga0495616_0034668 | Ga0495616_0034668_175_630 | 145 |
| 564 | 3300046514 | Ga0495618_0071521 | Ga0495618_0071521_1379_1834 | 145 |
| 565 | 3300046514 | Ga0495618_0197349 | Ga0495618_0197349_466_921 | 145 |
| 566 | 3300046515 | Ga0495620_0059732 | Ga0495620_0059732_12_467 | 145 |
| 567 | 3300046516 | Ga0495628_0009491 | Ga0495628_0009491_4578_5045 | 145 |
| 568 | 3300046516 | Ga0495628_0119453 | Ga0495628_0119453_527_982 | 145 |
| 569 | 3300046516 | Ga0495628_0474891 | Ga0495628_0474891_295_750 | 145 |
| 570 | 3300046517 | Ga0495630_0112967 | Ga0495630_0112967_1009_1476 | 145 |
| 571 | 3300046518 | Ga0495631_0004500 | Ga0495631_0004500_4032_4487 | 145 |
| 572 | 3300046519 | Ga0495632_0028377 | Ga0495632_0028377_834_1289 | 145 |
| 573 | 3300046520 | Ga0495637_0011728 | Ga0495637_0011728_3539_3994 | 145 |
| 574 | 3300046522 | Ga0495643_0015471 | Ga0495643_0015471_249_704 | 145 |
| 575 | 3300046522 | Ga0495643_0021595 | Ga0495643_0021595_2131_2586 | 145 |
| 576 | 3300046522 | Ga0495643_0324793 | Ga0495643_0324793_140_595 | 145 |
| 577 | 3300046526 | Ga0495666_0001706 | Ga0495666_0001706_4099_4566 | 145 |
| 578 | 3300046526 | Ga0495666_0014223 | Ga0495666_0014223_2316_2771 | 145 |
| 579 | 3300046529 | Ga0495652_0135094 | Ga0495652_0135094_166_621 | 145 |
| 580 | 3300046529 | Ga0495652_0151885 | Ga0495652_0151885_582_1049 | 145 |
| 581 | 3300046529 | Ga0495652_0213392 | Ga0495652_0213392_773_1228 | 145 |
| 582 | 3300046529 | Ga0495652_0447181 | Ga0495652_0447181_273_728 | 145 |
| 583 | 3300046531 | Ga0495665_0051007 | Ga0495665_0051007_1128_1595 | 145 |
| 584 | 3300046533 | Ga0495640_0004901 | Ga0495640_0004901_9573_10028 | 145 |
| 585 | 3300046533 | Ga0495640_0119508 | Ga0495640_0119508_925_1392 | 145 |
| 586 | 3300046535 | Ga0495586_0016082 | Ga0495586_0016082_371_838 | 145 |
| 587 | 3300046535 | Ga0495586_0300947 | Ga0495586_0300947_166_621 | 145 |
| 588 | 3300046536 | Ga0495587_0005723 | Ga0495587_0005723_2674_3129 | 145 |
| 589 | 3300046536 | Ga0495587_0017657 | Ga0495587_0017657_3382_3849 | 145 |
| 590 | 3300046542 | Ga0495597_0061951 | Ga0495597_0061951_1033_1488 | 145 |
| 591 | 3300046543 | Ga0495645_0001887 | Ga0495645_0001887_7009_7476 | 145 |
| 592 | 3300046543 | Ga0495645_0011669 | Ga0495645_0011669_3974_4429 | 145 |
| 593 | 3300046543 | Ga0495645_0013935 | Ga0495645_0013935_4074_4529 | 145 |
| 594 | 3300046557 | Ga0495622_0094613 | Ga0495622_0094613_207_662 | 145 |
| 595 | 3300046559 | Ga0495667_0021005 | Ga0495667_0021005_1584_2051 | 145 |
| 596 | 3300046559 | Ga0495667_0263332 | Ga0495667_0263332_89_544 | 145 |
| 597 | 3300046616 | Ga0495668_0021391 | Ga0495668_0021391_1233_1688 | 145 |
| 598 | 3300046642 | Ga0495634_0003733 | Ga0495634_0003733_4712_5167 | 145 |
| 599 | 3300046642 | Ga0495634_0072823 | Ga0495634_0072823_1432_1887 | 145 |
| 600 | 3300046642 | Ga0495634_0095140 | Ga0495634_0095140_582_1049 | 145 |
| 601 | 3300046648 | Ga0495611_0047008 | Ga0495611_0047008_492_947 | 145 |
| 602 | 3300046648 | Ga0495611_0092495 | Ga0495611_0092495_144_599 | 145 |
| 603 | 3300046648 | Ga0495611_0300197 | Ga0495611_0300197_253_708 | 145 |
| 604 | 3300046660 | Ga0495625_0003398 | Ga0495625_0003398_9390_9845 | 145 |
| 605 | 3300046660 | Ga0495625_0082137 | Ga0495625_0082137_365_820 | 145 |
| 606 | 3300046660 | Ga0495625_0132201 | Ga0495625_0132201_927_1382 | 145 |
| 607 | 3300046663 | Ga0495635_0019722 | Ga0495635_0019722_2662_3117 | 145 |
| 608 | 3300046663 | Ga0495635_0067921 | Ga0495635_0067921_800_1267 | 145 |
| 609 | 3300046665 | Ga0495661_0150276 | Ga0495661_0150276_663_1118 | 145 |
| 610 | 3300046674 | Ga0495588_0000457 | Ga0495588_0000457_15453_15908 | 145 |
| 611 | 3300046675 | Ga0495657_0009095 | Ga0495657_0009095_6324_6791 | 145 |
| 612 | 3300046675 | Ga0495657_0082483 | Ga0495657_0082483_957_1412 | 145 |
| 613 | 3300046675 | Ga0495657_0125780 | Ga0495657_0125780_789_1244 | 145 |
| 614 | 3300046675 | Ga0495657_0239046 | Ga0495657_0239046_246_701 | 145 |
| 615 | 3300046678 | Ga0495599_0090721 | Ga0495599_0090721_553_1020 | 145 |
| 616 | 3300046678 | Ga0495599_0292368 | Ga0495599_0292368_162_617 | 145 |
| 617 | 3300046679 | Ga0495623_0057784 | Ga0495623_0057784_735_1202 | 145 |
| 618 | 3300046679 | Ga0495623_0258735 | Ga0495623_0258735_79_534 | 145 |
| 619 | 3300046680 | Ga0495646_0006326 | Ga0495646_0006326_6729_7184 | 145 |
| 620 | 3300046680 | Ga0495646_0147915 | Ga0495646_0147915_289_756 | 145 |
| 621 | 3300046680 | Ga0495646_0403827 | Ga0495646_0403827_52_507 | 145 |
| 622 | 3300046683 | Ga0495658_0127343 | Ga0495658_0127343_494_949 | 145 |
| 623 | 3300046689 | Ga0495613_0008940 | Ga0495613_0008940_512_967 | 145 |
| 624 | 3300046689 | Ga0495613_0028895 | Ga0495613_0028895_1699_2154 | 145 |
| 625 | 3300046689 | Ga0495613_0045655 | Ga0495613_0045655_760_1227 | 145 |
| 626 | 3300046689 | Ga0495613_0063712 | Ga0495613_0063712_1353_1808 | 145 |
| 627 | 3300046691 | Ga0495670_0058317 | Ga0495670_0058317_119_574 | 145 |
| 628 | 3300046691 | Ga0495670_0228477 | Ga0495670_0228477_206_661 | 145 |
| 629 | 3300046692 | Ga0495671_0037936 | Ga0495671_0037936_446_901 | 145 |
| 630 | 3300046694 | Ga0495649_0198706 | Ga0495649_0198706_82_537 | 145 |
| 631 | 3300046794 | Ga0495589_0001319 | Ga0495589_0001319_835_1290 | 145 |
| 632 | 3300046794 | Ga0495589_0018296 | Ga0495589_0018296_64_519 | 145 |
| 633 | 3300046794 | Ga0495589_0021412 | Ga0495589_0021412_1937_2392 | 145 |
| 634 | 3300046794 | Ga0495589_0041917 | Ga0495589_0041917_341_796 | 145 |
| 635 | 3300046794 | Ga0495589_0052568 | Ga0495589_0052568_877_1332 | 145 |
| 636 | 3300046809 | Ga0495600_0022370 | Ga0495600_0022370_2225_2692 | 145 |
| 637 | 3300046809 | Ga0495600_0106144 | Ga0495600_0106144_199_654 | 145 |
| 638 | 3300046809 | Ga0495600_0281739 | Ga0495600_0281739_560_1015 | 145 |
| 639 | 3300046809 | Ga0495600_0377197 | Ga0495600_0377197_76_531 | 145 |
| 640 | 3300046810 | Ga0495660_0028052 | Ga0495660_0028052_2626_3081 | 145 |
| 641 | 3300047315 | Ga0495581_0020074 | Ga0495581_0020074_2249_2704 | 145 |
| 642 | 3300047315 | Ga0495581_0020881 | Ga0495581_0020881_932_1399 | 145 |
| 643 | 3300047315 | Ga0495581_0185057 | Ga0495581_0185057_610_1065 | 145 |
| 644 | 3300047317 | Ga0495604_0003998 | Ga0495604_0003998_8157_8624 | 145 |
| 645 | 3300047317 | Ga0495604_0124992 | Ga0495604_0124992_1159_1614 | 145 |
| 646 | 3300047318 | Ga0495636_0039582 | Ga0495636_0039582_1187_1642 | 145 |
| 647 | 3300047319 | Ga0495674_0021729 | Ga0495674_0021729_2013_2480 | 145 |
| 648 | 3300047320 | Ga0495672_0270509 | Ga0495672_0270509_128_583 | 145 |
| 649 | 3300047321 | Ga0495676_0021214 | Ga0495676_0021214_1643_2098 | 145 |
| 650 | 3300047321 | Ga0495676_0038263 | Ga0495676_0038263_2691_3146 | 145 |
| 651 | 3300047321 | Ga0495676_0038606 | Ga0495676_0038606_2571_3026 | 145 |
| 652 | 3300047321 | Ga0495676_0055233 | Ga0495676_0055233_1053_1508 | 145 |
| 653 | 3300047321 | Ga0495676_0118273 | Ga0495676_0118273_786_1241 | 145 |
| 654 | 3300047322 | Ga0495680_0627722 | Ga0495680_0627722_142_597 | 145 |
| 655 | 3300047322 | Ga0495680_0972827 | Ga0495680_0972827_68_523 | 145 |
| 656 | 3300047323 | Ga0495683_0025708 | Ga0495683_0025708_2057_2512 | 145 |
| 657 | 3300047323 | Ga0495683_0029820 | Ga0495683_0029820_1510_1965 | 145 |
| 658 | 3300047323 | Ga0495683_0103639 | Ga0495683_0103639_582_1037 | 145 |
| 659 | 3300047443 | Ga0495687_003569 | Ga0495687_003569_8039_8494 | 145 |
| 660 | 3300047443 | Ga0495687_005167 | Ga0495687_005167_7842_8297 | 145 |
| 661 | 3300047443 | Ga0495687_027206 | Ga0495687_027206_176_631 | 145 |
| 662 | 3300047444 | Ga0495675_0073327 | Ga0495675_0073327_673_1128 | 145 |
| 663 | 3300047444 | Ga0495675_0080058 | Ga0495675_0080058_582_1049 | 145 |
| 664 | 3300047444 | Ga0495675_0094195 | Ga0495675_0094195_973_1428 | 145 |
| 665 | 3300047444 | Ga0495675_0435364 | Ga0495675_0435364_115_570 | 145 |
| 666 | 3300047446 | Ga0495679_027516 | Ga0495679_027516_1353_1808 | 145 |
| 667 | 3300047447 | Ga0495685_000946 | Ga0495685_000946_1593_2048 | 145 |
| 668 | 3300047447 | Ga0495685_003370 | Ga0495685_003370_1850_2305 | 145 |
| 669 | 3300047447 | Ga0495685_027572 | Ga0495685_027572_148_603 | 145 |
| 670 | 3300047447 | Ga0495685_056773 | Ga0495685_056773_504_959 | 145 |
| 671 | 3300047447 | Ga0495685_100898 | Ga0495685_100898_338_793 | 145 |
| 672 | 3300047470 | Ga0495681_0000568 | Ga0495681_0000568_20362_20817 | 145 |
| 673 | 3300047470 | Ga0495681_0016496 | Ga0495681_0016496_274_729 | 145 |
| 674 | 3300047471 | Ga0495684_0057400 | Ga0495684_0057400_1076_1531 | 145 |
| 675 | 3300047471 | Ga0495684_0112105 | Ga0495684_0112105_1009_1476 | 145 |
| 676 | 3300047472 | Ga0495686_0022865 | Ga0495686_0022865_3081_3536 | 145 |
| 677 | 3300047472 | Ga0495686_0062562 | Ga0495686_0062562_1156_1611 | 145 |
| 678 | 3300047472 | Ga0495686_0063219 | Ga0495686_0063219_1447_1902 | 145 |
| 679 | 3300047673 | Ga0495593_0000284 | Ga0495593_0000284_25743_26198 | 145 |
| 680 | 3300047673 | Ga0495593_0035318 | Ga0495593_0035318_63_518 | 145 |
| 681 | 3300047673 | Ga0495593_0067969 | Ga0495593_0067969_373_828 | 145 |
| 682 | 3300048088 | Ga0495602_0028059 | Ga0495602_0028059_1187_1642 | 145 |
| 683 | 3300048088 | Ga0495602_0053551 | Ga0495602_0053551_582_1049 | 145 |
| 684 | 3300048088 | Ga0495602_0110671 | Ga0495602_0110671_163_618 | 145 |
| 685 | 3300048089 | Ga0495614_0094292 | Ga0495614_0094292_506_961 | 145 |
| 686 | 3300048089 | Ga0495614_0097791 | Ga0495614_0097791_507_962 | 145 |
| 687 | 3300048091 | Ga0495626_0039038 | Ga0495626_0039038_377_832 | 145 |
| 688 | 3300049459 | Ga0495678_200504 | Ga0495678_200504_16_471 | 145 |
| 689 | 3300049568 | Ga0501031_0008351 | Ga0501031_0008351_6107_6574 | 145 |
| 690 | 3300049569 | Ga0501032_0004814 | Ga0501032_0004814_2171_2638 | 145 |
| 691 | 3300049570 | Ga0501033_0090186 | Ga0501033_0090186_970_1425 | 145 |
| 692 | 3300049570 | Ga0501033_0115404 | Ga0501033_0115404_1388_1855 | 145 |
| 693 | 3300049571 | Ga0501034_0001465 | Ga0501034_0001465_27822_28289 | 145 |
| 694 | 3300049571 | Ga0501034_1252833 | Ga0501034_1252833_112_579 | 145 |
| 695 | 3300049572 | Ga0501036_0006415 | Ga0501036_0006415_2965_3432 | 145 |
| 696 | 3300049572 | Ga0501036_0017106 | Ga0501036_0017106_1789_2256 | 145 |
| 697 | 3300049572 | Ga0501036_0265300 | Ga0501036_0265300_62_517 | 145 |
| 698 | 3300049573 | Ga0501037_0003133 | Ga0501037_0003133_7641_8108 | 145 |
| 699 | 3300049573 | Ga0501037_0167088 | Ga0501037_0167088_335_802 | 145 |
| 700 | 3300049573 | Ga0501037_0475643 | Ga0501037_0475643_202_669 | 145 |
| 701 | 3300049574 | Ga0501038_0016070 | Ga0501038_0016070_6118_6585 | 145 |
| 702 | 3300049574 | Ga0501038_0040593 | Ga0501038_0040593_3381_3848 | 145 |
| 703 | 3300049574 | Ga0501038_0086285 | Ga0501038_0086285_921_1376 | 145 |
| 704 | 3300049575 | Ga0501039_0052491 | Ga0501039_0052491_2015_2482 | 145 |
| 705 | 3300049575 | Ga0501039_0093818 | Ga0501039_0093818_1257_1724 | 145 |
| 706 | 3300049577 | Ga0501041_0073140 | Ga0501041_0073140_863_1330 | 145 |
| 707 | 3300049578 | Ga0501042_0005133 | Ga0501042_0005133_168_635 | 145 |
| 708 | 3300049579 | Ga0501043_0000363 | Ga0501043_0000363_2965_3432 | 145 |
| 709 | 3300049579 | Ga0501043_0008415 | Ga0501043_0008415_7037_7504 | 145 |
| 710 | 3300049579 | Ga0501043_0149732 | Ga0501043_0149732_448_903 | 145 |
| 711 | 3300049580 | Ga0501046_0004043 | Ga0501046_0004043_3889_4356 | 145 |
| 712 | 3300049580 | Ga0501046_0152351 | Ga0501046_0152351_629_1096 | 145 |
| 713 | 3300049581 | Ga0501047_0000720 | Ga0501047_0000720_83_550 | 145 |
| 714 | 3300049581 | Ga0501047_0002947 | Ga0501047_0002947_5890_6357 | 145 |
| 715 | 3300049581 | Ga0501047_0060375 | Ga0501047_0060375_1534_1989 | 145 |
| 716 | 3300049581 | Ga0501047_0310186 | Ga0501047_0310186_79_534 | 145 |
| 717 | 3300049582 | Ga0501048_0006956 | Ga0501048_0006956_6283_6750 | 145 |
| 718 | 3300049583 | Ga0501067_0011256 | Ga0501067_0011256_725_1192 | 145 |
| 719 | 3300049585 | Ga0501069_0204957 | Ga0501069_0204957_466_933 | 145 |
| 720 | 3300049587 | Ga0501071_0025839 | Ga0501071_0025839_3008_3475 | 145 |
| 721 | 3300049588 | Ga0501072_0001490 | Ga0501072_0001490_16815_17282 | 145 |
| 722 | 3300049589 | Ga0501073_0052732 | Ga0501073_0052732_782_1237 | 145 |
| 723 | 3300049589 | Ga0501073_0552588 | Ga0501073_0552588_24_491 | 145 |
| 724 | 3300049589 | Ga0501073_0708921 | Ga0501073_0708921_26_493 | 145 |
| 725 | 3300049590 | Ga0501074_0097166 | Ga0501074_0097166_1176_1643 | 145 |
| 726 | 3300049592 | Ga0501076_0013874 | Ga0501076_0013874_884_1351 | 145 |
| 727 | 3300049593 | Ga0501077_0009715 | Ga0501077_0009715_3067_3534 | 145 |
| 728 | 3300049742 | Ga0501080_0071179 | Ga0501080_0071179_211_678 | 145 |
| 729 | 3300049742 | Ga0501080_0304974 | Ga0501080_0304974_682_1137 | 145 |
| 730 | 3300049744 | Ga0501083_0011002 | Ga0501083_0011002_4298_4765 | 145 |
| 731 | 3300049822 | Ga0501035_0000875 | Ga0501035_0000875_211_678 | 145 |
| 732 | 3300049822 | Ga0501035_0005206 | Ga0501035_0005206_8436_8903 | 145 |
| 733 | 3300049822 | Ga0501035_0031238 | Ga0501035_0031238_1155_1610 | 145 |
| 734 | 3300049822 | Ga0501035_0179403 | Ga0501035_0179403_438_893 | 145 |
| 735 | 3300049823 | Ga0501044_0000958 | Ga0501044_0000958_211_678 | 145 |
| 736 | 3300049823 | Ga0501044_0017668 | Ga0501044_0017668_3141_3608 | 145 |
| 737 | 3300049823 | Ga0501044_0577873 | Ga0501044_0577873_400_855 | 145 |
| 738 | 3300050492 | nmdc:mga0yw44_419387_c1 | nmdc:mga0yw44_419387_c1_100_555 | 145 |
| 739 | 3300050494 | nmdc:mga06z11_2052_c1 | nmdc:mga06z11_2052_c1_1676_2131 | 145 |
| 740 | 3300050495 | nmdc:mga04h51_1501_c1 | nmdc:mga04h51_1501_c1_3377_3832 | 145 |
| 741 | 3300050495 | nmdc:mga04h51_312293_c1 | nmdc:mga04h51_312293_c1_176_631 | 145 |
| 742 | 3300050496 | nmdc:mga07m45_156808_c1 | nmdc:mga07m45_156808_c1_322_777 | 145 |
| 743 | 3300053077 | Ga0495601_0008658 | Ga0495601_0008658_4228_4695 | 145 |
| 744 | 3300053078 | Ga0495612_0086778 | Ga0495612_0086778_192_659 | 145 |
| 745 | 3300053079 | Ga0500610_0060495 | Ga0500610_0060495_840_1295 | 145 |
| 746 | 3300053083 | Ga0495655_0211332 | Ga0495655_0211332_23_478 | 145 |
| 747 | 3300053085 | Ga0495619_0033451 | Ga0495619_0033451_2385_2840 | 145 |
| 748 | 3300053085 | Ga0495619_0033872 | Ga0495619_0033872_863_1330 | 145 |
| 749 | 3300053086 | Ga0500578_0057615 | Ga0500578_0057615_1050_1505 | 145 |
| 750 | 3300053086 | Ga0500578_0134918 | Ga0500578_0134918_268_723 | 145 |
| 751 | 3300053091 | Ga0500647_0285797 | Ga0500647_0285797_177_632 | 145 |
| 752 | 3300053092 | Ga0500583_0084407 | Ga0500583_0084407_590_1051 | 145 |
| 753 | 3300053092 | Ga0500583_0364142 | Ga0500583_0364142_234_689 | 145 |
| 754 | 3300053093 | Ga0500651_0140657 | Ga0500651_0140657_786_1241 | 145 |
| 755 | 3300053094 | Ga0500566_0012041 | Ga0500566_0012041_1016_1471 | 145 |
| 756 | 3300053098 | Ga0500650_0236364 | Ga0500650_0236364_72_527 | 145 |
| 757 | 3300053099 | Ga0500654_047066 | Ga0500654_047066_277_732 | 145 |
| 758 | 3300053100 | Ga0500660_048922 | Ga0500660_048922_1365_1820 | 145 |
| 759 | 3300053101 | Ga0500553_095001 | Ga0500553_095001_89_544 | 145 |
| 760 | 3300053104 | Ga0500556_0248689 | Ga0500556_0248689_159_614 | 145 |
| 761 | 3300053106 | Ga0500558_226084 | Ga0500558_226084_28_483 | 145 |
| 762 | 3300053107 | Ga0500560_096532 | Ga0500560_096532_373_828 | 145 |
| 763 | 3300053107 | Ga0500560_276697 | Ga0500560_276697_12_467 | 145 |
| 764 | 3300053111 | Ga0500572_106979 | Ga0500572_106979_164_619 | 145 |
| 765 | 3300053129 | Ga0500628_004401 | Ga0500628_004401_287_742 | 145 |
| 766 | 3300053131 | Ga0500652_001663 | Ga0500652_001663_4554_5009 | 145 |
| 767 | 3300053134 | Ga0500658_0013764 | Ga0500658_0013764_953_1408 | 145 |
| 768 | 3300053137 | Ga0500561_0000925 | Ga0500561_0000925_2295_2750 | 145 |
| 769 | 3300053140 | Ga0500573_0040943 | Ga0500573_0040943_643_1098 | 145 |
| 770 | 3300053140 | Ga0500573_0186478 | Ga0500573_0186478_105_560 | 145 |
| 771 | 3300053140 | Ga0500573_0298807 | Ga0500573_0298807_188_643 | 145 |
| 772 | 3300053143 | Ga0500579_055102 | Ga0500579_055102_821_1276 | 145 |
| 773 | 3300053149 | Ga0500600_0029849 | Ga0500600_0029849_1825_2280 | 145 |
| 774 | 3300053153 | Ga0500616_0010508 | Ga0500616_0010508_4423_4878 | 145 |
| 775 | 3300053157 | Ga0500624_010546 | Ga0500624_010546_265_720 | 145 |
| 776 | 3300053160 | Ga0500633_0002958 | Ga0500633_0002958_1749_2204 | 145 |
| 777 | 3300053161 | Ga0500634_0046269 | Ga0500634_0046269_394_849 | 145 |
| 778 | 3300054114 | Ga0501084_0009201 | Ga0501084_0009201_6107_6574 | 145 |
| 779 | 3300060353 | Ga0501082_0006857 | Ga0501082_0006857_2416_2883 | 145 |
| 780 | 3300061719 | Ga0466962_0028070 | Ga0466962_0028070_634_1089 | 145 |
| 781 | iso_pu_bacteria | 2997451912 | 2997455097 | 145 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2c2i-assembly1.cif.gz_B | structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis | 0.9111 | 3 | 143 |
| 2c2i-assembly1.cif.gz_B | structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis | 0.8814 | 3 | 143 |
| 3ir3-assembly1.cif.gz_B | crystal structure of human 3-hydroxyacyl-thioester dehydratase 2 (htd2) | 0.8076 | 15 | 141 |
| 3fzx-assembly1.cif.gz_A-2 | crystal structure of a putative exported protein with ymcc-like fold (bf2203) from bacteroides fragilis nctc 9343 at 2.22 a resolution | 0.8056 | 101 | 144 |
| 4xy5-assembly1.cif.gz_A | crystal structure of mutant (asp52ala) hypothetical thioesterase protein sp_1851 from streptococcus pneumoniae tigr4 | 0.7972 | 20 | 143 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2c2iB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8977 | 3 | 143 | 3.10.129.10 |
| af_B0G197_51_201_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8749 | 4 | 144 | 3.10.129.10 |
| 2c2iB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8685 | 3 | 143 | 3.10.129.10 |
| af_B0G197_51_201_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8468 | 4 | 144 | 3.10.129.10 |
| 4gwhA00 | Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain | 0.8412 | 89 | 143 | 2.40.160.210 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D3UIU8-F1-model_v4 | Dehydratase | 0.9839 | 78 | 144 |
|
| AF-A0A6J7MXR6-F1-model_v4 | Unannotated protein | 0.9739 | 63 | 145 |
|
| AF-A0A6L6ESY3-F1-model_v4 | Dehydratase | 0.9735 | 55 | 145 |
|
| AF-A0A524NTT2-F1-model_v4 | Dehydratase | 0.9699 | 77 | 144 |
|
| AF-A0A2V9Z8F8-F1-model_v4 | MaoC-like domain-containing protein | 0.9688 | 69 | 145 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar