F480581

General Info

Members Datasets Scaffolds Average Seq Length
781 405 1562 322

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_267289_c1|nmdc:mga05p37_267289_c1_854_1924
Length 356
Sequence LITPNSGRNPSSAVIFLLETPSSIGVNRGENAMSRLAAVAISVIALMXXXVAASAGADYPVRPVTLVVPYPPGGGVDAMARVVAAKLSDALRQQFIVDNRPGAGGTIGTRAVAQATPDGYTLLLGHTGTISINPSLYAHAGYDPRKDFAPIGLVASMPVALLAHPSFPAKSIAEFIDMARKAPGKLNLGTSAVGTGGYMCAELFKAEADIDVAIIPYKGTAPVMNDLLGGHVPIAFGVLPPALGNIQAGKLRAIAVTSKKRFSLLPDVPTFDESGMPGFEAVLHYGLLAPAGTPKEIVDRLSAQLQKLADMAEVQKQIHNEGGDPLTSTAAEYAADIDQEEKKWSGLVKRLGLKVE

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
8 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
9 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
13 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
91 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
92 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
95 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
96 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
97 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
98 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
103 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
110 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
142 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
143 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
145 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
212 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
218 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
219 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
220 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
221 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
222 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
223 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
224 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
225 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
226 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
227 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
228 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
229 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
230 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
231 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
232 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
233 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
234 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
235 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
236 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
237 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
238 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
239 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
241 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
242 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
243 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
244 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
245 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
246 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
247 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
248 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
249 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
250 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
251 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
252 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
253 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
254 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
255 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
256 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
257 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
258 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
259 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
260 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
261 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
262 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
263 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
264 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
265 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
266 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
267 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
268 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
269 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
270 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
271 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
272 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
273 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
274 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
275 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
276 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
277 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
278 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
279 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
280 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
281 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
282 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
283 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
284 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
285 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
286 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
287 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
288 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
289 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
290 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
291 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
292 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
293 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
294 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
295 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
296 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
297 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
298 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
299 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
300 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
301 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
302 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
303 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
304 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
305 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
306 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
307 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
308 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
309 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
310 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
311 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
312 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
313 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
314 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
315 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
316 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
317 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
318 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
319 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
320 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
321 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
322 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
323 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
324 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
325 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
326 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
327 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
328 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
329 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
330 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
331 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
332 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
333 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
334 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
338 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
339 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
340 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
341 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
342 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
343 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
344 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
345 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
346 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
347 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
348 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
349 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
350 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
366 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
367 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
368 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
369 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
370 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
371 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
372 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
373 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
374 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
375 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
376 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
377 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
378 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
379 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
380 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
383 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
384 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
385 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
386 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
387 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
388 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
389 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
390 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
391 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
392 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
393 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
394 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
395 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
396 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
397 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
398 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
399 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
400 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
401 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
402 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
403 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
404 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
405 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0
Isolates 0.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.59
Nodule 0
Rhizoplane 4.61
Rhizosphere 91.04
Stem 0
Stem Tuber 0
Unclassified 2.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_267289_c1 3300050507 Bacteria 2045
2 ARcpr5oldR_c000171 3300000041 Bacteria 11247
3 ARSoilYngRDRAFT_c00211 3300000042 Bacteria 9635
4 ARcpr5yngRDRAFT_c000814 3300000043 Bacteria 3754
5 ARSoilOldRDRAFT_c000112 3300000044 Bacteria 14373
6 ARCol0yngRDRAFT_1000085 3300000652 Bacteria 17273
7 JGI24032J14994_100073 3300001430 Bacteria 4245
8 JGI24746J21847_1000181 3300001977 Bacteria 8303
9 JGI24747J21853_1000306 3300001978 Bacteria 2782
10 JGI24739J22299_10000225 3300001989 Bacteria 19090
11 JGI24737J22298_10000161 3300001990 Bacteria 21202
12 JGI24750J21931_1000080 3300002070 Bacteria 14266
13 JGI24748J21848_1000464 3300002074 Bacteria 4488
14 JGI24738J21930_10000427 3300002075 Bacteria 11864
15 JGI24035J26624_1000093 3300002126 Bacteria 7489
16 JGI24742J22300_10000178 3300002244 Bacteria 9410
17 Ga0065717_1002296 3300005276 Bacteria 2228
18 Ga0065712_10118769 3300005290 Bacteria 1692
19 Ga0070676_10000033 3300005328 Bacteria 41621
20 Ga0070683_100001226 3300005329 Bacteria 19500
21 Ga0070683_100099235 3300005329 Bacteria 2741
22 Ga0070683_100116228 3300005329 Bacteria 2525
23 Ga0070690_100000218 3300005330 Bacteria 29970
24 Ga0070690_100014746 3300005330 Bacteria 4642
25 Ga0070670_100007598 3300005331 Bacteria 9204
26 Ga0070677_10000123 3300005333 Bacteria 25815
27 Ga0068869_100000061 3300005334 Bacteria 48273
28 Ga0068869_100269856 3300005334 Bacteria 1365
29 Ga0070666_10008604 3300005335 Bacteria 6343
30 Ga0070680_100000813 3300005336 Bacteria 22009
31 Ga0070680_100022350 3300005336 Bacteria 5038
32 Ga0070680_100025992 3300005336 Bacteria 4682
33 Ga0070682_100000120 3300005337 Bacteria 69124
34 Ga0068868_100001686 3300005338 Bacteria 15107
35 Ga0068868_100277897 3300005338 Bacteria 1416
36 Ga0070660_100000576 3300005339 Bacteria 24634
37 Ga0070689_100000702 3300005340 Bacteria 20362
38 Ga0070689_100021461 3300005340 Bacteria 4808
39 Ga0070689_100166445 3300005340 Bacteria 1784
40 Ga0070691_10000237 3300005341 Bacteria 18836
41 Ga0070687_100000671 3300005343 Bacteria 11417
42 Ga0070661_100000169 3300005344 Bacteria 53663
43 Ga0070692_10000058 3300005345 Bacteria 21589
44 Ga0070668_100000430 3300005347 Bacteria 27699
45 Ga0070669_100002842 3300005353 Bacteria 12512
46 Ga0070675_100000571 3300005354 Bacteria 25292
47 Ga0070675_100078678 3300005354 Bacteria 2747
48 Ga0070675_100078930 3300005354 Bacteria 2742
49 Ga0070675_100195653 3300005354 Bacteria 1753
50 Ga0070675_100363310 3300005354 Bacteria 1286
51 Ga0070671_100000667 3300005355 Bacteria 24574
52 Ga0070671_100019122 3300005355 Bacteria 5571
53 Ga0070671_100151498 3300005355 Bacteria 1958
54 Ga0070674_100000089 3300005356 Bacteria 42233
55 Ga0070674_100083793 3300005356 Bacteria 2284
56 Ga0070673_100003147 3300005364 Bacteria 10225
57 Ga0070673_100097949 3300005364 Bacteria 2409
58 Ga0070673_100189762 3300005364 Bacteria 1764
59 Ga0070688_100000346 3300005365 Bacteria 23554
60 Ga0070688_100173144 3300005365 Unclassified 1491
61 Ga0070659_100002399 3300005366 Bacteria 13308
62 Ga0070659_100035422 3300005366 Bacteria 3886
63 Ga0070667_100038743 3300005367 Bacteria 3996
64 Ga0070667_100220882 3300005367 Bacteria 1687
65 Ga0070667_100389591 3300005367 Bacteria 1267
66 Ga0070709_10015585 3300005434 Bacteria 4328
67 Ga0070714_100515387 3300005435 Bacteria 1142
68 Ga0070713_100009646 3300005436 Bacteria 6929
69 Ga0070713_100117510 3300005436 Bacteria 2327
70 Ga0070713_100280007 3300005436 Bacteria 1530
71 Ga0070710_10026077 3300005437 Bacteria 3101
72 Ga0070701_10000009 3300005438 Bacteria 49934
73 Ga0070701_10007254 3300005438 Bacteria 4721
74 Ga0070701_10095976 3300005438 Bacteria 1634
75 Ga0070711_100287903 3300005439 Bacteria 1302
76 Ga0070705_100000201 3300005440 Bacteria 35192
77 Ga0070705_100045556 3300005440 Bacteria 2524
78 Ga0070700_100000114 3300005441 Bacteria 51317
79 Ga0070700_100164485 3300005441 Unclassified 1530
80 Ga0070694_100001784 3300005444 Bacteria 12737
81 Ga0070694_100065981 3300005444 Bacteria 2482
82 Ga0070708_100099845 3300005445 Bacteria 2656
83 Ga0070663_100001897 3300005455 Bacteria 11667
84 Ga0070678_100001391 3300005456 Bacteria 12887
85 Ga0070678_100027456 3300005456 Bacteria 3865
86 Ga0070678_100071220 3300005456 Bacteria 2602
87 Ga0070678_100148844 3300005456 Bacteria 1883
88 Ga0070662_100000905 3300005457 Bacteria 18108
89 Ga0070662_100169491 3300005457 Bacteria 1714
90 Ga0070662_100243705 3300005457 Bacteria 1442
91 Ga0070681_10001394 3300005458 Bacteria 21188
92 Ga0070681_10018851 3300005458 Bacteria 6905
93 Ga0070681_10037021 3300005458 Bacteria 4897
94 Ga0070681_10148173 3300005458 Bacteria 2274
95 Ga0068867_100000067 3300005459 Bacteria 63019
96 Ga0070685_10092826 3300005466 Bacteria 1830
97 Ga0070685_10095350 3300005466 Unclassified 1808
98 Ga0070706_100104325 3300005467 Bacteria 2637
99 Ga0070679_100001329 3300005530 Bacteria 21782
100 Ga0070679_100043018 3300005530 Bacteria 4499
101 Ga0070679_100043899 3300005530 Bacteria 4452
102 Ga0070684_100000112 3300005535 Bacteria 52756
103 Ga0070697_100009244 3300005536 Bacteria 7702
104 Ga0068853_100000660 3300005539 Bacteria 23727
105 Ga0070672_100000282 3300005543 Bacteria 28867
106 Ga0070672_100003608 3300005543 Bacteria 10034
107 Ga0070686_100000097 3300005544 Bacteria 60306
108 Ga0070686_100061512 3300005544 Bacteria 2427
109 Ga0070686_100127594 3300005544 Bacteria 1755
110 Ga0070686_100155415 3300005544 Bacteria 1606
111 Ga0070695_100234643 3300005545 Bacteria 1328
112 Ga0070696_100395040 3300005546 Bacteria 1081
113 Ga0070693_100000656 3300005547 Bacteria 15261
114 Ga0070693_100060134 3300005547 Bacteria 2205
115 Ga0070693_100167965 3300005547 Bacteria 1403
116 Ga0070665_100003890 3300005548 Bacteria 15776
117 Ga0070665_100038876 3300005548 Bacteria 4784
118 Ga0070665_100041354 3300005548 Bacteria 4633
119 Ga0070704_100009835 3300005549 Bacteria 5800
120 Ga0070704_100018235 3300005549 Bacteria 4482
121 Ga0068855_100003734 3300005563 Bacteria 18609
122 Ga0068855_100066874 3300005563 Bacteria 4189
123 Ga0070664_100000328 3300005564 Bacteria 34412
124 Ga0068857_100000039 3300005577 Bacteria 71404
125 Ga0068857_100070306 3300005577 Bacteria 3117
126 Ga0068854_100000324 3300005578 Bacteria 31493
127 Ga0068854_100147242 3300005578 Unclassified 1813
128 Ga0068856_100001406 3300005614 Bacteria 25242
129 Ga0070702_100000038 3300005615 Bacteria 35448
130 Ga0070702_100006778 3300005615 Bacteria 5445
131 Ga0068852_100004415 3300005616 Bacteria 9940
132 Ga0068852_100065257 3300005616 Bacteria 3175
133 Ga0068859_100013685 3300005617 Bacteria 8132
134 Ga0068859_100137633 3300005617 Bacteria 2515
135 Ga0068859_100255765 3300005617 Bacteria 1842
136 Ga0068864_100000057 3300005618 Bacteria 127327
137 Ga0068866_10000128 3300005718 Bacteria 33594
138 Ga0068866_10057368 3300005718 Bacteria 2006
139 Ga0068861_100004914 3300005719 Bacteria 9003
140 Ga0068861_100040717 3300005719 Bacteria 3476
141 Ga0068861_100119314 3300005719 Unclassified 2125
142 Ga0068851_10091936 3300005834 Bacteria 1598
143 Ga0068870_10000008 3300005840 Bacteria 72411
144 Ga0068870_10097799 3300005840 Unclassified 1652
145 Ga0068863_100000206 3300005841 Bacteria 63372
146 Ga0068863_100121257 3300005841 Bacteria 2493
147 Ga0068863_100192842 3300005841 Bacteria 1958
148 Ga0068858_100005550 3300005842 Bacteria 12343
149 Ga0068858_100224620 3300005842 Bacteria 1779
150 Ga0068860_100001936 3300005843 Bacteria 21899
151 Ga0068860_100077335 3300005843 Bacteria 3164
152 Ga0068862_100001174 3300005844 Bacteria 24675
153 Ga0068862_100178388 3300005844 Bacteria 1905
154 Ga0081455_10000402 3300005937 Bacteria 57123
155 Ga0081538_10053646 3300005981 Bacteria 2394
156 Ga0081540_1014275 3300005983 Bacteria 5099
157 Ga0081539_10003270 3300005985 Bacteria 20333
158 Ga0075365_10007041 3300006038 Bacteria 6262
159 Ga0075368_10009636 3300006042 Bacteria 3477
160 Ga0075363_100022908 3300006048 Bacteria 3161
161 Ga0075364_10009388 3300006051 Bacteria 5866
162 Ga0075364_10010424 3300006051 Bacteria 5614
163 Ga0075432_10001357 3300006058 Bacteria 7949
164 Ga0070716_100050564 3300006173 Bacteria 2360
165 Ga0070712_100093669 3300006175 Bacteria 2205
166 Ga0070712_100189203 3300006175 Bacteria 1609
167 Ga0070712_100398243 3300006175 Bacteria 1136
168 Ga0070712_100432703 3300006175 Bacteria 1092
169 Ga0075362_10017236 3300006177 Bacteria 2973
170 Ga0075367_10004569 3300006178 Bacteria 6775
171 Ga0075367_10039299 3300006178 Bacteria 2759
172 Ga0075367_10040517 3300006178 Bacteria 2720
173 Ga0075369_10025130 3300006186 Bacteria 2474
174 Ga0075366_10013436 3300006195 Bacteria 4662
175 Ga0097621_100000688 3300006237 Bacteria 23672
176 Ga0097621_100225706 3300006237 Bacteria 1634
177 Ga0068871_100000244 3300006358 Bacteria 37714
178 Ga0068871_100012794 3300006358 Bacteria 6208
179 Ga0068871_100037966 3300006358 Bacteria 3843
180 Ga0068871_100084293 3300006358 Bacteria 2637
181 Ga0068871_100091052 3300006358 Bacteria 2541
182 Ga0075428_100017415 3300006844 Bacteria 7941
183 Ga0075428_100029491 3300006844 Bacteria 6070
184 Ga0075428_100191899 3300006844 Bacteria 2209
185 Ga0075430_100000885 3300006846 Bacteria 23513
186 Ga0075430_100079159 3300006846 Bacteria 2755
187 Ga0075431_100001907 3300006847 Bacteria 19804
188 Ga0075431_100002610 3300006847 Bacteria 17438
189 Ga0075433_10000273 3300006852 Bacteria 30404
190 Ga0075433_10030576 3300006852 Bacteria 4596
191 Ga0075434_100000882 3300006871 Bacteria 23997
192 Ga0075434_100010190 3300006871 Bacteria 8801
193 Ga0075434_100132272 3300006871 Bacteria 2514
194 Ga0075434_100355356 3300006871 Bacteria 1486
195 Ga0075429_100005227 3300006880 Bacteria 11166
196 Ga0075429_100033714 3300006880 Bacteria 4449
197 Ga0075429_100041345 3300006880 Bacteria 4015
198 Ga0068865_100000204 3300006881 Bacteria 32961
199 Ga0068865_100025384 3300006881 Bacteria 3898
200 Ga0068865_100071301 3300006881 Bacteria 2464
201 Ga0075436_100015037 3300006914 Bacteria 5304
202 Ga0075436_100015432 3300006914 Bacteria 5230
203 Ga0097620_100013685 3300006931 Bacteria 8132
204 Ga0097620_100137631 3300006931 Bacteria 2515
205 Ga0097620_100255743 3300006931 Bacteria 1842
206 Ga0075435_100015904 3300007076 Bacteria 5664
207 Ga0075435_100031901 3300007076 Bacteria 4156
208 Ga0075435_100071633 3300007076 Bacteria 2830
209 Ga0111539_10000178 3300009094 Bacteria 73928
210 Ga0111539_10001379 3300009094 Bacteria 32283
211 Ga0111539_10002326 3300009094 Bacteria 25295
212 Ga0111539_10005336 3300009094 Bacteria 16626
213 Ga0111539_10044480 3300009094 Bacteria 5319
214 Ga0111539_10060285 3300009094 Bacteria 4497
215 Ga0111539_10061458 3300009094 Bacteria 4450
216 Ga0111539_10173157 3300009094 Bacteria 2521
217 Ga0111539_10296844 3300009094 Bacteria 1880
218 Ga0105245_10001863 3300009098 Bacteria 19165
219 Ga0105245_10042699 3300009098 Bacteria 4045
220 Ga0105247_10005321 3300009101 Bacteria 8115
221 Ga0114129_10001129 3300009147 Bacteria 35251
222 Ga0114129_10002175 3300009147 Bacteria 26976
223 Ga0114129_10316163 3300009147 Bacteria 2077
224 Ga0105243_10000159 3300009148 Bacteria 76829
225 Ga0105243_10006434 3300009148 Bacteria 9078
226 Ga0105243_10183292 3300009148 Bacteria 1823
227 Ga0105241_10000205 3300009174 Bacteria 44442
228 Ga0105241_10142780 3300009174 Bacteria 1951
229 Ga0105242_10000174 3300009176 Bacteria 48919
230 Ga0105242_10033868 3300009176 Bacteria 4093
231 Ga0105248_10000221 3300009177 Bacteria 65242
232 Ga0105248_10043444 3300009177 Bacteria 5039
233 Ga0105248_10048997 3300009177 Bacteria 4739
234 Ga0105248_10171027 3300009177 Bacteria 2449
235 Ga0105237_10009209 3300009545 Bacteria 10598
236 Ga0105249_10000283 3300009553 Bacteria 53162
237 Ga0105249_10080022 3300009553 Bacteria 3035
238 Ga0105249_10386351 3300009553 Bacteria 1427
239 Ga0105249_10477625 3300009553 Bacteria 1289
240 Ga0105239_10018211 3300010375 Bacteria 7764
241 Ga0105246_10000257 3300011119 Bacteria 27427
242 Ga0157320_1000908 3300012481 Bacteria 1354
243 Ga0157371_10011491 3300013102 Bacteria 6812
244 Ga0157374_10010039 3300013296 Bacteria 8128
245 Ga0157378_10000165 3300013297 Bacteria 63451
246 Ga0163162_10000240 3300013306 Bacteria 50037
247 Ga0163162_10300835 3300013306 Bacteria 1736
248 Ga0163162_10304057 3300013306 Bacteria 1727
249 Ga0163162_10362754 3300013306 Bacteria 1582
250 Ga0157372_10029330 3300013307 Bacteria 6006
251 Ga0157375_10000547 3300013308 Bacteria 33817
252 Ga0157375_10036275 3300013308 Bacteria 4715
253 Ga0157375_10077613 3300013308 Bacteria 3352
254 Ga0163163_10006271 3300014325 Bacteria 10379
255 Ga0163163_10378731 3300014325 Unclassified 1473
256 Ga0157380_10000444 3300014326 Bacteria 25337
257 Ga0157377_10000158 3300014745 Bacteria 41582
258 Ga0157379_10002186 3300014968 Bacteria 16265
259 Ga0157376_10000120 3300014969 Bacteria 54853
260 Ga0157376_10066982 3300014969 Bacteria 3036
261 Ga0157376_10158537 3300014969 Bacteria 2049
262 Ga0163161_10000796 3300017792 Bacteria 24714
263 Ga0163161_10108596 3300017792 Bacteria 2072
264 Ga0163161_10167002 3300017792 Bacteria 1681
265 Ga0213876_10013918 3300021384 Bacteria 4264
266 Ga0209233_1032575 3300025261 Bacteria 1204
267 Ga0207666_1000020 3300025271 Bacteria 37987
268 Ga0207673_1000018 3300025290 Bacteria 12476
269 Ga0207426_1020846 3300025302 Bacteria 2273
270 Ga0207697_10000111 3300025315 Bacteria 37979
271 Ga0207697_10010913 3300025315 Bacteria 3863
272 Ga0207697_10024807 3300025315 Bacteria 2453
273 Ga0207653_10003485 3300025885 Bacteria 4955
274 Ga0207682_10000017 3300025893 Bacteria 72105
275 Ga0207682_10002784 3300025893 Bacteria 7735
276 Ga0207692_10003250 3300025898 Bacteria 6323
277 Ga0207642_10000382 3300025899 Bacteria 13273
278 Ga0207710_10016010 3300025900 Bacteria 3172
279 Ga0207688_10000071 3300025901 Bacteria 37993
280 Ga0207688_10014650 3300025901 Bacteria 4260
281 Ga0207647_10002372 3300025904 Bacteria 14311
282 Ga0207647_10133874 3300025904 Bacteria 1455
283 Ga0207645_10000064 3300025907 Bacteria 76394
284 Ga0207643_10000003 3300025908 Bacteria 207506
285 Ga0207643_10019522 3300025908 Bacteria 3715
286 Ga0207643_10059178 3300025908 Bacteria 2185
287 Ga0207705_10013922 3300025909 Bacteria 5800
288 Ga0207684_10106492 3300025910 Bacteria 2398
289 Ga0207654_10002311 3300025911 Bacteria 9785
290 Ga0207654_10112435 3300025911 Bacteria 1697
291 Ga0207707_10001069 3300025912 Bacteria 26270
292 Ga0207707_10344674 3300025912 Bacteria 1284
293 Ga0207671_10178029 3300025914 Bacteria 1654
294 Ga0207693_10013584 3300025915 Bacteria 6563
295 Ga0207693_10083771 3300025915 Bacteria 2498
296 Ga0207693_10360281 3300025915 Bacteria 1138
297 Ga0207663_10185819 3300025916 Bacteria 1488
298 Ga0207660_10000160 3300025917 Bacteria 42013
299 Ga0207660_10044525 3300025917 Bacteria 3123
300 Ga0207662_10000117 3300025918 Bacteria 38059
301 Ga0207662_10011583 3300025918 Bacteria 4897
302 Ga0207662_10026782 3300025918 Bacteria 3327
303 Ga0207662_10182959 3300025918 Bacteria 1349
304 Ga0207657_10002004 3300025919 Bacteria 22015
305 Ga0207657_10030435 3300025919 Bacteria 4899
306 Ga0207657_10036666 3300025919 Bacteria 4387
307 Ga0207649_10000179 3300025920 Bacteria 52053
308 Ga0207652_10000484 3300025921 Bacteria 40846
309 Ga0207652_10009052 3300025921 Bacteria 8020
310 Ga0207652_10048783 3300025921 Bacteria 3621
311 Ga0207646_10012975 3300025922 Bacteria 7985
312 Ga0207681_10000238 3300025923 Bacteria 42345
313 Ga0207681_10136154 3300025923 Bacteria 1823
314 Ga0207681_10190589 3300025923 Unclassified 1568
315 Ga0207694_10086879 3300025924 Bacteria 2463
316 Ga0207650_10011217 3300025925 Bacteria 6164
317 Ga0207650_10146762 3300025925 Bacteria 1859
318 Ga0207650_10271502 3300025925 Bacteria 1378
319 Ga0207650_10411482 3300025925 Bacteria 1121
320 Ga0207659_10000060 3300025926 Bacteria 68657
321 Ga0207659_10025854 3300025926 Bacteria 3952
322 Ga0207687_10001466 3300025927 Bacteria 16199
323 Ga0207687_10092653 3300025927 Bacteria 2207
324 Ga0207687_10254922 3300025927 Unclassified 1396
325 Ga0207700_10001188 3300025928 Bacteria 14964
326 Ga0207664_10170459 3300025929 Bacteria 1863
327 Ga0207644_10001905 3300025931 Bacteria 13524
328 Ga0207644_10003329 3300025931 Bacteria 10368
329 Ga0207644_10010223 3300025931 Bacteria 6185
330 Ga0207644_10019258 3300025931 Bacteria 4627
331 Ga0207644_10163598 3300025931 Bacteria 1732
332 Ga0207690_10000101 3300025932 Bacteria 69886
333 Ga0207706_10000610 3300025933 Bacteria 37993
334 Ga0207706_10035933 3300025933 Bacteria 4402
335 Ga0207686_10000110 3300025934 Bacteria 65876
336 Ga0207709_10000609 3300025935 Bacteria 29622
337 Ga0207709_10008740 3300025935 Bacteria 5587
338 Ga0207709_10128720 3300025935 Bacteria 1722
339 Ga0207670_10000255 3300025936 Bacteria 33265
340 Ga0207670_10142351 3300025936 Bacteria 1769
341 Ga0207669_10000039 3300025937 Bacteria 71511
342 Ga0207704_10000204 3300025938 Bacteria 30275
343 Ga0207704_10045475 3300025938 Bacteria 2608
344 Ga0207704_10137539 3300025938 Bacteria 1703
345 Ga0207665_10000652 3300025939 Bacteria 23312
346 Ga0207691_10000125 3300025940 Bacteria 69750
347 Ga0207691_10009530 3300025940 Bacteria 9321
348 Ga0207691_10152751 3300025940 Bacteria 2029
349 Ga0207711_10001038 3300025941 Bacteria 26568
350 Ga0207711_10268074 3300025941 Bacteria 1570
351 Ga0207689_10000239 3300025942 Bacteria 48962
352 Ga0207689_10051824 3300025942 Bacteria 3383
353 Ga0207661_10000100 3300025944 Bacteria 54771
354 Ga0207661_10072711 3300025944 Bacteria 2814
355 Ga0207679_10000014 3300025945 Bacteria 275841
356 Ga0207679_10099197 3300025945 Bacteria 2273
357 Ga0207667_10007798 3300025949 Bacteria 12795
358 Ga0207667_10206890 3300025949 Bacteria 2012
359 Ga0207667_10260832 3300025949 Bacteria 1772
360 Ga0207651_10000564 3300025960 Bacteria 15614
361 Ga0207651_10076300 3300025960 Bacteria 2395
362 Ga0207651_10093765 3300025960 Bacteria 2205
363 Ga0207712_10000159 3300025961 Bacteria 69703
364 Ga0207712_10203886 3300025961 Bacteria 1570
365 Ga0207668_10000462 3300025972 Bacteria 25560
366 Ga0207640_10000079 3300025981 Bacteria 75611
367 Ga0207658_10001600 3300025986 Bacteria 17471
368 Ga0207658_10072520 3300025986 Bacteria 2610
369 Ga0207658_10445602 3300025986 Bacteria 1145
370 Ga0207677_10001413 3300026023 Bacteria 12789
371 Ga0207703_10001502 3300026035 Bacteria 21292
372 Ga0207703_10211753 3300026035 Bacteria 1728
373 Ga0207639_10005912 3300026041 Bacteria 8291
374 Ga0207639_10161996 3300026041 Bacteria 1886
375 Ga0207678_10000432 3300026067 Bacteria 37993
376 Ga0207678_10024403 3300026067 Bacteria 5279
377 Ga0207678_10112807 3300026067 Bacteria 2319
378 Ga0207708_10000781 3300026075 Bacteria 24009
379 Ga0207708_10166871 3300026075 Bacteria 1741
380 Ga0207641_10000396 3300026088 Bacteria 51170
381 Ga0207641_10035491 3300026088 Bacteria 4154
382 Ga0207648_10000453 3300026089 Bacteria 45463
383 Ga0207648_10029019 3300026089 Bacteria 4905
384 Ga0207676_10086392 3300026095 Bacteria 2562
385 Ga0207676_10099453 3300026095 Bacteria 2407
386 Ga0207674_10000184 3300026116 Bacteria 76825
387 Ga0207674_10075488 3300026116 Bacteria 3380
388 Ga0207674_10293651 3300026116 Bacteria 1574
389 Ga0207674_10432566 3300026116 Bacteria 1272
390 Ga0207675_100000502 3300026118 Bacteria 37971
391 Ga0207675_100153903 3300026118 Unclassified 2190
392 Ga0207675_100561274 3300026118 Bacteria 1142
393 Ga0207683_10000145 3300026121 Bacteria 58662
394 Ga0207683_10002104 3300026121 Bacteria 17539
395 Ga0207683_10003726 3300026121 Bacteria 13222
396 Ga0207683_10094070 3300026121 Bacteria 2671
397 Ga0207683_10169518 3300026121 Unclassified 1977
398 Ga0207698_10001228 3300026142 Bacteria 14977
399 Ga0207698_10138763 3300026142 Bacteria 2090
400 Ga0207698_10600324 3300026142 Bacteria 1085
401 Ga0209996_1002089 3300027395 Bacteria 2463
402 Ga0209971_1006515 3300027682 Bacteria 2761
403 Ga0209998_10001872 3300027717 Bacteria 4979
404 Ga0209998_10002125 3300027717 Bacteria 4615
405 Ga0209813_10038769 3300027866 Bacteria 1441
406 Ga0209974_10001626 3300027876 Bacteria 8135
407 Ga0209974_10017089 3300027876 Bacteria 2407
408 Ga0207428_10000011 3300027907 Bacteria 354388
409 Ga0207428_10000243 3300027907 Bacteria 74403
410 Ga0207428_10000724 3300027907 Bacteria 38094
411 Ga0207428_10002929 3300027907 Bacteria 16912
412 Ga0207428_10013419 3300027907 Bacteria 7158
413 Ga0207428_10040003 3300027907 Bacteria 3805
414 Ga0207428_10044623 3300027907 Bacteria 3576
415 Ga0207428_10150347 3300027907 Bacteria 1772
416 Ga0268266_10001900 3300028379 Bacteria 23504
417 Ga0268266_10008492 3300028379 Bacteria 9129
418 Ga0268266_10123502 3300028379 Bacteria 2307
419 Ga0268266_10139297 3300028379 Bacteria 2176
420 Ga0268266_10394696 3300028379 Unclassified 1307
421 Ga0268265_10000995 3300028380 Bacteria 25758
422 Ga0268264_10000344 3300028381 Bacteria 71619
423 Ga0307515_10000110 3300028794 Bacteria 195560
424 Ga0265332_10004674 3300031238 Bacteria 6396
425 Ga0265325_10032988 3300031241 Bacteria 2762
426 Ga0265329_10048076 3300031242 Bacteria 1361
427 Ga0265340_10003009 3300031247 Bacteria 9592
428 Ga0265339_10001063 3300031249 Bacteria 20879
429 Ga0307513_10002039 3300031456 Bacteria 28431
430 Ga0265313_10007257 3300031595 Bacteria 7613
431 Ga0265313_10073040 3300031595 Bacteria 1575
432 Ga0265314_10001099 3300031711 Bacteria 31235
433 Ga0265342_10000464 3300031712 Bacteria 43974
434 Ga0265342_10000681 3300031712 Bacteria 35543
435 Ga0373930_0000215 3300034816 Bacteria 7159
436 Ga0373930_0001684 3300034816 Bacteria 3347
437 Ga0373948_0000532 3300034817 Bacteria 4779
438 Ga0373950_0004452 3300034818 Bacteria 2052
439 Ga0373958_0000941 3300034819 Bacteria 3765
440 Ga0373958_0008382 3300034819 Bacteria 1672
441 Ga0373938_0005249 3300034957 Bacteria 2196
442 Ga0373938_0012322 3300034957 Bacteria 1602
443 Ga0373926_0012286 3300035083 Bacteria 2894
444 Ga0373928_0002347 3300035084 Bacteria 3674
445 Ga0373929_0000631 3300035085 Bacteria 6792
446 Ga0373929_0006885 3300035085 Bacteria 2064
447 Ga0373929_0010796 3300035085 Bacteria 1713
448 Ga0373940_0028667 3300035088 Bacteria 1470
449 Ga0373949_0001458 3300035090 Bacteria 6748
450 Ga0373951_0001230 3300035091 Bacteria 6780
451 Ga0373952_0000498 3300035092 Bacteria 6836
452 Ga0373923_0067670 3300035111 Bacteria 1528
453 Ga0373932_0000501 3300035112 Bacteria 12054
454 Ga0373932_0001334 3300035112 Bacteria 6911
455 Ga0373939_0000376 3300035114 Bacteria 11282
456 Ga0373939_0007259 3300035114 Bacteria 2688
457 Ga0373941_0000657 3300035115 Bacteria 6992
458 Ga0373941_0001046 3300035115 Bacteria 5742
459 Ga0373945_0041881 3300035116 Bacteria 1657
460 Ga0373953_0000515 3300035117 Bacteria 10752
461 Ga0373956_0053571 3300035119 Bacteria 1816
462 Ga0373957_0025336 3300035120 Bacteria 2136
463 Ga0373960_0000567 3300035121 Bacteria 7495
464 Ga0373960_0005925 3300035121 Bacteria 2846
465 Ga0373943_0027985 3300035170 Bacteria 2653
466 Ga0373943_0122223 3300035170 Unclassified 1384
467 Ga0373946_0007211 3300035171 Bacteria 4057
468 Ga0373946_0030320 3300035171 Unclassified 2158
469 Ga0373955_0000935 3300035172 Bacteria 12494
470 Ga0373955_0033175 3300035172 Bacteria 2717
471 Ga0373942_0000639 3300035207 Bacteria 9833
472 Ga0373961_0001685 3300035241 Bacteria 6168
473 Ga0373962_0000067 3300035242 Bacteria 23002
474 Ga0373962_0000438 3300035242 Bacteria 9117
475 Ga0373924_0015353 3300035410 Bacteria 2911
476 Ga0373924_0037217 3300035410 Bacteria 1980
477 Ga0373931_0000069 3300035691 Bacteria 51023
478 Ga0373931_0029434 3300035691 Bacteria 2819
479 Ga0373935_0015051 3300035692 Bacteria 4671
480 Ga0373935_0233949 3300035692 Unclassified 1280
481 Ga0373927_0096996 3300035695 Bacteria 1916
482 Ga0373933_0002999 3300035724 Bacteria 9409
483 Ga0373933_0004321 3300035724 Bacteria 7800
484 Ga0373933_0025342 3300035724 Bacteria 3401
485 Ga0373947_0040744 3300035725 Bacteria 2767
486 Ga0373937_0002549 3300036401 Bacteria 15130
487 Ga0373937_0082731 3300036401 Bacteria 2970
488 Ga0373937_0143845 3300036401 Bacteria 2231
489 Ga0373925_0161417 3300037068 Bacteria 1765
490 Ga0436364_1444304 3300037853 Bacteria 1089
491 Ga0436365_0307466 3300039437 Bacteria 22966
492 Ga0436365_1061513 3300039437 Bacteria 6139
493 Ga0436360_1027199 3300039438 Bacteria 1977
494 Ga0439453_0000588 3300041408 Bacteria 4098
495 Ga0439441_001460 3300042001 Bacteria 3095
496 Ga0439435_0019185 3300042436 Bacteria 1749
497 Ga0439464_0017024 3300042439 Bacteria 1968
498 Ga0451577_0126349 3300042876 Bacteria 2292
499 Ga0451577_0196719 3300042876 Bacteria 1819
500 Ga0466961_0201082 3300044693 Bacteria 1232
501 Ga0466963_0060567 3300044694 Bacteria 2528
502 Ga0453684_0114016 3300044712 Bacteria 3278
503 Ga0466957_0083977 3300044842 Bacteria 1987
504 Ga0451576_0016099 3300045051 Bacteria 8262
505 Ga0451576_0243262 3300045051 Bacteria 1879
506 Ga0466958_0230058 3300045836 Bacteria 1184
507 Ga0466967_0069127 3300045976 Bacteria 3155
508 Ga0495617_004689 3300046452 Bacteria 4943
509 Ga0495592_0005373 3300046454 Bacteria 9457
510 Ga0495592_0075734 3300046454 Bacteria 2443
511 Ga0495603_0054809 3300046455 Bacteria 2362
512 Ga0495629_0041353 3300046459 Bacteria 3243
513 Ga0495641_0022456 3300046461 Bacteria 3156
514 Ga0495641_0117463 3300046461 Bacteria 1186
515 Ga0495651_0005634 3300046462 Bacteria 9545
516 Ga0495651_0009019 3300046462 Bacteria 7658
517 Ga0495653_0039796 3300046463 Bacteria 3680
518 Ga0495582_0008971 3300046473 Bacteria 5516
519 Ga0495582_0057920 3300046473 Bacteria 2136
520 Ga0495605_0042162 3300046474 Bacteria 2270
521 Ga0495639_0021239 3300046475 Bacteria 2840
522 Ga0495662_0012647 3300046476 Bacteria 4116
523 Ga0495662_0033453 3300046476 Bacteria 2483
524 Ga0495664_0005483 3300046477 Bacteria 6966
525 Ga0495664_0020650 3300046477 Bacteria 3800
526 Ga0495664_0032049 3300046477 Bacteria 3082
527 Ga0495584_0031220 3300046491 Bacteria 2697
528 Ga0495585_0017085 3300046492 Bacteria 4199
529 Ga0495594_0006989 3300046499 Bacteria 5800
530 Ga0495607_0005140 3300046501 Bacteria 9452
531 Ga0495583_0121682 3300046506 Unclassified 1098
532 Ga0495608_0002389 3300046511 Bacteria 13497
533 Ga0495618_0008897 3300046514 Bacteria 6058
534 Ga0495618_0015145 3300046514 Bacteria 4703
535 Ga0495618_0232276 3300046514 Bacteria 1161
536 Ga0495628_0017653 3300046516 Bacteria 5932
537 Ga0495628_0018796 3300046516 Bacteria 5719
538 Ga0495630_0013763 3300046517 Bacteria 5884
539 Ga0495666_0054112 3300046526 Bacteria 1925
540 Ga0495666_0055667 3300046526 Bacteria 1895
541 Ga0495665_0014385 3300046531 Bacteria 4268
542 Ga0495640_0014361 3300046533 Bacteria 5997
543 Ga0495640_0020776 3300046533 Bacteria 4827
544 Ga0495587_0001017 3300046536 Bacteria 18435
545 Ga0495587_0048300 3300046536 Bacteria 2520
546 Ga0495587_0057799 3300046536 Bacteria 2280
547 Ga0495598_0019157 3300046537 Bacteria 1790
548 Ga0495609_0051431 3300046538 Bacteria 1834
549 Ga0495621_0005432 3300046539 Bacteria 3665
550 Ga0495645_0020888 3300046543 Bacteria 4731
551 Ga0495622_0075069 3300046557 Bacteria 1558
552 Ga0495633_0021481 3300046558 Bacteria 3227
553 Ga0495667_0001520 3300046559 Bacteria 15331
554 Ga0495667_0012982 3300046559 Bacteria 5646
555 Ga0495634_0031524 3300046642 Bacteria 3650
556 Ga0495634_0188130 3300046642 Unclassified 1289
557 Ga0495611_0009012 3300046648 Bacteria 4220
558 Ga0495635_0004324 3300046663 Bacteria 9836
559 Ga0495635_0004512 3300046663 Bacteria 9645
560 Ga0495635_0312352 3300046663 Bacteria 1053
561 Ga0495588_0042738 3300046674 Bacteria 2317
562 Ga0495657_0012985 3300046675 Bacteria 6164
563 Ga0495599_0003792 3300046678 Bacteria 8874
564 Ga0495599_0012296 3300046678 Bacteria 5273
565 Ga0495623_0003669 3300046679 Bacteria 10140
566 Ga0495646_0001795 3300046680 Bacteria 12885
567 Ga0495647_0013168 3300046681 Bacteria 2861
568 Ga0495658_0005967 3300046683 Bacteria 5982
569 Ga0495658_0024941 3300046683 Bacteria 3191
570 Ga0495613_0117130 3300046689 Bacteria 1915
571 Ga0495624_0018308 3300046690 Bacteria 4685
572 Ga0495670_0006445 3300046691 Bacteria 5763
573 Ga0495589_0094881 3300046794 Bacteria 1447
574 Ga0495600_0001596 3300046809 Bacteria 12608
575 Ga0495600_0007111 3300046809 Bacteria 6840
576 Ga0495600_0036607 3300046809 Bacteria 3190
577 Ga0495600_0154216 3300046809 Bacteria 1486
578 Ga0495581_0089157 3300047315 Bacteria 1788
579 Ga0495604_0004240 3300047317 Bacteria 11352
580 Ga0495604_0008164 3300047317 Bacteria 8287
581 Ga0495604_0019882 3300047317 Bacteria 5371
582 Ga0495674_0020799 3300047319 Bacteria 6075
583 Ga0495674_0120687 3300047319 Bacteria 2214
584 Ga0495680_0004269 3300047322 Bacteria 13712
585 Ga0495680_0014761 3300047322 Bacteria 6752
586 Ga0495680_0052596 3300047322 Bacteria 3174
587 Ga0495675_0009360 3300047444 Bacteria 6091
588 Ga0495675_0148161 3300047444 Bacteria 1451
589 Ga0495684_0028620 3300047471 Bacteria 4277
590 Ga0495593_0008164 3300047673 Bacteria 6090
591 Ga0495602_0157692 3300048088 Bacteria 1775
592 Ga0495602_0263343 3300048088 Bacteria 1278
593 Ga0495614_0043032 3300048089 Bacteria 1936
594 Ga0495615_0009479 3300048090 Bacteria 1917
595 Ga0496100_0000107 3300048903 Bacteria 47887
596 Ga0496100_0284847 3300048903 Bacteria 1233
597 Ga0496101_0000203 3300048904 Bacteria 45452
598 Ga0496101_0029759 3300048904 Bacteria 3820
599 Ga0496101_0176242 3300048904 Bacteria 1645
600 Ga0496101_0274699 3300048904 Bacteria 1316
601 Ga0496102_0001940 3300048905 Bacteria 17819
602 Ga0496102_0300592 3300048905 Bacteria 1512
603 Ga0496103_0000884 3300048906 Bacteria 21709
604 Ga0496103_0035644 3300048906 Bacteria 3047
605 Ga0496104_0265042 3300048907 Bacteria 1631
606 Ga0496105_0065288 3300048908 Bacteria 3004
607 Ga0496105_0274434 3300048908 Bacteria 1361
608 Ga0496106_0000798 3300048909 Bacteria 22779
609 Ga0496106_0035919 3300048909 Bacteria 3707
610 Ga0496107_0036802 3300048910 Bacteria 3511
611 Ga0496108_0014474 3300048911 Bacteria 6441
612 Ga0496108_0015688 3300048911 Bacteria 6180
613 Ga0496108_0026298 3300048911 Bacteria 4799
614 Ga0496108_0100513 3300048911 Bacteria 2467
615 Ga0496108_0381256 3300048911 Bacteria 1231
616 Ga0496109_0000219 3300048912 Bacteria 56194
617 Ga0496109_0305583 3300048912 Bacteria 1500
618 Ga0496109_0319893 3300048912 Unclassified 1464
619 Ga0496110_0007524 3300048913 Bacteria 8701
620 Ga0496110_0014656 3300048913 Bacteria 6516
621 Ga0496110_0300457 3300048913 Bacteria 1462
622 Ga0496111_0015358 3300048914 Bacteria 5253
623 Ga0496111_0135920 3300048914 Bacteria 1821
624 Ga0496112_0039469 3300048915 Bacteria 4614
625 Ga0496112_0152127 3300048915 Bacteria 2281
626 Ga0496113_0224786 3300048916 Bacteria 1496
627 Ga0496114_0008698 3300048917 Bacteria 8045
628 Ga0496115_0000613 3300048918 Bacteria 27128
629 Ga0496115_0044088 3300048918 Bacteria 3557
630 Ga0496115_0188747 3300048918 Bacteria 1703
631 Ga0501031_0029828 3300049568 Bacteria 3558
632 Ga0501032_0087691 3300049569 Bacteria 2066
633 Ga0501033_0002765 3300049570 Bacteria 14710
634 Ga0501034_0000230 3300049571 Bacteria 105001
635 Ga0501034_0016716 3300049571 Bacteria 7523
636 Ga0501034_0048779 3300049571 Bacteria 4273
637 Ga0501034_0085183 3300049571 Bacteria 3162
638 Ga0501034_0090074 3300049571 Bacteria 3066
639 Ga0501034_0505819 3300049571 Bacteria 1121
640 Ga0501036_0010397 3300049572 Bacteria 7682
641 Ga0501036_0080019 3300049572 Bacteria 2763
642 Ga0501036_0115010 3300049572 Bacteria 2273
643 Ga0501036_0282007 3300049572 Bacteria 1390
644 Ga0501037_0011522 3300049573 Bacteria 6509
645 Ga0501037_0056641 3300049573 Bacteria 2862
646 Ga0501038_0023452 3300049574 Bacteria 5516
647 Ga0501039_0001530 3300049575 Bacteria 17012
648 Ga0501039_0004104 3300049575 Bacteria 10963
649 Ga0501039_0125692 3300049575 Bacteria 2011
650 Ga0501040_0026497 3300049576 Bacteria 3899
651 Ga0501041_0007924 3300049577 Bacteria 6244
652 Ga0501041_0061796 3300049577 Bacteria 2293
653 Ga0501042_0029109 3300049578 Bacteria 3896
654 Ga0501043_0028635 3300049579 Bacteria 4372
655 Ga0501043_0292217 3300049579 Bacteria 1247
656 Ga0501043_0448405 3300049579 Bacteria 970
657 Ga0501046_0053259 3300049580 Bacteria 3187
658 Ga0501046_0086613 3300049580 Bacteria 2415
659 Ga0501046_0233087 3300049580 Bacteria 1359
660 Ga0501047_0025121 3300049581 Bacteria 5723
661 Ga0501047_0027177 3300049581 Bacteria 5511
662 Ga0501047_0077880 3300049581 Bacteria 3188
663 Ga0501047_0110888 3300049581 Bacteria 2626
664 Ga0501048_0028260 3300049582 Bacteria 4071
665 Ga0501067_0034826 3300049583 Bacteria 2795
666 Ga0501068_0013850 3300049584 Bacteria 4596
667 Ga0501068_0121303 3300049584 Bacteria 1630
668 Ga0501069_0023904 3300049585 Bacteria 3331
669 Ga0501069_0089052 3300049585 Bacteria 1745
670 Ga0501070_0093169 3300049586 Bacteria 2492
671 Ga0501070_0252913 3300049586 Bacteria 1441
672 Ga0501071_0102730 3300049587 Bacteria 2108
673 Ga0501071_0302107 3300049587 Bacteria 1213
674 Ga0501072_0184128 3300049588 Bacteria 1666
675 Ga0501073_0029596 3300049589 Bacteria 3913
676 Ga0501074_0018112 3300049590 Bacteria 5116
677 Ga0501074_0094968 3300049590 Bacteria 2135
678 Ga0501075_0015749 3300049591 Bacteria 5433
679 Ga0501075_0031231 3300049591 Bacteria 3952
680 Ga0501076_0002813 3300049592 Bacteria 12033
681 Ga0501076_0015987 3300049592 Bacteria 5680
682 Ga0501077_0016223 3300049593 Bacteria 4692
683 Ga0501079_0002358 3300049741 Bacteria 13713
684 Ga0501079_0012744 3300049741 Bacteria 6422
685 Ga0501079_0180487 3300049741 Bacteria 1647
686 Ga0501079_0186631 3300049741 Bacteria 1618
687 Ga0501080_0026017 3300049742 Bacteria 5437
688 Ga0501080_0028049 3300049742 Bacteria 5235
689 Ga0501080_0039671 3300049742 Bacteria 4395
690 Ga0501080_0066996 3300049742 Bacteria 3339
691 Ga0501080_0099085 3300049742 Bacteria 2705
692 Ga0501080_0123179 3300049742 Bacteria 2402
693 Ga0501081_0008168 3300049743 Bacteria 6791
694 Ga0501081_0008652 3300049743 Bacteria 6612
695 Ga0501083_0048411 3300049744 Bacteria 2869
696 Ga0501083_0180829 3300049744 Bacteria 1377
697 Ga0501035_0041227 3300049822 Bacteria 4169
698 Ga0501035_0042421 3300049822 Bacteria 4103
699 Ga0501044_0001788 3300049823 Bacteria 25106
700 Ga0501044_0017915 3300049823 Bacteria 7595
701 Ga0501044_0221899 3300049823 Bacteria 1841
702 Ga0501044_0337858 3300049823 Bacteria 1428
703 Ga0501044_0442922 3300049823 Bacteria 1206
704 Ga0501045_0069902 3300049824 Bacteria 2582
705 Ga0501045_0101405 3300049824 Bacteria 2131
706 nmdc:mga03683_22477_c1 3300050489 Bacteria 2445
707 nmdc:mga03683_55104_c1 3300050489 Bacteria 1669
708 nmdc:mga03683_55263_c1 3300050489 Bacteria 1667
709 nmdc:mga03n38_127658_c1 3300050490 Bacteria 1257
710 nmdc:mga03n38_91076_c1 3300050490 Bacteria 1452
711 nmdc:mga00v17_13574_c1 3300050491 Bacteria 4525
712 nmdc:mga0yw44_70866_c1 3300050492 Bacteria 2163
713 nmdc:mga0yw44_71682_c1 3300050492 Bacteria 2152
714 nmdc:mga0yw44_85831_c1 3300050492 Bacteria 1981
715 nmdc:mga06z11_31054_c1 3300050494 Bacteria 2592
716 nmdc:mga06z11_7343_c1 3300050494 Bacteria 4528
717 nmdc:mga05p37_250_c1 3300050507 Bacteria 32288
718 nmdc:mga05p37_743_c1 3300050507 Bacteria 36122
719 nmdc:mga09592_28252_c1 3300050508 Bacteria 4659
720 nmdc:mga09592_781_c1 3300050508 Bacteria 24612
721 nmdc:mga09592_939_c1 3300050508 Bacteria 22904
722 nmdc:mga0qj67_416_c1 3300050509 Bacteria 29134
723 nmdc:mga0qj67_72223_c1 3300050509 Bacteria 2755
724 nmdc:mga06r32_19037_c1 3300050510 Bacteria 6295
725 nmdc:mga06r32_23198_c1 3300050510 Bacteria 5740
726 nmdc:mga08y16_121_c1 3300050511 Bacteria 67325
727 nmdc:mga08y16_177521_c1 3300050511 Bacteria 2212
728 nmdc:mga08y16_238767_c1 3300050511 Bacteria 1879
729 nmdc:mga08y16_28590_c1 3300050511 Bacteria 5877
730 nmdc:mga08y16_342471_c1 3300050511 Bacteria 1537
731 nmdc:mga08y16_37579_c1 3300050511 Bacteria 5084
732 nmdc:mga08y16_5320_c1 3300050511 Bacteria 13464
733 nmdc:mga08y16_54282_c1 3300050511 Bacteria 4186
734 nmdc:mga08y16_8302_c1 3300050511 Bacteria 10868
735 nmdc:mga0n895_3024_c1 3300050512 Bacteria 13372
736 nmdc:mga0n895_366652_c1 3300050512 Bacteria 1458
737 nmdc:mga0n895_447_c1 3300050512 Bacteria 27667
738 nmdc:mga0n895_459075_c1 3300050512 Bacteria 1286
739 nmdc:mga0n895_505618_c1 3300050512 Bacteria 1217
740 nmdc:mga0n895_95759_c1 3300050512 Bacteria 2973
741 nmdc:mga0rr50_10300_c1 3300050513 Bacteria 5925
742 nmdc:mga0rr50_104734_c1 3300050513 Bacteria 1558
743 nmdc:mga0rr50_183943_c1 3300050513 Bacteria 1709
744 nmdc:mga0rr50_334296_c1 3300050513 Bacteria 1272
745 nmdc:mga0rr50_47881_c1 3300050513 Bacteria 3157
746 nmdc:mga0rr50_84714_c1 3300050513 Bacteria 2455
747 nmdc:mga08x19_267634_c1 3300050514 Bacteria 1182
748 nmdc:mga08x19_46289_c1 3300050514 Bacteria 2782
749 nmdc:mga08x19_7066_c1 3300050514 Bacteria 6664
750 nmdc:mga0a205_46967_c1 3300050515 Bacteria 4165
751 nmdc:mga0a205_9850_c1 3300050515 Bacteria 8767
752 Ga0495601_0000372 3300053077 Bacteria 23692
753 Ga0495601_0002865 3300053077 Bacteria 9804
754 Ga0495601_0005078 3300053077 Bacteria 7642
755 Ga0495601_0005661 3300053077 Bacteria 7287
756 Ga0495601_0017787 3300053077 Bacteria 4318
757 Ga0495612_0007797 3300053078 Bacteria 4369
758 Ga0495612_0018337 3300053078 Bacteria 2803
759 Ga0495612_0077279 3300053078 Bacteria 1395
760 Ga0495612_0143864 3300053078 Bacteria 1035
761 Ga0495595_0001871 3300053084 Bacteria 8168
762 Ga0495595_0004960 3300053084 Bacteria 5368
763 Ga0495595_0005461 3300053084 Bacteria 5146
764 Ga0495595_0013305 3300053084 Bacteria 3475
765 Ga0495595_0116074 3300053084 Bacteria 1301
766 Ga0495619_0000560 3300053085 Bacteria 24582
767 Ga0495619_0002608 3300053085 Bacteria 11772
768 Ga0495619_0012089 3300053085 Bacteria 5437
769 Ga0495619_0027182 3300053085 Bacteria 3685
770 Ga0495619_0040965 3300053085 Bacteria 3028
771 Ga0500595_027664 3300053119 Bacteria 1939
772 Ga0500652_000019 3300053131 Bacteria 120149
773 Ga0500639_070003 3300053163 Bacteria 1790
774 Ga0501084_0109733 3300054114 Bacteria 2318
775 Ga0501084_0164338 3300054114 Bacteria 1873
776 Ga0501082_0060484 3300060353 Bacteria 3261
777 Ga0501082_0067050 3300060353 Bacteria 3090
778 Ga0501082_0102900 3300060353 Bacteria 2470
779 Ga0501082_0341867 3300060353 Unclassified 1304
780 Ga0501082_0346637 3300060353 Bacteria 1294
781 2939636133 2939631187 Bacteria 6118131
782 nmdc:mga05p37_267289_c1
783 ARcpr5oldR_c000171
784 ARSoilYngRDRAFT_c00211
785 ARcpr5yngRDRAFT_c000814
786 ARSoilOldRDRAFT_c000112
787 ARCol0yngRDRAFT_1000085
788 JGI24032J14994_100073
789 JGI24746J21847_1000181
790 JGI24747J21853_1000306
791 JGI24739J22299_10000225
792 JGI24737J22298_10000161
793 JGI24750J21931_1000080
794 JGI24748J21848_1000464
795 JGI24738J21930_10000427
796 JGI24035J26624_1000093
797 JGI24742J22300_10000178
798 Ga0065717_1002296
799 Ga0065712_10118769
800 Ga0070676_10000033
801 Ga0070683_100001226
802 Ga0070683_100099235
803 Ga0070683_100116228
804 Ga0070690_100000218
805 Ga0070690_100014746
806 Ga0070670_100007598
807 Ga0070677_10000123
808 Ga0068869_100000061
809 Ga0068869_100269856
810 Ga0070666_10008604
811 Ga0070680_100000813
812 Ga0070680_100022350
813 Ga0070680_100025992
814 Ga0070682_100000120
815 Ga0068868_100001686
816 Ga0068868_100277897
817 Ga0070660_100000576
818 Ga0070689_100000702
819 Ga0070689_100021461
820 Ga0070689_100166445
821 Ga0070691_10000237
822 Ga0070687_100000671
823 Ga0070661_100000169
824 Ga0070692_10000058
825 Ga0070668_100000430
826 Ga0070669_100002842
827 Ga0070675_100000571
828 Ga0070675_100078678
829 Ga0070675_100078930
830 Ga0070675_100195653
831 Ga0070675_100363310
832 Ga0070671_100000667
833 Ga0070671_100019122
834 Ga0070671_100151498
835 Ga0070674_100000089
836 Ga0070674_100083793
837 Ga0070673_100003147
838 Ga0070673_100097949
839 Ga0070673_100189762
840 Ga0070688_100000346
841 Ga0070688_100173144
842 Ga0070659_100002399
843 Ga0070659_100035422
844 Ga0070667_100038743
845 Ga0070667_100220882
846 Ga0070667_100389591
847 Ga0070709_10015585
848 Ga0070714_100515387
849 Ga0070713_100009646
850 Ga0070713_100117510
851 Ga0070713_100280007
852 Ga0070710_10026077
853 Ga0070701_10000009
854 Ga0070701_10007254
855 Ga0070701_10095976
856 Ga0070711_100287903
857 Ga0070705_100000201
858 Ga0070705_100045556
859 Ga0070700_100000114
860 Ga0070700_100164485
861 Ga0070694_100001784
862 Ga0070694_100065981
863 Ga0070708_100099845
864 Ga0070663_100001897
865 Ga0070678_100001391
866 Ga0070678_100027456
867 Ga0070678_100071220
868 Ga0070678_100148844
869 Ga0070662_100000905
870 Ga0070662_100169491
871 Ga0070662_100243705
872 Ga0070681_10001394
873 Ga0070681_10018851
874 Ga0070681_10037021
875 Ga0070681_10148173
876 Ga0068867_100000067
877 Ga0070685_10092826
878 Ga0070685_10095350
879 Ga0070706_100104325
880 Ga0070679_100001329
881 Ga0070679_100043018
882 Ga0070679_100043899
883 Ga0070684_100000112
884 Ga0070697_100009244
885 Ga0068853_100000660
886 Ga0070672_100000282
887 Ga0070672_100003608
888 Ga0070686_100000097
889 Ga0070686_100061512
890 Ga0070686_100127594
891 Ga0070686_100155415
892 Ga0070695_100234643
893 Ga0070696_100395040
894 Ga0070693_100000656
895 Ga0070693_100060134
896 Ga0070693_100167965
897 Ga0070665_100003890
898 Ga0070665_100038876
899 Ga0070665_100041354
900 Ga0070704_100009835
901 Ga0070704_100018235
902 Ga0068855_100003734
903 Ga0068855_100066874
904 Ga0070664_100000328
905 Ga0068857_100000039
906 Ga0068857_100070306
907 Ga0068854_100000324
908 Ga0068854_100147242
909 Ga0068856_100001406
910 Ga0070702_100000038
911 Ga0070702_100006778
912 Ga0068852_100004415
913 Ga0068852_100065257
914 Ga0068859_100013685
915 Ga0068859_100137633
916 Ga0068859_100255765
917 Ga0068864_100000057
918 Ga0068866_10000128
919 Ga0068866_10057368
920 Ga0068861_100004914
921 Ga0068861_100040717
922 Ga0068861_100119314
923 Ga0068851_10091936
924 Ga0068870_10000008
925 Ga0068870_10097799
926 Ga0068863_100000206
927 Ga0068863_100121257
928 Ga0068863_100192842
929 Ga0068858_100005550
930 Ga0068858_100224620
931 Ga0068860_100001936
932 Ga0068860_100077335
933 Ga0068862_100001174
934 Ga0068862_100178388
935 Ga0081455_10000402
936 Ga0081538_10053646
937 Ga0081540_1014275
938 Ga0081539_10003270
939 Ga0075365_10007041
940 Ga0075368_10009636
941 Ga0075363_100022908
942 Ga0075364_10009388
943 Ga0075364_10010424
944 Ga0075432_10001357
945 Ga0070716_100050564
946 Ga0070712_100093669
947 Ga0070712_100189203
948 Ga0070712_100398243
949 Ga0070712_100432703
950 Ga0075362_10017236
951 Ga0075367_10004569
952 Ga0075367_10039299
953 Ga0075367_10040517
954 Ga0075369_10025130
955 Ga0075366_10013436
956 Ga0097621_100000688
957 Ga0097621_100225706
958 Ga0068871_100000244
959 Ga0068871_100012794
960 Ga0068871_100037966
961 Ga0068871_100084293
962 Ga0068871_100091052
963 Ga0075428_100017415
964 Ga0075428_100029491
965 Ga0075428_100191899
966 Ga0075430_100000885
967 Ga0075430_100079159
968 Ga0075431_100001907
969 Ga0075431_100002610
970 Ga0075433_10000273
971 Ga0075433_10030576
972 Ga0075434_100000882
973 Ga0075434_100010190
974 Ga0075434_100132272
975 Ga0075434_100355356
976 Ga0075429_100005227
977 Ga0075429_100033714
978 Ga0075429_100041345
979 Ga0068865_100000204
980 Ga0068865_100025384
981 Ga0068865_100071301
982 Ga0075436_100015037
983 Ga0075436_100015432
984 Ga0097620_100013685
985 Ga0097620_100137631
986 Ga0097620_100255743
987 Ga0075435_100015904
988 Ga0075435_100031901
989 Ga0075435_100071633
990 Ga0111539_10000178
991 Ga0111539_10001379
992 Ga0111539_10002326
993 Ga0111539_10005336
994 Ga0111539_10044480
995 Ga0111539_10060285
996 Ga0111539_10061458
997 Ga0111539_10173157
998 Ga0111539_10296844
999 Ga0105245_10001863
1000 Ga0105245_10042699
1001 Ga0105247_10005321
1002 Ga0114129_10001129
1003 Ga0114129_10002175
1004 Ga0114129_10316163
1005 Ga0105243_10000159
1006 Ga0105243_10006434
1007 Ga0105243_10183292
1008 Ga0105241_10000205
1009 Ga0105241_10142780
1010 Ga0105242_10000174
1011 Ga0105242_10033868
1012 Ga0105248_10000221
1013 Ga0105248_10043444
1014 Ga0105248_10048997
1015 Ga0105248_10171027
1016 Ga0105237_10009209
1017 Ga0105249_10000283
1018 Ga0105249_10080022
1019 Ga0105249_10386351
1020 Ga0105249_10477625
1021 Ga0105239_10018211
1022 Ga0105246_10000257
1023 Ga0157320_1000908
1024 Ga0157371_10011491
1025 Ga0157374_10010039
1026 Ga0157378_10000165
1027 Ga0163162_10000240
1028 Ga0163162_10300835
1029 Ga0163162_10304057
1030 Ga0163162_10362754
1031 Ga0157372_10029330
1032 Ga0157375_10000547
1033 Ga0157375_10036275
1034 Ga0157375_10077613
1035 Ga0163163_10006271
1036 Ga0163163_10378731
1037 Ga0157380_10000444
1038 Ga0157377_10000158
1039 Ga0157379_10002186
1040 Ga0157376_10000120
1041 Ga0157376_10066982
1042 Ga0157376_10158537
1043 Ga0163161_10000796
1044 Ga0163161_10108596
1045 Ga0163161_10167002
1046 Ga0213876_10013918
1047 Ga0209233_1032575
1048 Ga0207666_1000020
1049 Ga0207673_1000018
1050 Ga0207426_1020846
1051 Ga0207697_10000111
1052 Ga0207697_10010913
1053 Ga0207697_10024807
1054 Ga0207653_10003485
1055 Ga0207682_10000017
1056 Ga0207682_10002784
1057 Ga0207692_10003250
1058 Ga0207642_10000382
1059 Ga0207710_10016010
1060 Ga0207688_10000071
1061 Ga0207688_10014650
1062 Ga0207647_10002372
1063 Ga0207647_10133874
1064 Ga0207645_10000064
1065 Ga0207643_10000003
1066 Ga0207643_10019522
1067 Ga0207643_10059178
1068 Ga0207705_10013922
1069 Ga0207684_10106492
1070 Ga0207654_10002311
1071 Ga0207654_10112435
1072 Ga0207707_10001069
1073 Ga0207707_10344674
1074 Ga0207671_10178029
1075 Ga0207693_10013584
1076 Ga0207693_10083771
1077 Ga0207693_10360281
1078 Ga0207663_10185819
1079 Ga0207660_10000160
1080 Ga0207660_10044525
1081 Ga0207662_10000117
1082 Ga0207662_10011583
1083 Ga0207662_10026782
1084 Ga0207662_10182959
1085 Ga0207657_10002004
1086 Ga0207657_10030435
1087 Ga0207657_10036666
1088 Ga0207649_10000179
1089 Ga0207652_10000484
1090 Ga0207652_10009052
1091 Ga0207652_10048783
1092 Ga0207646_10012975
1093 Ga0207681_10000238
1094 Ga0207681_10136154
1095 Ga0207681_10190589
1096 Ga0207694_10086879
1097 Ga0207650_10011217
1098 Ga0207650_10146762
1099 Ga0207650_10271502
1100 Ga0207650_10411482
1101 Ga0207659_10000060
1102 Ga0207659_10025854
1103 Ga0207687_10001466
1104 Ga0207687_10092653
1105 Ga0207687_10254922
1106 Ga0207700_10001188
1107 Ga0207664_10170459
1108 Ga0207644_10001905
1109 Ga0207644_10003329
1110 Ga0207644_10010223
1111 Ga0207644_10019258
1112 Ga0207644_10163598
1113 Ga0207690_10000101
1114 Ga0207706_10000610
1115 Ga0207706_10035933
1116 Ga0207686_10000110
1117 Ga0207709_10000609
1118 Ga0207709_10008740
1119 Ga0207709_10128720
1120 Ga0207670_10000255
1121 Ga0207670_10142351
1122 Ga0207669_10000039
1123 Ga0207704_10000204
1124 Ga0207704_10045475
1125 Ga0207704_10137539
1126 Ga0207665_10000652
1127 Ga0207691_10000125
1128 Ga0207691_10009530
1129 Ga0207691_10152751
1130 Ga0207711_10001038
1131 Ga0207711_10268074
1132 Ga0207689_10000239
1133 Ga0207689_10051824
1134 Ga0207661_10000100
1135 Ga0207661_10072711
1136 Ga0207679_10000014
1137 Ga0207679_10099197
1138 Ga0207667_10007798
1139 Ga0207667_10206890
1140 Ga0207667_10260832
1141 Ga0207651_10000564
1142 Ga0207651_10076300
1143 Ga0207651_10093765
1144 Ga0207712_10000159
1145 Ga0207712_10203886
1146 Ga0207668_10000462
1147 Ga0207640_10000079
1148 Ga0207658_10001600
1149 Ga0207658_10072520
1150 Ga0207658_10445602
1151 Ga0207677_10001413
1152 Ga0207703_10001502
1153 Ga0207703_10211753
1154 Ga0207639_10005912
1155 Ga0207639_10161996
1156 Ga0207678_10000432
1157 Ga0207678_10024403
1158 Ga0207678_10112807
1159 Ga0207708_10000781
1160 Ga0207708_10166871
1161 Ga0207641_10000396
1162 Ga0207641_10035491
1163 Ga0207648_10000453
1164 Ga0207648_10029019
1165 Ga0207676_10086392
1166 Ga0207676_10099453
1167 Ga0207674_10000184
1168 Ga0207674_10075488
1169 Ga0207674_10293651
1170 Ga0207674_10432566
1171 Ga0207675_100000502
1172 Ga0207675_100153903
1173 Ga0207675_100561274
1174 Ga0207683_10000145
1175 Ga0207683_10002104
1176 Ga0207683_10003726
1177 Ga0207683_10094070
1178 Ga0207683_10169518
1179 Ga0207698_10001228
1180 Ga0207698_10138763
1181 Ga0207698_10600324
1182 Ga0209996_1002089
1183 Ga0209971_1006515
1184 Ga0209998_10001872
1185 Ga0209998_10002125
1186 Ga0209813_10038769
1187 Ga0209974_10001626
1188 Ga0209974_10017089
1189 Ga0207428_10000011
1190 Ga0207428_10000243
1191 Ga0207428_10000724
1192 Ga0207428_10002929
1193 Ga0207428_10013419
1194 Ga0207428_10040003
1195 Ga0207428_10044623
1196 Ga0207428_10150347
1197 Ga0268266_10001900
1198 Ga0268266_10008492
1199 Ga0268266_10123502
1200 Ga0268266_10139297
1201 Ga0268266_10394696
1202 Ga0268265_10000995
1203 Ga0268264_10000344
1204 Ga0307515_10000110
1205 Ga0265332_10004674
1206 Ga0265325_10032988
1207 Ga0265329_10048076
1208 Ga0265340_10003009
1209 Ga0265339_10001063
1210 Ga0307513_10002039
1211 Ga0265313_10007257
1212 Ga0265313_10073040
1213 Ga0265314_10001099
1214 Ga0265342_10000464
1215 Ga0265342_10000681
1216 Ga0373930_0000215
1217 Ga0373930_0001684
1218 Ga0373948_0000532
1219 Ga0373950_0004452
1220 Ga0373958_0000941
1221 Ga0373958_0008382
1222 Ga0373938_0005249
1223 Ga0373938_0012322
1224 Ga0373926_0012286
1225 Ga0373928_0002347
1226 Ga0373929_0000631
1227 Ga0373929_0006885
1228 Ga0373929_0010796
1229 Ga0373940_0028667
1230 Ga0373949_0001458
1231 Ga0373951_0001230
1232 Ga0373952_0000498
1233 Ga0373923_0067670
1234 Ga0373932_0000501
1235 Ga0373932_0001334
1236 Ga0373939_0000376
1237 Ga0373939_0007259
1238 Ga0373941_0000657
1239 Ga0373941_0001046
1240 Ga0373945_0041881
1241 Ga0373953_0000515
1242 Ga0373956_0053571
1243 Ga0373957_0025336
1244 Ga0373960_0000567
1245 Ga0373960_0005925
1246 Ga0373943_0027985
1247 Ga0373943_0122223
1248 Ga0373946_0007211
1249 Ga0373946_0030320
1250 Ga0373955_0000935
1251 Ga0373955_0033175
1252 Ga0373942_0000639
1253 Ga0373961_0001685
1254 Ga0373962_0000067
1255 Ga0373962_0000438
1256 Ga0373924_0015353
1257 Ga0373924_0037217
1258 Ga0373931_0000069
1259 Ga0373931_0029434
1260 Ga0373935_0015051
1261 Ga0373935_0233949
1262 Ga0373927_0096996
1263 Ga0373933_0002999
1264 Ga0373933_0004321
1265 Ga0373933_0025342
1266 Ga0373947_0040744
1267 Ga0373937_0002549
1268 Ga0373937_0082731
1269 Ga0373937_0143845
1270 Ga0373925_0161417
1271 Ga0436364_1444304
1272 Ga0436365_0307466
1273 Ga0436365_1061513
1274 Ga0436360_1027199
1275 Ga0439453_0000588
1276 Ga0439441_001460
1277 Ga0439435_0019185
1278 Ga0439464_0017024
1279 Ga0451577_0126349
1280 Ga0451577_0196719
1281 Ga0466961_0201082
1282 Ga0466963_0060567
1283 Ga0453684_0114016
1284 Ga0466957_0083977
1285 Ga0451576_0016099
1286 Ga0451576_0243262
1287 Ga0466958_0230058
1288 Ga0466967_0069127
1289 Ga0495617_004689
1290 Ga0495592_0005373
1291 Ga0495592_0075734
1292 Ga0495603_0054809
1293 Ga0495629_0041353
1294 Ga0495641_0022456
1295 Ga0495641_0117463
1296 Ga0495651_0005634
1297 Ga0495651_0009019
1298 Ga0495653_0039796
1299 Ga0495582_0008971
1300 Ga0495582_0057920
1301 Ga0495605_0042162
1302 Ga0495639_0021239
1303 Ga0495662_0012647
1304 Ga0495662_0033453
1305 Ga0495664_0005483
1306 Ga0495664_0020650
1307 Ga0495664_0032049
1308 Ga0495584_0031220
1309 Ga0495585_0017085
1310 Ga0495594_0006989
1311 Ga0495607_0005140
1312 Ga0495583_0121682
1313 Ga0495608_0002389
1314 Ga0495618_0008897
1315 Ga0495618_0015145
1316 Ga0495618_0232276
1317 Ga0495628_0017653
1318 Ga0495628_0018796
1319 Ga0495630_0013763
1320 Ga0495666_0054112
1321 Ga0495666_0055667
1322 Ga0495665_0014385
1323 Ga0495640_0014361
1324 Ga0495640_0020776
1325 Ga0495587_0001017
1326 Ga0495587_0048300
1327 Ga0495587_0057799
1328 Ga0495598_0019157
1329 Ga0495609_0051431
1330 Ga0495621_0005432
1331 Ga0495645_0020888
1332 Ga0495622_0075069
1333 Ga0495633_0021481
1334 Ga0495667_0001520
1335 Ga0495667_0012982
1336 Ga0495634_0031524
1337 Ga0495634_0188130
1338 Ga0495611_0009012
1339 Ga0495635_0004324
1340 Ga0495635_0004512
1341 Ga0495635_0312352
1342 Ga0495588_0042738
1343 Ga0495657_0012985
1344 Ga0495599_0003792
1345 Ga0495599_0012296
1346 Ga0495623_0003669
1347 Ga0495646_0001795
1348 Ga0495647_0013168
1349 Ga0495658_0005967
1350 Ga0495658_0024941
1351 Ga0495613_0117130
1352 Ga0495624_0018308
1353 Ga0495670_0006445
1354 Ga0495589_0094881
1355 Ga0495600_0001596
1356 Ga0495600_0007111
1357 Ga0495600_0036607
1358 Ga0495600_0154216
1359 Ga0495581_0089157
1360 Ga0495604_0004240
1361 Ga0495604_0008164
1362 Ga0495604_0019882
1363 Ga0495674_0020799
1364 Ga0495674_0120687
1365 Ga0495680_0004269
1366 Ga0495680_0014761
1367 Ga0495680_0052596
1368 Ga0495675_0009360
1369 Ga0495675_0148161
1370 Ga0495684_0028620
1371 Ga0495593_0008164
1372 Ga0495602_0157692
1373 Ga0495602_0263343
1374 Ga0495614_0043032
1375 Ga0495615_0009479
1376 Ga0496100_0000107
1377 Ga0496100_0284847
1378 Ga0496101_0000203
1379 Ga0496101_0029759
1380 Ga0496101_0176242
1381 Ga0496101_0274699
1382 Ga0496102_0001940
1383 Ga0496102_0300592
1384 Ga0496103_0000884
1385 Ga0496103_0035644
1386 Ga0496104_0265042
1387 Ga0496105_0065288
1388 Ga0496105_0274434
1389 Ga0496106_0000798
1390 Ga0496106_0035919
1391 Ga0496107_0036802
1392 Ga0496108_0014474
1393 Ga0496108_0015688
1394 Ga0496108_0026298
1395 Ga0496108_0100513
1396 Ga0496108_0381256
1397 Ga0496109_0000219
1398 Ga0496109_0305583
1399 Ga0496109_0319893
1400 Ga0496110_0007524
1401 Ga0496110_0014656
1402 Ga0496110_0300457
1403 Ga0496111_0015358
1404 Ga0496111_0135920
1405 Ga0496112_0039469
1406 Ga0496112_0152127
1407 Ga0496113_0224786
1408 Ga0496114_0008698
1409 Ga0496115_0000613
1410 Ga0496115_0044088
1411 Ga0496115_0188747
1412 Ga0501031_0029828
1413 Ga0501032_0087691
1414 Ga0501033_0002765
1415 Ga0501034_0000230
1416 Ga0501034_0016716
1417 Ga0501034_0048779
1418 Ga0501034_0085183
1419 Ga0501034_0090074
1420 Ga0501034_0505819
1421 Ga0501036_0010397
1422 Ga0501036_0080019
1423 Ga0501036_0115010
1424 Ga0501036_0282007
1425 Ga0501037_0011522
1426 Ga0501037_0056641
1427 Ga0501038_0023452
1428 Ga0501039_0001530
1429 Ga0501039_0004104
1430 Ga0501039_0125692
1431 Ga0501040_0026497
1432 Ga0501041_0007924
1433 Ga0501041_0061796
1434 Ga0501042_0029109
1435 Ga0501043_0028635
1436 Ga0501043_0292217
1437 Ga0501043_0448405
1438 Ga0501046_0053259
1439 Ga0501046_0086613
1440 Ga0501046_0233087
1441 Ga0501047_0025121
1442 Ga0501047_0027177
1443 Ga0501047_0077880
1444 Ga0501047_0110888
1445 Ga0501048_0028260
1446 Ga0501067_0034826
1447 Ga0501068_0013850
1448 Ga0501068_0121303
1449 Ga0501069_0023904
1450 Ga0501069_0089052
1451 Ga0501070_0093169
1452 Ga0501070_0252913
1453 Ga0501071_0102730
1454 Ga0501071_0302107
1455 Ga0501072_0184128
1456 Ga0501073_0029596
1457 Ga0501074_0018112
1458 Ga0501074_0094968
1459 Ga0501075_0015749
1460 Ga0501075_0031231
1461 Ga0501076_0002813
1462 Ga0501076_0015987
1463 Ga0501077_0016223
1464 Ga0501079_0002358
1465 Ga0501079_0012744
1466 Ga0501079_0180487
1467 Ga0501079_0186631
1468 Ga0501080_0026017
1469 Ga0501080_0028049
1470 Ga0501080_0039671
1471 Ga0501080_0066996
1472 Ga0501080_0099085
1473 Ga0501080_0123179
1474 Ga0501081_0008168
1475 Ga0501081_0008652
1476 Ga0501083_0048411
1477 Ga0501083_0180829
1478 Ga0501035_0041227
1479 Ga0501035_0042421
1480 Ga0501044_0001788
1481 Ga0501044_0017915
1482 Ga0501044_0221899
1483 Ga0501044_0337858
1484 Ga0501044_0442922
1485 Ga0501045_0069902
1486 Ga0501045_0101405
1487 nmdc:mga03683_22477_c1
1488 nmdc:mga03683_55104_c1
1489 nmdc:mga03683_55263_c1
1490 nmdc:mga03n38_127658_c1
1491 nmdc:mga03n38_91076_c1
1492 nmdc:mga00v17_13574_c1
1493 nmdc:mga0yw44_70866_c1
1494 nmdc:mga0yw44_71682_c1
1495 nmdc:mga0yw44_85831_c1
1496 nmdc:mga06z11_31054_c1
1497 nmdc:mga06z11_7343_c1
1498 nmdc:mga05p37_250_c1
1499 nmdc:mga05p37_743_c1
1500 nmdc:mga09592_28252_c1
1501 nmdc:mga09592_781_c1
1502 nmdc:mga09592_939_c1
1503 nmdc:mga0qj67_416_c1
1504 nmdc:mga0qj67_72223_c1
1505 nmdc:mga06r32_19037_c1
1506 nmdc:mga06r32_23198_c1
1507 nmdc:mga08y16_121_c1
1508 nmdc:mga08y16_177521_c1
1509 nmdc:mga08y16_238767_c1
1510 nmdc:mga08y16_28590_c1
1511 nmdc:mga08y16_342471_c1
1512 nmdc:mga08y16_37579_c1
1513 nmdc:mga08y16_5320_c1
1514 nmdc:mga08y16_54282_c1
1515 nmdc:mga08y16_8302_c1
1516 nmdc:mga0n895_3024_c1
1517 nmdc:mga0n895_366652_c1
1518 nmdc:mga0n895_447_c1
1519 nmdc:mga0n895_459075_c1
1520 nmdc:mga0n895_505618_c1
1521 nmdc:mga0n895_95759_c1
1522 nmdc:mga0rr50_10300_c1
1523 nmdc:mga0rr50_104734_c1
1524 nmdc:mga0rr50_183943_c1
1525 nmdc:mga0rr50_334296_c1
1526 nmdc:mga0rr50_47881_c1
1527 nmdc:mga0rr50_84714_c1
1528 nmdc:mga08x19_267634_c1
1529 nmdc:mga08x19_46289_c1
1530 nmdc:mga08x19_7066_c1
1531 nmdc:mga0a205_46967_c1
1532 nmdc:mga0a205_9850_c1
1533 Ga0495601_0000372
1534 Ga0495601_0002865
1535 Ga0495601_0005078
1536 Ga0495601_0005661
1537 Ga0495601_0017787
1538 Ga0495612_0007797
1539 Ga0495612_0018337
1540 Ga0495612_0077279
1541 Ga0495612_0143864
1542 Ga0495595_0001871
1543 Ga0495595_0004960
1544 Ga0495595_0005461
1545 Ga0495595_0013305
1546 Ga0495595_0116074
1547 Ga0495619_0000560
1548 Ga0495619_0002608
1549 Ga0495619_0012089
1550 Ga0495619_0027182
1551 Ga0495619_0040965
1552 Ga0500595_027664
1553 Ga0500652_000019
1554 Ga0500639_070003
1555 Ga0501084_0109733
1556 Ga0501084_0164338
1557 Ga0501082_0060484
1558 Ga0501082_0067050
1559 Ga0501082_0102900
1560 Ga0501082_0341867
1561 Ga0501082_0346637
1562 2939636133

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

79

353

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.945 34 316
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9434 32 319
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9269 31 319
7ndr-assembly1.cif.gz_E crystal structure of tphc in an open conformation 0.9239 33 316
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9177 31 319
ID Description Score Start End Superfamily
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9279 121 243 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9279 121 243 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9275 121 239 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.914 121 243 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9137 121 243 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4Q3HMS6-F1-model_v4 deleted 0.9642 90 319
AF-A0A2N4SUF0-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9596 38 319
AF-A0A5P2HBP2-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9585 24 319
AF-A0A5N7RLR6-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9574 24 319
AF-A0A7Y9IQU3-F1-model_v4 Tripartite-type tricarboxylate transporter receptor subunit TctC 0.9566 28 319

Map