F480592

General Info

Members Datasets Scaffolds Average Seq Length
782 327 1564 94

Family's Representative Sequence

Representative Sequence 3300002737|JGI25162J39368_1000007|JGI25162J39368_100000771
Length 94
Sequence MTYKLNFFKSALKEWKALAPTIKEQFKKKLAERLENPHVVSARLCGPKNNRYKIKLKSLGYRLVYQVEDQEIIVTVVAVGKREGNEAYKLAEKR

Samples

Sample ID Description Type Environment
1 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
52 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
53 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
54 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
74 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
76 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
100 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
106 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
120 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
121 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
122 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
123 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
124 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
125 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
126 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
127 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
128 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
129 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
130 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
131 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
132 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
133 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
134 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
135 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
136 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
137 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
138 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
139 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
140 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
141 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
142 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
143 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
144 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
145 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
146 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
147 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
148 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
149 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
152 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
153 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
157 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
160 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
161 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
165 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
169 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
170 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
171 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
172 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
173 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
174 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
175 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
179 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
180 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
181 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
182 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
185 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
186 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
189 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
190 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
191 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
198 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
199 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
207 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
208 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
209 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
210 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
211 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
215 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
216 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
217 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
218 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
219 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
220 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
221 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
222 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
223 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
224 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
225 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
234 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
235 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
236 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
237 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
240 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
241 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
245 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
246 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
247 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
254 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
255 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
256 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
257 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
258 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
259 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
260 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
261 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
262 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
263 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
264 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
265 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
266 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
267 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
270 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
271 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
272 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
273 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
274 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
275 2511231004 Pseudomonas sp. GM102 Isolate Nodule
276 2511231012 Pseudomonas sp. GM33 Isolate Nodule
277 2511231018 Pseudomonas sp. GM60 Isolate Nodule
278 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
279 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
280 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
281 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
282 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
283 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
284 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
285 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
286 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
287 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
288 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
289 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
290 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
291 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
292 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
293 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
294 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
295 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
296 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
297 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
298 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
299 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
300 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
301 2784132063 Pseudomonas sp. 424 Isolate Unclassified
302 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
303 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
304 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
305 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
306 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
307 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
308 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
309 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
310 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
311 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
312 2919150387 Rahnella aceris 1817 Isolate Unclassified
313 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
314 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
315 2927143783 Rahnella sp. 2050 Isolate Unclassified
316 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
317 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
318 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
319 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
320 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
321 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
322 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
323 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
324 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
325 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
326 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
327 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.09
Metatranscriptomes 0.13
Isolates 6.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.95
Nodule 1.79
Rhizoplane 2.94
Rhizosphere 70.59
Stem 0
Stem Tuber 0.13
Unclassified 1.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000007 3300002737 Bacteria 403947
2 MRS2a_Contig_878 2124908027 Bacteria 17504
3 SwRhRL2b_contig_942673 2162886007 Bacteria 2901
4 MRS1b_contig_1512768 2162886011 Bacteria 979
5 JGI24740J21852_10031135 3300001979 Bacteria 1725
6 JGI24737J22298_10033282 3300001990 Unclassified 1602
7 JGI24738J21930_10024949 3300002075 Bacteria 1229
8 JGI25163J39215_1000040 3300002771 Bacteria 58616
9 JGI25164J39214_1000016 3300002772 Bacteria 202035
10 Ga0055538_1000006 3300003751 Bacteria 403947
11 Ga0055539_1000010 3300003752 Bacteria 403947
12 Ga0055533_1000013 3300003756 Bacteria 403947
13 Ga0055525_1000015 3300003759 Bacteria 403947
14 Ga0055536_1000145 3300003781 Bacteria 60430
15 Ga0055536_1000200 3300003781 Bacteria 48822
16 Ga0055534_1049140 3300003784 Bacteria 603
17 Ga0055530_10000128 3300003791 Bacteria 66096
18 Ga0055530_10000163 3300003791 Bacteria 60448
19 Ga0055540_1000156 3300003792 Bacteria 67320
20 Ga0055540_1001073 3300003792 Bacteria 17394
21 Ga0055540_1088347 3300003792 Bacteria 587
22 Ga0055531_10000425 3300003794 Bacteria 40017
23 Ga0055541_1000007 3300003841 Bacteria 403947
24 Ga0065714_10000431 3300005288 Bacteria 4997
25 Ga0065714_10005818 3300005288 Bacteria 3631
26 Ga0065714_10102197 3300005288 Bacteria 1627
27 Ga0065714_10120917 3300005288 Bacteria 1350
28 Ga0065714_10172880 3300005288 Bacteria 983
29 Ga0065714_10218135 3300005288 Bacteria 848
30 Ga0065714_10330062 3300005288 Bacteria 658
31 Ga0065704_10000271 3300005289 Bacteria 42831
32 Ga0065704_10156563 3300005289 Bacteria 1386
33 Ga0065704_10161970 3300005289 Bacteria 1348
34 Ga0065704_10291037 3300005289 Bacteria 903
35 Ga0065704_10315890 3300005289 Bacteria 861
36 Ga0065712_10182057 3300005290 Bacteria 1177
37 Ga0065712_10652761 3300005290 Bacteria 560
38 Ga0065715_10139364 3300005293 Bacteria 1875
39 Ga0065707_10127222 3300005295 Bacteria 1978
40 Ga0070680_102009700 3300005336 Bacteria 501
41 Ga0070659_100315936 3300005366 Bacteria 1305
42 Ga0070662_100027158 3300005457 Bacteria 3970
43 Ga0070662_100330068 3300005457 Bacteria 1246
44 Ga0068853_100053947 3300005539 Bacteria 3463
45 Ga0068855_100511680 3300005563 Bacteria 1303
46 Ga0068857_100029738 3300005577 Bacteria 4821
47 Ga0068857_100228009 3300005577 Bacteria 1703
48 Ga0068854_100049056 3300005578 Bacteria 3014
49 Ga0068852_101526137 3300005616 Unclassified 690
50 Ga0075363_100255511 3300006048 Bacteria 1010
51 Ga0075364_10095803 3300006051 Bacteria 1973
52 Ga0075364_10267326 3300006051 Bacteria 1163
53 Ga0075364_10715459 3300006051 Bacteria 683
54 Ga0075364_10741135 3300006051 Bacteria 670
55 Ga0075364_11019993 3300006051 Bacteria 562
56 Ga0075364_11070689 3300006051 Bacteria 548
57 Ga0075432_10097649 3300006058 Bacteria 1082
58 Ga0075432_10141775 3300006058 Bacteria 917
59 Ga0075432_10206485 3300006058 Bacteria 780
60 Ga0075432_10258756 3300006058 Bacteria 709
61 Ga0075432_10395522 3300006058 Bacteria 595
62 Ga0075432_10407184 3300006058 Bacteria 588
63 Ga0075432_10560242 3300006058 Bacteria 517
64 Ga0075362_10047340 3300006177 Bacteria 1915
65 Ga0075362_10243354 3300006177 Bacteria 884
66 Ga0075369_10126209 3300006186 Bacteria 1160
67 Ga0075370_10416480 3300006353 Bacteria 807
68 Ga0075436_100223473 3300006914 Bacteria 1336
69 Ga0075436_100455893 3300006914 Bacteria 931
70 Ga0075436_100474883 3300006914 Bacteria 913
71 Ga0079104_1000290 3300006946 Bacteria 63769
72 Ga0079104_1003915 3300006946 Bacteria 6652
73 Ga0079104_1009332 3300006946 Bacteria 3332
74 Ga0079104_1013375 3300006946 Bacteria 2530
75 Ga0105251_10008384 3300009011 Bacteria 6230
76 Ga0105251_10074727 3300009011 Bacteria 1574
77 Ga0105251_10148544 3300009011 Bacteria 1059
78 Ga0105251_10227935 3300009011 Bacteria 839
79 Ga0105251_10255529 3300009011 Bacteria 790
80 Ga0105244_10000026 3300009036 Bacteria 216056
81 Ga0105244_10019547 3300009036 Bacteria 3778
82 Ga0105244_10123703 3300009036 Bacteria 1251
83 Ga0105244_10143032 3300009036 Bacteria 1149
84 Ga0105244_10177061 3300009036 Bacteria 1013
85 Ga0105244_10192564 3300009036 Bacteria 964
86 Ga0105244_10205776 3300009036 Bacteria 927
87 Ga0105244_10220761 3300009036 Bacteria 889
88 Ga0105250_10001116 3300009092 Bacteria 15151
89 Ga0105250_10004167 3300009092 Bacteria 6704
90 Ga0105250_10099421 3300009092 Bacteria 1187
91 Ga0105250_10142365 3300009092 Bacteria 994
92 Ga0105250_10160908 3300009092 Bacteria 937
93 Ga0105240_12485856 3300009093 Bacteria 536
94 Ga0105243_10013201 3300009148 Bacteria 6245
95 Ga0105243_10124879 3300009148 Bacteria 2175
96 Ga0105243_11055168 3300009148 Bacteria 818
97 Ga0105241_10110315 3300009174 Bacteria 2201
98 Ga0105242_10015438 3300009176 Bacteria 5931
99 Ga0105242_11491208 3300009176 Bacteria 707
100 Ga0105248_10102693 3300009177 Bacteria 3222
101 Ga0105238_10311764 3300009551 Unclassified 1558
102 Ga0105238_10337113 3300009551 Bacteria 1495
103 Ga0105239_11041604 3300010375 Bacteria 941
104 Ga0157336_1001858 3300012477 Bacteria 1140
105 Ga0157345_1001192 3300012498 Bacteria 1858
106 Ga0157347_1011896 3300012502 Bacteria 931
107 Ga0157339_1013620 3300012505 Bacteria 780
108 Ga0157373_10016444 3300013100 Bacteria 5396
109 Ga0157373_10165428 3300013100 Bacteria 1557
110 Ga0157373_10479049 3300013100 Bacteria 898
111 Ga0157373_10498403 3300013100 Bacteria 880
112 Ga0157371_10000044 3300013102 Bacteria 194689
113 Ga0157371_10001383 3300013102 Bacteria 25425
114 Ga0157371_10010204 3300013102 Bacteria 7335
115 Ga0157371_10051292 3300013102 Bacteria 2932
116 Ga0157371_10067811 3300013102 Bacteria 2525
117 Ga0157371_10267965 3300013102 Bacteria 1232
118 Ga0157371_10432678 3300013102 Bacteria 966
119 Ga0157371_11318332 3300013102 Bacteria 559
120 Ga0157370_10021828 3300013104 Bacteria 6377
121 Ga0157370_10085874 3300013104 Bacteria 2956
122 Ga0157370_10210362 3300013104 Bacteria 1803
123 Ga0157370_10293730 3300013104 Bacteria 1501
124 Ga0157370_10636892 3300013104 Bacteria 975
125 Ga0157370_11737983 3300013104 Bacteria 560
126 Ga0157369_10007905 3300013105 Bacteria 12228
127 Ga0157369_10078453 3300013105 Bacteria 3538
128 Ga0157369_10397493 3300013105 Bacteria 1430
129 Ga0163162_10010387 3300013306 Bacteria 9049
130 Ga0163162_10582585 3300013306 Bacteria 1246
131 Ga0163162_11280742 3300013306 Bacteria 833
132 Ga0163162_11375294 3300013306 Bacteria 803
133 Ga0163162_11583479 3300013306 Bacteria 747
134 Ga0157372_10000453 3300013307 Bacteria 45046
135 Ga0157372_10025185 3300013307 Bacteria 6467
136 Ga0157375_10666823 3300013308 Bacteria 1195
137 Ga0157375_10810817 3300013308 Bacteria 1084
138 Ga0182008_10000238 3300014497 Bacteria 42638
139 Ga0182008_10016432 3300014497 Bacteria 3845
140 Ga0182008_10032643 3300014497 Bacteria 2614
141 Ga0182008_10130828 3300014497 Bacteria 1251
142 Ga0182008_10144922 3300014497 Bacteria 1189
143 Ga0182006_1013786 3300015261 Bacteria 3497
144 Ga0182006_1073962 3300015261 Bacteria 1257
145 Ga0182007_10072698 3300015262 Bacteria 1126
146 Ga0182007_10240575 3300015262 Bacteria 646
147 Ga0182005_1041845 3300015265 Bacteria 1246
148 Ga0182005_1070302 3300015265 Bacteria 961
149 Ga0182005_1086315 3300015265 Bacteria 870
150 Ga0163161_10175584 3300017792 Bacteria 1640
151 Ga0163161_10327370 3300017792 Bacteria 1213
152 Ga0163161_10489217 3300017792 Bacteria 1000
153 Ga0163161_10510030 3300017792 Bacteria 981
154 Ga0163161_10701669 3300017792 Bacteria 842
155 Ga0163161_10702948 3300017792 Bacteria 842
156 Ga0163161_11476642 3300017792 Bacteria 596
157 Ga0163161_11730898 3300017792 Bacteria 554
158 Ga0209760_100034 3300025207 Bacteria 135933
159 Ga0209784_100022 3300025224 Bacteria 403999
160 Ga0209566_100021 3300025225 Bacteria 403999
161 Ga0209674_100038 3300025226 Bacteria 403999
162 Ga0209563_100042 3300025230 Bacteria 403999
163 Ga0207427_100027 3300025231 Bacteria 403999
164 Ga0209437_100049 3300025233 Bacteria 403999
165 Ga0209677_100025 3300025253 Bacteria 403999
166 Ga0209233_1003281 3300025261 Bacteria 5737
167 Ga0209130_1031380 3300025284 Bacteria 1090
168 Ga0209675_1010416 3300025291 Bacteria 3177
169 Ga0209676_1000020 3300025292 Bacteria 617256
170 Ga0209676_1000032 3300025292 Bacteria 469558
171 Ga0209676_1000408 3300025292 Bacteria 77177
172 Ga0209676_1006111 3300025292 Bacteria 6045
173 Ga0209050_1000025 3300025298 Bacteria 528225
174 Ga0209050_1000099 3300025298 Bacteria 232176
175 Ga0209050_1001082 3300025298 Bacteria 33254
176 Ga0209051_1000026 3300025303 Bacteria 413311
177 Ga0209051_1000039 3300025303 Bacteria 319632
178 Ga0209051_1000047 3300025303 Bacteria 293227
179 Ga0209051_1024322 3300025303 Bacteria 2493
180 Ga0209257_1000034 3300025304 Bacteria 662719
181 Ga0209257_1111975 3300025304 Bacteria 650
182 Ga0207696_1000002 3300025711 Bacteria 1098043
183 Ga0207696_1000642 3300025711 Bacteria 25299
184 Ga0207696_1020208 3300025711 Bacteria 2153
185 Ga0207696_1053664 3300025711 Bacteria 1147
186 Ga0207655_1000057 3300025728 Bacteria 273598
187 Ga0207655_1000560 3300025728 Bacteria 46369
188 Ga0207655_1012867 3300025728 Bacteria 4847
189 Ga0207655_1018585 3300025728 Bacteria 3678
190 Ga0207655_1087344 3300025728 Bacteria 1107
191 Ga0207655_1088890 3300025728 Bacteria 1092
192 Ga0207655_1098508 3300025728 Bacteria 1012
193 Ga0207655_1117921 3300025728 Bacteria 885
194 Ga0207655_1122063 3300025728 Bacteria 862
195 Ga0207655_1200550 3300025728 Bacteria 596
196 Ga0207713_1000573 3300025735 Bacteria 36512
197 Ga0207713_1004368 3300025735 Bacteria 9184
198 Ga0207713_1006126 3300025735 Bacteria 7392
199 Ga0207713_1006127 3300025735 Bacteria 7392
200 Ga0207713_1008055 3300025735 Bacteria 6119
201 Ga0207713_1020172 3300025735 Bacteria 3238
202 Ga0207713_1031210 3300025735 Bacteria 2359
203 Ga0207713_1069000 3300025735 Bacteria 1311
204 Ga0207647_10175276 3300025904 Bacteria 1248
205 Ga0207654_10332309 3300025911 Bacteria 1042
206 Ga0207694_10104047 3300025924 Bacteria 2252
207 Ga0207650_10000185 3300025925 Bacteria 72385
208 Ga0207644_10548985 3300025931 Bacteria 956
209 Ga0207690_10261516 3300025932 Bacteria 1341
210 Ga0207706_10176427 3300025933 Bacteria 1877
211 Ga0207706_10399000 3300025933 Bacteria 1192
212 Ga0207686_10571208 3300025934 Bacteria 886
213 Ga0207709_10940985 3300025935 Bacteria 704
214 Ga0207709_11138580 3300025935 Bacteria 642
215 Ga0207668_10773876 3300025972 Bacteria 848
216 Ga0207640_10040953 3300025981 Bacteria 2943
217 Ga0207639_10017627 3300026041 Bacteria 5063
218 Ga0207674_10000029 3300026116 Bacteria 145730
219 Ga0207674_10025912 3300026116 Bacteria 6241
220 Ga0207674_10233715 3300026116 Bacteria 1786
221 Ga0207698_10178607 3300026142 Unclassified 1878
222 Ga0209281_1000026 3300027111 Bacteria 465877
223 Ga0209281_1000614 3300027111 Bacteria 40136
224 Ga0209281_1003496 3300027111 Bacteria 5164
225 Ga0209281_1005509 3300027111 Bacteria 3499
226 Ga0209371_1000014 3300027312 Bacteria 661118
227 Ga0209983_1026045 3300027665 Bacteria 1236
228 Ga0209974_10126046 3300027876 Bacteria 910
229 Ga0207428_10069990 3300027907 Bacteria 2759
230 Ga0207428_10407641 3300027907 Bacteria 995
231 Ga0207428_10454500 3300027907 Bacteria 933
232 Ga0207428_10505325 3300027907 Bacteria 878
233 Ga0207428_10815099 3300027907 Bacteria 663
234 Ga0268266_10106882 3300028379 Bacteria 2474
235 Ga0268266_10254151 3300028379 Bacteria 1626
236 Ga0268256_1000021 3300030500 Bacteria 542735
237 Ga0268256_1010279 3300030500 Bacteria 3043
238 Ga0316178_1142514 3300030735 Bacteria 13262
239 Ga0307408_100009196 3300031548 Bacteria 6515
240 Ga0307408_100273538 3300031548 Unclassified 1403
241 Ga0307408_100677396 3300031548 Bacteria 925
242 Ga0316579_10212966 3300031691 Bacteria 934
243 Ga0316579_10521807 3300031691 Unclassified 575
244 Ga0307405_10108814 3300031731 Bacteria 1873
245 Ga0307405_10182115 3300031731 Bacteria 1509
246 Ga0307405_10310489 3300031731 Bacteria 1200
247 Ga0307405_10331974 3300031731 Bacteria 1166
248 Ga0307405_10828258 3300031731 Unclassified 777
249 Ga0307410_10308877 3300031852 Bacteria 1250
250 Ga0307406_10267357 3300031901 Bacteria 1297
251 Ga0307412_10164900 3300031911 Bacteria 1651
252 Ga0307412_10213799 3300031911 Bacteria 1473
253 Ga0307412_10319033 3300031911 Bacteria 1235
254 Ga0307416_100281173 3300032002 Bacteria 1641
255 Ga0307416_102284124 3300032002 Bacteria 641
256 Ga0307411_10114545 3300032005 Bacteria 1937
257 Ga0307411_10347662 3300032005 Bacteria 1207
258 Ga0307415_101443879 3300032126 Bacteria 656
259 Ga0395899_0217634 3300037312 Bacteria 1324
260 Ga0395900_0002169 3300037418 Bacteria 21931
261 Ga0395900_0071831 3300037418 Bacteria 3558
262 Ga0395898_0072438 3300037466 Bacteria 3329
263 Ga0436361_1058773 3300039447 Bacteria 5025
264 Ga0439438_001153 3300041405 Bacteria 11736
265 Ga0439438_033200 3300041405 Bacteria 1364
266 Ga0439447_000379 3300041407 Bacteria 16202
267 Ga0439447_000776 3300041407 Bacteria 11711
268 Ga0439447_003341 3300041407 Bacteria 5707
269 Ga0439447_035093 3300041407 Bacteria 1244
270 Ga0439466_0000176 3300041411 Bacteria 25636
271 Ga0439466_0008485 3300041411 Bacteria 3872
272 Ga0439466_0020842 3300041411 Bacteria 2331
273 Ga0439466_0030233 3300041411 Bacteria 1859
274 Ga0439466_0064278 3300041411 Bacteria 1176
275 Ga0439466_0130211 3300041411 Bacteria 774
276 Ga0451807_0901309 3300041486 Bacteria 759
277 Ga0451807_0911490 3300041486 Bacteria 662
278 Ga0439432_002585 3300042006 Bacteria 6813
279 Ga0439432_023994 3300042006 Bacteria 2005
280 Ga0439432_058951 3300042006 Bacteria 1186
281 Ga0439432_093155 3300042006 Bacteria 905
282 Ga0439451_022878 3300042009 Bacteria 1259
283 Ga0439451_059161 3300042009 Bacteria 766
284 Ga0439452_000005 3300042010 Bacteria 646919
285 Ga0439452_000229 3300042010 Bacteria 39029
286 Ga0439452_048552 3300042010 Bacteria 978
287 Ga0439456_001064 3300042013 Bacteria 5468
288 Ga0439456_001435 3300042013 Bacteria 4789
289 Ga0439456_002068 3300042013 Bacteria 4040
290 Ga0439456_005338 3300042013 Bacteria 2604
291 Ga0439456_007928 3300042013 Bacteria 2188
292 Ga0439456_008553 3300042013 Bacteria 2114
293 Ga0439456_014786 3300042013 Bacteria 1627
294 Ga0439463_000558 3300042016 Bacteria 10418
295 Ga0439463_001147 3300042016 Bacteria 7098
296 Ga0439463_125649 3300042016 Bacteria 663
297 Ga0450911_000290 3300042115 Bacteria 18460
298 Ga0450911_000924 3300042115 Bacteria 7774
299 Ga0450911_006040 3300042115 Bacteria 1828
300 Ga0450919_004043 3300042121 Bacteria 1802
301 Ga0450920_002881 3300042122 Bacteria 2958
302 Ga0450922_000391 3300042124 Bacteria 4703
303 Ga0450923_011486 3300042125 Bacteria 1592
304 Ga0450900_016097 3300042136 Bacteria 1010
305 Ga0450902_001758 3300042137 Bacteria 2990
306 Ga0450902_032425 3300042137 Bacteria 881
307 Ga0450902_044893 3300042137 Bacteria 754
308 Ga0450903_000904 3300042138 Bacteria 5702
309 Ga0450903_025431 3300042138 Bacteria 905
310 Ga0450904_004135 3300042139 Bacteria 1521
311 Ga0450905_024695 3300042142 Bacteria 901
312 Ga0450906_001755 3300042145 Bacteria 4746
313 Ga0450906_003379 3300042145 Bacteria 3434
314 Ga0450907_000020 3300042146 Bacteria 75915
315 Ga0450907_000681 3300042146 Bacteria 8821
316 Ga0450910_005521 3300042147 Bacteria 1726
317 Ga0450910_022646 3300042147 Bacteria 957
318 Ga0439446_0064545 3300042156 Bacteria 1111
319 Ga0450908_087622 3300042184 Bacteria 562
320 Ga0450909_000635 3300042185 Bacteria 4635
321 Ga0450909_012929 3300042185 Bacteria 1225
322 Ga0439434_0000018 3300042435 Bacteria 42785
323 Ga0439464_0293630 3300042439 Bacteria 530
324 Ga0439460_0000545 3300042461 Bacteria 8252
325 Ga0439460_0002133 3300042461 Bacteria 4744
326 Ga0450918_021625 3300042531 Bacteria 1123
327 Ga0450893_0010920 3300042532 Bacteria 1496
328 Ga0451577_0000239 3300042876 Bacteria 108628
329 Ga0451577_0348022 3300042876 Unclassified 1344
330 Ga0439440_0000422 3300042993 Bacteria 7062
331 Ga0466969_0006571 3300044656 Bacteria 6180
332 Ga0453683_0640014 3300044673 Bacteria 695
333 Ga0453683_0952108 3300044673 Bacteria 569
334 Ga0453684_0001090 3300044712 Bacteria 85790
335 Ga0453684_0021005 3300044712 Bacteria 9789
336 Ga0453684_0190791 3300044712 Bacteria 2397
337 Ga0453684_0212099 3300044712 Bacteria 2250
338 Ga0451576_1319323 3300045051 Unclassified 752
339 Ga0451576_1654857 3300045051 Unclassified 663
340 Ga0495617_000608 3300046452 Bacteria 17996
341 Ga0495617_006994 3300046452 Bacteria 3933
342 Ga0495617_013490 3300046452 Bacteria 2781
343 Ga0495617_013625 3300046452 Bacteria 2766
344 Ga0495617_119463 3300046452 Bacteria 849
345 Ga0495627_001586 3300046453 Bacteria 12824
346 Ga0495627_011878 3300046453 Bacteria 3107
347 Ga0495627_015823 3300046453 Bacteria 2598
348 Ga0495627_088122 3300046453 Bacteria 894
349 Ga0495603_0001348 3300046455 Bacteria 14264
350 Ga0495603_0030679 3300046455 Bacteria 3237
351 Ga0495603_0693215 3300046455 Bacteria 582
352 Ga0495590_0000615 3300046457 Bacteria 16615
353 Ga0495590_0086300 3300046457 Bacteria 1108
354 Ga0495591_002305 3300046458 Bacteria 10797
355 Ga0495591_007492 3300046458 Bacteria 4633
356 Ga0495591_013020 3300046458 Bacteria 3065
357 Ga0495638_0002132 3300046460 Bacteria 16635
358 Ga0495638_0008667 3300046460 Bacteria 7195
359 Ga0495653_0570250 3300046463 Bacteria 698
360 Ga0495650_0000039 3300046471 Bacteria 375501
361 Ga0495650_0002587 3300046471 Bacteria 14248
362 Ga0495650_0106470 3300046471 Bacteria 1046
363 Ga0495605_0000530 3300046474 Bacteria 32164
364 Ga0495605_0000758 3300046474 Bacteria 23640
365 Ga0495605_0010780 3300046474 Bacteria 5108
366 Ga0495605_0226505 3300046474 Bacteria 806
367 Ga0495639_0039981 3300046475 Bacteria 2109
368 Ga0495639_0070435 3300046475 Bacteria 1615
369 Ga0495639_0090588 3300046475 Bacteria 1434
370 Ga0495639_0333060 3300046475 Bacteria 760
371 Ga0495584_0000787 3300046491 Bacteria 20916
372 Ga0495584_0002815 3300046491 Bacteria 9708
373 Ga0495584_0028177 3300046491 Bacteria 2845
374 Ga0495584_0115361 3300046491 Bacteria 1359
375 Ga0495584_0347430 3300046491 Bacteria 753
376 Ga0495585_0016673 3300046492 Bacteria 4255
377 Ga0495585_0117335 3300046492 Bacteria 1410
378 Ga0495585_0226186 3300046492 Bacteria 942
379 Ga0495585_0274479 3300046492 Bacteria 835
380 Ga0495594_0016477 3300046499 Bacteria 3893
381 Ga0495596_0022058 3300046500 Bacteria 2594
382 Ga0495607_0010999 3300046501 Bacteria 6048
383 Ga0495607_0040897 3300046501 Bacteria 2756
384 Ga0495607_0147481 3300046501 Bacteria 1207
385 Ga0495607_0193517 3300046501 Bacteria 1011
386 Ga0495607_0520267 3300046501 Bacteria 525
387 Ga0495583_0001511 3300046506 Bacteria 23143
388 Ga0495583_0040852 3300046506 Bacteria 2176
389 Ga0495583_0087514 3300046506 Bacteria 1345
390 Ga0495606_0006414 3300046507 Bacteria 10855
391 Ga0495606_0009270 3300046507 Bacteria 8352
392 Ga0495606_0091273 3300046507 Bacteria 1873
393 Ga0495606_0156493 3300046507 Bacteria 1333
394 Ga0495610_0003477 3300046512 Bacteria 12259
395 Ga0495610_0008115 3300046512 Bacteria 6862
396 Ga0495610_0009185 3300046512 Bacteria 6275
397 Ga0495610_0023023 3300046512 Bacteria 3393
398 Ga0495610_0035494 3300046512 Bacteria 2559
399 Ga0495610_0060740 3300046512 Bacteria 1798
400 Ga0495610_0101103 3300046512 Bacteria 1291
401 Ga0495616_0001725 3300046513 Bacteria 14898
402 Ga0495616_0006195 3300046513 Bacteria 7277
403 Ga0495616_0107817 3300046513 Bacteria 1297
404 Ga0495620_0002386 3300046515 Bacteria 10888
405 Ga0495620_0002590 3300046515 Bacteria 10459
406 Ga0495620_0257161 3300046515 Bacteria 665
407 Ga0495628_0211855 3300046516 Bacteria 1457
408 Ga0495630_0000091 3300046517 Bacteria 71198
409 Ga0495630_0680147 3300046517 Bacteria 787
410 Ga0495631_0001404 3300046518 Bacteria 14638
411 Ga0495631_0019053 3300046518 Bacteria 3223
412 Ga0495631_0398065 3300046518 Bacteria 586
413 Ga0495632_0000312 3300046519 Bacteria 47020
414 Ga0495632_0044876 3300046519 Bacteria 2204
415 Ga0495632_0069013 3300046519 Bacteria 1702
416 Ga0495632_0072070 3300046519 Bacteria 1658
417 Ga0495632_0198472 3300046519 Bacteria 914
418 Ga0495637_0001838 3300046520 Bacteria 12150
419 Ga0495637_0007664 3300046520 Bacteria 5340
420 Ga0495637_0009153 3300046520 Bacteria 4836
421 Ga0495637_0017794 3300046520 Bacteria 3303
422 Ga0495637_0024007 3300046520 Bacteria 2760
423 Ga0495643_0003399 3300046522 Bacteria 11696
424 Ga0495643_0084848 3300046522 Bacteria 1643
425 Ga0495644_0021319 3300046523 Bacteria 2472
426 Ga0495644_0441361 3300046523 Bacteria 517
427 Ga0495648_0002010 3300046524 Bacteria 19274
428 Ga0495648_0010271 3300046524 Bacteria 7148
429 Ga0495648_0025513 3300046524 Bacteria 3999
430 Ga0495648_0033204 3300046524 Bacteria 3374
431 Ga0495648_0086748 3300046524 Bacteria 1764
432 Ga0495648_0483567 3300046524 Bacteria 534
433 Ga0495666_0002069 3300046526 Bacteria 9937
434 Ga0495666_0004705 3300046526 Bacteria 6902
435 Ga0495666_0203230 3300046526 Bacteria 910
436 Ga0495666_0574002 3300046526 Bacteria 502
437 Ga0495642_0000231 3300046528 Bacteria 31949
438 Ga0495642_0007466 3300046528 Bacteria 4188
439 Ga0495654_0002895 3300046530 Bacteria 10758
440 Ga0495654_0004614 3300046530 Bacteria 8133
441 Ga0495654_0007837 3300046530 Bacteria 5938
442 Ga0495654_0011817 3300046530 Bacteria 4712
443 Ga0495654_0015690 3300046530 Bacteria 4020
444 Ga0495654_0017619 3300046530 Bacteria 3750
445 Ga0495654_0433818 3300046530 Bacteria 518
446 Ga0495665_0131052 3300046531 Bacteria 1312
447 Ga0495598_0044642 3300046537 Bacteria 1310
448 Ga0495609_0004699 3300046538 Bacteria 7392
449 Ga0495609_0007646 3300046538 Bacteria 5370
450 Ga0495609_0158782 3300046538 Bacteria 959
451 Ga0495609_0160730 3300046538 Bacteria 952
452 Ga0495609_0200777 3300046538 Bacteria 833
453 Ga0495609_0231846 3300046538 Bacteria 764
454 Ga0495597_0016354 3300046542 Bacteria 3502
455 Ga0495597_0050948 3300046542 Bacteria 1826
456 Ga0495597_0099047 3300046542 Bacteria 1231
457 Ga0495597_0187926 3300046542 Bacteria 832
458 Ga0495622_0010557 3300046557 Bacteria 4264
459 Ga0495622_0092064 3300046557 Bacteria 1392
460 Ga0495622_0120410 3300046557 Bacteria 1198
461 Ga0495622_0402770 3300046557 Bacteria 589
462 Ga0495633_0007110 3300046558 Bacteria 6504
463 Ga0495633_0077315 3300046558 Bacteria 1550
464 Ga0495633_0087462 3300046558 Bacteria 1449
465 Ga0495668_0010717 3300046616 Bacteria 5536
466 Ga0495634_0001289 3300046642 Bacteria 22945
467 Ga0495611_0015723 3300046648 Bacteria 3233
468 Ga0495625_0005424 3300046660 Bacteria 11641
469 Ga0495625_0009016 3300046660 Bacteria 8425
470 Ga0495625_0011860 3300046660 Bacteria 7078
471 Ga0495625_0041834 3300046660 Bacteria 3333
472 Ga0495659_0089481 3300046664 Bacteria 1180
473 Ga0495659_0123236 3300046664 Bacteria 1022
474 Ga0495661_0011981 3300046665 Bacteria 5868
475 Ga0495661_0044203 3300046665 Bacteria 2732
476 Ga0495661_0053604 3300046665 Bacteria 2424
477 Ga0495588_0009384 3300046674 Bacteria 4520
478 Ga0495588_0047982 3300046674 Bacteria 2193
479 Ga0495588_0112479 3300046674 Bacteria 1434
480 Ga0495623_0002460 3300046679 Bacteria 12290
481 Ga0495623_0007120 3300046679 Bacteria 7264
482 Ga0495646_0052317 3300046680 Bacteria 2467
483 Ga0495669_0083221 3300046684 Bacteria 1470
484 Ga0495669_0343256 3300046684 Bacteria 722
485 Ga0495613_0147858 3300046689 Bacteria 1676
486 Ga0495624_0135552 3300046690 Bacteria 1509
487 Ga0495670_0002161 3300046691 Bacteria 9721
488 Ga0495670_0009471 3300046691 Bacteria 4787
489 Ga0495670_0109700 3300046691 Bacteria 1427
490 Ga0495670_0124583 3300046691 Bacteria 1340
491 Ga0495670_0356741 3300046691 Bacteria 787
492 Ga0495670_0752563 3300046691 Bacteria 531
493 Ga0495670_0770526 3300046691 Unclassified 525
494 Ga0495671_0031930 3300046692 Bacteria 2690
495 Ga0495671_0077331 3300046692 Bacteria 1631
496 Ga0495671_0127779 3300046692 Bacteria 1239
497 Ga0495671_0166423 3300046692 Bacteria 1072
498 Ga0495649_0000095 3300046694 Bacteria 76587
499 Ga0495649_0024772 3300046694 Bacteria 3345
500 Ga0495649_0026855 3300046694 Bacteria 3197
501 Ga0495649_0038244 3300046694 Bacteria 2633
502 Ga0495649_0207266 3300046694 Bacteria 1016
503 Ga0495649_0236518 3300046694 Bacteria 941
504 Ga0495649_0551568 3300046694 Bacteria 570
505 Ga0495589_0000199 3300046794 Bacteria 52067
506 Ga0495589_0009466 3300046794 Bacteria 5067
507 Ga0495589_0011985 3300046794 Bacteria 4494
508 Ga0495589_0091139 3300046794 Bacteria 1480
509 Ga0495589_0144244 3300046794 Bacteria 1139
510 Ga0495660_0000023 3300046810 Bacteria 272605
511 Ga0495660_0012349 3300046810 Bacteria 4956
512 Ga0495660_0014970 3300046810 Bacteria 4484
513 Ga0495660_0016611 3300046810 Bacteria 4243
514 Ga0495660_0030975 3300046810 Bacteria 3010
515 Ga0495660_0065501 3300046810 Bacteria 1939
516 Ga0495660_0078488 3300046810 Bacteria 1735
517 Ga0495660_0124607 3300046810 Bacteria 1299
518 Ga0495660_0273895 3300046810 Bacteria 774
519 Ga0495660_0309822 3300046810 Bacteria 712
520 Ga0495604_0020713 3300047317 Bacteria 5250
521 Ga0495636_0087388 3300047318 Bacteria 1349
522 Ga0495674_0030209 3300047319 Bacteria 4929
523 Ga0495674_1434889 3300047319 Bacteria 513
524 Ga0495672_0001614 3300047320 Bacteria 22014
525 Ga0495672_0002964 3300047320 Bacteria 14946
526 Ga0495672_0003304 3300047320 Bacteria 13933
527 Ga0495672_0014441 3300047320 Bacteria 5407
528 Ga0495672_0124754 3300047320 Bacteria 1363
529 Ga0495672_0136669 3300047320 Bacteria 1284
530 Ga0495672_0477763 3300047320 Bacteria 557
531 Ga0495680_0014308 3300047322 Bacteria 6879
532 Ga0495680_0016640 3300047322 Bacteria 6310
533 Ga0495680_0159865 3300047322 Bacteria 1636
534 Ga0495683_0000604 3300047323 Bacteria 26955
535 Ga0495683_0033580 3300047323 Bacteria 2610
536 Ga0495683_0082720 3300047323 Bacteria 1564
537 Ga0495687_057410 3300047443 Bacteria 1619
538 Ga0495687_173789 3300047443 Bacteria 710
539 Ga0495675_0086816 3300047444 Bacteria 1966
540 Ga0495679_001784 3300047446 Bacteria 11765
541 Ga0495685_003052 3300047447 Bacteria 5307
542 Ga0495685_124053 3300047447 Bacteria 847
543 Ga0495673_0000957 3300047469 Bacteria 26116
544 Ga0495673_0003450 3300047469 Bacteria 10405
545 Ga0495673_0005239 3300047469 Bacteria 7877
546 Ga0495673_0027758 3300047469 Bacteria 2689
547 Ga0495673_0073814 3300047469 Bacteria 1428
548 Ga0495681_0001896 3300047470 Bacteria 15349
549 Ga0495681_0009188 3300047470 Bacteria 6113
550 Ga0495681_0016792 3300047470 Bacteria 4087
551 Ga0495681_0027486 3300047470 Bacteria 2941
552 Ga0495681_0350152 3300047470 Bacteria 562
553 Ga0495593_0000903 3300047673 Bacteria 17237
554 Ga0495593_0104978 3300047673 Bacteria 1446
555 Ga0495614_0077121 3300048089 Bacteria 1441
556 Ga0495615_0002720 3300048090 Bacteria 2868
557 Ga0495626_0000931 3300048091 Bacteria 25617
558 Ga0495626_0001133 3300048091 Bacteria 22281
559 Ga0495626_0002819 3300048091 Bacteria 11623
560 Ga0495626_0058837 3300048091 Bacteria 1754
561 Ga0495626_0126736 3300048091 Bacteria 1093
562 Ga0495626_0187227 3300048091 Bacteria 855
563 Ga0495626_0369595 3300048091 Bacteria 557
564 Ga0496102_0001223 3300048905 Bacteria 23305
565 Ga0496102_0073644 3300048905 Bacteria 3138
566 Ga0496103_0000823 3300048906 Bacteria 22758
567 Ga0496104_0000514 3300048907 Bacteria 33125
568 Ga0496108_1163972 3300048911 Bacteria 653
569 Ga0496110_0115942 3300048913 Bacteria 2411
570 Ga0496111_0821547 3300048914 Bacteria 672
571 Ga0496113_0814912 3300048916 Bacteria 741
572 Ga0496116_0000112 3300048919 Bacteria 181946
573 Ga0496116_0001003 3300048919 Bacteria 34466
574 Ga0496116_0006369 3300048919 Bacteria 10736
575 Ga0496116_0011788 3300048919 Bacteria 7196
576 Ga0496116_0013064 3300048919 Bacteria 6729
577 Ga0496116_0015601 3300048919 Bacteria 5997
578 Ga0496116_0051985 3300048919 Bacteria 2717
579 Ga0496116_0058673 3300048919 Bacteria 2507
580 Ga0496116_0192380 3300048919 Bacteria 1078
581 Ga0496116_0273013 3300048919 Bacteria 824
582 Ga0496116_0276053 3300048919 Bacteria 817
583 Ga0496117_0004007 3300048920 Bacteria 16614
584 Ga0496117_0013976 3300048920 Bacteria 6956
585 Ga0496117_0067627 3300048920 Bacteria 2416
586 Ga0496117_0068072 3300048920 Bacteria 2405
587 Ga0496117_0083412 3300048920 Bacteria 2089
588 Ga0496117_0152831 3300048920 Bacteria 1363
589 Ga0496117_0170557 3300048920 Bacteria 1263
590 Ga0496117_0179132 3300048920 Bacteria 1220
591 Ga0496117_0265985 3300048920 Bacteria 926
592 Ga0496117_0278240 3300048920 Bacteria 897
593 Ga0496117_0369737 3300048920 Bacteria 734
594 Ga0496117_0401421 3300048920 Bacteria 691
595 Ga0496118_0002977 3300048921 Bacteria 21906
596 Ga0496118_0011162 3300048921 Bacteria 8798
597 Ga0496118_0035604 3300048921 Bacteria 4038
598 Ga0496118_0125271 3300048921 Bacteria 1664
599 Ga0496118_0153834 3300048921 Bacteria 1434
600 Ga0496118_0160248 3300048921 Bacteria 1392
601 Ga0496118_0165701 3300048921 Bacteria 1358
602 Ga0496118_0175828 3300048921 Bacteria 1300
603 Ga0496118_0201686 3300048921 Bacteria 1177
604 Ga0496118_0291062 3300048921 Bacteria 902
605 Ga0496118_0311509 3300048921 Bacteria 858
606 Ga0496118_0570494 3300048921 Bacteria 547
607 Ga0496119_0000847 3300048922 Bacteria 40396
608 Ga0496119_0007444 3300048922 Bacteria 9856
609 Ga0496119_0014320 3300048922 Bacteria 6219
610 Ga0496119_0152341 3300048922 Bacteria 1237
611 Ga0496119_0269287 3300048922 Bacteria 851
612 Ga0496120_0004876 3300048923 Bacteria 10938
613 Ga0496120_0041389 3300048923 Bacteria 2699
614 Ga0496120_0061416 3300048923 Bacteria 2097
615 Ga0496120_0133159 3300048923 Bacteria 1270
616 Ga0496120_0154587 3300048923 Bacteria 1149
617 Ga0496121_0000097 3300048924 Bacteria 201224
618 Ga0496121_0013519 3300048924 Bacteria 8759
619 Ga0496121_0034157 3300048924 Bacteria 4582
620 Ga0496121_0037405 3300048924 Bacteria 4311
621 Ga0496121_0077588 3300048924 Bacteria 2644
622 Ga0496121_0264509 3300048924 Bacteria 1185
623 Ga0496122_0000067 3300048925 Bacteria 231365
624 Ga0496122_0003413 3300048925 Bacteria 20906
625 Ga0496122_0038151 3300048925 Bacteria 3854
626 Ga0496122_0075028 3300048925 Bacteria 2388
627 Ga0496122_0112971 3300048925 Bacteria 1776
628 Ga0496122_0167868 3300048925 Bacteria 1327
629 Ga0496122_0214848 3300048925 Bacteria 1110
630 Ga0496122_0269285 3300048925 Bacteria 939
631 Ga0496123_0000056 3300048926 Bacteria 231365
632 Ga0496123_0001391 3300048926 Bacteria 33892
633 Ga0496123_0007815 3300048926 Bacteria 9955
634 Ga0496123_0042687 3300048926 Bacteria 3125
635 Ga0496123_0073455 3300048926 Bacteria 2121
636 Ga0496123_0095355 3300048926 Bacteria 1750
637 Ga0496123_0208862 3300048926 Bacteria 994
638 Ga0496123_0232106 3300048926 Bacteria 922
639 Ga0496123_0366142 3300048926 Bacteria 666
640 Ga0496124_0000150 3300048927 Bacteria 142820
641 Ga0496124_0000247 3300048927 Bacteria 104657
642 Ga0496124_0006179 3300048927 Bacteria 13126
643 Ga0496124_0008088 3300048927 Bacteria 11053
644 Ga0496124_0038226 3300048927 Bacteria 4168
645 Ga0496124_0061033 3300048927 Bacteria 3161
646 Ga0496124_0083929 3300048927 Bacteria 2613
647 Ga0496124_0084502 3300048927 Bacteria 2602
648 Ga0496124_0110448 3300048927 Bacteria 2213
649 Ga0496124_0139680 3300048927 Bacteria 1913
650 Ga0496124_0142342 3300048927 Bacteria 1891
651 Ga0496124_0230626 3300048927 Bacteria 1384
652 Ga0496124_0233950 3300048927 Bacteria 1371
653 Ga0496124_0443479 3300048927 Bacteria 887
654 Ga0496124_0518559 3300048927 Bacteria 794
655 Ga0496124_0835257 3300048927 Bacteria 566
656 Ga0496124_0991124 3300048927 Bacteria 501
657 Ga0496125_0000048 3300048928 Bacteria 290651
658 Ga0496125_0001267 3300048928 Bacteria 37640
659 Ga0496125_0005813 3300048928 Bacteria 13548
660 Ga0496125_0011522 3300048928 Bacteria 8835
661 Ga0496125_0016521 3300048928 Bacteria 7082
662 Ga0496125_0021219 3300048928 Bacteria 6066
663 Ga0496125_0092376 3300048928 Bacteria 2263
664 Ga0496125_0153496 3300048928 Bacteria 1577
665 Ga0496125_0197397 3300048928 Bacteria 1321
666 Ga0496125_0275150 3300048928 Bacteria 1046
667 Ga0496125_0286304 3300048928 Bacteria 1017
668 Ga0496125_0328633 3300048928 Bacteria 923
669 Ga0496125_0624216 3300048928 Bacteria 584
670 Ga0496125_0683133 3300048928 Bacteria 547
671 Ga0496126_0050061 3300048929 Bacteria 3809
672 Ga0496126_0083434 3300048929 Bacteria 2820
673 Ga0496126_0145532 3300048929 Bacteria 2035
674 Ga0496126_0288064 3300048929 Bacteria 1359
675 Ga0496126_0462333 3300048929 Bacteria 1019
676 Ga0496126_0568155 3300048929 Bacteria 897
677 Ga0496126_0742629 3300048929 Bacteria 758
678 Ga0496126_1041310 3300048929 Bacteria 611
679 Ga0495678_016179 3300049459 Bacteria 3417
680 Ga0495678_029133 3300049459 Bacteria 2321
681 Ga0495678_029443 3300049459 Bacteria 2305
682 Ga0495678_042348 3300049459 Bacteria 1815
683 Ga0495682_0065915 3300049460 Bacteria 1305
684 Ga0495682_0074495 3300049460 Bacteria 1221
685 Ga0495682_0299221 3300049460 Bacteria 567
686 Ga0495682_0366744 3300049460 Bacteria 507
687 Ga0501290_031375 3300049513 Bacteria 763
688 Ga0501335_015018 3300049551 Bacteria 787
689 Ga0501034_0114939 3300049571 Bacteria 2680
690 Ga0501034_0244190 3300049571 Bacteria 1741
691 Ga0501034_0264477 3300049571 Bacteria 1662
692 Ga0501038_0140963 3300049574 Bacteria 1972
693 Ga0501043_0018210 3300049579 Bacteria 5507
694 Ga0501043_0381375 3300049579 Bacteria 1067
695 Ga0501046_0015320 3300049580 Bacteria 6446
696 Ga0501047_0672521 3300049581 Unclassified 854
697 Ga0501202_091395 3300049652 Bacteria 729
698 Ga0501206_022389 3300049653 Bacteria 906
699 Ga0501211_005242 3300049658 Bacteria 1301
700 Ga0501217_289699 3300049661 Unclassified 538
701 Ga0501235_001027 3300049669 Bacteria 5821
702 Ga0501236_023660 3300049670 Bacteria 926
703 Ga0501240_017619 3300049673 Bacteria 1041
704 Ga0501243_107875 3300049675 Bacteria 568
705 Ga0501225_0007311 3300049705 Bacteria 3201
706 Ga0501225_0291406 3300049705 Bacteria 550
707 Ga0501245_005492 3300049708 Bacteria 1757
708 Ga0501264_005581 3300049761 Bacteria 1147
709 Ga0501281_21911 3300049777 Bacteria 501
710 nmdc:mga03683_160815_c1 3300050489 Bacteria 1017
711 nmdc:mga03683_298171_c1 3300050489 Bacteria 755
712 nmdc:mga03683_408802_c1 3300050489 Bacteria 649
713 nmdc:mga03683_476106_c1 3300050489 Bacteria 603
714 nmdc:mga03683_84215_c1 3300050489 Bacteria 1378
715 nmdc:mga03n38_276812_c1 3300050490 Bacteria 894
716 nmdc:mga00v17_1066996_c1 3300050491 Bacteria 507
717 nmdc:mga00v17_199939_c1 3300050491 Bacteria 1292
718 nmdc:mga00v17_853315_c1 3300050491 Bacteria 578
719 nmdc:mga00v17_917402_c1 3300050491 Bacteria 554
720 nmdc:mga00v17_918451_c1 3300050491 Bacteria 554
721 nmdc:mga00v17_923703_c1 3300050491 Bacteria 552
722 nmdc:mga07m45_393668_c1 3300050496 Bacteria 804
723 nmdc:mga08x19_1027785_c1 3300050514 Bacteria 585
724 nmdc:mga08x19_80812_c1 3300050514 Bacteria 2134
725 Ga0500641_0011666 3300053096 Bacteria 3193
726 Ga0500621_048640 3300053126 Bacteria 1715
727 Ga0500577_0003180 3300053142 Bacteria 4252
728 Ga0500616_0191680 3300053153 Bacteria 912
729 Ga0500625_002649 3300053729 Bacteria 6780
730 2511254897 2511231004 Bacteria 6669789
731 2511302425 2511231012 Bacteria 6738011
732 2511341167 2511231018 Bacteria 6436256
733 2512328733 2512047018 Bacteria 6663241
734 2583789563 2582580891 Bacteria 6800976
735 2597855363 2597489887 Bacteria 6666321
736 2599364774 2599185161 Bacteria 6960462
737 2599371105 2599185162 Bacteria 6957254
738 2599377467 2599185163 Bacteria 6995158
739 2599381422 2599185164 Bacteria 6841688
740 2599388434 2599185165 Bacteria 6843250
741 2599396329 2599185166 Bacteria 6959206
742 2599408516 2599185168 Bacteria 6997636
743 2599463150 2599185181 Bacteria 6844519
744 2599492167 2599185186 Bacteria 6831633
745 2599950806 2599185303 Bacteria 6512725
746 2600215778 2599185356 Bacteria 6843884
747 2601775945 2600255313 Bacteria 6842543
748 2643951331 2643221588 Bacteria 3692460
749 2643956349 2643221589 Bacteria 6250934
750 2644021402 2643221602 Bacteria 6249926
751 2671109272 2667528173 Bacteria 5375747
752 2715750581 2713897148 Bacteria 5883533
753 2715760007 2713897149 Bacteria 6506249
754 2739261243 2738543015 Bacteria 6750701
755 2739314616 2738543025 Bacteria 6600348
756 2784264222 2784132063 Bacteria 6262788
757 2838737731 2838736955 Bacteria 5760694
758 2841841900 2841840854 Bacteria 5761912
759 2842141679 2842140634 Bacteria 5759631
760 2842846756 2842843487 Bacteria 6004777
761 2844667581 2844665904 Bacteria 6817974
762 2852657693 2852657418 Bacteria 6472974
763 2855022543 2855020534 Bacteria 3204685
764 2880233699 2880230671 Bacteria 6140320
765 2904477448 2904474040 Bacteria 5504324
766 2904555006 2904550169 Bacteria 6221258
767 2919153843 2919150387 Bacteria 5500879
768 2919489270 2919487758 Bacteria 5929766
769 2919681666 2919679072 Bacteria 4629602
770 2927147141 2927143783 Bacteria 5504251
771 2939575845 2939573065 Bacteria 4926053
772 2984292347 2984286254 Bacteria 6702062
773 2998142518 2998139840 Bacteria 6073514
774 3007616166 3007614139 Bacteria 6053559
775 3007721499 3007718800 Bacteria 5971527
776 8029998176 8029995093 Bacteria 5990776
777 8055088440 8055087960 Bacteria 4784273
778 8055096929 8055092621 Bacteria 4873875
779 8055771126 8055770955 Bacteria 6827675
780 8056126211 8056125926 Bacteria 6228218
781 8056158237 8056155041 Bacteria 6486948
782 8056168566 8056166840 Bacteria 5820959
783 JGI25162J39368_1000007
784 MRS2a_Contig_878
785 SwRhRL2b_contig_942673
786 MRS1b_contig_1512768
787 JGI24740J21852_10031135
788 JGI24737J22298_10033282
789 JGI24738J21930_10024949
790 JGI25163J39215_1000040
791 JGI25164J39214_1000016
792 Ga0055538_1000006
793 Ga0055539_1000010
794 Ga0055533_1000013
795 Ga0055525_1000015
796 Ga0055536_1000145
797 Ga0055536_1000200
798 Ga0055534_1049140
799 Ga0055530_10000128
800 Ga0055530_10000163
801 Ga0055540_1000156
802 Ga0055540_1001073
803 Ga0055540_1088347
804 Ga0055531_10000425
805 Ga0055541_1000007
806 Ga0065714_10000431
807 Ga0065714_10005818
808 Ga0065714_10102197
809 Ga0065714_10120917
810 Ga0065714_10172880
811 Ga0065714_10218135
812 Ga0065714_10330062
813 Ga0065704_10000271
814 Ga0065704_10156563
815 Ga0065704_10161970
816 Ga0065704_10291037
817 Ga0065704_10315890
818 Ga0065712_10182057
819 Ga0065712_10652761
820 Ga0065715_10139364
821 Ga0065707_10127222
822 Ga0070680_102009700
823 Ga0070659_100315936
824 Ga0070662_100027158
825 Ga0070662_100330068
826 Ga0068853_100053947
827 Ga0068855_100511680
828 Ga0068857_100029738
829 Ga0068857_100228009
830 Ga0068854_100049056
831 Ga0068852_101526137
832 Ga0075363_100255511
833 Ga0075364_10095803
834 Ga0075364_10267326
835 Ga0075364_10715459
836 Ga0075364_10741135
837 Ga0075364_11019993
838 Ga0075364_11070689
839 Ga0075432_10097649
840 Ga0075432_10141775
841 Ga0075432_10206485
842 Ga0075432_10258756
843 Ga0075432_10395522
844 Ga0075432_10407184
845 Ga0075432_10560242
846 Ga0075362_10047340
847 Ga0075362_10243354
848 Ga0075369_10126209
849 Ga0075370_10416480
850 Ga0075436_100223473
851 Ga0075436_100455893
852 Ga0075436_100474883
853 Ga0079104_1000290
854 Ga0079104_1003915
855 Ga0079104_1009332
856 Ga0079104_1013375
857 Ga0105251_10008384
858 Ga0105251_10074727
859 Ga0105251_10148544
860 Ga0105251_10227935
861 Ga0105251_10255529
862 Ga0105244_10000026
863 Ga0105244_10019547
864 Ga0105244_10123703
865 Ga0105244_10143032
866 Ga0105244_10177061
867 Ga0105244_10192564
868 Ga0105244_10205776
869 Ga0105244_10220761
870 Ga0105250_10001116
871 Ga0105250_10004167
872 Ga0105250_10099421
873 Ga0105250_10142365
874 Ga0105250_10160908
875 Ga0105240_12485856
876 Ga0105243_10013201
877 Ga0105243_10124879
878 Ga0105243_11055168
879 Ga0105241_10110315
880 Ga0105242_10015438
881 Ga0105242_11491208
882 Ga0105248_10102693
883 Ga0105238_10311764
884 Ga0105238_10337113
885 Ga0105239_11041604
886 Ga0157336_1001858
887 Ga0157345_1001192
888 Ga0157347_1011896
889 Ga0157339_1013620
890 Ga0157373_10016444
891 Ga0157373_10165428
892 Ga0157373_10479049
893 Ga0157373_10498403
894 Ga0157371_10000044
895 Ga0157371_10001383
896 Ga0157371_10010204
897 Ga0157371_10051292
898 Ga0157371_10067811
899 Ga0157371_10267965
900 Ga0157371_10432678
901 Ga0157371_11318332
902 Ga0157370_10021828
903 Ga0157370_10085874
904 Ga0157370_10210362
905 Ga0157370_10293730
906 Ga0157370_10636892
907 Ga0157370_11737983
908 Ga0157369_10007905
909 Ga0157369_10078453
910 Ga0157369_10397493
911 Ga0163162_10010387
912 Ga0163162_10582585
913 Ga0163162_11280742
914 Ga0163162_11375294
915 Ga0163162_11583479
916 Ga0157372_10000453
917 Ga0157372_10025185
918 Ga0157375_10666823
919 Ga0157375_10810817
920 Ga0182008_10000238
921 Ga0182008_10016432
922 Ga0182008_10032643
923 Ga0182008_10130828
924 Ga0182008_10144922
925 Ga0182006_1013786
926 Ga0182006_1073962
927 Ga0182007_10072698
928 Ga0182007_10240575
929 Ga0182005_1041845
930 Ga0182005_1070302
931 Ga0182005_1086315
932 Ga0163161_10175584
933 Ga0163161_10327370
934 Ga0163161_10489217
935 Ga0163161_10510030
936 Ga0163161_10701669
937 Ga0163161_10702948
938 Ga0163161_11476642
939 Ga0163161_11730898
940 Ga0209760_100034
941 Ga0209784_100022
942 Ga0209566_100021
943 Ga0209674_100038
944 Ga0209563_100042
945 Ga0207427_100027
946 Ga0209437_100049
947 Ga0209677_100025
948 Ga0209233_1003281
949 Ga0209130_1031380
950 Ga0209675_1010416
951 Ga0209676_1000020
952 Ga0209676_1000032
953 Ga0209676_1000408
954 Ga0209676_1006111
955 Ga0209050_1000025
956 Ga0209050_1000099
957 Ga0209050_1001082
958 Ga0209051_1000026
959 Ga0209051_1000039
960 Ga0209051_1000047
961 Ga0209051_1024322
962 Ga0209257_1000034
963 Ga0209257_1111975
964 Ga0207696_1000002
965 Ga0207696_1000642
966 Ga0207696_1020208
967 Ga0207696_1053664
968 Ga0207655_1000057
969 Ga0207655_1000560
970 Ga0207655_1012867
971 Ga0207655_1018585
972 Ga0207655_1087344
973 Ga0207655_1088890
974 Ga0207655_1098508
975 Ga0207655_1117921
976 Ga0207655_1122063
977 Ga0207655_1200550
978 Ga0207713_1000573
979 Ga0207713_1004368
980 Ga0207713_1006126
981 Ga0207713_1006127
982 Ga0207713_1008055
983 Ga0207713_1020172
984 Ga0207713_1031210
985 Ga0207713_1069000
986 Ga0207647_10175276
987 Ga0207654_10332309
988 Ga0207694_10104047
989 Ga0207650_10000185
990 Ga0207644_10548985
991 Ga0207690_10261516
992 Ga0207706_10176427
993 Ga0207706_10399000
994 Ga0207686_10571208
995 Ga0207709_10940985
996 Ga0207709_11138580
997 Ga0207668_10773876
998 Ga0207640_10040953
999 Ga0207639_10017627
1000 Ga0207674_10000029
1001 Ga0207674_10025912
1002 Ga0207674_10233715
1003 Ga0207698_10178607
1004 Ga0209281_1000026
1005 Ga0209281_1000614
1006 Ga0209281_1003496
1007 Ga0209281_1005509
1008 Ga0209371_1000014
1009 Ga0209983_1026045
1010 Ga0209974_10126046
1011 Ga0207428_10069990
1012 Ga0207428_10407641
1013 Ga0207428_10454500
1014 Ga0207428_10505325
1015 Ga0207428_10815099
1016 Ga0268266_10106882
1017 Ga0268266_10254151
1018 Ga0268256_1000021
1019 Ga0268256_1010279
1020 Ga0316178_1142514
1021 Ga0307408_100009196
1022 Ga0307408_100273538
1023 Ga0307408_100677396
1024 Ga0316579_10212966
1025 Ga0316579_10521807
1026 Ga0307405_10108814
1027 Ga0307405_10182115
1028 Ga0307405_10310489
1029 Ga0307405_10331974
1030 Ga0307405_10828258
1031 Ga0307410_10308877
1032 Ga0307406_10267357
1033 Ga0307412_10164900
1034 Ga0307412_10213799
1035 Ga0307412_10319033
1036 Ga0307416_100281173
1037 Ga0307416_102284124
1038 Ga0307411_10114545
1039 Ga0307411_10347662
1040 Ga0307415_101443879
1041 Ga0395899_0217634
1042 Ga0395900_0002169
1043 Ga0395900_0071831
1044 Ga0395898_0072438
1045 Ga0436361_1058773
1046 Ga0439438_001153
1047 Ga0439438_033200
1048 Ga0439447_000379
1049 Ga0439447_000776
1050 Ga0439447_003341
1051 Ga0439447_035093
1052 Ga0439466_0000176
1053 Ga0439466_0008485
1054 Ga0439466_0020842
1055 Ga0439466_0030233
1056 Ga0439466_0064278
1057 Ga0439466_0130211
1058 Ga0451807_0901309
1059 Ga0451807_0911490
1060 Ga0439432_002585
1061 Ga0439432_023994
1062 Ga0439432_058951
1063 Ga0439432_093155
1064 Ga0439451_022878
1065 Ga0439451_059161
1066 Ga0439452_000005
1067 Ga0439452_000229
1068 Ga0439452_048552
1069 Ga0439456_001064
1070 Ga0439456_001435
1071 Ga0439456_002068
1072 Ga0439456_005338
1073 Ga0439456_007928
1074 Ga0439456_008553
1075 Ga0439456_014786
1076 Ga0439463_000558
1077 Ga0439463_001147
1078 Ga0439463_125649
1079 Ga0450911_000290
1080 Ga0450911_000924
1081 Ga0450911_006040
1082 Ga0450919_004043
1083 Ga0450920_002881
1084 Ga0450922_000391
1085 Ga0450923_011486
1086 Ga0450900_016097
1087 Ga0450902_001758
1088 Ga0450902_032425
1089 Ga0450902_044893
1090 Ga0450903_000904
1091 Ga0450903_025431
1092 Ga0450904_004135
1093 Ga0450905_024695
1094 Ga0450906_001755
1095 Ga0450906_003379
1096 Ga0450907_000020
1097 Ga0450907_000681
1098 Ga0450910_005521
1099 Ga0450910_022646
1100 Ga0439446_0064545
1101 Ga0450908_087622
1102 Ga0450909_000635
1103 Ga0450909_012929
1104 Ga0439434_0000018
1105 Ga0439464_0293630
1106 Ga0439460_0000545
1107 Ga0439460_0002133
1108 Ga0450918_021625
1109 Ga0450893_0010920
1110 Ga0451577_0000239
1111 Ga0451577_0348022
1112 Ga0439440_0000422
1113 Ga0466969_0006571
1114 Ga0453683_0640014
1115 Ga0453683_0952108
1116 Ga0453684_0001090
1117 Ga0453684_0021005
1118 Ga0453684_0190791
1119 Ga0453684_0212099
1120 Ga0451576_1319323
1121 Ga0451576_1654857
1122 Ga0495617_000608
1123 Ga0495617_006994
1124 Ga0495617_013490
1125 Ga0495617_013625
1126 Ga0495617_119463
1127 Ga0495627_001586
1128 Ga0495627_011878
1129 Ga0495627_015823
1130 Ga0495627_088122
1131 Ga0495603_0001348
1132 Ga0495603_0030679
1133 Ga0495603_0693215
1134 Ga0495590_0000615
1135 Ga0495590_0086300
1136 Ga0495591_002305
1137 Ga0495591_007492
1138 Ga0495591_013020
1139 Ga0495638_0002132
1140 Ga0495638_0008667
1141 Ga0495653_0570250
1142 Ga0495650_0000039
1143 Ga0495650_0002587
1144 Ga0495650_0106470
1145 Ga0495605_0000530
1146 Ga0495605_0000758
1147 Ga0495605_0010780
1148 Ga0495605_0226505
1149 Ga0495639_0039981
1150 Ga0495639_0070435
1151 Ga0495639_0090588
1152 Ga0495639_0333060
1153 Ga0495584_0000787
1154 Ga0495584_0002815
1155 Ga0495584_0028177
1156 Ga0495584_0115361
1157 Ga0495584_0347430
1158 Ga0495585_0016673
1159 Ga0495585_0117335
1160 Ga0495585_0226186
1161 Ga0495585_0274479
1162 Ga0495594_0016477
1163 Ga0495596_0022058
1164 Ga0495607_0010999
1165 Ga0495607_0040897
1166 Ga0495607_0147481
1167 Ga0495607_0193517
1168 Ga0495607_0520267
1169 Ga0495583_0001511
1170 Ga0495583_0040852
1171 Ga0495583_0087514
1172 Ga0495606_0006414
1173 Ga0495606_0009270
1174 Ga0495606_0091273
1175 Ga0495606_0156493
1176 Ga0495610_0003477
1177 Ga0495610_0008115
1178 Ga0495610_0009185
1179 Ga0495610_0023023
1180 Ga0495610_0035494
1181 Ga0495610_0060740
1182 Ga0495610_0101103
1183 Ga0495616_0001725
1184 Ga0495616_0006195
1185 Ga0495616_0107817
1186 Ga0495620_0002386
1187 Ga0495620_0002590
1188 Ga0495620_0257161
1189 Ga0495628_0211855
1190 Ga0495630_0000091
1191 Ga0495630_0680147
1192 Ga0495631_0001404
1193 Ga0495631_0019053
1194 Ga0495631_0398065
1195 Ga0495632_0000312
1196 Ga0495632_0044876
1197 Ga0495632_0069013
1198 Ga0495632_0072070
1199 Ga0495632_0198472
1200 Ga0495637_0001838
1201 Ga0495637_0007664
1202 Ga0495637_0009153
1203 Ga0495637_0017794
1204 Ga0495637_0024007
1205 Ga0495643_0003399
1206 Ga0495643_0084848
1207 Ga0495644_0021319
1208 Ga0495644_0441361
1209 Ga0495648_0002010
1210 Ga0495648_0010271
1211 Ga0495648_0025513
1212 Ga0495648_0033204
1213 Ga0495648_0086748
1214 Ga0495648_0483567
1215 Ga0495666_0002069
1216 Ga0495666_0004705
1217 Ga0495666_0203230
1218 Ga0495666_0574002
1219 Ga0495642_0000231
1220 Ga0495642_0007466
1221 Ga0495654_0002895
1222 Ga0495654_0004614
1223 Ga0495654_0007837
1224 Ga0495654_0011817
1225 Ga0495654_0015690
1226 Ga0495654_0017619
1227 Ga0495654_0433818
1228 Ga0495665_0131052
1229 Ga0495598_0044642
1230 Ga0495609_0004699
1231 Ga0495609_0007646
1232 Ga0495609_0158782
1233 Ga0495609_0160730
1234 Ga0495609_0200777
1235 Ga0495609_0231846
1236 Ga0495597_0016354
1237 Ga0495597_0050948
1238 Ga0495597_0099047
1239 Ga0495597_0187926
1240 Ga0495622_0010557
1241 Ga0495622_0092064
1242 Ga0495622_0120410
1243 Ga0495622_0402770
1244 Ga0495633_0007110
1245 Ga0495633_0077315
1246 Ga0495633_0087462
1247 Ga0495668_0010717
1248 Ga0495634_0001289
1249 Ga0495611_0015723
1250 Ga0495625_0005424
1251 Ga0495625_0009016
1252 Ga0495625_0011860
1253 Ga0495625_0041834
1254 Ga0495659_0089481
1255 Ga0495659_0123236
1256 Ga0495661_0011981
1257 Ga0495661_0044203
1258 Ga0495661_0053604
1259 Ga0495588_0009384
1260 Ga0495588_0047982
1261 Ga0495588_0112479
1262 Ga0495623_0002460
1263 Ga0495623_0007120
1264 Ga0495646_0052317
1265 Ga0495669_0083221
1266 Ga0495669_0343256
1267 Ga0495613_0147858
1268 Ga0495624_0135552
1269 Ga0495670_0002161
1270 Ga0495670_0009471
1271 Ga0495670_0109700
1272 Ga0495670_0124583
1273 Ga0495670_0356741
1274 Ga0495670_0752563
1275 Ga0495670_0770526
1276 Ga0495671_0031930
1277 Ga0495671_0077331
1278 Ga0495671_0127779
1279 Ga0495671_0166423
1280 Ga0495649_0000095
1281 Ga0495649_0024772
1282 Ga0495649_0026855
1283 Ga0495649_0038244
1284 Ga0495649_0207266
1285 Ga0495649_0236518
1286 Ga0495649_0551568
1287 Ga0495589_0000199
1288 Ga0495589_0009466
1289 Ga0495589_0011985
1290 Ga0495589_0091139
1291 Ga0495589_0144244
1292 Ga0495660_0000023
1293 Ga0495660_0012349
1294 Ga0495660_0014970
1295 Ga0495660_0016611
1296 Ga0495660_0030975
1297 Ga0495660_0065501
1298 Ga0495660_0078488
1299 Ga0495660_0124607
1300 Ga0495660_0273895
1301 Ga0495660_0309822
1302 Ga0495604_0020713
1303 Ga0495636_0087388
1304 Ga0495674_0030209
1305 Ga0495674_1434889
1306 Ga0495672_0001614
1307 Ga0495672_0002964
1308 Ga0495672_0003304
1309 Ga0495672_0014441
1310 Ga0495672_0124754
1311 Ga0495672_0136669
1312 Ga0495672_0477763
1313 Ga0495680_0014308
1314 Ga0495680_0016640
1315 Ga0495680_0159865
1316 Ga0495683_0000604
1317 Ga0495683_0033580
1318 Ga0495683_0082720
1319 Ga0495687_057410
1320 Ga0495687_173789
1321 Ga0495675_0086816
1322 Ga0495679_001784
1323 Ga0495685_003052
1324 Ga0495685_124053
1325 Ga0495673_0000957
1326 Ga0495673_0003450
1327 Ga0495673_0005239
1328 Ga0495673_0027758
1329 Ga0495673_0073814
1330 Ga0495681_0001896
1331 Ga0495681_0009188
1332 Ga0495681_0016792
1333 Ga0495681_0027486
1334 Ga0495681_0350152
1335 Ga0495593_0000903
1336 Ga0495593_0104978
1337 Ga0495614_0077121
1338 Ga0495615_0002720
1339 Ga0495626_0000931
1340 Ga0495626_0001133
1341 Ga0495626_0002819
1342 Ga0495626_0058837
1343 Ga0495626_0126736
1344 Ga0495626_0187227
1345 Ga0495626_0369595
1346 Ga0496102_0001223
1347 Ga0496102_0073644
1348 Ga0496103_0000823
1349 Ga0496104_0000514
1350 Ga0496108_1163972
1351 Ga0496110_0115942
1352 Ga0496111_0821547
1353 Ga0496113_0814912
1354 Ga0496116_0000112
1355 Ga0496116_0001003
1356 Ga0496116_0006369
1357 Ga0496116_0011788
1358 Ga0496116_0013064
1359 Ga0496116_0015601
1360 Ga0496116_0051985
1361 Ga0496116_0058673
1362 Ga0496116_0192380
1363 Ga0496116_0273013
1364 Ga0496116_0276053
1365 Ga0496117_0004007
1366 Ga0496117_0013976
1367 Ga0496117_0067627
1368 Ga0496117_0068072
1369 Ga0496117_0083412
1370 Ga0496117_0152831
1371 Ga0496117_0170557
1372 Ga0496117_0179132
1373 Ga0496117_0265985
1374 Ga0496117_0278240
1375 Ga0496117_0369737
1376 Ga0496117_0401421
1377 Ga0496118_0002977
1378 Ga0496118_0011162
1379 Ga0496118_0035604
1380 Ga0496118_0125271
1381 Ga0496118_0153834
1382 Ga0496118_0160248
1383 Ga0496118_0165701
1384 Ga0496118_0175828
1385 Ga0496118_0201686
1386 Ga0496118_0291062
1387 Ga0496118_0311509
1388 Ga0496118_0570494
1389 Ga0496119_0000847
1390 Ga0496119_0007444
1391 Ga0496119_0014320
1392 Ga0496119_0152341
1393 Ga0496119_0269287
1394 Ga0496120_0004876
1395 Ga0496120_0041389
1396 Ga0496120_0061416
1397 Ga0496120_0133159
1398 Ga0496120_0154587
1399 Ga0496121_0000097
1400 Ga0496121_0013519
1401 Ga0496121_0034157
1402 Ga0496121_0037405
1403 Ga0496121_0077588
1404 Ga0496121_0264509
1405 Ga0496122_0000067
1406 Ga0496122_0003413
1407 Ga0496122_0038151
1408 Ga0496122_0075028
1409 Ga0496122_0112971
1410 Ga0496122_0167868
1411 Ga0496122_0214848
1412 Ga0496122_0269285
1413 Ga0496123_0000056
1414 Ga0496123_0001391
1415 Ga0496123_0007815
1416 Ga0496123_0042687
1417 Ga0496123_0073455
1418 Ga0496123_0095355
1419 Ga0496123_0208862
1420 Ga0496123_0232106
1421 Ga0496123_0366142
1422 Ga0496124_0000150
1423 Ga0496124_0000247
1424 Ga0496124_0006179
1425 Ga0496124_0008088
1426 Ga0496124_0038226
1427 Ga0496124_0061033
1428 Ga0496124_0083929
1429 Ga0496124_0084502
1430 Ga0496124_0110448
1431 Ga0496124_0139680
1432 Ga0496124_0142342
1433 Ga0496124_0230626
1434 Ga0496124_0233950
1435 Ga0496124_0443479
1436 Ga0496124_0518559
1437 Ga0496124_0835257
1438 Ga0496124_0991124
1439 Ga0496125_0000048
1440 Ga0496125_0001267
1441 Ga0496125_0005813
1442 Ga0496125_0011522
1443 Ga0496125_0016521
1444 Ga0496125_0021219
1445 Ga0496125_0092376
1446 Ga0496125_0153496
1447 Ga0496125_0197397
1448 Ga0496125_0275150
1449 Ga0496125_0286304
1450 Ga0496125_0328633
1451 Ga0496125_0624216
1452 Ga0496125_0683133
1453 Ga0496126_0050061
1454 Ga0496126_0083434
1455 Ga0496126_0145532
1456 Ga0496126_0288064
1457 Ga0496126_0462333
1458 Ga0496126_0568155
1459 Ga0496126_0742629
1460 Ga0496126_1041310
1461 Ga0495678_016179
1462 Ga0495678_029133
1463 Ga0495678_029443
1464 Ga0495678_042348
1465 Ga0495682_0065915
1466 Ga0495682_0074495
1467 Ga0495682_0299221
1468 Ga0495682_0366744
1469 Ga0501290_031375
1470 Ga0501335_015018
1471 Ga0501034_0114939
1472 Ga0501034_0244190
1473 Ga0501034_0264477
1474 Ga0501038_0140963
1475 Ga0501043_0018210
1476 Ga0501043_0381375
1477 Ga0501046_0015320
1478 Ga0501047_0672521
1479 Ga0501202_091395
1480 Ga0501206_022389
1481 Ga0501211_005242
1482 Ga0501217_289699
1483 Ga0501235_001027
1484 Ga0501236_023660
1485 Ga0501240_017619
1486 Ga0501243_107875
1487 Ga0501225_0007311
1488 Ga0501225_0291406
1489 Ga0501245_005492
1490 Ga0501264_005581
1491 Ga0501281_21911
1492 nmdc:mga03683_160815_c1
1493 nmdc:mga03683_298171_c1
1494 nmdc:mga03683_408802_c1
1495 nmdc:mga03683_476106_c1
1496 nmdc:mga03683_84215_c1
1497 nmdc:mga03n38_276812_c1
1498 nmdc:mga00v17_1066996_c1
1499 nmdc:mga00v17_199939_c1
1500 nmdc:mga00v17_853315_c1
1501 nmdc:mga00v17_917402_c1
1502 nmdc:mga00v17_918451_c1
1503 nmdc:mga00v17_923703_c1
1504 nmdc:mga07m45_393668_c1
1505 nmdc:mga08x19_1027785_c1
1506 nmdc:mga08x19_80812_c1
1507 Ga0500641_0011666
1508 Ga0500621_048640
1509 Ga0500577_0003180
1510 Ga0500616_0191680
1511 Ga0500625_002649
1512 2511254897
1513 2511302425
1514 2511341167
1515 2512328733
1516 2583789563
1517 2597855363
1518 2599364774
1519 2599371105
1520 2599377467
1521 2599381422
1522 2599388434
1523 2599396329
1524 2599408516
1525 2599463150
1526 2599492167
1527 2599950806
1528 2600215778
1529 2601775945
1530 2643951331
1531 2643956349
1532 2644021402
1533 2671109272
1534 2715750581
1535 2715760007
1536 2739261243
1537 2739314616
1538 2784264222
1539 2838737731
1540 2841841900
1541 2842141679
1542 2842846756
1543 2844667581
1544 2852657693
1545 2855022543
1546 2880233699
1547 2904477448
1548 2904555006
1549 2919153843
1550 2919489270
1551 2919681666
1552 2927147141
1553 2939575845
1554 2984292347
1555 2998142518
1556 3007616166
1557 3007721499
1558 8029998176
1559 8055088440
1560 8055096929
1561 8055771126
1562 8056126211
1563 8056158237
1564 8056168566

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05016

ParE_toxin

ParE toxin of type II toxin-antitoxin system, parDE

5

86

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fxe-assembly1.cif.gz_D-2 crystal structure of the intact e. coli relbe toxin-antitoxin complex 0.9765 3 80
4fxe-assembly1.cif.gz_E crystal structure of the intact e. coli relbe toxin-antitoxin complex 0.9666 3 83
4fxe-assembly1.cif.gz_D-2 crystal structure of the intact e. coli relbe toxin-antitoxin complex 0.9633 3 80
4v7j-assembly2.cif.gz_By structure of rele nuclease bound to the 70s ribosome (precleavage state) 0.9622 3 93
4v7k-assembly2.cif.gz_By structure of rele nuclease bound to the 70s ribosome (postcleavage state) 0.9593 3 93
ID Description Score Start End Superfamily
4fxeF00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.981 3 80 3.30.2310.20
4fxeD00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9765 3 80 3.30.2310.20
4fxeD00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9633 3 80 3.30.2310.20
4fxeF00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9569 3 80 3.30.2310.20
af_Q8VWG2_13_142_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.9011 50 80 2.120.10.80
ID Description Score Start End GO Terms
AF-A0A3S4J7T8-F1-model_v4 RelE toxin (EC 3.1.-.-) 1.008 1 65 GO:0016787
AF-A0A2H0HT33-F1-model_v4 Type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family 1.007 1 68
AF-A0A1P8EU37-F1-model_v4 deleted 1.004 1 93
AF-A0A3P1WM56-F1-model_v4 Type II toxin-antitoxin system mRNA interferase RelE 1.004 1 68
AF-A0A1V3K7R2-F1-model_v4 deleted 1.003 1 93

Map