F480592
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 782 | 327 | 1564 | 94 |
Family's Representative Sequence
| Representative Sequence | 3300002737|JGI25162J39368_1000007|JGI25162J39368_100000771 |
| Length | 94 |
| Sequence | MTYKLNFFKSALKEWKALAPTIKEQFKKKLAERLENPHVVSARLCGPKNNRYKIKLKSLGYRLVYQVEDQEIIVTVVAVGKREGNEAYKLAEKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 34 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 35 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 36 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 37 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 38 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 39 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 40 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 41 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 52 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 53 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 54 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 63 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 64 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 65 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 100 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 104 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 106 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 107 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 108 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 109 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 110 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 111 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 112 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 113 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 114 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 115 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 116 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 117 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 118 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 119 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 120 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 121 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 122 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 123 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 124 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 125 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 126 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 127 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 128 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 129 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 130 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 131 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 132 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 133 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 134 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 135 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 136 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 137 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 138 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 139 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 140 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 141 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 142 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 143 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 144 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 145 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 146 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 147 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 148 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 149 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 150 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 151 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 152 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 153 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 154 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 155 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 156 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 227 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 228 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 229 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 231 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 232 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 233 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 234 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 235 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 236 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 237 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 238 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 239 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 240 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 241 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 242 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 243 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 244 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 247 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 254 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 255 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 256 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 257 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 258 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 259 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 260 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 261 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 262 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 263 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 264 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 265 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 266 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 267 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 268 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 269 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 271 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 272 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 273 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 274 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 275 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 276 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 277 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 278 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 279 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 280 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 281 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 282 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 283 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 284 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 285 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 286 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 287 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 288 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 289 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 290 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 291 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 292 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 293 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 294 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 295 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 296 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 297 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 298 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 299 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 300 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 301 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 302 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 303 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 304 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 305 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 306 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 307 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 308 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 309 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 310 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 311 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 312 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 313 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 314 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 315 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 316 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 317 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 318 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 319 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 320 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 321 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 322 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 323 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 324 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 325 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 326 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 327 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.09 |
| Metatranscriptomes | 0.13 |
| Isolates | 6.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.95 |
| Nodule | 1.79 |
| Rhizoplane | 2.94 |
| Rhizosphere | 70.59 |
| Stem | 0 |
| Stem Tuber | 0.13 |
| Unclassified | 1.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1000007 | 3300002737 | Bacteria | 403947 |
| 2 | MRS2a_Contig_878 | 2124908027 | Bacteria | 17504 |
| 3 | SwRhRL2b_contig_942673 | 2162886007 | Bacteria | 2901 |
| 4 | MRS1b_contig_1512768 | 2162886011 | Bacteria | 979 |
| 5 | JGI24740J21852_10031135 | 3300001979 | Bacteria | 1725 |
| 6 | JGI24737J22298_10033282 | 3300001990 | Unclassified | 1602 |
| 7 | JGI24738J21930_10024949 | 3300002075 | Bacteria | 1229 |
| 8 | JGI25163J39215_1000040 | 3300002771 | Bacteria | 58616 |
| 9 | JGI25164J39214_1000016 | 3300002772 | Bacteria | 202035 |
| 10 | Ga0055538_1000006 | 3300003751 | Bacteria | 403947 |
| 11 | Ga0055539_1000010 | 3300003752 | Bacteria | 403947 |
| 12 | Ga0055533_1000013 | 3300003756 | Bacteria | 403947 |
| 13 | Ga0055525_1000015 | 3300003759 | Bacteria | 403947 |
| 14 | Ga0055536_1000145 | 3300003781 | Bacteria | 60430 |
| 15 | Ga0055536_1000200 | 3300003781 | Bacteria | 48822 |
| 16 | Ga0055534_1049140 | 3300003784 | Bacteria | 603 |
| 17 | Ga0055530_10000128 | 3300003791 | Bacteria | 66096 |
| 18 | Ga0055530_10000163 | 3300003791 | Bacteria | 60448 |
| 19 | Ga0055540_1000156 | 3300003792 | Bacteria | 67320 |
| 20 | Ga0055540_1001073 | 3300003792 | Bacteria | 17394 |
| 21 | Ga0055540_1088347 | 3300003792 | Bacteria | 587 |
| 22 | Ga0055531_10000425 | 3300003794 | Bacteria | 40017 |
| 23 | Ga0055541_1000007 | 3300003841 | Bacteria | 403947 |
| 24 | Ga0065714_10000431 | 3300005288 | Bacteria | 4997 |
| 25 | Ga0065714_10005818 | 3300005288 | Bacteria | 3631 |
| 26 | Ga0065714_10102197 | 3300005288 | Bacteria | 1627 |
| 27 | Ga0065714_10120917 | 3300005288 | Bacteria | 1350 |
| 28 | Ga0065714_10172880 | 3300005288 | Bacteria | 983 |
| 29 | Ga0065714_10218135 | 3300005288 | Bacteria | 848 |
| 30 | Ga0065714_10330062 | 3300005288 | Bacteria | 658 |
| 31 | Ga0065704_10000271 | 3300005289 | Bacteria | 42831 |
| 32 | Ga0065704_10156563 | 3300005289 | Bacteria | 1386 |
| 33 | Ga0065704_10161970 | 3300005289 | Bacteria | 1348 |
| 34 | Ga0065704_10291037 | 3300005289 | Bacteria | 903 |
| 35 | Ga0065704_10315890 | 3300005289 | Bacteria | 861 |
| 36 | Ga0065712_10182057 | 3300005290 | Bacteria | 1177 |
| 37 | Ga0065712_10652761 | 3300005290 | Bacteria | 560 |
| 38 | Ga0065715_10139364 | 3300005293 | Bacteria | 1875 |
| 39 | Ga0065707_10127222 | 3300005295 | Bacteria | 1978 |
| 40 | Ga0070680_102009700 | 3300005336 | Bacteria | 501 |
| 41 | Ga0070659_100315936 | 3300005366 | Bacteria | 1305 |
| 42 | Ga0070662_100027158 | 3300005457 | Bacteria | 3970 |
| 43 | Ga0070662_100330068 | 3300005457 | Bacteria | 1246 |
| 44 | Ga0068853_100053947 | 3300005539 | Bacteria | 3463 |
| 45 | Ga0068855_100511680 | 3300005563 | Bacteria | 1303 |
| 46 | Ga0068857_100029738 | 3300005577 | Bacteria | 4821 |
| 47 | Ga0068857_100228009 | 3300005577 | Bacteria | 1703 |
| 48 | Ga0068854_100049056 | 3300005578 | Bacteria | 3014 |
| 49 | Ga0068852_101526137 | 3300005616 | Unclassified | 690 |
| 50 | Ga0075363_100255511 | 3300006048 | Bacteria | 1010 |
| 51 | Ga0075364_10095803 | 3300006051 | Bacteria | 1973 |
| 52 | Ga0075364_10267326 | 3300006051 | Bacteria | 1163 |
| 53 | Ga0075364_10715459 | 3300006051 | Bacteria | 683 |
| 54 | Ga0075364_10741135 | 3300006051 | Bacteria | 670 |
| 55 | Ga0075364_11019993 | 3300006051 | Bacteria | 562 |
| 56 | Ga0075364_11070689 | 3300006051 | Bacteria | 548 |
| 57 | Ga0075432_10097649 | 3300006058 | Bacteria | 1082 |
| 58 | Ga0075432_10141775 | 3300006058 | Bacteria | 917 |
| 59 | Ga0075432_10206485 | 3300006058 | Bacteria | 780 |
| 60 | Ga0075432_10258756 | 3300006058 | Bacteria | 709 |
| 61 | Ga0075432_10395522 | 3300006058 | Bacteria | 595 |
| 62 | Ga0075432_10407184 | 3300006058 | Bacteria | 588 |
| 63 | Ga0075432_10560242 | 3300006058 | Bacteria | 517 |
| 64 | Ga0075362_10047340 | 3300006177 | Bacteria | 1915 |
| 65 | Ga0075362_10243354 | 3300006177 | Bacteria | 884 |
| 66 | Ga0075369_10126209 | 3300006186 | Bacteria | 1160 |
| 67 | Ga0075370_10416480 | 3300006353 | Bacteria | 807 |
| 68 | Ga0075436_100223473 | 3300006914 | Bacteria | 1336 |
| 69 | Ga0075436_100455893 | 3300006914 | Bacteria | 931 |
| 70 | Ga0075436_100474883 | 3300006914 | Bacteria | 913 |
| 71 | Ga0079104_1000290 | 3300006946 | Bacteria | 63769 |
| 72 | Ga0079104_1003915 | 3300006946 | Bacteria | 6652 |
| 73 | Ga0079104_1009332 | 3300006946 | Bacteria | 3332 |
| 74 | Ga0079104_1013375 | 3300006946 | Bacteria | 2530 |
| 75 | Ga0105251_10008384 | 3300009011 | Bacteria | 6230 |
| 76 | Ga0105251_10074727 | 3300009011 | Bacteria | 1574 |
| 77 | Ga0105251_10148544 | 3300009011 | Bacteria | 1059 |
| 78 | Ga0105251_10227935 | 3300009011 | Bacteria | 839 |
| 79 | Ga0105251_10255529 | 3300009011 | Bacteria | 790 |
| 80 | Ga0105244_10000026 | 3300009036 | Bacteria | 216056 |
| 81 | Ga0105244_10019547 | 3300009036 | Bacteria | 3778 |
| 82 | Ga0105244_10123703 | 3300009036 | Bacteria | 1251 |
| 83 | Ga0105244_10143032 | 3300009036 | Bacteria | 1149 |
| 84 | Ga0105244_10177061 | 3300009036 | Bacteria | 1013 |
| 85 | Ga0105244_10192564 | 3300009036 | Bacteria | 964 |
| 86 | Ga0105244_10205776 | 3300009036 | Bacteria | 927 |
| 87 | Ga0105244_10220761 | 3300009036 | Bacteria | 889 |
| 88 | Ga0105250_10001116 | 3300009092 | Bacteria | 15151 |
| 89 | Ga0105250_10004167 | 3300009092 | Bacteria | 6704 |
| 90 | Ga0105250_10099421 | 3300009092 | Bacteria | 1187 |
| 91 | Ga0105250_10142365 | 3300009092 | Bacteria | 994 |
| 92 | Ga0105250_10160908 | 3300009092 | Bacteria | 937 |
| 93 | Ga0105240_12485856 | 3300009093 | Bacteria | 536 |
| 94 | Ga0105243_10013201 | 3300009148 | Bacteria | 6245 |
| 95 | Ga0105243_10124879 | 3300009148 | Bacteria | 2175 |
| 96 | Ga0105243_11055168 | 3300009148 | Bacteria | 818 |
| 97 | Ga0105241_10110315 | 3300009174 | Bacteria | 2201 |
| 98 | Ga0105242_10015438 | 3300009176 | Bacteria | 5931 |
| 99 | Ga0105242_11491208 | 3300009176 | Bacteria | 707 |
| 100 | Ga0105248_10102693 | 3300009177 | Bacteria | 3222 |
| 101 | Ga0105238_10311764 | 3300009551 | Unclassified | 1558 |
| 102 | Ga0105238_10337113 | 3300009551 | Bacteria | 1495 |
| 103 | Ga0105239_11041604 | 3300010375 | Bacteria | 941 |
| 104 | Ga0157336_1001858 | 3300012477 | Bacteria | 1140 |
| 105 | Ga0157345_1001192 | 3300012498 | Bacteria | 1858 |
| 106 | Ga0157347_1011896 | 3300012502 | Bacteria | 931 |
| 107 | Ga0157339_1013620 | 3300012505 | Bacteria | 780 |
| 108 | Ga0157373_10016444 | 3300013100 | Bacteria | 5396 |
| 109 | Ga0157373_10165428 | 3300013100 | Bacteria | 1557 |
| 110 | Ga0157373_10479049 | 3300013100 | Bacteria | 898 |
| 111 | Ga0157373_10498403 | 3300013100 | Bacteria | 880 |
| 112 | Ga0157371_10000044 | 3300013102 | Bacteria | 194689 |
| 113 | Ga0157371_10001383 | 3300013102 | Bacteria | 25425 |
| 114 | Ga0157371_10010204 | 3300013102 | Bacteria | 7335 |
| 115 | Ga0157371_10051292 | 3300013102 | Bacteria | 2932 |
| 116 | Ga0157371_10067811 | 3300013102 | Bacteria | 2525 |
| 117 | Ga0157371_10267965 | 3300013102 | Bacteria | 1232 |
| 118 | Ga0157371_10432678 | 3300013102 | Bacteria | 966 |
| 119 | Ga0157371_11318332 | 3300013102 | Bacteria | 559 |
| 120 | Ga0157370_10021828 | 3300013104 | Bacteria | 6377 |
| 121 | Ga0157370_10085874 | 3300013104 | Bacteria | 2956 |
| 122 | Ga0157370_10210362 | 3300013104 | Bacteria | 1803 |
| 123 | Ga0157370_10293730 | 3300013104 | Bacteria | 1501 |
| 124 | Ga0157370_10636892 | 3300013104 | Bacteria | 975 |
| 125 | Ga0157370_11737983 | 3300013104 | Bacteria | 560 |
| 126 | Ga0157369_10007905 | 3300013105 | Bacteria | 12228 |
| 127 | Ga0157369_10078453 | 3300013105 | Bacteria | 3538 |
| 128 | Ga0157369_10397493 | 3300013105 | Bacteria | 1430 |
| 129 | Ga0163162_10010387 | 3300013306 | Bacteria | 9049 |
| 130 | Ga0163162_10582585 | 3300013306 | Bacteria | 1246 |
| 131 | Ga0163162_11280742 | 3300013306 | Bacteria | 833 |
| 132 | Ga0163162_11375294 | 3300013306 | Bacteria | 803 |
| 133 | Ga0163162_11583479 | 3300013306 | Bacteria | 747 |
| 134 | Ga0157372_10000453 | 3300013307 | Bacteria | 45046 |
| 135 | Ga0157372_10025185 | 3300013307 | Bacteria | 6467 |
| 136 | Ga0157375_10666823 | 3300013308 | Bacteria | 1195 |
| 137 | Ga0157375_10810817 | 3300013308 | Bacteria | 1084 |
| 138 | Ga0182008_10000238 | 3300014497 | Bacteria | 42638 |
| 139 | Ga0182008_10016432 | 3300014497 | Bacteria | 3845 |
| 140 | Ga0182008_10032643 | 3300014497 | Bacteria | 2614 |
| 141 | Ga0182008_10130828 | 3300014497 | Bacteria | 1251 |
| 142 | Ga0182008_10144922 | 3300014497 | Bacteria | 1189 |
| 143 | Ga0182006_1013786 | 3300015261 | Bacteria | 3497 |
| 144 | Ga0182006_1073962 | 3300015261 | Bacteria | 1257 |
| 145 | Ga0182007_10072698 | 3300015262 | Bacteria | 1126 |
| 146 | Ga0182007_10240575 | 3300015262 | Bacteria | 646 |
| 147 | Ga0182005_1041845 | 3300015265 | Bacteria | 1246 |
| 148 | Ga0182005_1070302 | 3300015265 | Bacteria | 961 |
| 149 | Ga0182005_1086315 | 3300015265 | Bacteria | 870 |
| 150 | Ga0163161_10175584 | 3300017792 | Bacteria | 1640 |
| 151 | Ga0163161_10327370 | 3300017792 | Bacteria | 1213 |
| 152 | Ga0163161_10489217 | 3300017792 | Bacteria | 1000 |
| 153 | Ga0163161_10510030 | 3300017792 | Bacteria | 981 |
| 154 | Ga0163161_10701669 | 3300017792 | Bacteria | 842 |
| 155 | Ga0163161_10702948 | 3300017792 | Bacteria | 842 |
| 156 | Ga0163161_11476642 | 3300017792 | Bacteria | 596 |
| 157 | Ga0163161_11730898 | 3300017792 | Bacteria | 554 |
| 158 | Ga0209760_100034 | 3300025207 | Bacteria | 135933 |
| 159 | Ga0209784_100022 | 3300025224 | Bacteria | 403999 |
| 160 | Ga0209566_100021 | 3300025225 | Bacteria | 403999 |
| 161 | Ga0209674_100038 | 3300025226 | Bacteria | 403999 |
| 162 | Ga0209563_100042 | 3300025230 | Bacteria | 403999 |
| 163 | Ga0207427_100027 | 3300025231 | Bacteria | 403999 |
| 164 | Ga0209437_100049 | 3300025233 | Bacteria | 403999 |
| 165 | Ga0209677_100025 | 3300025253 | Bacteria | 403999 |
| 166 | Ga0209233_1003281 | 3300025261 | Bacteria | 5737 |
| 167 | Ga0209130_1031380 | 3300025284 | Bacteria | 1090 |
| 168 | Ga0209675_1010416 | 3300025291 | Bacteria | 3177 |
| 169 | Ga0209676_1000020 | 3300025292 | Bacteria | 617256 |
| 170 | Ga0209676_1000032 | 3300025292 | Bacteria | 469558 |
| 171 | Ga0209676_1000408 | 3300025292 | Bacteria | 77177 |
| 172 | Ga0209676_1006111 | 3300025292 | Bacteria | 6045 |
| 173 | Ga0209050_1000025 | 3300025298 | Bacteria | 528225 |
| 174 | Ga0209050_1000099 | 3300025298 | Bacteria | 232176 |
| 175 | Ga0209050_1001082 | 3300025298 | Bacteria | 33254 |
| 176 | Ga0209051_1000026 | 3300025303 | Bacteria | 413311 |
| 177 | Ga0209051_1000039 | 3300025303 | Bacteria | 319632 |
| 178 | Ga0209051_1000047 | 3300025303 | Bacteria | 293227 |
| 179 | Ga0209051_1024322 | 3300025303 | Bacteria | 2493 |
| 180 | Ga0209257_1000034 | 3300025304 | Bacteria | 662719 |
| 181 | Ga0209257_1111975 | 3300025304 | Bacteria | 650 |
| 182 | Ga0207696_1000002 | 3300025711 | Bacteria | 1098043 |
| 183 | Ga0207696_1000642 | 3300025711 | Bacteria | 25299 |
| 184 | Ga0207696_1020208 | 3300025711 | Bacteria | 2153 |
| 185 | Ga0207696_1053664 | 3300025711 | Bacteria | 1147 |
| 186 | Ga0207655_1000057 | 3300025728 | Bacteria | 273598 |
| 187 | Ga0207655_1000560 | 3300025728 | Bacteria | 46369 |
| 188 | Ga0207655_1012867 | 3300025728 | Bacteria | 4847 |
| 189 | Ga0207655_1018585 | 3300025728 | Bacteria | 3678 |
| 190 | Ga0207655_1087344 | 3300025728 | Bacteria | 1107 |
| 191 | Ga0207655_1088890 | 3300025728 | Bacteria | 1092 |
| 192 | Ga0207655_1098508 | 3300025728 | Bacteria | 1012 |
| 193 | Ga0207655_1117921 | 3300025728 | Bacteria | 885 |
| 194 | Ga0207655_1122063 | 3300025728 | Bacteria | 862 |
| 195 | Ga0207655_1200550 | 3300025728 | Bacteria | 596 |
| 196 | Ga0207713_1000573 | 3300025735 | Bacteria | 36512 |
| 197 | Ga0207713_1004368 | 3300025735 | Bacteria | 9184 |
| 198 | Ga0207713_1006126 | 3300025735 | Bacteria | 7392 |
| 199 | Ga0207713_1006127 | 3300025735 | Bacteria | 7392 |
| 200 | Ga0207713_1008055 | 3300025735 | Bacteria | 6119 |
| 201 | Ga0207713_1020172 | 3300025735 | Bacteria | 3238 |
| 202 | Ga0207713_1031210 | 3300025735 | Bacteria | 2359 |
| 203 | Ga0207713_1069000 | 3300025735 | Bacteria | 1311 |
| 204 | Ga0207647_10175276 | 3300025904 | Bacteria | 1248 |
| 205 | Ga0207654_10332309 | 3300025911 | Bacteria | 1042 |
| 206 | Ga0207694_10104047 | 3300025924 | Bacteria | 2252 |
| 207 | Ga0207650_10000185 | 3300025925 | Bacteria | 72385 |
| 208 | Ga0207644_10548985 | 3300025931 | Bacteria | 956 |
| 209 | Ga0207690_10261516 | 3300025932 | Bacteria | 1341 |
| 210 | Ga0207706_10176427 | 3300025933 | Bacteria | 1877 |
| 211 | Ga0207706_10399000 | 3300025933 | Bacteria | 1192 |
| 212 | Ga0207686_10571208 | 3300025934 | Bacteria | 886 |
| 213 | Ga0207709_10940985 | 3300025935 | Bacteria | 704 |
| 214 | Ga0207709_11138580 | 3300025935 | Bacteria | 642 |
| 215 | Ga0207668_10773876 | 3300025972 | Bacteria | 848 |
| 216 | Ga0207640_10040953 | 3300025981 | Bacteria | 2943 |
| 217 | Ga0207639_10017627 | 3300026041 | Bacteria | 5063 |
| 218 | Ga0207674_10000029 | 3300026116 | Bacteria | 145730 |
| 219 | Ga0207674_10025912 | 3300026116 | Bacteria | 6241 |
| 220 | Ga0207674_10233715 | 3300026116 | Bacteria | 1786 |
| 221 | Ga0207698_10178607 | 3300026142 | Unclassified | 1878 |
| 222 | Ga0209281_1000026 | 3300027111 | Bacteria | 465877 |
| 223 | Ga0209281_1000614 | 3300027111 | Bacteria | 40136 |
| 224 | Ga0209281_1003496 | 3300027111 | Bacteria | 5164 |
| 225 | Ga0209281_1005509 | 3300027111 | Bacteria | 3499 |
| 226 | Ga0209371_1000014 | 3300027312 | Bacteria | 661118 |
| 227 | Ga0209983_1026045 | 3300027665 | Bacteria | 1236 |
| 228 | Ga0209974_10126046 | 3300027876 | Bacteria | 910 |
| 229 | Ga0207428_10069990 | 3300027907 | Bacteria | 2759 |
| 230 | Ga0207428_10407641 | 3300027907 | Bacteria | 995 |
| 231 | Ga0207428_10454500 | 3300027907 | Bacteria | 933 |
| 232 | Ga0207428_10505325 | 3300027907 | Bacteria | 878 |
| 233 | Ga0207428_10815099 | 3300027907 | Bacteria | 663 |
| 234 | Ga0268266_10106882 | 3300028379 | Bacteria | 2474 |
| 235 | Ga0268266_10254151 | 3300028379 | Bacteria | 1626 |
| 236 | Ga0268256_1000021 | 3300030500 | Bacteria | 542735 |
| 237 | Ga0268256_1010279 | 3300030500 | Bacteria | 3043 |
| 238 | Ga0316178_1142514 | 3300030735 | Bacteria | 13262 |
| 239 | Ga0307408_100009196 | 3300031548 | Bacteria | 6515 |
| 240 | Ga0307408_100273538 | 3300031548 | Unclassified | 1403 |
| 241 | Ga0307408_100677396 | 3300031548 | Bacteria | 925 |
| 242 | Ga0316579_10212966 | 3300031691 | Bacteria | 934 |
| 243 | Ga0316579_10521807 | 3300031691 | Unclassified | 575 |
| 244 | Ga0307405_10108814 | 3300031731 | Bacteria | 1873 |
| 245 | Ga0307405_10182115 | 3300031731 | Bacteria | 1509 |
| 246 | Ga0307405_10310489 | 3300031731 | Bacteria | 1200 |
| 247 | Ga0307405_10331974 | 3300031731 | Bacteria | 1166 |
| 248 | Ga0307405_10828258 | 3300031731 | Unclassified | 777 |
| 249 | Ga0307410_10308877 | 3300031852 | Bacteria | 1250 |
| 250 | Ga0307406_10267357 | 3300031901 | Bacteria | 1297 |
| 251 | Ga0307412_10164900 | 3300031911 | Bacteria | 1651 |
| 252 | Ga0307412_10213799 | 3300031911 | Bacteria | 1473 |
| 253 | Ga0307412_10319033 | 3300031911 | Bacteria | 1235 |
| 254 | Ga0307416_100281173 | 3300032002 | Bacteria | 1641 |
| 255 | Ga0307416_102284124 | 3300032002 | Bacteria | 641 |
| 256 | Ga0307411_10114545 | 3300032005 | Bacteria | 1937 |
| 257 | Ga0307411_10347662 | 3300032005 | Bacteria | 1207 |
| 258 | Ga0307415_101443879 | 3300032126 | Bacteria | 656 |
| 259 | Ga0395899_0217634 | 3300037312 | Bacteria | 1324 |
| 260 | Ga0395900_0002169 | 3300037418 | Bacteria | 21931 |
| 261 | Ga0395900_0071831 | 3300037418 | Bacteria | 3558 |
| 262 | Ga0395898_0072438 | 3300037466 | Bacteria | 3329 |
| 263 | Ga0436361_1058773 | 3300039447 | Bacteria | 5025 |
| 264 | Ga0439438_001153 | 3300041405 | Bacteria | 11736 |
| 265 | Ga0439438_033200 | 3300041405 | Bacteria | 1364 |
| 266 | Ga0439447_000379 | 3300041407 | Bacteria | 16202 |
| 267 | Ga0439447_000776 | 3300041407 | Bacteria | 11711 |
| 268 | Ga0439447_003341 | 3300041407 | Bacteria | 5707 |
| 269 | Ga0439447_035093 | 3300041407 | Bacteria | 1244 |
| 270 | Ga0439466_0000176 | 3300041411 | Bacteria | 25636 |
| 271 | Ga0439466_0008485 | 3300041411 | Bacteria | 3872 |
| 272 | Ga0439466_0020842 | 3300041411 | Bacteria | 2331 |
| 273 | Ga0439466_0030233 | 3300041411 | Bacteria | 1859 |
| 274 | Ga0439466_0064278 | 3300041411 | Bacteria | 1176 |
| 275 | Ga0439466_0130211 | 3300041411 | Bacteria | 774 |
| 276 | Ga0451807_0901309 | 3300041486 | Bacteria | 759 |
| 277 | Ga0451807_0911490 | 3300041486 | Bacteria | 662 |
| 278 | Ga0439432_002585 | 3300042006 | Bacteria | 6813 |
| 279 | Ga0439432_023994 | 3300042006 | Bacteria | 2005 |
| 280 | Ga0439432_058951 | 3300042006 | Bacteria | 1186 |
| 281 | Ga0439432_093155 | 3300042006 | Bacteria | 905 |
| 282 | Ga0439451_022878 | 3300042009 | Bacteria | 1259 |
| 283 | Ga0439451_059161 | 3300042009 | Bacteria | 766 |
| 284 | Ga0439452_000005 | 3300042010 | Bacteria | 646919 |
| 285 | Ga0439452_000229 | 3300042010 | Bacteria | 39029 |
| 286 | Ga0439452_048552 | 3300042010 | Bacteria | 978 |
| 287 | Ga0439456_001064 | 3300042013 | Bacteria | 5468 |
| 288 | Ga0439456_001435 | 3300042013 | Bacteria | 4789 |
| 289 | Ga0439456_002068 | 3300042013 | Bacteria | 4040 |
| 290 | Ga0439456_005338 | 3300042013 | Bacteria | 2604 |
| 291 | Ga0439456_007928 | 3300042013 | Bacteria | 2188 |
| 292 | Ga0439456_008553 | 3300042013 | Bacteria | 2114 |
| 293 | Ga0439456_014786 | 3300042013 | Bacteria | 1627 |
| 294 | Ga0439463_000558 | 3300042016 | Bacteria | 10418 |
| 295 | Ga0439463_001147 | 3300042016 | Bacteria | 7098 |
| 296 | Ga0439463_125649 | 3300042016 | Bacteria | 663 |
| 297 | Ga0450911_000290 | 3300042115 | Bacteria | 18460 |
| 298 | Ga0450911_000924 | 3300042115 | Bacteria | 7774 |
| 299 | Ga0450911_006040 | 3300042115 | Bacteria | 1828 |
| 300 | Ga0450919_004043 | 3300042121 | Bacteria | 1802 |
| 301 | Ga0450920_002881 | 3300042122 | Bacteria | 2958 |
| 302 | Ga0450922_000391 | 3300042124 | Bacteria | 4703 |
| 303 | Ga0450923_011486 | 3300042125 | Bacteria | 1592 |
| 304 | Ga0450900_016097 | 3300042136 | Bacteria | 1010 |
| 305 | Ga0450902_001758 | 3300042137 | Bacteria | 2990 |
| 306 | Ga0450902_032425 | 3300042137 | Bacteria | 881 |
| 307 | Ga0450902_044893 | 3300042137 | Bacteria | 754 |
| 308 | Ga0450903_000904 | 3300042138 | Bacteria | 5702 |
| 309 | Ga0450903_025431 | 3300042138 | Bacteria | 905 |
| 310 | Ga0450904_004135 | 3300042139 | Bacteria | 1521 |
| 311 | Ga0450905_024695 | 3300042142 | Bacteria | 901 |
| 312 | Ga0450906_001755 | 3300042145 | Bacteria | 4746 |
| 313 | Ga0450906_003379 | 3300042145 | Bacteria | 3434 |
| 314 | Ga0450907_000020 | 3300042146 | Bacteria | 75915 |
| 315 | Ga0450907_000681 | 3300042146 | Bacteria | 8821 |
| 316 | Ga0450910_005521 | 3300042147 | Bacteria | 1726 |
| 317 | Ga0450910_022646 | 3300042147 | Bacteria | 957 |
| 318 | Ga0439446_0064545 | 3300042156 | Bacteria | 1111 |
| 319 | Ga0450908_087622 | 3300042184 | Bacteria | 562 |
| 320 | Ga0450909_000635 | 3300042185 | Bacteria | 4635 |
| 321 | Ga0450909_012929 | 3300042185 | Bacteria | 1225 |
| 322 | Ga0439434_0000018 | 3300042435 | Bacteria | 42785 |
| 323 | Ga0439464_0293630 | 3300042439 | Bacteria | 530 |
| 324 | Ga0439460_0000545 | 3300042461 | Bacteria | 8252 |
| 325 | Ga0439460_0002133 | 3300042461 | Bacteria | 4744 |
| 326 | Ga0450918_021625 | 3300042531 | Bacteria | 1123 |
| 327 | Ga0450893_0010920 | 3300042532 | Bacteria | 1496 |
| 328 | Ga0451577_0000239 | 3300042876 | Bacteria | 108628 |
| 329 | Ga0451577_0348022 | 3300042876 | Unclassified | 1344 |
| 330 | Ga0439440_0000422 | 3300042993 | Bacteria | 7062 |
| 331 | Ga0466969_0006571 | 3300044656 | Bacteria | 6180 |
| 332 | Ga0453683_0640014 | 3300044673 | Bacteria | 695 |
| 333 | Ga0453683_0952108 | 3300044673 | Bacteria | 569 |
| 334 | Ga0453684_0001090 | 3300044712 | Bacteria | 85790 |
| 335 | Ga0453684_0021005 | 3300044712 | Bacteria | 9789 |
| 336 | Ga0453684_0190791 | 3300044712 | Bacteria | 2397 |
| 337 | Ga0453684_0212099 | 3300044712 | Bacteria | 2250 |
| 338 | Ga0451576_1319323 | 3300045051 | Unclassified | 752 |
| 339 | Ga0451576_1654857 | 3300045051 | Unclassified | 663 |
| 340 | Ga0495617_000608 | 3300046452 | Bacteria | 17996 |
| 341 | Ga0495617_006994 | 3300046452 | Bacteria | 3933 |
| 342 | Ga0495617_013490 | 3300046452 | Bacteria | 2781 |
| 343 | Ga0495617_013625 | 3300046452 | Bacteria | 2766 |
| 344 | Ga0495617_119463 | 3300046452 | Bacteria | 849 |
| 345 | Ga0495627_001586 | 3300046453 | Bacteria | 12824 |
| 346 | Ga0495627_011878 | 3300046453 | Bacteria | 3107 |
| 347 | Ga0495627_015823 | 3300046453 | Bacteria | 2598 |
| 348 | Ga0495627_088122 | 3300046453 | Bacteria | 894 |
| 349 | Ga0495603_0001348 | 3300046455 | Bacteria | 14264 |
| 350 | Ga0495603_0030679 | 3300046455 | Bacteria | 3237 |
| 351 | Ga0495603_0693215 | 3300046455 | Bacteria | 582 |
| 352 | Ga0495590_0000615 | 3300046457 | Bacteria | 16615 |
| 353 | Ga0495590_0086300 | 3300046457 | Bacteria | 1108 |
| 354 | Ga0495591_002305 | 3300046458 | Bacteria | 10797 |
| 355 | Ga0495591_007492 | 3300046458 | Bacteria | 4633 |
| 356 | Ga0495591_013020 | 3300046458 | Bacteria | 3065 |
| 357 | Ga0495638_0002132 | 3300046460 | Bacteria | 16635 |
| 358 | Ga0495638_0008667 | 3300046460 | Bacteria | 7195 |
| 359 | Ga0495653_0570250 | 3300046463 | Bacteria | 698 |
| 360 | Ga0495650_0000039 | 3300046471 | Bacteria | 375501 |
| 361 | Ga0495650_0002587 | 3300046471 | Bacteria | 14248 |
| 362 | Ga0495650_0106470 | 3300046471 | Bacteria | 1046 |
| 363 | Ga0495605_0000530 | 3300046474 | Bacteria | 32164 |
| 364 | Ga0495605_0000758 | 3300046474 | Bacteria | 23640 |
| 365 | Ga0495605_0010780 | 3300046474 | Bacteria | 5108 |
| 366 | Ga0495605_0226505 | 3300046474 | Bacteria | 806 |
| 367 | Ga0495639_0039981 | 3300046475 | Bacteria | 2109 |
| 368 | Ga0495639_0070435 | 3300046475 | Bacteria | 1615 |
| 369 | Ga0495639_0090588 | 3300046475 | Bacteria | 1434 |
| 370 | Ga0495639_0333060 | 3300046475 | Bacteria | 760 |
| 371 | Ga0495584_0000787 | 3300046491 | Bacteria | 20916 |
| 372 | Ga0495584_0002815 | 3300046491 | Bacteria | 9708 |
| 373 | Ga0495584_0028177 | 3300046491 | Bacteria | 2845 |
| 374 | Ga0495584_0115361 | 3300046491 | Bacteria | 1359 |
| 375 | Ga0495584_0347430 | 3300046491 | Bacteria | 753 |
| 376 | Ga0495585_0016673 | 3300046492 | Bacteria | 4255 |
| 377 | Ga0495585_0117335 | 3300046492 | Bacteria | 1410 |
| 378 | Ga0495585_0226186 | 3300046492 | Bacteria | 942 |
| 379 | Ga0495585_0274479 | 3300046492 | Bacteria | 835 |
| 380 | Ga0495594_0016477 | 3300046499 | Bacteria | 3893 |
| 381 | Ga0495596_0022058 | 3300046500 | Bacteria | 2594 |
| 382 | Ga0495607_0010999 | 3300046501 | Bacteria | 6048 |
| 383 | Ga0495607_0040897 | 3300046501 | Bacteria | 2756 |
| 384 | Ga0495607_0147481 | 3300046501 | Bacteria | 1207 |
| 385 | Ga0495607_0193517 | 3300046501 | Bacteria | 1011 |
| 386 | Ga0495607_0520267 | 3300046501 | Bacteria | 525 |
| 387 | Ga0495583_0001511 | 3300046506 | Bacteria | 23143 |
| 388 | Ga0495583_0040852 | 3300046506 | Bacteria | 2176 |
| 389 | Ga0495583_0087514 | 3300046506 | Bacteria | 1345 |
| 390 | Ga0495606_0006414 | 3300046507 | Bacteria | 10855 |
| 391 | Ga0495606_0009270 | 3300046507 | Bacteria | 8352 |
| 392 | Ga0495606_0091273 | 3300046507 | Bacteria | 1873 |
| 393 | Ga0495606_0156493 | 3300046507 | Bacteria | 1333 |
| 394 | Ga0495610_0003477 | 3300046512 | Bacteria | 12259 |
| 395 | Ga0495610_0008115 | 3300046512 | Bacteria | 6862 |
| 396 | Ga0495610_0009185 | 3300046512 | Bacteria | 6275 |
| 397 | Ga0495610_0023023 | 3300046512 | Bacteria | 3393 |
| 398 | Ga0495610_0035494 | 3300046512 | Bacteria | 2559 |
| 399 | Ga0495610_0060740 | 3300046512 | Bacteria | 1798 |
| 400 | Ga0495610_0101103 | 3300046512 | Bacteria | 1291 |
| 401 | Ga0495616_0001725 | 3300046513 | Bacteria | 14898 |
| 402 | Ga0495616_0006195 | 3300046513 | Bacteria | 7277 |
| 403 | Ga0495616_0107817 | 3300046513 | Bacteria | 1297 |
| 404 | Ga0495620_0002386 | 3300046515 | Bacteria | 10888 |
| 405 | Ga0495620_0002590 | 3300046515 | Bacteria | 10459 |
| 406 | Ga0495620_0257161 | 3300046515 | Bacteria | 665 |
| 407 | Ga0495628_0211855 | 3300046516 | Bacteria | 1457 |
| 408 | Ga0495630_0000091 | 3300046517 | Bacteria | 71198 |
| 409 | Ga0495630_0680147 | 3300046517 | Bacteria | 787 |
| 410 | Ga0495631_0001404 | 3300046518 | Bacteria | 14638 |
| 411 | Ga0495631_0019053 | 3300046518 | Bacteria | 3223 |
| 412 | Ga0495631_0398065 | 3300046518 | Bacteria | 586 |
| 413 | Ga0495632_0000312 | 3300046519 | Bacteria | 47020 |
| 414 | Ga0495632_0044876 | 3300046519 | Bacteria | 2204 |
| 415 | Ga0495632_0069013 | 3300046519 | Bacteria | 1702 |
| 416 | Ga0495632_0072070 | 3300046519 | Bacteria | 1658 |
| 417 | Ga0495632_0198472 | 3300046519 | Bacteria | 914 |
| 418 | Ga0495637_0001838 | 3300046520 | Bacteria | 12150 |
| 419 | Ga0495637_0007664 | 3300046520 | Bacteria | 5340 |
| 420 | Ga0495637_0009153 | 3300046520 | Bacteria | 4836 |
| 421 | Ga0495637_0017794 | 3300046520 | Bacteria | 3303 |
| 422 | Ga0495637_0024007 | 3300046520 | Bacteria | 2760 |
| 423 | Ga0495643_0003399 | 3300046522 | Bacteria | 11696 |
| 424 | Ga0495643_0084848 | 3300046522 | Bacteria | 1643 |
| 425 | Ga0495644_0021319 | 3300046523 | Bacteria | 2472 |
| 426 | Ga0495644_0441361 | 3300046523 | Bacteria | 517 |
| 427 | Ga0495648_0002010 | 3300046524 | Bacteria | 19274 |
| 428 | Ga0495648_0010271 | 3300046524 | Bacteria | 7148 |
| 429 | Ga0495648_0025513 | 3300046524 | Bacteria | 3999 |
| 430 | Ga0495648_0033204 | 3300046524 | Bacteria | 3374 |
| 431 | Ga0495648_0086748 | 3300046524 | Bacteria | 1764 |
| 432 | Ga0495648_0483567 | 3300046524 | Bacteria | 534 |
| 433 | Ga0495666_0002069 | 3300046526 | Bacteria | 9937 |
| 434 | Ga0495666_0004705 | 3300046526 | Bacteria | 6902 |
| 435 | Ga0495666_0203230 | 3300046526 | Bacteria | 910 |
| 436 | Ga0495666_0574002 | 3300046526 | Bacteria | 502 |
| 437 | Ga0495642_0000231 | 3300046528 | Bacteria | 31949 |
| 438 | Ga0495642_0007466 | 3300046528 | Bacteria | 4188 |
| 439 | Ga0495654_0002895 | 3300046530 | Bacteria | 10758 |
| 440 | Ga0495654_0004614 | 3300046530 | Bacteria | 8133 |
| 441 | Ga0495654_0007837 | 3300046530 | Bacteria | 5938 |
| 442 | Ga0495654_0011817 | 3300046530 | Bacteria | 4712 |
| 443 | Ga0495654_0015690 | 3300046530 | Bacteria | 4020 |
| 444 | Ga0495654_0017619 | 3300046530 | Bacteria | 3750 |
| 445 | Ga0495654_0433818 | 3300046530 | Bacteria | 518 |
| 446 | Ga0495665_0131052 | 3300046531 | Bacteria | 1312 |
| 447 | Ga0495598_0044642 | 3300046537 | Bacteria | 1310 |
| 448 | Ga0495609_0004699 | 3300046538 | Bacteria | 7392 |
| 449 | Ga0495609_0007646 | 3300046538 | Bacteria | 5370 |
| 450 | Ga0495609_0158782 | 3300046538 | Bacteria | 959 |
| 451 | Ga0495609_0160730 | 3300046538 | Bacteria | 952 |
| 452 | Ga0495609_0200777 | 3300046538 | Bacteria | 833 |
| 453 | Ga0495609_0231846 | 3300046538 | Bacteria | 764 |
| 454 | Ga0495597_0016354 | 3300046542 | Bacteria | 3502 |
| 455 | Ga0495597_0050948 | 3300046542 | Bacteria | 1826 |
| 456 | Ga0495597_0099047 | 3300046542 | Bacteria | 1231 |
| 457 | Ga0495597_0187926 | 3300046542 | Bacteria | 832 |
| 458 | Ga0495622_0010557 | 3300046557 | Bacteria | 4264 |
| 459 | Ga0495622_0092064 | 3300046557 | Bacteria | 1392 |
| 460 | Ga0495622_0120410 | 3300046557 | Bacteria | 1198 |
| 461 | Ga0495622_0402770 | 3300046557 | Bacteria | 589 |
| 462 | Ga0495633_0007110 | 3300046558 | Bacteria | 6504 |
| 463 | Ga0495633_0077315 | 3300046558 | Bacteria | 1550 |
| 464 | Ga0495633_0087462 | 3300046558 | Bacteria | 1449 |
| 465 | Ga0495668_0010717 | 3300046616 | Bacteria | 5536 |
| 466 | Ga0495634_0001289 | 3300046642 | Bacteria | 22945 |
| 467 | Ga0495611_0015723 | 3300046648 | Bacteria | 3233 |
| 468 | Ga0495625_0005424 | 3300046660 | Bacteria | 11641 |
| 469 | Ga0495625_0009016 | 3300046660 | Bacteria | 8425 |
| 470 | Ga0495625_0011860 | 3300046660 | Bacteria | 7078 |
| 471 | Ga0495625_0041834 | 3300046660 | Bacteria | 3333 |
| 472 | Ga0495659_0089481 | 3300046664 | Bacteria | 1180 |
| 473 | Ga0495659_0123236 | 3300046664 | Bacteria | 1022 |
| 474 | Ga0495661_0011981 | 3300046665 | Bacteria | 5868 |
| 475 | Ga0495661_0044203 | 3300046665 | Bacteria | 2732 |
| 476 | Ga0495661_0053604 | 3300046665 | Bacteria | 2424 |
| 477 | Ga0495588_0009384 | 3300046674 | Bacteria | 4520 |
| 478 | Ga0495588_0047982 | 3300046674 | Bacteria | 2193 |
| 479 | Ga0495588_0112479 | 3300046674 | Bacteria | 1434 |
| 480 | Ga0495623_0002460 | 3300046679 | Bacteria | 12290 |
| 481 | Ga0495623_0007120 | 3300046679 | Bacteria | 7264 |
| 482 | Ga0495646_0052317 | 3300046680 | Bacteria | 2467 |
| 483 | Ga0495669_0083221 | 3300046684 | Bacteria | 1470 |
| 484 | Ga0495669_0343256 | 3300046684 | Bacteria | 722 |
| 485 | Ga0495613_0147858 | 3300046689 | Bacteria | 1676 |
| 486 | Ga0495624_0135552 | 3300046690 | Bacteria | 1509 |
| 487 | Ga0495670_0002161 | 3300046691 | Bacteria | 9721 |
| 488 | Ga0495670_0009471 | 3300046691 | Bacteria | 4787 |
| 489 | Ga0495670_0109700 | 3300046691 | Bacteria | 1427 |
| 490 | Ga0495670_0124583 | 3300046691 | Bacteria | 1340 |
| 491 | Ga0495670_0356741 | 3300046691 | Bacteria | 787 |
| 492 | Ga0495670_0752563 | 3300046691 | Bacteria | 531 |
| 493 | Ga0495670_0770526 | 3300046691 | Unclassified | 525 |
| 494 | Ga0495671_0031930 | 3300046692 | Bacteria | 2690 |
| 495 | Ga0495671_0077331 | 3300046692 | Bacteria | 1631 |
| 496 | Ga0495671_0127779 | 3300046692 | Bacteria | 1239 |
| 497 | Ga0495671_0166423 | 3300046692 | Bacteria | 1072 |
| 498 | Ga0495649_0000095 | 3300046694 | Bacteria | 76587 |
| 499 | Ga0495649_0024772 | 3300046694 | Bacteria | 3345 |
| 500 | Ga0495649_0026855 | 3300046694 | Bacteria | 3197 |
| 501 | Ga0495649_0038244 | 3300046694 | Bacteria | 2633 |
| 502 | Ga0495649_0207266 | 3300046694 | Bacteria | 1016 |
| 503 | Ga0495649_0236518 | 3300046694 | Bacteria | 941 |
| 504 | Ga0495649_0551568 | 3300046694 | Bacteria | 570 |
| 505 | Ga0495589_0000199 | 3300046794 | Bacteria | 52067 |
| 506 | Ga0495589_0009466 | 3300046794 | Bacteria | 5067 |
| 507 | Ga0495589_0011985 | 3300046794 | Bacteria | 4494 |
| 508 | Ga0495589_0091139 | 3300046794 | Bacteria | 1480 |
| 509 | Ga0495589_0144244 | 3300046794 | Bacteria | 1139 |
| 510 | Ga0495660_0000023 | 3300046810 | Bacteria | 272605 |
| 511 | Ga0495660_0012349 | 3300046810 | Bacteria | 4956 |
| 512 | Ga0495660_0014970 | 3300046810 | Bacteria | 4484 |
| 513 | Ga0495660_0016611 | 3300046810 | Bacteria | 4243 |
| 514 | Ga0495660_0030975 | 3300046810 | Bacteria | 3010 |
| 515 | Ga0495660_0065501 | 3300046810 | Bacteria | 1939 |
| 516 | Ga0495660_0078488 | 3300046810 | Bacteria | 1735 |
| 517 | Ga0495660_0124607 | 3300046810 | Bacteria | 1299 |
| 518 | Ga0495660_0273895 | 3300046810 | Bacteria | 774 |
| 519 | Ga0495660_0309822 | 3300046810 | Bacteria | 712 |
| 520 | Ga0495604_0020713 | 3300047317 | Bacteria | 5250 |
| 521 | Ga0495636_0087388 | 3300047318 | Bacteria | 1349 |
| 522 | Ga0495674_0030209 | 3300047319 | Bacteria | 4929 |
| 523 | Ga0495674_1434889 | 3300047319 | Bacteria | 513 |
| 524 | Ga0495672_0001614 | 3300047320 | Bacteria | 22014 |
| 525 | Ga0495672_0002964 | 3300047320 | Bacteria | 14946 |
| 526 | Ga0495672_0003304 | 3300047320 | Bacteria | 13933 |
| 527 | Ga0495672_0014441 | 3300047320 | Bacteria | 5407 |
| 528 | Ga0495672_0124754 | 3300047320 | Bacteria | 1363 |
| 529 | Ga0495672_0136669 | 3300047320 | Bacteria | 1284 |
| 530 | Ga0495672_0477763 | 3300047320 | Bacteria | 557 |
| 531 | Ga0495680_0014308 | 3300047322 | Bacteria | 6879 |
| 532 | Ga0495680_0016640 | 3300047322 | Bacteria | 6310 |
| 533 | Ga0495680_0159865 | 3300047322 | Bacteria | 1636 |
| 534 | Ga0495683_0000604 | 3300047323 | Bacteria | 26955 |
| 535 | Ga0495683_0033580 | 3300047323 | Bacteria | 2610 |
| 536 | Ga0495683_0082720 | 3300047323 | Bacteria | 1564 |
| 537 | Ga0495687_057410 | 3300047443 | Bacteria | 1619 |
| 538 | Ga0495687_173789 | 3300047443 | Bacteria | 710 |
| 539 | Ga0495675_0086816 | 3300047444 | Bacteria | 1966 |
| 540 | Ga0495679_001784 | 3300047446 | Bacteria | 11765 |
| 541 | Ga0495685_003052 | 3300047447 | Bacteria | 5307 |
| 542 | Ga0495685_124053 | 3300047447 | Bacteria | 847 |
| 543 | Ga0495673_0000957 | 3300047469 | Bacteria | 26116 |
| 544 | Ga0495673_0003450 | 3300047469 | Bacteria | 10405 |
| 545 | Ga0495673_0005239 | 3300047469 | Bacteria | 7877 |
| 546 | Ga0495673_0027758 | 3300047469 | Bacteria | 2689 |
| 547 | Ga0495673_0073814 | 3300047469 | Bacteria | 1428 |
| 548 | Ga0495681_0001896 | 3300047470 | Bacteria | 15349 |
| 549 | Ga0495681_0009188 | 3300047470 | Bacteria | 6113 |
| 550 | Ga0495681_0016792 | 3300047470 | Bacteria | 4087 |
| 551 | Ga0495681_0027486 | 3300047470 | Bacteria | 2941 |
| 552 | Ga0495681_0350152 | 3300047470 | Bacteria | 562 |
| 553 | Ga0495593_0000903 | 3300047673 | Bacteria | 17237 |
| 554 | Ga0495593_0104978 | 3300047673 | Bacteria | 1446 |
| 555 | Ga0495614_0077121 | 3300048089 | Bacteria | 1441 |
| 556 | Ga0495615_0002720 | 3300048090 | Bacteria | 2868 |
| 557 | Ga0495626_0000931 | 3300048091 | Bacteria | 25617 |
| 558 | Ga0495626_0001133 | 3300048091 | Bacteria | 22281 |
| 559 | Ga0495626_0002819 | 3300048091 | Bacteria | 11623 |
| 560 | Ga0495626_0058837 | 3300048091 | Bacteria | 1754 |
| 561 | Ga0495626_0126736 | 3300048091 | Bacteria | 1093 |
| 562 | Ga0495626_0187227 | 3300048091 | Bacteria | 855 |
| 563 | Ga0495626_0369595 | 3300048091 | Bacteria | 557 |
| 564 | Ga0496102_0001223 | 3300048905 | Bacteria | 23305 |
| 565 | Ga0496102_0073644 | 3300048905 | Bacteria | 3138 |
| 566 | Ga0496103_0000823 | 3300048906 | Bacteria | 22758 |
| 567 | Ga0496104_0000514 | 3300048907 | Bacteria | 33125 |
| 568 | Ga0496108_1163972 | 3300048911 | Bacteria | 653 |
| 569 | Ga0496110_0115942 | 3300048913 | Bacteria | 2411 |
| 570 | Ga0496111_0821547 | 3300048914 | Bacteria | 672 |
| 571 | Ga0496113_0814912 | 3300048916 | Bacteria | 741 |
| 572 | Ga0496116_0000112 | 3300048919 | Bacteria | 181946 |
| 573 | Ga0496116_0001003 | 3300048919 | Bacteria | 34466 |
| 574 | Ga0496116_0006369 | 3300048919 | Bacteria | 10736 |
| 575 | Ga0496116_0011788 | 3300048919 | Bacteria | 7196 |
| 576 | Ga0496116_0013064 | 3300048919 | Bacteria | 6729 |
| 577 | Ga0496116_0015601 | 3300048919 | Bacteria | 5997 |
| 578 | Ga0496116_0051985 | 3300048919 | Bacteria | 2717 |
| 579 | Ga0496116_0058673 | 3300048919 | Bacteria | 2507 |
| 580 | Ga0496116_0192380 | 3300048919 | Bacteria | 1078 |
| 581 | Ga0496116_0273013 | 3300048919 | Bacteria | 824 |
| 582 | Ga0496116_0276053 | 3300048919 | Bacteria | 817 |
| 583 | Ga0496117_0004007 | 3300048920 | Bacteria | 16614 |
| 584 | Ga0496117_0013976 | 3300048920 | Bacteria | 6956 |
| 585 | Ga0496117_0067627 | 3300048920 | Bacteria | 2416 |
| 586 | Ga0496117_0068072 | 3300048920 | Bacteria | 2405 |
| 587 | Ga0496117_0083412 | 3300048920 | Bacteria | 2089 |
| 588 | Ga0496117_0152831 | 3300048920 | Bacteria | 1363 |
| 589 | Ga0496117_0170557 | 3300048920 | Bacteria | 1263 |
| 590 | Ga0496117_0179132 | 3300048920 | Bacteria | 1220 |
| 591 | Ga0496117_0265985 | 3300048920 | Bacteria | 926 |
| 592 | Ga0496117_0278240 | 3300048920 | Bacteria | 897 |
| 593 | Ga0496117_0369737 | 3300048920 | Bacteria | 734 |
| 594 | Ga0496117_0401421 | 3300048920 | Bacteria | 691 |
| 595 | Ga0496118_0002977 | 3300048921 | Bacteria | 21906 |
| 596 | Ga0496118_0011162 | 3300048921 | Bacteria | 8798 |
| 597 | Ga0496118_0035604 | 3300048921 | Bacteria | 4038 |
| 598 | Ga0496118_0125271 | 3300048921 | Bacteria | 1664 |
| 599 | Ga0496118_0153834 | 3300048921 | Bacteria | 1434 |
| 600 | Ga0496118_0160248 | 3300048921 | Bacteria | 1392 |
| 601 | Ga0496118_0165701 | 3300048921 | Bacteria | 1358 |
| 602 | Ga0496118_0175828 | 3300048921 | Bacteria | 1300 |
| 603 | Ga0496118_0201686 | 3300048921 | Bacteria | 1177 |
| 604 | Ga0496118_0291062 | 3300048921 | Bacteria | 902 |
| 605 | Ga0496118_0311509 | 3300048921 | Bacteria | 858 |
| 606 | Ga0496118_0570494 | 3300048921 | Bacteria | 547 |
| 607 | Ga0496119_0000847 | 3300048922 | Bacteria | 40396 |
| 608 | Ga0496119_0007444 | 3300048922 | Bacteria | 9856 |
| 609 | Ga0496119_0014320 | 3300048922 | Bacteria | 6219 |
| 610 | Ga0496119_0152341 | 3300048922 | Bacteria | 1237 |
| 611 | Ga0496119_0269287 | 3300048922 | Bacteria | 851 |
| 612 | Ga0496120_0004876 | 3300048923 | Bacteria | 10938 |
| 613 | Ga0496120_0041389 | 3300048923 | Bacteria | 2699 |
| 614 | Ga0496120_0061416 | 3300048923 | Bacteria | 2097 |
| 615 | Ga0496120_0133159 | 3300048923 | Bacteria | 1270 |
| 616 | Ga0496120_0154587 | 3300048923 | Bacteria | 1149 |
| 617 | Ga0496121_0000097 | 3300048924 | Bacteria | 201224 |
| 618 | Ga0496121_0013519 | 3300048924 | Bacteria | 8759 |
| 619 | Ga0496121_0034157 | 3300048924 | Bacteria | 4582 |
| 620 | Ga0496121_0037405 | 3300048924 | Bacteria | 4311 |
| 621 | Ga0496121_0077588 | 3300048924 | Bacteria | 2644 |
| 622 | Ga0496121_0264509 | 3300048924 | Bacteria | 1185 |
| 623 | Ga0496122_0000067 | 3300048925 | Bacteria | 231365 |
| 624 | Ga0496122_0003413 | 3300048925 | Bacteria | 20906 |
| 625 | Ga0496122_0038151 | 3300048925 | Bacteria | 3854 |
| 626 | Ga0496122_0075028 | 3300048925 | Bacteria | 2388 |
| 627 | Ga0496122_0112971 | 3300048925 | Bacteria | 1776 |
| 628 | Ga0496122_0167868 | 3300048925 | Bacteria | 1327 |
| 629 | Ga0496122_0214848 | 3300048925 | Bacteria | 1110 |
| 630 | Ga0496122_0269285 | 3300048925 | Bacteria | 939 |
| 631 | Ga0496123_0000056 | 3300048926 | Bacteria | 231365 |
| 632 | Ga0496123_0001391 | 3300048926 | Bacteria | 33892 |
| 633 | Ga0496123_0007815 | 3300048926 | Bacteria | 9955 |
| 634 | Ga0496123_0042687 | 3300048926 | Bacteria | 3125 |
| 635 | Ga0496123_0073455 | 3300048926 | Bacteria | 2121 |
| 636 | Ga0496123_0095355 | 3300048926 | Bacteria | 1750 |
| 637 | Ga0496123_0208862 | 3300048926 | Bacteria | 994 |
| 638 | Ga0496123_0232106 | 3300048926 | Bacteria | 922 |
| 639 | Ga0496123_0366142 | 3300048926 | Bacteria | 666 |
| 640 | Ga0496124_0000150 | 3300048927 | Bacteria | 142820 |
| 641 | Ga0496124_0000247 | 3300048927 | Bacteria | 104657 |
| 642 | Ga0496124_0006179 | 3300048927 | Bacteria | 13126 |
| 643 | Ga0496124_0008088 | 3300048927 | Bacteria | 11053 |
| 644 | Ga0496124_0038226 | 3300048927 | Bacteria | 4168 |
| 645 | Ga0496124_0061033 | 3300048927 | Bacteria | 3161 |
| 646 | Ga0496124_0083929 | 3300048927 | Bacteria | 2613 |
| 647 | Ga0496124_0084502 | 3300048927 | Bacteria | 2602 |
| 648 | Ga0496124_0110448 | 3300048927 | Bacteria | 2213 |
| 649 | Ga0496124_0139680 | 3300048927 | Bacteria | 1913 |
| 650 | Ga0496124_0142342 | 3300048927 | Bacteria | 1891 |
| 651 | Ga0496124_0230626 | 3300048927 | Bacteria | 1384 |
| 652 | Ga0496124_0233950 | 3300048927 | Bacteria | 1371 |
| 653 | Ga0496124_0443479 | 3300048927 | Bacteria | 887 |
| 654 | Ga0496124_0518559 | 3300048927 | Bacteria | 794 |
| 655 | Ga0496124_0835257 | 3300048927 | Bacteria | 566 |
| 656 | Ga0496124_0991124 | 3300048927 | Bacteria | 501 |
| 657 | Ga0496125_0000048 | 3300048928 | Bacteria | 290651 |
| 658 | Ga0496125_0001267 | 3300048928 | Bacteria | 37640 |
| 659 | Ga0496125_0005813 | 3300048928 | Bacteria | 13548 |
| 660 | Ga0496125_0011522 | 3300048928 | Bacteria | 8835 |
| 661 | Ga0496125_0016521 | 3300048928 | Bacteria | 7082 |
| 662 | Ga0496125_0021219 | 3300048928 | Bacteria | 6066 |
| 663 | Ga0496125_0092376 | 3300048928 | Bacteria | 2263 |
| 664 | Ga0496125_0153496 | 3300048928 | Bacteria | 1577 |
| 665 | Ga0496125_0197397 | 3300048928 | Bacteria | 1321 |
| 666 | Ga0496125_0275150 | 3300048928 | Bacteria | 1046 |
| 667 | Ga0496125_0286304 | 3300048928 | Bacteria | 1017 |
| 668 | Ga0496125_0328633 | 3300048928 | Bacteria | 923 |
| 669 | Ga0496125_0624216 | 3300048928 | Bacteria | 584 |
| 670 | Ga0496125_0683133 | 3300048928 | Bacteria | 547 |
| 671 | Ga0496126_0050061 | 3300048929 | Bacteria | 3809 |
| 672 | Ga0496126_0083434 | 3300048929 | Bacteria | 2820 |
| 673 | Ga0496126_0145532 | 3300048929 | Bacteria | 2035 |
| 674 | Ga0496126_0288064 | 3300048929 | Bacteria | 1359 |
| 675 | Ga0496126_0462333 | 3300048929 | Bacteria | 1019 |
| 676 | Ga0496126_0568155 | 3300048929 | Bacteria | 897 |
| 677 | Ga0496126_0742629 | 3300048929 | Bacteria | 758 |
| 678 | Ga0496126_1041310 | 3300048929 | Bacteria | 611 |
| 679 | Ga0495678_016179 | 3300049459 | Bacteria | 3417 |
| 680 | Ga0495678_029133 | 3300049459 | Bacteria | 2321 |
| 681 | Ga0495678_029443 | 3300049459 | Bacteria | 2305 |
| 682 | Ga0495678_042348 | 3300049459 | Bacteria | 1815 |
| 683 | Ga0495682_0065915 | 3300049460 | Bacteria | 1305 |
| 684 | Ga0495682_0074495 | 3300049460 | Bacteria | 1221 |
| 685 | Ga0495682_0299221 | 3300049460 | Bacteria | 567 |
| 686 | Ga0495682_0366744 | 3300049460 | Bacteria | 507 |
| 687 | Ga0501290_031375 | 3300049513 | Bacteria | 763 |
| 688 | Ga0501335_015018 | 3300049551 | Bacteria | 787 |
| 689 | Ga0501034_0114939 | 3300049571 | Bacteria | 2680 |
| 690 | Ga0501034_0244190 | 3300049571 | Bacteria | 1741 |
| 691 | Ga0501034_0264477 | 3300049571 | Bacteria | 1662 |
| 692 | Ga0501038_0140963 | 3300049574 | Bacteria | 1972 |
| 693 | Ga0501043_0018210 | 3300049579 | Bacteria | 5507 |
| 694 | Ga0501043_0381375 | 3300049579 | Bacteria | 1067 |
| 695 | Ga0501046_0015320 | 3300049580 | Bacteria | 6446 |
| 696 | Ga0501047_0672521 | 3300049581 | Unclassified | 854 |
| 697 | Ga0501202_091395 | 3300049652 | Bacteria | 729 |
| 698 | Ga0501206_022389 | 3300049653 | Bacteria | 906 |
| 699 | Ga0501211_005242 | 3300049658 | Bacteria | 1301 |
| 700 | Ga0501217_289699 | 3300049661 | Unclassified | 538 |
| 701 | Ga0501235_001027 | 3300049669 | Bacteria | 5821 |
| 702 | Ga0501236_023660 | 3300049670 | Bacteria | 926 |
| 703 | Ga0501240_017619 | 3300049673 | Bacteria | 1041 |
| 704 | Ga0501243_107875 | 3300049675 | Bacteria | 568 |
| 705 | Ga0501225_0007311 | 3300049705 | Bacteria | 3201 |
| 706 | Ga0501225_0291406 | 3300049705 | Bacteria | 550 |
| 707 | Ga0501245_005492 | 3300049708 | Bacteria | 1757 |
| 708 | Ga0501264_005581 | 3300049761 | Bacteria | 1147 |
| 709 | Ga0501281_21911 | 3300049777 | Bacteria | 501 |
| 710 | nmdc:mga03683_160815_c1 | 3300050489 | Bacteria | 1017 |
| 711 | nmdc:mga03683_298171_c1 | 3300050489 | Bacteria | 755 |
| 712 | nmdc:mga03683_408802_c1 | 3300050489 | Bacteria | 649 |
| 713 | nmdc:mga03683_476106_c1 | 3300050489 | Bacteria | 603 |
| 714 | nmdc:mga03683_84215_c1 | 3300050489 | Bacteria | 1378 |
| 715 | nmdc:mga03n38_276812_c1 | 3300050490 | Bacteria | 894 |
| 716 | nmdc:mga00v17_1066996_c1 | 3300050491 | Bacteria | 507 |
| 717 | nmdc:mga00v17_199939_c1 | 3300050491 | Bacteria | 1292 |
| 718 | nmdc:mga00v17_853315_c1 | 3300050491 | Bacteria | 578 |
| 719 | nmdc:mga00v17_917402_c1 | 3300050491 | Bacteria | 554 |
| 720 | nmdc:mga00v17_918451_c1 | 3300050491 | Bacteria | 554 |
| 721 | nmdc:mga00v17_923703_c1 | 3300050491 | Bacteria | 552 |
| 722 | nmdc:mga07m45_393668_c1 | 3300050496 | Bacteria | 804 |
| 723 | nmdc:mga08x19_1027785_c1 | 3300050514 | Bacteria | 585 |
| 724 | nmdc:mga08x19_80812_c1 | 3300050514 | Bacteria | 2134 |
| 725 | Ga0500641_0011666 | 3300053096 | Bacteria | 3193 |
| 726 | Ga0500621_048640 | 3300053126 | Bacteria | 1715 |
| 727 | Ga0500577_0003180 | 3300053142 | Bacteria | 4252 |
| 728 | Ga0500616_0191680 | 3300053153 | Bacteria | 912 |
| 729 | Ga0500625_002649 | 3300053729 | Bacteria | 6780 |
| 730 | 2511254897 | 2511231004 | Bacteria | 6669789 |
| 731 | 2511302425 | 2511231012 | Bacteria | 6738011 |
| 732 | 2511341167 | 2511231018 | Bacteria | 6436256 |
| 733 | 2512328733 | 2512047018 | Bacteria | 6663241 |
| 734 | 2583789563 | 2582580891 | Bacteria | 6800976 |
| 735 | 2597855363 | 2597489887 | Bacteria | 6666321 |
| 736 | 2599364774 | 2599185161 | Bacteria | 6960462 |
| 737 | 2599371105 | 2599185162 | Bacteria | 6957254 |
| 738 | 2599377467 | 2599185163 | Bacteria | 6995158 |
| 739 | 2599381422 | 2599185164 | Bacteria | 6841688 |
| 740 | 2599388434 | 2599185165 | Bacteria | 6843250 |
| 741 | 2599396329 | 2599185166 | Bacteria | 6959206 |
| 742 | 2599408516 | 2599185168 | Bacteria | 6997636 |
| 743 | 2599463150 | 2599185181 | Bacteria | 6844519 |
| 744 | 2599492167 | 2599185186 | Bacteria | 6831633 |
| 745 | 2599950806 | 2599185303 | Bacteria | 6512725 |
| 746 | 2600215778 | 2599185356 | Bacteria | 6843884 |
| 747 | 2601775945 | 2600255313 | Bacteria | 6842543 |
| 748 | 2643951331 | 2643221588 | Bacteria | 3692460 |
| 749 | 2643956349 | 2643221589 | Bacteria | 6250934 |
| 750 | 2644021402 | 2643221602 | Bacteria | 6249926 |
| 751 | 2671109272 | 2667528173 | Bacteria | 5375747 |
| 752 | 2715750581 | 2713897148 | Bacteria | 5883533 |
| 753 | 2715760007 | 2713897149 | Bacteria | 6506249 |
| 754 | 2739261243 | 2738543015 | Bacteria | 6750701 |
| 755 | 2739314616 | 2738543025 | Bacteria | 6600348 |
| 756 | 2784264222 | 2784132063 | Bacteria | 6262788 |
| 757 | 2838737731 | 2838736955 | Bacteria | 5760694 |
| 758 | 2841841900 | 2841840854 | Bacteria | 5761912 |
| 759 | 2842141679 | 2842140634 | Bacteria | 5759631 |
| 760 | 2842846756 | 2842843487 | Bacteria | 6004777 |
| 761 | 2844667581 | 2844665904 | Bacteria | 6817974 |
| 762 | 2852657693 | 2852657418 | Bacteria | 6472974 |
| 763 | 2855022543 | 2855020534 | Bacteria | 3204685 |
| 764 | 2880233699 | 2880230671 | Bacteria | 6140320 |
| 765 | 2904477448 | 2904474040 | Bacteria | 5504324 |
| 766 | 2904555006 | 2904550169 | Bacteria | 6221258 |
| 767 | 2919153843 | 2919150387 | Bacteria | 5500879 |
| 768 | 2919489270 | 2919487758 | Bacteria | 5929766 |
| 769 | 2919681666 | 2919679072 | Bacteria | 4629602 |
| 770 | 2927147141 | 2927143783 | Bacteria | 5504251 |
| 771 | 2939575845 | 2939573065 | Bacteria | 4926053 |
| 772 | 2984292347 | 2984286254 | Bacteria | 6702062 |
| 773 | 2998142518 | 2998139840 | Bacteria | 6073514 |
| 774 | 3007616166 | 3007614139 | Bacteria | 6053559 |
| 775 | 3007721499 | 3007718800 | Bacteria | 5971527 |
| 776 | 8029998176 | 8029995093 | Bacteria | 5990776 |
| 777 | 8055088440 | 8055087960 | Bacteria | 4784273 |
| 778 | 8055096929 | 8055092621 | Bacteria | 4873875 |
| 779 | 8055771126 | 8055770955 | Bacteria | 6827675 |
| 780 | 8056126211 | 8056125926 | Bacteria | 6228218 |
| 781 | 8056158237 | 8056155041 | Bacteria | 6486948 |
| 782 | 8056168566 | 8056166840 | Bacteria | 5820959 |
| 783 | JGI25162J39368_1000007 | |||
| 784 | MRS2a_Contig_878 | |||
| 785 | SwRhRL2b_contig_942673 | |||
| 786 | MRS1b_contig_1512768 | |||
| 787 | JGI24740J21852_10031135 | |||
| 788 | JGI24737J22298_10033282 | |||
| 789 | JGI24738J21930_10024949 | |||
| 790 | JGI25163J39215_1000040 | |||
| 791 | JGI25164J39214_1000016 | |||
| 792 | Ga0055538_1000006 | |||
| 793 | Ga0055539_1000010 | |||
| 794 | Ga0055533_1000013 | |||
| 795 | Ga0055525_1000015 | |||
| 796 | Ga0055536_1000145 | |||
| 797 | Ga0055536_1000200 | |||
| 798 | Ga0055534_1049140 | |||
| 799 | Ga0055530_10000128 | |||
| 800 | Ga0055530_10000163 | |||
| 801 | Ga0055540_1000156 | |||
| 802 | Ga0055540_1001073 | |||
| 803 | Ga0055540_1088347 | |||
| 804 | Ga0055531_10000425 | |||
| 805 | Ga0055541_1000007 | |||
| 806 | Ga0065714_10000431 | |||
| 807 | Ga0065714_10005818 | |||
| 808 | Ga0065714_10102197 | |||
| 809 | Ga0065714_10120917 | |||
| 810 | Ga0065714_10172880 | |||
| 811 | Ga0065714_10218135 | |||
| 812 | Ga0065714_10330062 | |||
| 813 | Ga0065704_10000271 | |||
| 814 | Ga0065704_10156563 | |||
| 815 | Ga0065704_10161970 | |||
| 816 | Ga0065704_10291037 | |||
| 817 | Ga0065704_10315890 | |||
| 818 | Ga0065712_10182057 | |||
| 819 | Ga0065712_10652761 | |||
| 820 | Ga0065715_10139364 | |||
| 821 | Ga0065707_10127222 | |||
| 822 | Ga0070680_102009700 | |||
| 823 | Ga0070659_100315936 | |||
| 824 | Ga0070662_100027158 | |||
| 825 | Ga0070662_100330068 | |||
| 826 | Ga0068853_100053947 | |||
| 827 | Ga0068855_100511680 | |||
| 828 | Ga0068857_100029738 | |||
| 829 | Ga0068857_100228009 | |||
| 830 | Ga0068854_100049056 | |||
| 831 | Ga0068852_101526137 | |||
| 832 | Ga0075363_100255511 | |||
| 833 | Ga0075364_10095803 | |||
| 834 | Ga0075364_10267326 | |||
| 835 | Ga0075364_10715459 | |||
| 836 | Ga0075364_10741135 | |||
| 837 | Ga0075364_11019993 | |||
| 838 | Ga0075364_11070689 | |||
| 839 | Ga0075432_10097649 | |||
| 840 | Ga0075432_10141775 | |||
| 841 | Ga0075432_10206485 | |||
| 842 | Ga0075432_10258756 | |||
| 843 | Ga0075432_10395522 | |||
| 844 | Ga0075432_10407184 | |||
| 845 | Ga0075432_10560242 | |||
| 846 | Ga0075362_10047340 | |||
| 847 | Ga0075362_10243354 | |||
| 848 | Ga0075369_10126209 | |||
| 849 | Ga0075370_10416480 | |||
| 850 | Ga0075436_100223473 | |||
| 851 | Ga0075436_100455893 | |||
| 852 | Ga0075436_100474883 | |||
| 853 | Ga0079104_1000290 | |||
| 854 | Ga0079104_1003915 | |||
| 855 | Ga0079104_1009332 | |||
| 856 | Ga0079104_1013375 | |||
| 857 | Ga0105251_10008384 | |||
| 858 | Ga0105251_10074727 | |||
| 859 | Ga0105251_10148544 | |||
| 860 | Ga0105251_10227935 | |||
| 861 | Ga0105251_10255529 | |||
| 862 | Ga0105244_10000026 | |||
| 863 | Ga0105244_10019547 | |||
| 864 | Ga0105244_10123703 | |||
| 865 | Ga0105244_10143032 | |||
| 866 | Ga0105244_10177061 | |||
| 867 | Ga0105244_10192564 | |||
| 868 | Ga0105244_10205776 | |||
| 869 | Ga0105244_10220761 | |||
| 870 | Ga0105250_10001116 | |||
| 871 | Ga0105250_10004167 | |||
| 872 | Ga0105250_10099421 | |||
| 873 | Ga0105250_10142365 | |||
| 874 | Ga0105250_10160908 | |||
| 875 | Ga0105240_12485856 | |||
| 876 | Ga0105243_10013201 | |||
| 877 | Ga0105243_10124879 | |||
| 878 | Ga0105243_11055168 | |||
| 879 | Ga0105241_10110315 | |||
| 880 | Ga0105242_10015438 | |||
| 881 | Ga0105242_11491208 | |||
| 882 | Ga0105248_10102693 | |||
| 883 | Ga0105238_10311764 | |||
| 884 | Ga0105238_10337113 | |||
| 885 | Ga0105239_11041604 | |||
| 886 | Ga0157336_1001858 | |||
| 887 | Ga0157345_1001192 | |||
| 888 | Ga0157347_1011896 | |||
| 889 | Ga0157339_1013620 | |||
| 890 | Ga0157373_10016444 | |||
| 891 | Ga0157373_10165428 | |||
| 892 | Ga0157373_10479049 | |||
| 893 | Ga0157373_10498403 | |||
| 894 | Ga0157371_10000044 | |||
| 895 | Ga0157371_10001383 | |||
| 896 | Ga0157371_10010204 | |||
| 897 | Ga0157371_10051292 | |||
| 898 | Ga0157371_10067811 | |||
| 899 | Ga0157371_10267965 | |||
| 900 | Ga0157371_10432678 | |||
| 901 | Ga0157371_11318332 | |||
| 902 | Ga0157370_10021828 | |||
| 903 | Ga0157370_10085874 | |||
| 904 | Ga0157370_10210362 | |||
| 905 | Ga0157370_10293730 | |||
| 906 | Ga0157370_10636892 | |||
| 907 | Ga0157370_11737983 | |||
| 908 | Ga0157369_10007905 | |||
| 909 | Ga0157369_10078453 | |||
| 910 | Ga0157369_10397493 | |||
| 911 | Ga0163162_10010387 | |||
| 912 | Ga0163162_10582585 | |||
| 913 | Ga0163162_11280742 | |||
| 914 | Ga0163162_11375294 | |||
| 915 | Ga0163162_11583479 | |||
| 916 | Ga0157372_10000453 | |||
| 917 | Ga0157372_10025185 | |||
| 918 | Ga0157375_10666823 | |||
| 919 | Ga0157375_10810817 | |||
| 920 | Ga0182008_10000238 | |||
| 921 | Ga0182008_10016432 | |||
| 922 | Ga0182008_10032643 | |||
| 923 | Ga0182008_10130828 | |||
| 924 | Ga0182008_10144922 | |||
| 925 | Ga0182006_1013786 | |||
| 926 | Ga0182006_1073962 | |||
| 927 | Ga0182007_10072698 | |||
| 928 | Ga0182007_10240575 | |||
| 929 | Ga0182005_1041845 | |||
| 930 | Ga0182005_1070302 | |||
| 931 | Ga0182005_1086315 | |||
| 932 | Ga0163161_10175584 | |||
| 933 | Ga0163161_10327370 | |||
| 934 | Ga0163161_10489217 | |||
| 935 | Ga0163161_10510030 | |||
| 936 | Ga0163161_10701669 | |||
| 937 | Ga0163161_10702948 | |||
| 938 | Ga0163161_11476642 | |||
| 939 | Ga0163161_11730898 | |||
| 940 | Ga0209760_100034 | |||
| 941 | Ga0209784_100022 | |||
| 942 | Ga0209566_100021 | |||
| 943 | Ga0209674_100038 | |||
| 944 | Ga0209563_100042 | |||
| 945 | Ga0207427_100027 | |||
| 946 | Ga0209437_100049 | |||
| 947 | Ga0209677_100025 | |||
| 948 | Ga0209233_1003281 | |||
| 949 | Ga0209130_1031380 | |||
| 950 | Ga0209675_1010416 | |||
| 951 | Ga0209676_1000020 | |||
| 952 | Ga0209676_1000032 | |||
| 953 | Ga0209676_1000408 | |||
| 954 | Ga0209676_1006111 | |||
| 955 | Ga0209050_1000025 | |||
| 956 | Ga0209050_1000099 | |||
| 957 | Ga0209050_1001082 | |||
| 958 | Ga0209051_1000026 | |||
| 959 | Ga0209051_1000039 | |||
| 960 | Ga0209051_1000047 | |||
| 961 | Ga0209051_1024322 | |||
| 962 | Ga0209257_1000034 | |||
| 963 | Ga0209257_1111975 | |||
| 964 | Ga0207696_1000002 | |||
| 965 | Ga0207696_1000642 | |||
| 966 | Ga0207696_1020208 | |||
| 967 | Ga0207696_1053664 | |||
| 968 | Ga0207655_1000057 | |||
| 969 | Ga0207655_1000560 | |||
| 970 | Ga0207655_1012867 | |||
| 971 | Ga0207655_1018585 | |||
| 972 | Ga0207655_1087344 | |||
| 973 | Ga0207655_1088890 | |||
| 974 | Ga0207655_1098508 | |||
| 975 | Ga0207655_1117921 | |||
| 976 | Ga0207655_1122063 | |||
| 977 | Ga0207655_1200550 | |||
| 978 | Ga0207713_1000573 | |||
| 979 | Ga0207713_1004368 | |||
| 980 | Ga0207713_1006126 | |||
| 981 | Ga0207713_1006127 | |||
| 982 | Ga0207713_1008055 | |||
| 983 | Ga0207713_1020172 | |||
| 984 | Ga0207713_1031210 | |||
| 985 | Ga0207713_1069000 | |||
| 986 | Ga0207647_10175276 | |||
| 987 | Ga0207654_10332309 | |||
| 988 | Ga0207694_10104047 | |||
| 989 | Ga0207650_10000185 | |||
| 990 | Ga0207644_10548985 | |||
| 991 | Ga0207690_10261516 | |||
| 992 | Ga0207706_10176427 | |||
| 993 | Ga0207706_10399000 | |||
| 994 | Ga0207686_10571208 | |||
| 995 | Ga0207709_10940985 | |||
| 996 | Ga0207709_11138580 | |||
| 997 | Ga0207668_10773876 | |||
| 998 | Ga0207640_10040953 | |||
| 999 | Ga0207639_10017627 | |||
| 1000 | Ga0207674_10000029 | |||
| 1001 | Ga0207674_10025912 | |||
| 1002 | Ga0207674_10233715 | |||
| 1003 | Ga0207698_10178607 | |||
| 1004 | Ga0209281_1000026 | |||
| 1005 | Ga0209281_1000614 | |||
| 1006 | Ga0209281_1003496 | |||
| 1007 | Ga0209281_1005509 | |||
| 1008 | Ga0209371_1000014 | |||
| 1009 | Ga0209983_1026045 | |||
| 1010 | Ga0209974_10126046 | |||
| 1011 | Ga0207428_10069990 | |||
| 1012 | Ga0207428_10407641 | |||
| 1013 | Ga0207428_10454500 | |||
| 1014 | Ga0207428_10505325 | |||
| 1015 | Ga0207428_10815099 | |||
| 1016 | Ga0268266_10106882 | |||
| 1017 | Ga0268266_10254151 | |||
| 1018 | Ga0268256_1000021 | |||
| 1019 | Ga0268256_1010279 | |||
| 1020 | Ga0316178_1142514 | |||
| 1021 | Ga0307408_100009196 | |||
| 1022 | Ga0307408_100273538 | |||
| 1023 | Ga0307408_100677396 | |||
| 1024 | Ga0316579_10212966 | |||
| 1025 | Ga0316579_10521807 | |||
| 1026 | Ga0307405_10108814 | |||
| 1027 | Ga0307405_10182115 | |||
| 1028 | Ga0307405_10310489 | |||
| 1029 | Ga0307405_10331974 | |||
| 1030 | Ga0307405_10828258 | |||
| 1031 | Ga0307410_10308877 | |||
| 1032 | Ga0307406_10267357 | |||
| 1033 | Ga0307412_10164900 | |||
| 1034 | Ga0307412_10213799 | |||
| 1035 | Ga0307412_10319033 | |||
| 1036 | Ga0307416_100281173 | |||
| 1037 | Ga0307416_102284124 | |||
| 1038 | Ga0307411_10114545 | |||
| 1039 | Ga0307411_10347662 | |||
| 1040 | Ga0307415_101443879 | |||
| 1041 | Ga0395899_0217634 | |||
| 1042 | Ga0395900_0002169 | |||
| 1043 | Ga0395900_0071831 | |||
| 1044 | Ga0395898_0072438 | |||
| 1045 | Ga0436361_1058773 | |||
| 1046 | Ga0439438_001153 | |||
| 1047 | Ga0439438_033200 | |||
| 1048 | Ga0439447_000379 | |||
| 1049 | Ga0439447_000776 | |||
| 1050 | Ga0439447_003341 | |||
| 1051 | Ga0439447_035093 | |||
| 1052 | Ga0439466_0000176 | |||
| 1053 | Ga0439466_0008485 | |||
| 1054 | Ga0439466_0020842 | |||
| 1055 | Ga0439466_0030233 | |||
| 1056 | Ga0439466_0064278 | |||
| 1057 | Ga0439466_0130211 | |||
| 1058 | Ga0451807_0901309 | |||
| 1059 | Ga0451807_0911490 | |||
| 1060 | Ga0439432_002585 | |||
| 1061 | Ga0439432_023994 | |||
| 1062 | Ga0439432_058951 | |||
| 1063 | Ga0439432_093155 | |||
| 1064 | Ga0439451_022878 | |||
| 1065 | Ga0439451_059161 | |||
| 1066 | Ga0439452_000005 | |||
| 1067 | Ga0439452_000229 | |||
| 1068 | Ga0439452_048552 | |||
| 1069 | Ga0439456_001064 | |||
| 1070 | Ga0439456_001435 | |||
| 1071 | Ga0439456_002068 | |||
| 1072 | Ga0439456_005338 | |||
| 1073 | Ga0439456_007928 | |||
| 1074 | Ga0439456_008553 | |||
| 1075 | Ga0439456_014786 | |||
| 1076 | Ga0439463_000558 | |||
| 1077 | Ga0439463_001147 | |||
| 1078 | Ga0439463_125649 | |||
| 1079 | Ga0450911_000290 | |||
| 1080 | Ga0450911_000924 | |||
| 1081 | Ga0450911_006040 | |||
| 1082 | Ga0450919_004043 | |||
| 1083 | Ga0450920_002881 | |||
| 1084 | Ga0450922_000391 | |||
| 1085 | Ga0450923_011486 | |||
| 1086 | Ga0450900_016097 | |||
| 1087 | Ga0450902_001758 | |||
| 1088 | Ga0450902_032425 | |||
| 1089 | Ga0450902_044893 | |||
| 1090 | Ga0450903_000904 | |||
| 1091 | Ga0450903_025431 | |||
| 1092 | Ga0450904_004135 | |||
| 1093 | Ga0450905_024695 | |||
| 1094 | Ga0450906_001755 | |||
| 1095 | Ga0450906_003379 | |||
| 1096 | Ga0450907_000020 | |||
| 1097 | Ga0450907_000681 | |||
| 1098 | Ga0450910_005521 | |||
| 1099 | Ga0450910_022646 | |||
| 1100 | Ga0439446_0064545 | |||
| 1101 | Ga0450908_087622 | |||
| 1102 | Ga0450909_000635 | |||
| 1103 | Ga0450909_012929 | |||
| 1104 | Ga0439434_0000018 | |||
| 1105 | Ga0439464_0293630 | |||
| 1106 | Ga0439460_0000545 | |||
| 1107 | Ga0439460_0002133 | |||
| 1108 | Ga0450918_021625 | |||
| 1109 | Ga0450893_0010920 | |||
| 1110 | Ga0451577_0000239 | |||
| 1111 | Ga0451577_0348022 | |||
| 1112 | Ga0439440_0000422 | |||
| 1113 | Ga0466969_0006571 | |||
| 1114 | Ga0453683_0640014 | |||
| 1115 | Ga0453683_0952108 | |||
| 1116 | Ga0453684_0001090 | |||
| 1117 | Ga0453684_0021005 | |||
| 1118 | Ga0453684_0190791 | |||
| 1119 | Ga0453684_0212099 | |||
| 1120 | Ga0451576_1319323 | |||
| 1121 | Ga0451576_1654857 | |||
| 1122 | Ga0495617_000608 | |||
| 1123 | Ga0495617_006994 | |||
| 1124 | Ga0495617_013490 | |||
| 1125 | Ga0495617_013625 | |||
| 1126 | Ga0495617_119463 | |||
| 1127 | Ga0495627_001586 | |||
| 1128 | Ga0495627_011878 | |||
| 1129 | Ga0495627_015823 | |||
| 1130 | Ga0495627_088122 | |||
| 1131 | Ga0495603_0001348 | |||
| 1132 | Ga0495603_0030679 | |||
| 1133 | Ga0495603_0693215 | |||
| 1134 | Ga0495590_0000615 | |||
| 1135 | Ga0495590_0086300 | |||
| 1136 | Ga0495591_002305 | |||
| 1137 | Ga0495591_007492 | |||
| 1138 | Ga0495591_013020 | |||
| 1139 | Ga0495638_0002132 | |||
| 1140 | Ga0495638_0008667 | |||
| 1141 | Ga0495653_0570250 | |||
| 1142 | Ga0495650_0000039 | |||
| 1143 | Ga0495650_0002587 | |||
| 1144 | Ga0495650_0106470 | |||
| 1145 | Ga0495605_0000530 | |||
| 1146 | Ga0495605_0000758 | |||
| 1147 | Ga0495605_0010780 | |||
| 1148 | Ga0495605_0226505 | |||
| 1149 | Ga0495639_0039981 | |||
| 1150 | Ga0495639_0070435 | |||
| 1151 | Ga0495639_0090588 | |||
| 1152 | Ga0495639_0333060 | |||
| 1153 | Ga0495584_0000787 | |||
| 1154 | Ga0495584_0002815 | |||
| 1155 | Ga0495584_0028177 | |||
| 1156 | Ga0495584_0115361 | |||
| 1157 | Ga0495584_0347430 | |||
| 1158 | Ga0495585_0016673 | |||
| 1159 | Ga0495585_0117335 | |||
| 1160 | Ga0495585_0226186 | |||
| 1161 | Ga0495585_0274479 | |||
| 1162 | Ga0495594_0016477 | |||
| 1163 | Ga0495596_0022058 | |||
| 1164 | Ga0495607_0010999 | |||
| 1165 | Ga0495607_0040897 | |||
| 1166 | Ga0495607_0147481 | |||
| 1167 | Ga0495607_0193517 | |||
| 1168 | Ga0495607_0520267 | |||
| 1169 | Ga0495583_0001511 | |||
| 1170 | Ga0495583_0040852 | |||
| 1171 | Ga0495583_0087514 | |||
| 1172 | Ga0495606_0006414 | |||
| 1173 | Ga0495606_0009270 | |||
| 1174 | Ga0495606_0091273 | |||
| 1175 | Ga0495606_0156493 | |||
| 1176 | Ga0495610_0003477 | |||
| 1177 | Ga0495610_0008115 | |||
| 1178 | Ga0495610_0009185 | |||
| 1179 | Ga0495610_0023023 | |||
| 1180 | Ga0495610_0035494 | |||
| 1181 | Ga0495610_0060740 | |||
| 1182 | Ga0495610_0101103 | |||
| 1183 | Ga0495616_0001725 | |||
| 1184 | Ga0495616_0006195 | |||
| 1185 | Ga0495616_0107817 | |||
| 1186 | Ga0495620_0002386 | |||
| 1187 | Ga0495620_0002590 | |||
| 1188 | Ga0495620_0257161 | |||
| 1189 | Ga0495628_0211855 | |||
| 1190 | Ga0495630_0000091 | |||
| 1191 | Ga0495630_0680147 | |||
| 1192 | Ga0495631_0001404 | |||
| 1193 | Ga0495631_0019053 | |||
| 1194 | Ga0495631_0398065 | |||
| 1195 | Ga0495632_0000312 | |||
| 1196 | Ga0495632_0044876 | |||
| 1197 | Ga0495632_0069013 | |||
| 1198 | Ga0495632_0072070 | |||
| 1199 | Ga0495632_0198472 | |||
| 1200 | Ga0495637_0001838 | |||
| 1201 | Ga0495637_0007664 | |||
| 1202 | Ga0495637_0009153 | |||
| 1203 | Ga0495637_0017794 | |||
| 1204 | Ga0495637_0024007 | |||
| 1205 | Ga0495643_0003399 | |||
| 1206 | Ga0495643_0084848 | |||
| 1207 | Ga0495644_0021319 | |||
| 1208 | Ga0495644_0441361 | |||
| 1209 | Ga0495648_0002010 | |||
| 1210 | Ga0495648_0010271 | |||
| 1211 | Ga0495648_0025513 | |||
| 1212 | Ga0495648_0033204 | |||
| 1213 | Ga0495648_0086748 | |||
| 1214 | Ga0495648_0483567 | |||
| 1215 | Ga0495666_0002069 | |||
| 1216 | Ga0495666_0004705 | |||
| 1217 | Ga0495666_0203230 | |||
| 1218 | Ga0495666_0574002 | |||
| 1219 | Ga0495642_0000231 | |||
| 1220 | Ga0495642_0007466 | |||
| 1221 | Ga0495654_0002895 | |||
| 1222 | Ga0495654_0004614 | |||
| 1223 | Ga0495654_0007837 | |||
| 1224 | Ga0495654_0011817 | |||
| 1225 | Ga0495654_0015690 | |||
| 1226 | Ga0495654_0017619 | |||
| 1227 | Ga0495654_0433818 | |||
| 1228 | Ga0495665_0131052 | |||
| 1229 | Ga0495598_0044642 | |||
| 1230 | Ga0495609_0004699 | |||
| 1231 | Ga0495609_0007646 | |||
| 1232 | Ga0495609_0158782 | |||
| 1233 | Ga0495609_0160730 | |||
| 1234 | Ga0495609_0200777 | |||
| 1235 | Ga0495609_0231846 | |||
| 1236 | Ga0495597_0016354 | |||
| 1237 | Ga0495597_0050948 | |||
| 1238 | Ga0495597_0099047 | |||
| 1239 | Ga0495597_0187926 | |||
| 1240 | Ga0495622_0010557 | |||
| 1241 | Ga0495622_0092064 | |||
| 1242 | Ga0495622_0120410 | |||
| 1243 | Ga0495622_0402770 | |||
| 1244 | Ga0495633_0007110 | |||
| 1245 | Ga0495633_0077315 | |||
| 1246 | Ga0495633_0087462 | |||
| 1247 | Ga0495668_0010717 | |||
| 1248 | Ga0495634_0001289 | |||
| 1249 | Ga0495611_0015723 | |||
| 1250 | Ga0495625_0005424 | |||
| 1251 | Ga0495625_0009016 | |||
| 1252 | Ga0495625_0011860 | |||
| 1253 | Ga0495625_0041834 | |||
| 1254 | Ga0495659_0089481 | |||
| 1255 | Ga0495659_0123236 | |||
| 1256 | Ga0495661_0011981 | |||
| 1257 | Ga0495661_0044203 | |||
| 1258 | Ga0495661_0053604 | |||
| 1259 | Ga0495588_0009384 | |||
| 1260 | Ga0495588_0047982 | |||
| 1261 | Ga0495588_0112479 | |||
| 1262 | Ga0495623_0002460 | |||
| 1263 | Ga0495623_0007120 | |||
| 1264 | Ga0495646_0052317 | |||
| 1265 | Ga0495669_0083221 | |||
| 1266 | Ga0495669_0343256 | |||
| 1267 | Ga0495613_0147858 | |||
| 1268 | Ga0495624_0135552 | |||
| 1269 | Ga0495670_0002161 | |||
| 1270 | Ga0495670_0009471 | |||
| 1271 | Ga0495670_0109700 | |||
| 1272 | Ga0495670_0124583 | |||
| 1273 | Ga0495670_0356741 | |||
| 1274 | Ga0495670_0752563 | |||
| 1275 | Ga0495670_0770526 | |||
| 1276 | Ga0495671_0031930 | |||
| 1277 | Ga0495671_0077331 | |||
| 1278 | Ga0495671_0127779 | |||
| 1279 | Ga0495671_0166423 | |||
| 1280 | Ga0495649_0000095 | |||
| 1281 | Ga0495649_0024772 | |||
| 1282 | Ga0495649_0026855 | |||
| 1283 | Ga0495649_0038244 | |||
| 1284 | Ga0495649_0207266 | |||
| 1285 | Ga0495649_0236518 | |||
| 1286 | Ga0495649_0551568 | |||
| 1287 | Ga0495589_0000199 | |||
| 1288 | Ga0495589_0009466 | |||
| 1289 | Ga0495589_0011985 | |||
| 1290 | Ga0495589_0091139 | |||
| 1291 | Ga0495589_0144244 | |||
| 1292 | Ga0495660_0000023 | |||
| 1293 | Ga0495660_0012349 | |||
| 1294 | Ga0495660_0014970 | |||
| 1295 | Ga0495660_0016611 | |||
| 1296 | Ga0495660_0030975 | |||
| 1297 | Ga0495660_0065501 | |||
| 1298 | Ga0495660_0078488 | |||
| 1299 | Ga0495660_0124607 | |||
| 1300 | Ga0495660_0273895 | |||
| 1301 | Ga0495660_0309822 | |||
| 1302 | Ga0495604_0020713 | |||
| 1303 | Ga0495636_0087388 | |||
| 1304 | Ga0495674_0030209 | |||
| 1305 | Ga0495674_1434889 | |||
| 1306 | Ga0495672_0001614 | |||
| 1307 | Ga0495672_0002964 | |||
| 1308 | Ga0495672_0003304 | |||
| 1309 | Ga0495672_0014441 | |||
| 1310 | Ga0495672_0124754 | |||
| 1311 | Ga0495672_0136669 | |||
| 1312 | Ga0495672_0477763 | |||
| 1313 | Ga0495680_0014308 | |||
| 1314 | Ga0495680_0016640 | |||
| 1315 | Ga0495680_0159865 | |||
| 1316 | Ga0495683_0000604 | |||
| 1317 | Ga0495683_0033580 | |||
| 1318 | Ga0495683_0082720 | |||
| 1319 | Ga0495687_057410 | |||
| 1320 | Ga0495687_173789 | |||
| 1321 | Ga0495675_0086816 | |||
| 1322 | Ga0495679_001784 | |||
| 1323 | Ga0495685_003052 | |||
| 1324 | Ga0495685_124053 | |||
| 1325 | Ga0495673_0000957 | |||
| 1326 | Ga0495673_0003450 | |||
| 1327 | Ga0495673_0005239 | |||
| 1328 | Ga0495673_0027758 | |||
| 1329 | Ga0495673_0073814 | |||
| 1330 | Ga0495681_0001896 | |||
| 1331 | Ga0495681_0009188 | |||
| 1332 | Ga0495681_0016792 | |||
| 1333 | Ga0495681_0027486 | |||
| 1334 | Ga0495681_0350152 | |||
| 1335 | Ga0495593_0000903 | |||
| 1336 | Ga0495593_0104978 | |||
| 1337 | Ga0495614_0077121 | |||
| 1338 | Ga0495615_0002720 | |||
| 1339 | Ga0495626_0000931 | |||
| 1340 | Ga0495626_0001133 | |||
| 1341 | Ga0495626_0002819 | |||
| 1342 | Ga0495626_0058837 | |||
| 1343 | Ga0495626_0126736 | |||
| 1344 | Ga0495626_0187227 | |||
| 1345 | Ga0495626_0369595 | |||
| 1346 | Ga0496102_0001223 | |||
| 1347 | Ga0496102_0073644 | |||
| 1348 | Ga0496103_0000823 | |||
| 1349 | Ga0496104_0000514 | |||
| 1350 | Ga0496108_1163972 | |||
| 1351 | Ga0496110_0115942 | |||
| 1352 | Ga0496111_0821547 | |||
| 1353 | Ga0496113_0814912 | |||
| 1354 | Ga0496116_0000112 | |||
| 1355 | Ga0496116_0001003 | |||
| 1356 | Ga0496116_0006369 | |||
| 1357 | Ga0496116_0011788 | |||
| 1358 | Ga0496116_0013064 | |||
| 1359 | Ga0496116_0015601 | |||
| 1360 | Ga0496116_0051985 | |||
| 1361 | Ga0496116_0058673 | |||
| 1362 | Ga0496116_0192380 | |||
| 1363 | Ga0496116_0273013 | |||
| 1364 | Ga0496116_0276053 | |||
| 1365 | Ga0496117_0004007 | |||
| 1366 | Ga0496117_0013976 | |||
| 1367 | Ga0496117_0067627 | |||
| 1368 | Ga0496117_0068072 | |||
| 1369 | Ga0496117_0083412 | |||
| 1370 | Ga0496117_0152831 | |||
| 1371 | Ga0496117_0170557 | |||
| 1372 | Ga0496117_0179132 | |||
| 1373 | Ga0496117_0265985 | |||
| 1374 | Ga0496117_0278240 | |||
| 1375 | Ga0496117_0369737 | |||
| 1376 | Ga0496117_0401421 | |||
| 1377 | Ga0496118_0002977 | |||
| 1378 | Ga0496118_0011162 | |||
| 1379 | Ga0496118_0035604 | |||
| 1380 | Ga0496118_0125271 | |||
| 1381 | Ga0496118_0153834 | |||
| 1382 | Ga0496118_0160248 | |||
| 1383 | Ga0496118_0165701 | |||
| 1384 | Ga0496118_0175828 | |||
| 1385 | Ga0496118_0201686 | |||
| 1386 | Ga0496118_0291062 | |||
| 1387 | Ga0496118_0311509 | |||
| 1388 | Ga0496118_0570494 | |||
| 1389 | Ga0496119_0000847 | |||
| 1390 | Ga0496119_0007444 | |||
| 1391 | Ga0496119_0014320 | |||
| 1392 | Ga0496119_0152341 | |||
| 1393 | Ga0496119_0269287 | |||
| 1394 | Ga0496120_0004876 | |||
| 1395 | Ga0496120_0041389 | |||
| 1396 | Ga0496120_0061416 | |||
| 1397 | Ga0496120_0133159 | |||
| 1398 | Ga0496120_0154587 | |||
| 1399 | Ga0496121_0000097 | |||
| 1400 | Ga0496121_0013519 | |||
| 1401 | Ga0496121_0034157 | |||
| 1402 | Ga0496121_0037405 | |||
| 1403 | Ga0496121_0077588 | |||
| 1404 | Ga0496121_0264509 | |||
| 1405 | Ga0496122_0000067 | |||
| 1406 | Ga0496122_0003413 | |||
| 1407 | Ga0496122_0038151 | |||
| 1408 | Ga0496122_0075028 | |||
| 1409 | Ga0496122_0112971 | |||
| 1410 | Ga0496122_0167868 | |||
| 1411 | Ga0496122_0214848 | |||
| 1412 | Ga0496122_0269285 | |||
| 1413 | Ga0496123_0000056 | |||
| 1414 | Ga0496123_0001391 | |||
| 1415 | Ga0496123_0007815 | |||
| 1416 | Ga0496123_0042687 | |||
| 1417 | Ga0496123_0073455 | |||
| 1418 | Ga0496123_0095355 | |||
| 1419 | Ga0496123_0208862 | |||
| 1420 | Ga0496123_0232106 | |||
| 1421 | Ga0496123_0366142 | |||
| 1422 | Ga0496124_0000150 | |||
| 1423 | Ga0496124_0000247 | |||
| 1424 | Ga0496124_0006179 | |||
| 1425 | Ga0496124_0008088 | |||
| 1426 | Ga0496124_0038226 | |||
| 1427 | Ga0496124_0061033 | |||
| 1428 | Ga0496124_0083929 | |||
| 1429 | Ga0496124_0084502 | |||
| 1430 | Ga0496124_0110448 | |||
| 1431 | Ga0496124_0139680 | |||
| 1432 | Ga0496124_0142342 | |||
| 1433 | Ga0496124_0230626 | |||
| 1434 | Ga0496124_0233950 | |||
| 1435 | Ga0496124_0443479 | |||
| 1436 | Ga0496124_0518559 | |||
| 1437 | Ga0496124_0835257 | |||
| 1438 | Ga0496124_0991124 | |||
| 1439 | Ga0496125_0000048 | |||
| 1440 | Ga0496125_0001267 | |||
| 1441 | Ga0496125_0005813 | |||
| 1442 | Ga0496125_0011522 | |||
| 1443 | Ga0496125_0016521 | |||
| 1444 | Ga0496125_0021219 | |||
| 1445 | Ga0496125_0092376 | |||
| 1446 | Ga0496125_0153496 | |||
| 1447 | Ga0496125_0197397 | |||
| 1448 | Ga0496125_0275150 | |||
| 1449 | Ga0496125_0286304 | |||
| 1450 | Ga0496125_0328633 | |||
| 1451 | Ga0496125_0624216 | |||
| 1452 | Ga0496125_0683133 | |||
| 1453 | Ga0496126_0050061 | |||
| 1454 | Ga0496126_0083434 | |||
| 1455 | Ga0496126_0145532 | |||
| 1456 | Ga0496126_0288064 | |||
| 1457 | Ga0496126_0462333 | |||
| 1458 | Ga0496126_0568155 | |||
| 1459 | Ga0496126_0742629 | |||
| 1460 | Ga0496126_1041310 | |||
| 1461 | Ga0495678_016179 | |||
| 1462 | Ga0495678_029133 | |||
| 1463 | Ga0495678_029443 | |||
| 1464 | Ga0495678_042348 | |||
| 1465 | Ga0495682_0065915 | |||
| 1466 | Ga0495682_0074495 | |||
| 1467 | Ga0495682_0299221 | |||
| 1468 | Ga0495682_0366744 | |||
| 1469 | Ga0501290_031375 | |||
| 1470 | Ga0501335_015018 | |||
| 1471 | Ga0501034_0114939 | |||
| 1472 | Ga0501034_0244190 | |||
| 1473 | Ga0501034_0264477 | |||
| 1474 | Ga0501038_0140963 | |||
| 1475 | Ga0501043_0018210 | |||
| 1476 | Ga0501043_0381375 | |||
| 1477 | Ga0501046_0015320 | |||
| 1478 | Ga0501047_0672521 | |||
| 1479 | Ga0501202_091395 | |||
| 1480 | Ga0501206_022389 | |||
| 1481 | Ga0501211_005242 | |||
| 1482 | Ga0501217_289699 | |||
| 1483 | Ga0501235_001027 | |||
| 1484 | Ga0501236_023660 | |||
| 1485 | Ga0501240_017619 | |||
| 1486 | Ga0501243_107875 | |||
| 1487 | Ga0501225_0007311 | |||
| 1488 | Ga0501225_0291406 | |||
| 1489 | Ga0501245_005492 | |||
| 1490 | Ga0501264_005581 | |||
| 1491 | Ga0501281_21911 | |||
| 1492 | nmdc:mga03683_160815_c1 | |||
| 1493 | nmdc:mga03683_298171_c1 | |||
| 1494 | nmdc:mga03683_408802_c1 | |||
| 1495 | nmdc:mga03683_476106_c1 | |||
| 1496 | nmdc:mga03683_84215_c1 | |||
| 1497 | nmdc:mga03n38_276812_c1 | |||
| 1498 | nmdc:mga00v17_1066996_c1 | |||
| 1499 | nmdc:mga00v17_199939_c1 | |||
| 1500 | nmdc:mga00v17_853315_c1 | |||
| 1501 | nmdc:mga00v17_917402_c1 | |||
| 1502 | nmdc:mga00v17_918451_c1 | |||
| 1503 | nmdc:mga00v17_923703_c1 | |||
| 1504 | nmdc:mga07m45_393668_c1 | |||
| 1505 | nmdc:mga08x19_1027785_c1 | |||
| 1506 | nmdc:mga08x19_80812_c1 | |||
| 1507 | Ga0500641_0011666 | |||
| 1508 | Ga0500621_048640 | |||
| 1509 | Ga0500577_0003180 | |||
| 1510 | Ga0500616_0191680 | |||
| 1511 | Ga0500625_002649 | |||
| 1512 | 2511254897 | |||
| 1513 | 2511302425 | |||
| 1514 | 2511341167 | |||
| 1515 | 2512328733 | |||
| 1516 | 2583789563 | |||
| 1517 | 2597855363 | |||
| 1518 | 2599364774 | |||
| 1519 | 2599371105 | |||
| 1520 | 2599377467 | |||
| 1521 | 2599381422 | |||
| 1522 | 2599388434 | |||
| 1523 | 2599396329 | |||
| 1524 | 2599408516 | |||
| 1525 | 2599463150 | |||
| 1526 | 2599492167 | |||
| 1527 | 2599950806 | |||
| 1528 | 2600215778 | |||
| 1529 | 2601775945 | |||
| 1530 | 2643951331 | |||
| 1531 | 2643956349 | |||
| 1532 | 2644021402 | |||
| 1533 | 2671109272 | |||
| 1534 | 2715750581 | |||
| 1535 | 2715760007 | |||
| 1536 | 2739261243 | |||
| 1537 | 2739314616 | |||
| 1538 | 2784264222 | |||
| 1539 | 2838737731 | |||
| 1540 | 2841841900 | |||
| 1541 | 2842141679 | |||
| 1542 | 2842846756 | |||
| 1543 | 2844667581 | |||
| 1544 | 2852657693 | |||
| 1545 | 2855022543 | |||
| 1546 | 2880233699 | |||
| 1547 | 2904477448 | |||
| 1548 | 2904555006 | |||
| 1549 | 2919153843 | |||
| 1550 | 2919489270 | |||
| 1551 | 2919681666 | |||
| 1552 | 2927147141 | |||
| 1553 | 2939575845 | |||
| 1554 | 2984292347 | |||
| 1555 | 2998142518 | |||
| 1556 | 3007616166 | |||
| 1557 | 3007721499 | |||
| 1558 | 8029998176 | |||
| 1559 | 8055088440 | |||
| 1560 | 8055096929 | |||
| 1561 | 8055771126 | |||
| 1562 | 8056126211 | |||
| 1563 | 8056158237 | |||
| 1564 | 8056168566 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4fxe-assembly1.cif.gz_D-2 | crystal structure of the intact e. coli relbe toxin-antitoxin complex | 0.9765 | 3 | 80 |
| 4fxe-assembly1.cif.gz_E | crystal structure of the intact e. coli relbe toxin-antitoxin complex | 0.9666 | 3 | 83 |
| 4fxe-assembly1.cif.gz_D-2 | crystal structure of the intact e. coli relbe toxin-antitoxin complex | 0.9633 | 3 | 80 |
| 4v7j-assembly2.cif.gz_By | structure of rele nuclease bound to the 70s ribosome (precleavage state) | 0.9622 | 3 | 93 |
| 4v7k-assembly2.cif.gz_By | structure of rele nuclease bound to the 70s ribosome (postcleavage state) | 0.9593 | 3 | 93 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4fxeF00 | Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like | 0.981 | 3 | 80 | 3.30.2310.20 |
| 4fxeD00 | Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like | 0.9765 | 3 | 80 | 3.30.2310.20 |
| 4fxeD00 | Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like | 0.9633 | 3 | 80 | 3.30.2310.20 |
| 4fxeF00 | Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like | 0.9569 | 3 | 80 | 3.30.2310.20 |
| af_Q8VWG2_13_142_2.120.10.80 | Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller | 0.9011 | 50 | 80 | 2.120.10.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S4J7T8-F1-model_v4 | RelE toxin (EC 3.1.-.-) | 1.008 | 1 | 65 |
GO:0016787
|
| AF-A0A2H0HT33-F1-model_v4 | Type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | 1.007 | 1 | 68 |
|
| AF-A0A1P8EU37-F1-model_v4 | deleted | 1.004 | 1 | 93 |
|
| AF-A0A3P1WM56-F1-model_v4 | Type II toxin-antitoxin system mRNA interferase RelE | 1.004 | 1 | 68 |
|
| AF-A0A1V3K7R2-F1-model_v4 | deleted | 1.003 | 1 | 93 |
|