F480601
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 782 | 510 | 1564 | 270 |
Family's Representative Sequence
| Representative Sequence | 3300005535|Ga0070684_100095369|Ga0070684_1000953693 |
| Length | 304 |
| Sequence | MPCAIGVARHSGHAGKYRAGAGRRTGASFGGRRILAKVVVITSGKGGVGKTTSSAAFAAGLALRGHRTVVIDFDVGLRNLDLIMGCERRVVFDFINVINRDANLNQALIKDKRNDNLYVFPTSQTRDKDALKREGVERVLEELRQQFDYIVCDSPAGIEHGAITALYFADAAIIVTNPEVSSVRDSDRIIGILASRSRRAERNEAPVELNLLLTRYDSGRVSRGEMMTVEDVQEILSIPLLGVIPESESVLRASNTGTPVTFDTESPAGRAYHDAVARFLGETREMRFVKPERRNFFRVLFGRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 12 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 16 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 17 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 41 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 42 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 45 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 46 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 47 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 48 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 49 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 50 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 51 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 70 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 73 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 74 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 75 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 78 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 79 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 80 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 81 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 86 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 117 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 118 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 126 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 129 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 132 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 133 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 134 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 135 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 136 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 137 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 138 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 139 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 140 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 141 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 142 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 143 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 144 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 145 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 146 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 148 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 149 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 150 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 151 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 152 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 153 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 154 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 155 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 156 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 157 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 158 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 159 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 160 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 161 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 164 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 165 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 166 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 167 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 168 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 169 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 170 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 171 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 172 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 173 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 174 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 175 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 176 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 177 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 178 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 179 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 180 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 181 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 182 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 183 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 184 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 185 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 186 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 187 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 188 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 189 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 190 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 191 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 192 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 193 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 194 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 195 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 261 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 262 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 263 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 264 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 265 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 266 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 267 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 268 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 269 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 270 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 271 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 272 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 273 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 274 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 275 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 276 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 289 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 291 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 292 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 293 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 294 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 295 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 296 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 297 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 298 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 299 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 300 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 301 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 302 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 303 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 304 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 305 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 306 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 307 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 308 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 309 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 310 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 311 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 312 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 313 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 314 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 315 | 2551306352 | Acinetobacter sp. GG2 | Isolate | Rhizosphere |
| 316 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 317 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 318 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 319 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 320 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 321 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 322 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 323 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 324 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 325 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 326 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 327 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 328 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 329 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 330 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 331 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 332 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 333 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 334 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 335 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 336 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 337 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 338 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 339 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 340 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 341 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 342 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 343 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 344 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 345 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 346 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 347 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 348 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 349 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 350 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 351 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 352 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 353 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 354 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 355 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 356 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 357 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 358 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 359 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 360 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 361 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 362 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 363 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 364 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 365 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 366 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 367 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 368 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 369 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 370 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 371 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 372 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 373 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 374 | 2639762793 | Acinetobacter calcoaceticus GK1 | Isolate | Rhizosphere |
| 375 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 376 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 377 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 378 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 379 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 380 | 2643221665 | Acinetobacter sp. Root1280 | Isolate | Unclassified |
| 381 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 382 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 383 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 384 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 385 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 386 | 2675903507 | Acinetobacter calcoaceticus GK2 | Isolate | Unclassified |
| 387 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 388 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 389 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 390 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 391 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 392 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 393 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 394 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 395 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 396 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 397 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 398 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 399 | 2744054655 | Acinetobacter sp. BMW17 | Isolate | Unclassified |
| 400 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 401 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 402 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 403 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 404 | 2773857761 | Acinetobacter sp. 3664 | Isolate | Unclassified |
| 405 | 2773857770 | Acinetobacter sp. 3636 | Isolate | Unclassified |
| 406 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 407 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 408 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 409 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 410 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 411 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 412 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 413 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 414 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 415 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 416 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 417 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 418 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 419 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 420 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 421 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 422 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 423 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 424 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 425 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 426 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 427 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 428 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 429 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 430 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 431 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 432 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 433 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 434 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 435 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 436 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 437 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 438 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 439 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 440 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 441 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 442 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 443 | 2916699645 | Acinetobacter ursingii M3 | Isolate | Unclassified |
| 444 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 445 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 446 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 447 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 448 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 449 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 450 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 451 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 452 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 453 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 454 | 2919506607 | Acinetobacter sp. 3657 | Isolate | Unclassified |
| 455 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 456 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 457 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 458 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 459 | 2928515477 | Acinetobacter bereziniae 1375 | Isolate | Rhizosphere |
| 460 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 461 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 462 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 463 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 464 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 465 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 466 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 467 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 468 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 469 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 470 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 471 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 472 | 2984568884 | Acinetobacter baylyi SORGH_AS893 | Isolate | Aerial Root |
| 473 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 474 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 475 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 476 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 477 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 478 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 479 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 480 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 481 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 482 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 483 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 484 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 485 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 486 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 487 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 488 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 489 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 490 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 491 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 492 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 493 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 494 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 495 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 496 | 8033232454 | Acinetobacter radioresistens SA188 | Isolate | Unclassified |
| 497 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 498 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 499 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 500 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 501 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 502 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 503 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 504 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 505 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 506 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 507 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 508 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 509 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 510 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 71.1 |
| Metatranscriptomes | 0.64 |
| Isolates | 28.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.38 |
| Bulb | 0 |
| Endosphere | 4.86 |
| Nodule | 3.32 |
| Rhizoplane | 8.44 |
| Rhizosphere | 69.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070684_100095369 | 3300005535 | Bacteria | 2650 |
| 2 | MRS2a_Contig_23 | 2124908027 | Bacteria | 55080 |
| 3 | MRS2a_Contig_6280 | 2124908027 | Bacteria | 1660 |
| 4 | SwRhRL2b_contig_2798511 | 2162886007 | Bacteria | 2305 |
| 5 | JGI25162J39368_1000251 | 3300002737 | Bacteria | 52332 |
| 6 | JGI25162J39368_1000315 | 3300002737 | Bacteria | 42934 |
| 7 | JGI25163J39215_1001111 | 3300002771 | Bacteria | 5465 |
| 8 | JGI25164J39214_1000194 | 3300002772 | Bacteria | 52332 |
| 9 | JGI25164J39214_1000411 | 3300002772 | Bacteria | 24391 |
| 10 | JGI25159J45721_1001567 | 3300002987 | Bacteria | 9372 |
| 11 | JGI25165J46597_1000348 | 3300003214 | Bacteria | 52332 |
| 12 | JGI25165J46597_1000430 | 3300003214 | Bacteria | 42934 |
| 13 | rootH2_10091229 | 3300003320 | Bacteria | 5621 |
| 14 | rootH1_10005337 | 3300003323 | Bacteria | 42291 |
| 15 | rootH1_10167004 | 3300003323 | Bacteria | 9914 |
| 16 | Ga0006562J51391_1018591 | 3300003578 | Bacteria | 3510 |
| 17 | Ga0006562J51391_1037971 | 3300003578 | Bacteria | 1941 |
| 18 | Ga0055524_1000017 | 3300003775 | Bacteria | 235608 |
| 19 | Ga0055536_1004018 | 3300003781 | Bacteria | 7673 |
| 20 | Ga0055531_10000997 | 3300003794 | Bacteria | 22497 |
| 21 | Ga0058692_1000014 | 3300003856 | Bacteria | 313984 |
| 22 | Ga0065703_1000184 | 3300005272 | Bacteria | 28729 |
| 23 | Ga0065714_10000034 | 3300005288 | Bacteria | 15985 |
| 24 | Ga0065714_10070725 | 3300005288 | Bacteria | 3783 |
| 25 | Ga0065714_10183392 | 3300005288 | Bacteria | 954 |
| 26 | Ga0065704_10015961 | 3300005289 | Bacteria | 3535 |
| 27 | Ga0065704_10194481 | 3300005289 | Bacteria | 1174 |
| 28 | Ga0065712_10067911 | 3300005290 | Bacteria | 21555 |
| 29 | Ga0065712_10069558 | 3300005290 | Bacteria | 7067 |
| 30 | Ga0065715_10234727 | 3300005293 | Bacteria | 1215 |
| 31 | Ga0070682_100033828 | 3300005337 | Bacteria | 3108 |
| 32 | Ga0070660_100030566 | 3300005339 | Bacteria | 4040 |
| 33 | Ga0070669_100008078 | 3300005353 | Bacteria | 7518 |
| 34 | Ga0070671_100029170 | 3300005355 | Bacteria | 4550 |
| 35 | Ga0070671_100179916 | 3300005355 | Bacteria | 1790 |
| 36 | Ga0070709_10010843 | 3300005434 | Bacteria | 5058 |
| 37 | Ga0070714_100032520 | 3300005435 | Bacteria | 4355 |
| 38 | Ga0070714_100254214 | 3300005435 | Bacteria | 1626 |
| 39 | Ga0070713_100091115 | 3300005436 | Bacteria | 2622 |
| 40 | Ga0070713_100288260 | 3300005436 | Bacteria | 1508 |
| 41 | Ga0070710_10111820 | 3300005437 | Bacteria | 1641 |
| 42 | Ga0070711_100024685 | 3300005439 | Bacteria | 3925 |
| 43 | Ga0070711_100210121 | 3300005439 | Bacteria | 1507 |
| 44 | Ga0070711_100494301 | 3300005439 | Bacteria | 1008 |
| 45 | Ga0070708_100310713 | 3300005445 | Bacteria | 1485 |
| 46 | Ga0070662_100032504 | 3300005457 | Bacteria | 3667 |
| 47 | Ga0070706_100018287 | 3300005467 | Bacteria | 6467 |
| 48 | Ga0070706_100093967 | 3300005467 | Bacteria | 2783 |
| 49 | Ga0070707_100020705 | 3300005468 | Bacteria | 6207 |
| 50 | Ga0070698_100017589 | 3300005471 | Bacteria | 7533 |
| 51 | Ga0070698_100401646 | 3300005471 | Bacteria | 1304 |
| 52 | Ga0070698_100406750 | 3300005471 | Bacteria | 1295 |
| 53 | Ga0070699_100172711 | 3300005518 | Bacteria | 1915 |
| 54 | Ga0070699_100382835 | 3300005518 | Bacteria | 1270 |
| 55 | Ga0070699_100466838 | 3300005518 | Bacteria | 1145 |
| 56 | Ga0070697_100031861 | 3300005536 | Bacteria | 4242 |
| 57 | Ga0070697_100336889 | 3300005536 | Bacteria | 1301 |
| 58 | Ga0070665_100018863 | 3300005548 | Bacteria | 6917 |
| 59 | Ga0068861_100552079 | 3300005719 | Bacteria | 1050 |
| 60 | Ga0070717_10011796 | 3300006028 | Bacteria | 6647 |
| 61 | Ga0075364_10068387 | 3300006051 | Bacteria | 2336 |
| 62 | Ga0075432_10101495 | 3300006058 | Bacteria | 1063 |
| 63 | Ga0075432_10130832 | 3300006058 | Bacteria | 950 |
| 64 | Ga0070716_100029621 | 3300006173 | Bacteria | 2962 |
| 65 | Ga0070716_100053936 | 3300006173 | Bacteria | 2294 |
| 66 | Ga0070712_100013081 | 3300006175 | Bacteria | 5292 |
| 67 | Ga0070712_100027336 | 3300006175 | Bacteria | 3809 |
| 68 | Ga0075362_10056973 | 3300006177 | Bacteria | 1760 |
| 69 | Ga0075370_10143729 | 3300006353 | Bacteria | 1395 |
| 70 | Ga0075434_100059625 | 3300006871 | Bacteria | 3794 |
| 71 | Ga0075436_100012460 | 3300006914 | Bacteria | 5827 |
| 72 | Ga0079104_1000982 | 3300006946 | Bacteria | 22250 |
| 73 | Ga0099826_10003959 | 3300006948 | Bacteria | 10255 |
| 74 | Ga0099795_10001078 | 3300007788 | Bacteria | 5642 |
| 75 | Ga0099795_10008269 | 3300007788 | Bacteria | 2958 |
| 76 | Ga0105251_10000035 | 3300009011 | Bacteria | 117861 |
| 77 | Ga0105251_10005924 | 3300009011 | Bacteria | 7901 |
| 78 | Ga0105251_10032130 | 3300009011 | Bacteria | 2619 |
| 79 | Ga0105251_10065962 | 3300009011 | Bacteria | 1693 |
| 80 | Ga0105251_10083088 | 3300009011 | Bacteria | 1479 |
| 81 | Ga0105251_10083294 | 3300009011 | Bacteria | 1477 |
| 82 | Ga0105251_10200108 | 3300009011 | Bacteria | 900 |
| 83 | Ga0105244_10001134 | 3300009036 | Bacteria | 22154 |
| 84 | Ga0105244_10017376 | 3300009036 | Bacteria | 4066 |
| 85 | Ga0105244_10031086 | 3300009036 | Bacteria | 2835 |
| 86 | Ga0105244_10091482 | 3300009036 | Bacteria | 1495 |
| 87 | Ga0105250_10000056 | 3300009092 | Bacteria | 114085 |
| 88 | Ga0105250_10011835 | 3300009092 | Bacteria | 3616 |
| 89 | Ga0105250_10023276 | 3300009092 | Bacteria | 2496 |
| 90 | Ga0105250_10023995 | 3300009092 | Bacteria | 2458 |
| 91 | Ga0105250_10041937 | 3300009092 | Bacteria | 1834 |
| 92 | Ga0105240_10004855 | 3300009093 | Bacteria | 20243 |
| 93 | Ga0105240_10041595 | 3300009093 | Bacteria | 5864 |
| 94 | Ga0105240_10260407 | 3300009093 | Bacteria | 2001 |
| 95 | Ga0105243_10000249 | 3300009148 | Bacteria | 61872 |
| 96 | Ga0105243_10001441 | 3300009148 | Bacteria | 20939 |
| 97 | Ga0105243_10002007 | 3300009148 | Bacteria | 17310 |
| 98 | Ga0105243_10036370 | 3300009148 | Bacteria | 3822 |
| 99 | Ga0105242_10306473 | 3300009176 | Bacteria | 1451 |
| 100 | Ga0105242_10554592 | 3300009176 | Bacteria | 1102 |
| 101 | Ga0105249_10000342 | 3300009553 | Bacteria | 47083 |
| 102 | Ga0099796_10010745 | 3300010159 | Bacteria | 2527 |
| 103 | Ga0099796_10028241 | 3300010159 | Bacteria | 1799 |
| 104 | Ga0105239_10344886 | 3300010375 | Bacteria | 1681 |
| 105 | Ga0105246_10001895 | 3300011119 | Bacteria | 12596 |
| 106 | Ga0105246_10007270 | 3300011119 | Bacteria | 6785 |
| 107 | Ga0105246_10270088 | 3300011119 | Bacteria | 1359 |
| 108 | Ga0157373_10009442 | 3300013100 | Bacteria | 7206 |
| 109 | Ga0157373_10036301 | 3300013100 | Bacteria | 3538 |
| 110 | Ga0157373_10133656 | 3300013100 | Bacteria | 1744 |
| 111 | Ga0157371_10014441 | 3300013102 | Bacteria | 5959 |
| 112 | Ga0157371_10017060 | 3300013102 | Bacteria | 5402 |
| 113 | Ga0157371_10029699 | 3300013102 | Bacteria | 3949 |
| 114 | Ga0157371_10209200 | 3300013102 | Bacteria | 1400 |
| 115 | Ga0157370_10064240 | 3300013104 | Bacteria | 3475 |
| 116 | Ga0157370_10383435 | 3300013104 | Bacteria | 1294 |
| 117 | Ga0157369_10004688 | 3300013105 | Bacteria | 16077 |
| 118 | Ga0157374_10430858 | 3300013296 | Bacteria | 1318 |
| 119 | Ga0163162_10065357 | 3300013306 | Bacteria | 3684 |
| 120 | Ga0157372_10038059 | 3300013307 | Bacteria | 5308 |
| 121 | Ga0157372_10727607 | 3300013307 | Bacteria | 1154 |
| 122 | Ga0157375_10308655 | 3300013308 | Bacteria | 1746 |
| 123 | Ga0182008_10023277 | 3300014497 | Bacteria | 3166 |
| 124 | Ga0182008_10029769 | 3300014497 | Bacteria | 2756 |
| 125 | Ga0182008_10090027 | 3300014497 | Bacteria | 1512 |
| 126 | Ga0157377_10222222 | 3300014745 | Bacteria | 1210 |
| 127 | Ga0157379_10316027 | 3300014968 | Bacteria | 1425 |
| 128 | Ga0182006_1006419 | 3300015261 | Bacteria | 5469 |
| 129 | Ga0182006_1009493 | 3300015261 | Bacteria | 4358 |
| 130 | Ga0182006_1035789 | 3300015261 | Bacteria | 1976 |
| 131 | Ga0182007_10001991 | 3300015262 | Bacteria | 10535 |
| 132 | Ga0182005_1008729 | 3300015265 | Bacteria | 2976 |
| 133 | Ga0182005_1076232 | 3300015265 | Bacteria | 923 |
| 134 | Ga0163161_10084202 | 3300017792 | Bacteria | 2345 |
| 135 | Ga0206352_11149150 | 3300020078 | Bacteria | 2530 |
| 136 | Ga0213873_10014176 | 3300021358 | Bacteria | 1762 |
| 137 | Ga0213872_10000652 | 3300021361 | Bacteria | 26299 |
| 138 | Ga0213872_10001532 | 3300021361 | Bacteria | 14857 |
| 139 | Ga0213872_10001557 | 3300021361 | Bacteria | 14685 |
| 140 | Ga0213872_10001677 | 3300021361 | Bacteria | 13937 |
| 141 | Ga0213872_10026800 | 3300021361 | Bacteria | 2647 |
| 142 | Ga0213874_10009670 | 3300021377 | Bacteria | 2391 |
| 143 | Ga0213875_10000145 | 3300021388 | Bacteria | 75194 |
| 144 | Ga0213875_10006534 | 3300021388 | Bacteria | 6104 |
| 145 | Ga0209760_100011 | 3300025207 | Bacteria | 197221 |
| 146 | Ga0209760_100064 | 3300025207 | Bacteria | 91180 |
| 147 | Ga0209563_100495 | 3300025230 | Bacteria | 13358 |
| 148 | Ga0207427_100008 | 3300025231 | Bacteria | 740731 |
| 149 | Ga0207427_100082 | 3300025231 | Bacteria | 142809 |
| 150 | Ga0209437_100006 | 3300025233 | Bacteria | 1042724 |
| 151 | Ga0209437_100014 | 3300025233 | Bacteria | 740714 |
| 152 | Ga0209759_1007138 | 3300025256 | Bacteria | 3642 |
| 153 | Ga0209233_1000008 | 3300025261 | Bacteria | 1356712 |
| 154 | Ga0209233_1000105 | 3300025261 | Bacteria | 272035 |
| 155 | Ga0209675_1017364 | 3300025291 | Bacteria | 2058 |
| 156 | Ga0209676_1000006 | 3300025292 | Bacteria | 1039588 |
| 157 | Ga0209676_1000369 | 3300025292 | Bacteria | 83704 |
| 158 | Ga0209676_1000803 | 3300025292 | Bacteria | 41332 |
| 159 | Ga0209676_1001140 | 3300025292 | Bacteria | 29053 |
| 160 | Ga0209050_1000070 | 3300025298 | Bacteria | 296366 |
| 161 | Ga0209050_1000235 | 3300025298 | Bacteria | 121420 |
| 162 | Ga0209050_1000380 | 3300025298 | Bacteria | 83704 |
| 163 | Ga0209050_1001241 | 3300025298 | Bacteria | 29500 |
| 164 | Ga0209051_1000086 | 3300025303 | Bacteria | 183550 |
| 165 | Ga0209051_1000123 | 3300025303 | Bacteria | 144298 |
| 166 | Ga0209051_1001064 | 3300025303 | Bacteria | 25530 |
| 167 | Ga0209257_1000421 | 3300025304 | Bacteria | 81748 |
| 168 | Ga0209257_1005819 | 3300025304 | Bacteria | 8368 |
| 169 | Ga0207696_1000025 | 3300025711 | Bacteria | 418650 |
| 170 | Ga0207696_1000144 | 3300025711 | Bacteria | 122345 |
| 171 | Ga0207696_1003214 | 3300025711 | Bacteria | 7545 |
| 172 | Ga0207696_1006143 | 3300025711 | Bacteria | 4883 |
| 173 | Ga0207696_1006846 | 3300025711 | Bacteria | 4537 |
| 174 | Ga0207696_1013375 | 3300025711 | Bacteria | 2862 |
| 175 | Ga0207655_1000183 | 3300025728 | Bacteria | 112295 |
| 176 | Ga0207655_1000592 | 3300025728 | Bacteria | 44578 |
| 177 | Ga0207655_1000976 | 3300025728 | Bacteria | 29345 |
| 178 | Ga0207655_1001969 | 3300025728 | Bacteria | 17531 |
| 179 | Ga0207655_1003070 | 3300025728 | Bacteria | 12720 |
| 180 | Ga0207655_1005485 | 3300025728 | Bacteria | 8608 |
| 181 | Ga0207655_1006081 | 3300025728 | Bacteria | 8057 |
| 182 | Ga0207655_1008047 | 3300025728 | Bacteria | 6758 |
| 183 | Ga0207655_1010633 | 3300025728 | Bacteria | 5564 |
| 184 | Ga0207655_1012126 | 3300025728 | Bacteria | 5067 |
| 185 | Ga0207655_1025877 | 3300025728 | Bacteria | 2835 |
| 186 | Ga0207713_1001249 | 3300025735 | Bacteria | 21049 |
| 187 | Ga0207713_1001767 | 3300025735 | Bacteria | 16571 |
| 188 | Ga0207713_1003135 | 3300025735 | Bacteria | 11460 |
| 189 | Ga0207713_1003177 | 3300025735 | Bacteria | 11369 |
| 190 | Ga0207713_1006088 | 3300025735 | Bacteria | 7431 |
| 191 | Ga0207713_1014429 | 3300025735 | Bacteria | 4108 |
| 192 | Ga0207713_1047856 | 3300025735 | Bacteria | 1727 |
| 193 | Ga0207692_10010663 | 3300025898 | Bacteria | 3882 |
| 194 | Ga0207692_10023731 | 3300025898 | Bacteria | 2841 |
| 195 | Ga0207710_10000122 | 3300025900 | Bacteria | 94509 |
| 196 | Ga0207684_10378695 | 3300025910 | Bacteria | 1217 |
| 197 | Ga0207707_10030684 | 3300025912 | Bacteria | 4703 |
| 198 | Ga0207707_10231927 | 3300025912 | Bacteria | 1606 |
| 199 | Ga0207695_10015272 | 3300025913 | Bacteria | 9052 |
| 200 | Ga0207693_10005303 | 3300025915 | Bacteria | 10773 |
| 201 | Ga0207693_10052530 | 3300025915 | Bacteria | 3197 |
| 202 | Ga0207693_10071210 | 3300025915 | Bacteria | 2721 |
| 203 | Ga0207663_10341937 | 3300025916 | Bacteria | 1130 |
| 204 | Ga0207660_10387537 | 3300025917 | Bacteria | 1124 |
| 205 | Ga0207652_10100233 | 3300025921 | Bacteria | 2557 |
| 206 | Ga0207646_10009040 | 3300025922 | Bacteria | 9898 |
| 207 | Ga0207681_10005882 | 3300025923 | Bacteria | 7524 |
| 208 | Ga0207681_10088241 | 3300025923 | Bacteria | 2208 |
| 209 | Ga0207700_10002928 | 3300025928 | Bacteria | 9849 |
| 210 | Ga0207700_10183041 | 3300025928 | Bacteria | 1756 |
| 211 | Ga0207700_10208336 | 3300025928 | Bacteria | 1651 |
| 212 | Ga0207664_10016110 | 3300025929 | Bacteria | 5446 |
| 213 | Ga0207664_10127472 | 3300025929 | Bacteria | 2138 |
| 214 | Ga0207664_10520324 | 3300025929 | Bacteria | 1066 |
| 215 | Ga0207644_10109678 | 3300025931 | Bacteria | 2085 |
| 216 | Ga0207709_10000001 | 3300025935 | Bacteria | 2228154 |
| 217 | Ga0207709_10000223 | 3300025935 | Bacteria | 71537 |
| 218 | Ga0207709_10000835 | 3300025935 | Bacteria | 23621 |
| 219 | Ga0207709_10030554 | 3300025935 | Bacteria | 3135 |
| 220 | Ga0207665_10006644 | 3300025939 | Bacteria | 7673 |
| 221 | Ga0207665_10033004 | 3300025939 | Bacteria | 3429 |
| 222 | Ga0207665_10049356 | 3300025939 | Bacteria | 2827 |
| 223 | Ga0207712_10001909 | 3300025961 | Bacteria | 13702 |
| 224 | Ga0207703_10319423 | 3300026035 | Bacteria | 1422 |
| 225 | Ga0207702_10031690 | 3300026078 | Bacteria | 4407 |
| 226 | Ga0207641_10435466 | 3300026088 | Bacteria | 1265 |
| 227 | Ga0207676_10416744 | 3300026095 | Bacteria | 1259 |
| 228 | Ga0209281_1000010 | 3300027111 | Bacteria | 726106 |
| 229 | Ga0209281_1000331 | 3300027111 | Bacteria | 81645 |
| 230 | Ga0209281_1005471 | 3300027111 | Bacteria | 3515 |
| 231 | Ga0209389_1000031 | 3300027296 | Bacteria | 138036 |
| 232 | Ga0209371_1000040 | 3300027312 | Bacteria | 340804 |
| 233 | Ga0209371_1000182 | 3300027312 | Bacteria | 92399 |
| 234 | Ga0209371_1000589 | 3300027312 | Bacteria | 32598 |
| 235 | Ga0209371_1017352 | 3300027312 | Bacteria | 1867 |
| 236 | Ga0209969_1013169 | 3300027360 | Bacteria | 1196 |
| 237 | Ga0209984_1001806 | 3300027424 | Bacteria | 2351 |
| 238 | Ga0209179_1019988 | 3300027512 | Bacteria | 1295 |
| 239 | Ga0209999_1002159 | 3300027543 | Bacteria | 3443 |
| 240 | Ga0209982_1009659 | 3300027552 | Bacteria | 1427 |
| 241 | Ga0209983_1000763 | 3300027665 | Bacteria | 7000 |
| 242 | Ga0209282_1054335 | 3300027666 | Bacteria | 2273 |
| 243 | Ga0209971_1000554 | 3300027682 | Bacteria | 9762 |
| 244 | Ga0209974_10007616 | 3300027876 | Bacteria | 3729 |
| 245 | Ga0207428_10238370 | 3300027907 | Bacteria | 1360 |
| 246 | Ga0268266_10014923 | 3300028379 | Bacteria | 6671 |
| 247 | Ga0268266_10055084 | 3300028379 | Bacteria | 3418 |
| 248 | Ga0268265_10473215 | 3300028380 | Bacteria | 1175 |
| 249 | Ga0307515_10002349 | 3300028794 | Bacteria | 41308 |
| 250 | Ga0265338_10006011 | 3300028800 | Bacteria | 15594 |
| 251 | Ga0265338_10155737 | 3300028800 | Bacteria | 1770 |
| 252 | Ga0268256_1000041 | 3300030500 | Bacteria | 340725 |
| 253 | Ga0268256_1000153 | 3300030500 | Bacteria | 92399 |
| 254 | Ga0268256_1000511 | 3300030500 | Bacteria | 32598 |
| 255 | Ga0268256_1019341 | 3300030500 | Bacteria | 1867 |
| 256 | Ga0316177_1211506 | 3300030731 | Bacteria | 2006 |
| 257 | Ga0316179_1028994 | 3300030734 | Bacteria | 2584 |
| 258 | Ga0316178_1108793 | 3300030735 | Bacteria | 13326 |
| 259 | Ga0316183_1189572 | 3300030742 | Bacteria | 1868 |
| 260 | Ga0265327_10013441 | 3300031251 | Bacteria | 5435 |
| 261 | Ga0265327_10031808 | 3300031251 | Bacteria | 2960 |
| 262 | Ga0307408_100000025 | 3300031548 | Bacteria | 267563 |
| 263 | Ga0307408_100000192 | 3300031548 | Bacteria | 65993 |
| 264 | Ga0265314_10038335 | 3300031711 | Bacteria | 3463 |
| 265 | Ga0307413_10226145 | 3300031824 | Bacteria | 1370 |
| 266 | Ga0307406_10004592 | 3300031901 | Bacteria | 7515 |
| 267 | Ga0307416_100018095 | 3300032002 | Bacteria | 4953 |
| 268 | Ga0307416_100311510 | 3300032002 | Bacteria | 1571 |
| 269 | Ga0307414_10009804 | 3300032004 | Bacteria | 5521 |
| 270 | Ga0307510_10084516 | 3300033180 | Bacteria | 3056 |
| 271 | Ga0316592_1010457 | 3300033524 | Bacteria | 1873 |
| 272 | Ga0373926_0056900 | 3300035083 | Bacteria | 1419 |
| 273 | Ga0373934_0048463 | 3300035086 | Bacteria | 1682 |
| 274 | Ga0373936_0078468 | 3300035113 | Bacteria | 1371 |
| 275 | Ga0373936_0144144 | 3300035113 | Bacteria | 1030 |
| 276 | Ga0373945_0004496 | 3300035116 | Bacteria | 4435 |
| 277 | Ga0373954_0015261 | 3300035118 | Bacteria | 3433 |
| 278 | Ga0373956_0025169 | 3300035119 | Bacteria | 2570 |
| 279 | Ga0373943_0015057 | 3300035170 | Bacteria | 3511 |
| 280 | Ga0373946_0011231 | 3300035171 | Bacteria | 3336 |
| 281 | Ga0373955_0012134 | 3300035172 | Bacteria | 4135 |
| 282 | Ga0373931_0031538 | 3300035691 | Bacteria | 2736 |
| 283 | Ga0373935_0070416 | 3300035692 | Bacteria | 2254 |
| 284 | Ga0373935_0258906 | 3300035692 | Bacteria | 1220 |
| 285 | Ga0373927_0027023 | 3300035695 | Bacteria | 3750 |
| 286 | Ga0373933_0029653 | 3300035724 | Bacteria | 3165 |
| 287 | Ga0373933_0086916 | 3300035724 | Bacteria | 1925 |
| 288 | Ga0373947_0035501 | 3300035725 | Bacteria | 2952 |
| 289 | Ga0373947_0128505 | 3300035725 | Bacteria | 1615 |
| 290 | Ga0373937_0006327 | 3300036401 | Bacteria | 10209 |
| 291 | Ga0373937_0020176 | 3300036401 | Bacteria | 5973 |
| 292 | Ga0373937_0027602 | 3300036401 | Bacteria | 5135 |
| 293 | Ga0373937_0216263 | 3300036401 | Bacteria | 1804 |
| 294 | Ga0373925_0257410 | 3300037068 | Bacteria | 1401 |
| 295 | Ga0395905_0004104 | 3300037471 | Bacteria | 15258 |
| 296 | Ga0436364_0056880 | 3300037853 | Bacteria | 87492 |
| 297 | Ga0436364_0723260 | 3300037853 | Bacteria | 46751 |
| 298 | Ga0436364_1260460 | 3300037853 | Bacteria | 34019 |
| 299 | Ga0395901_0180939 | 3300038443 | Bacteria | 2211 |
| 300 | Ga0237819_09277 | 3300038705 | Bacteria | 1326 |
| 301 | Ga0400487_28623 | 3300039110 | Bacteria | 17274 |
| 302 | Ga0436365_0036381 | 3300039437 | Bacteria | 1551 |
| 303 | Ga0436365_1164564 | 3300039437 | Bacteria | 2425 |
| 304 | Ga0436360_0186592 | 3300039438 | Bacteria | 4129 |
| 305 | Ga0436360_0307969 | 3300039438 | Bacteria | 1537 |
| 306 | Ga0436360_0572509 | 3300039438 | Bacteria | 1403 |
| 307 | Ga0436360_0734628 | 3300039438 | Bacteria | 2392 |
| 308 | Ga0436360_0800231 | 3300039438 | Bacteria | 2473 |
| 309 | Ga0436360_0839587 | 3300039438 | Bacteria | 1977 |
| 310 | Ga0436361_0284071 | 3300039447 | Bacteria | 50310 |
| 311 | Ga0436361_0606756 | 3300039447 | Bacteria | 2209 |
| 312 | Ga0436361_0714916 | 3300039447 | Bacteria | 984 |
| 313 | Ga0436361_1053619 | 3300039447 | Bacteria | 7181 |
| 314 | Ga0436361_1216557 | 3300039447 | Bacteria | 1915 |
| 315 | Ga0436363_0451735 | 3300039450 | Bacteria | 2405 |
| 316 | Ga0436363_1129503 | 3300039450 | Bacteria | 1188 |
| 317 | Ga0436363_1381957 | 3300039450 | Bacteria | 1375 |
| 318 | Ga0436363_1460963 | 3300039450 | Bacteria | 4458 |
| 319 | Ga0436362_0220171 | 3300039453 | Bacteria | 1319 |
| 320 | Ga0436362_0436236 | 3300039453 | Bacteria | 3595 |
| 321 | Ga0436362_0656757 | 3300039453 | Bacteria | 2439 |
| 322 | Ga0436362_0999455 | 3300039453 | Bacteria | 1321 |
| 323 | Ga0439438_001471 | 3300041405 | Bacteria | 10380 |
| 324 | Ga0439438_005024 | 3300041405 | Bacteria | 4936 |
| 325 | Ga0439438_008558 | 3300041405 | Bacteria | 3382 |
| 326 | Ga0439438_008813 | 3300041405 | Bacteria | 3309 |
| 327 | Ga0439447_002251 | 3300041407 | Bacteria | 7074 |
| 328 | Ga0439466_0002838 | 3300041411 | Bacteria | 6779 |
| 329 | Ga0439466_0004194 | 3300041411 | Bacteria | 5560 |
| 330 | Ga0439466_0008003 | 3300041411 | Bacteria | 3986 |
| 331 | Ga0439432_000967 | 3300042006 | Bacteria | 10835 |
| 332 | Ga0439432_002797 | 3300042006 | Bacteria | 6506 |
| 333 | Ga0439451_015276 | 3300042009 | Bacteria | 1547 |
| 334 | Ga0439452_001447 | 3300042010 | Bacteria | 9700 |
| 335 | Ga0439452_005155 | 3300042010 | Bacteria | 4250 |
| 336 | Ga0439456_003614 | 3300042013 | Bacteria | 3141 |
| 337 | Ga0439463_003014 | 3300042016 | Bacteria | 4274 |
| 338 | Ga0450905_003390 | 3300042142 | Bacteria | 2094 |
| 339 | Ga0450907_000326 | 3300042146 | Bacteria | 15234 |
| 340 | Ga0439446_0000172 | 3300042156 | Bacteria | 11417 |
| 341 | Ga0439446_0007048 | 3300042156 | Bacteria | 2946 |
| 342 | Ga0439444_0004568 | 3300042437 | Bacteria | 2020 |
| 343 | Ga0439460_0002152 | 3300042461 | Bacteria | 4727 |
| 344 | Ga0451577_0157217 | 3300042876 | Bacteria | 2046 |
| 345 | Ga0451577_0290548 | 3300042876 | Bacteria | 1481 |
| 346 | Ga0439440_0004886 | 3300042993 | Bacteria | 2644 |
| 347 | Ga0466966_0102598 | 3300044684 | Bacteria | 1768 |
| 348 | Ga0453684_0002079 | 3300044712 | Bacteria | 50825 |
| 349 | Ga0453684_0003561 | 3300044712 | Bacteria | 34833 |
| 350 | Ga0466957_0378394 | 3300044842 | Bacteria | 965 |
| 351 | Ga0466959_0620050 | 3300045049 | Unclassified | 727 |
| 352 | Ga0451576_0001285 | 3300045051 | Bacteria | 43656 |
| 353 | Ga0451576_0021642 | 3300045051 | Bacteria | 6987 |
| 354 | Ga0451576_0024670 | 3300045051 | Bacteria | 6492 |
| 355 | Ga0466958_0001326 | 3300045836 | Bacteria | 11669 |
| 356 | Ga0466958_0302669 | 3300045836 | Bacteria | 1027 |
| 357 | Ga0466967_0416720 | 3300045976 | Bacteria | 1308 |
| 358 | Ga0466967_0558682 | 3300045976 | Bacteria | 1127 |
| 359 | Ga0495617_001158 | 3300046452 | Bacteria | 11919 |
| 360 | Ga0495627_000040 | 3300046453 | Bacteria | 195248 |
| 361 | Ga0495627_000137 | 3300046453 | Bacteria | 87495 |
| 362 | Ga0495603_0003767 | 3300046455 | Bacteria | 9020 |
| 363 | Ga0495603_0049463 | 3300046455 | Bacteria | 2502 |
| 364 | Ga0495590_0002219 | 3300046457 | Bacteria | 8116 |
| 365 | Ga0495591_000023 | 3300046458 | Bacteria | 191598 |
| 366 | Ga0495591_001514 | 3300046458 | Bacteria | 14316 |
| 367 | Ga0495591_007986 | 3300046458 | Bacteria | 4398 |
| 368 | Ga0495638_0077961 | 3300046460 | Bacteria | 2016 |
| 369 | Ga0495653_0029603 | 3300046463 | Bacteria | 4369 |
| 370 | Ga0495650_0007260 | 3300046471 | Bacteria | 6710 |
| 371 | Ga0495650_0050834 | 3300046471 | Bacteria | 1711 |
| 372 | Ga0495580_0022084 | 3300046472 | Bacteria | 4689 |
| 373 | Ga0495605_0000245 | 3300046474 | Bacteria | 64374 |
| 374 | Ga0495605_0001067 | 3300046474 | Bacteria | 18295 |
| 375 | Ga0495605_0002605 | 3300046474 | Bacteria | 11085 |
| 376 | Ga0495605_0010029 | 3300046474 | Bacteria | 5306 |
| 377 | Ga0495605_0029245 | 3300046474 | Bacteria | 2839 |
| 378 | Ga0495662_0101796 | 3300046476 | Bacteria | 1405 |
| 379 | Ga0495584_0014523 | 3300046491 | Bacteria | 4011 |
| 380 | Ga0495585_0002457 | 3300046492 | Bacteria | 13263 |
| 381 | Ga0495585_0011404 | 3300046492 | Bacteria | 5259 |
| 382 | Ga0495585_0013930 | 3300046492 | Bacteria | 4696 |
| 383 | Ga0495585_0058023 | 3300046492 | Bacteria | 2135 |
| 384 | Ga0495596_0000001 | 3300046500 | Bacteria | 501331 |
| 385 | Ga0495596_0000375 | 3300046500 | Bacteria | 28559 |
| 386 | Ga0495607_0000097 | 3300046501 | Bacteria | 92021 |
| 387 | Ga0495607_0000234 | 3300046501 | Bacteria | 59488 |
| 388 | Ga0495607_0000893 | 3300046501 | Bacteria | 27775 |
| 389 | Ga0495607_0000972 | 3300046501 | Bacteria | 26545 |
| 390 | Ga0495607_0004021 | 3300046501 | Bacteria | 11034 |
| 391 | Ga0495607_0022053 | 3300046501 | Bacteria | 4003 |
| 392 | Ga0495583_0003081 | 3300046506 | Bacteria | 13200 |
| 393 | Ga0495583_0003683 | 3300046506 | Bacteria | 11408 |
| 394 | Ga0495606_0000167 | 3300046507 | Bacteria | 115739 |
| 395 | Ga0495606_0003593 | 3300046507 | Bacteria | 16335 |
| 396 | Ga0495606_0004329 | 3300046507 | Bacteria | 14275 |
| 397 | Ga0495606_0045902 | 3300046507 | Bacteria | 2891 |
| 398 | Ga0495610_0026298 | 3300046512 | Bacteria | 3108 |
| 399 | Ga0495610_0045368 | 3300046512 | Bacteria | 2175 |
| 400 | Ga0495616_0018868 | 3300046513 | Bacteria | 3772 |
| 401 | Ga0495616_0039392 | 3300046513 | Bacteria | 2420 |
| 402 | Ga0495616_0058008 | 3300046513 | Bacteria | 1907 |
| 403 | Ga0495620_0000003 | 3300046515 | Bacteria | 345923 |
| 404 | Ga0495620_0009640 | 3300046515 | Bacteria | 5125 |
| 405 | Ga0495620_0052081 | 3300046515 | Bacteria | 1740 |
| 406 | Ga0495630_0094256 | 3300046517 | Bacteria | 2263 |
| 407 | Ga0495631_0001015 | 3300046518 | Bacteria | 17434 |
| 408 | Ga0495631_0006645 | 3300046518 | Bacteria | 5946 |
| 409 | Ga0495631_0055140 | 3300046518 | Bacteria | 1731 |
| 410 | Ga0495632_0001340 | 3300046519 | Bacteria | 20692 |
| 411 | Ga0495632_0003328 | 3300046519 | Bacteria | 11458 |
| 412 | Ga0495632_0004266 | 3300046519 | Bacteria | 9758 |
| 413 | Ga0495632_0079706 | 3300046519 | Bacteria | 1563 |
| 414 | Ga0495637_0000583 | 3300046520 | Bacteria | 25971 |
| 415 | Ga0495637_0002931 | 3300046520 | Bacteria | 9200 |
| 416 | Ga0495637_0003057 | 3300046520 | Bacteria | 8945 |
| 417 | Ga0495637_0024711 | 3300046520 | Bacteria | 2717 |
| 418 | Ga0495643_0000673 | 3300046522 | Bacteria | 40197 |
| 419 | Ga0495643_0001803 | 3300046522 | Bacteria | 18339 |
| 420 | Ga0495644_0003207 | 3300046523 | Bacteria | 6461 |
| 421 | Ga0495648_0003579 | 3300046524 | Bacteria | 13596 |
| 422 | Ga0495648_0004170 | 3300046524 | Bacteria | 12431 |
| 423 | Ga0495648_0010693 | 3300046524 | Bacteria | 6971 |
| 424 | Ga0495642_0001942 | 3300046528 | Bacteria | 8738 |
| 425 | Ga0495642_0006012 | 3300046528 | Bacteria | 4661 |
| 426 | Ga0495654_0008388 | 3300046530 | Bacteria | 5712 |
| 427 | Ga0495654_0015800 | 3300046530 | Bacteria | 4003 |
| 428 | Ga0495654_0035682 | 3300046530 | Bacteria | 2501 |
| 429 | Ga0495654_0040236 | 3300046530 | Bacteria | 2330 |
| 430 | Ga0495586_0034252 | 3300046535 | Bacteria | 2727 |
| 431 | Ga0495587_0006269 | 3300046536 | Bacteria | 7762 |
| 432 | Ga0495609_0000167 | 3300046538 | Bacteria | 68911 |
| 433 | Ga0495609_0003356 | 3300046538 | Bacteria | 9226 |
| 434 | Ga0495609_0006411 | 3300046538 | Bacteria | 6005 |
| 435 | Ga0495597_0000016 | 3300046542 | Bacteria | 167456 |
| 436 | Ga0495597_0008843 | 3300046542 | Bacteria | 5024 |
| 437 | Ga0495622_0001305 | 3300046557 | Bacteria | 12775 |
| 438 | Ga0495622_0012102 | 3300046557 | Bacteria | 3990 |
| 439 | Ga0495622_0142618 | 3300046557 | Bacteria | 1087 |
| 440 | Ga0495633_0003087 | 3300046558 | Bacteria | 11324 |
| 441 | Ga0495667_0031187 | 3300046559 | Bacteria | 3579 |
| 442 | Ga0495667_0142330 | 3300046559 | Bacteria | 1545 |
| 443 | Ga0495656_0004946 | 3300046615 | Bacteria | 4588 |
| 444 | Ga0495625_0000134 | 3300046660 | Bacteria | 115073 |
| 445 | Ga0495625_0051221 | 3300046660 | Bacteria | 2960 |
| 446 | Ga0495625_0135573 | 3300046660 | Bacteria | 1664 |
| 447 | Ga0495635_0027178 | 3300046663 | Bacteria | 3981 |
| 448 | Ga0495635_0102510 | 3300046663 | Bacteria | 1956 |
| 449 | Ga0495659_0001323 | 3300046664 | Bacteria | 8509 |
| 450 | Ga0495661_0000030 | 3300046665 | Bacteria | 171980 |
| 451 | Ga0495661_0000088 | 3300046665 | Bacteria | 111782 |
| 452 | Ga0495661_0009503 | 3300046665 | Bacteria | 6674 |
| 453 | Ga0495661_0025395 | 3300046665 | Bacteria | 3826 |
| 454 | Ga0495657_0104340 | 3300046675 | Bacteria | 1803 |
| 455 | Ga0495599_0057891 | 3300046678 | Bacteria | 2425 |
| 456 | Ga0495623_0024699 | 3300046679 | Bacteria | 3869 |
| 457 | Ga0495669_0033833 | 3300046684 | Bacteria | 2251 |
| 458 | Ga0495670_0002914 | 3300046691 | Bacteria | 8429 |
| 459 | Ga0495670_0030265 | 3300046691 | Bacteria | 2689 |
| 460 | Ga0495671_0023443 | 3300046692 | Bacteria | 3224 |
| 461 | Ga0495671_0030450 | 3300046692 | Bacteria | 2763 |
| 462 | Ga0495649_0000864 | 3300046694 | Bacteria | 24358 |
| 463 | Ga0495649_0001550 | 3300046694 | Bacteria | 17244 |
| 464 | Ga0495649_0050595 | 3300046694 | Bacteria | 2254 |
| 465 | Ga0495589_0000881 | 3300046794 | Bacteria | 18650 |
| 466 | Ga0495589_0007709 | 3300046794 | Bacteria | 5633 |
| 467 | Ga0495589_0057115 | 3300046794 | Bacteria | 1920 |
| 468 | Ga0495600_0060110 | 3300046809 | Bacteria | 2481 |
| 469 | Ga0495600_0096446 | 3300046809 | Bacteria | 1928 |
| 470 | Ga0495660_0001771 | 3300046810 | Bacteria | 14286 |
| 471 | Ga0495660_0005240 | 3300046810 | Bacteria | 7778 |
| 472 | Ga0495660_0027927 | 3300046810 | Bacteria | 3190 |
| 473 | Ga0495660_0084170 | 3300046810 | Bacteria | 1663 |
| 474 | Ga0495604_0036434 | 3300047317 | Bacteria | 3878 |
| 475 | Ga0495636_0005048 | 3300047318 | Bacteria | 5181 |
| 476 | Ga0495636_0009958 | 3300047318 | Bacteria | 3745 |
| 477 | Ga0495672_0002710 | 3300047320 | Bacteria | 15891 |
| 478 | Ga0495672_0012883 | 3300047320 | Bacteria | 5799 |
| 479 | Ga0495672_0013396 | 3300047320 | Bacteria | 5659 |
| 480 | Ga0495672_0139527 | 3300047320 | Bacteria | 1267 |
| 481 | Ga0495676_0000018 | 3300047321 | Bacteria | 178380 |
| 482 | Ga0495680_0156474 | 3300047322 | Bacteria | 1657 |
| 483 | Ga0495680_0238027 | 3300047322 | Bacteria | 1294 |
| 484 | Ga0495683_0000081 | 3300047323 | Bacteria | 95260 |
| 485 | Ga0495683_0001199 | 3300047323 | Bacteria | 17691 |
| 486 | Ga0495687_011688 | 3300047443 | Bacteria | 4696 |
| 487 | Ga0495675_0005746 | 3300047444 | Bacteria | 7588 |
| 488 | Ga0495679_007522 | 3300047446 | Bacteria | 4528 |
| 489 | Ga0495673_0003548 | 3300047469 | Bacteria | 10270 |
| 490 | Ga0495673_0005161 | 3300047469 | Bacteria | 7955 |
| 491 | Ga0495673_0011087 | 3300047469 | Bacteria | 4870 |
| 492 | Ga0495681_0002659 | 3300047470 | Bacteria | 12664 |
| 493 | Ga0495681_0004092 | 3300047470 | Bacteria | 10026 |
| 494 | Ga0495681_0007297 | 3300047470 | Bacteria | 7087 |
| 495 | Ga0495681_0018194 | 3300047470 | Bacteria | 3878 |
| 496 | Ga0495681_0044875 | 3300047470 | Bacteria | 2120 |
| 497 | Ga0495684_0034497 | 3300047471 | Bacteria | 3882 |
| 498 | Ga0495593_0029162 | 3300047673 | Bacteria | 3027 |
| 499 | Ga0495626_0000125 | 3300048091 | Bacteria | 99451 |
| 500 | Ga0495626_0003758 | 3300048091 | Bacteria | 9556 |
| 501 | Ga0495626_0004444 | 3300048091 | Bacteria | 8605 |
| 502 | Ga0496102_0008143 | 3300048905 | Bacteria | 8969 |
| 503 | Ga0496106_0247213 | 3300048909 | Bacteria | 1426 |
| 504 | Ga0496112_0038138 | 3300048915 | Bacteria | 4692 |
| 505 | Ga0496113_0052589 | 3300048916 | Bacteria | 3043 |
| 506 | Ga0496114_0012877 | 3300048917 | Bacteria | 6699 |
| 507 | Ga0496114_0014042 | 3300048917 | Bacteria | 6423 |
| 508 | Ga0496114_0040220 | 3300048917 | Bacteria | 3870 |
| 509 | Ga0496116_0001043 | 3300048919 | Bacteria | 33784 |
| 510 | Ga0496117_0015449 | 3300048920 | Bacteria | 6510 |
| 511 | Ga0496117_0105712 | 3300048920 | Bacteria | 1768 |
| 512 | Ga0496118_0009485 | 3300048921 | Bacteria | 9816 |
| 513 | Ga0496118_0022994 | 3300048921 | Bacteria | 5428 |
| 514 | Ga0496118_0060355 | 3300048921 | Bacteria | 2816 |
| 515 | Ga0496119_0000444 | 3300048922 | Bacteria | 56759 |
| 516 | Ga0496120_0001654 | 3300048923 | Bacteria | 25753 |
| 517 | Ga0496121_0005707 | 3300048924 | Bacteria | 15809 |
| 518 | Ga0496121_0063203 | 3300048924 | Bacteria | 3027 |
| 519 | Ga0496121_0185589 | 3300048924 | Bacteria | 1496 |
| 520 | Ga0496122_0006709 | 3300048925 | Bacteria | 13098 |
| 521 | Ga0496122_0020183 | 3300048925 | Bacteria | 6039 |
| 522 | Ga0496122_0077198 | 3300048925 | Bacteria | 2340 |
| 523 | Ga0496123_0000887 | 3300048926 | Bacteria | 47327 |
| 524 | Ga0496123_0001511 | 3300048926 | Bacteria | 32223 |
| 525 | Ga0496123_0027233 | 3300048926 | Bacteria | 4262 |
| 526 | Ga0496124_0022637 | 3300048927 | Bacteria | 5754 |
| 527 | Ga0496124_0033678 | 3300048927 | Bacteria | 4505 |
| 528 | Ga0496124_0098145 | 3300048927 | Bacteria | 2377 |
| 529 | Ga0496124_0145885 | 3300048927 | Bacteria | 1862 |
| 530 | Ga0496124_0295162 | 3300048927 | Bacteria | 1174 |
| 531 | Ga0496125_0003525 | 3300048928 | Bacteria | 18884 |
| 532 | Ga0496125_0034533 | 3300048928 | Bacteria | 4456 |
| 533 | Ga0496125_0151532 | 3300048928 | Bacteria | 1591 |
| 534 | Ga0496126_0050942 | 3300048929 | Bacteria | 3772 |
| 535 | Ga0496126_0070794 | 3300048929 | Bacteria | 3106 |
| 536 | Ga0496126_0099536 | 3300048929 | Bacteria | 2546 |
| 537 | Ga0495678_000918 | 3300049459 | Bacteria | 25900 |
| 538 | Ga0495682_0000050 | 3300049460 | Bacteria | 110280 |
| 539 | Ga0495682_0001437 | 3300049460 | Bacteria | 12877 |
| 540 | Ga0495682_0009054 | 3300049460 | Bacteria | 3904 |
| 541 | Ga0501315_006626 | 3300049531 | Bacteria | 1295 |
| 542 | Ga0501034_0000150 | 3300049571 | Bacteria | 131760 |
| 543 | Ga0501034_0081970 | 3300049571 | Bacteria | 3228 |
| 544 | Ga0501034_0101361 | 3300049571 | Bacteria | 2873 |
| 545 | Ga0501034_0131785 | 3300049571 | Bacteria | 2483 |
| 546 | Ga0501037_0019636 | 3300049573 | Bacteria | 4986 |
| 547 | Ga0501070_0509753 | 3300049586 | Bacteria | 966 |
| 548 | Ga0501076_0353512 | 3300049592 | Bacteria | 1207 |
| 549 | Ga0501083_0007057 | 3300049744 | Bacteria | 7978 |
| 550 | nmdc:mga0n895_145778_c1 | 3300050512 | Bacteria | 2397 |
| 551 | nmdc:mga0n895_381445_c1 | 3300050512 | Bacteria | 1426 |
| 552 | nmdc:mga0rr50_54084_c1 | 3300050513 | Bacteria | 2989 |
| 553 | Ga0495601_0008558 | 3300053077 | Bacteria | 6043 |
| 554 | Ga0495601_0091978 | 3300053077 | Bacteria | 1953 |
| 555 | Ga0495619_0010468 | 3300053085 | Bacteria | 5833 |
| 556 | Ga0495619_0050642 | 3300053085 | Bacteria | 2742 |
| 557 | Ga0495619_0134760 | 3300053085 | Bacteria | 1698 |
| 558 | Ga0495619_0183361 | 3300053085 | Bacteria | 1448 |
| 559 | Ga0495619_0322549 | 3300053085 | Bacteria | 1069 |
| 560 | Ga0500659_0002281 | 3300053135 | Bacteria | 11593 |
| 561 | Ga0501082_0020563 | 3300060353 | Bacteria | 5689 |
| 562 | 2510285129 | 2510065053 | Bacteria | 5005518 |
| 563 | 2510294034 | 2510065055 | Bacteria | 5037935 |
| 564 | 2510313068 | 2510065058 | Bacteria | 5005894 |
| 565 | 2511254566 | 2511231004 | Bacteria | 6669789 |
| 566 | 2511267037 | 2511231006 | Bacteria | 6794709 |
| 567 | 2511273791 | 2511231007 | Bacteria | 6306603 |
| 568 | 2511276685 | 2511231008 | Bacteria | 6624100 |
| 569 | 2511292990 | 2511231010 | Bacteria | 6373152 |
| 570 | 2511293233 | 2511231011 | Bacteria | 6149768 |
| 571 | 2511301881 | 2511231012 | Bacteria | 6738011 |
| 572 | 2511314629 | 2511231014 | Bacteria | 6462302 |
| 573 | 2511317210 | 2511231015 | Bacteria | 6598026 |
| 574 | 2511323969 | 2511231016 | Bacteria | 6704427 |
| 575 | 2511331559 | 2511231017 | Bacteria | 6503007 |
| 576 | 2511339606 | 2511231018 | Bacteria | 6436256 |
| 577 | 2511344680 | 2511231019 | Bacteria | 6520662 |
| 578 | 2511349360 | 2511231020 | Bacteria | 6115223 |
| 579 | 2511355243 | 2511231021 | Bacteria | 7302637 |
| 580 | 2511366151 | 2511231022 | Bacteria | 6719296 |
| 581 | 2511368708 | 2511231023 | Bacteria | 6808468 |
| 582 | 2511374558 | 2511231024 | Bacteria | 5835885 |
| 583 | 2511413526 | 2511231031 | Bacteria | 6558529 |
| 584 | 2511826334 | 2511231156 | Bacteria | 6845832 |
| 585 | 2512324133 | 2512047018 | Bacteria | 6663241 |
| 586 | 2547373211 | 2547132103 | Bacteria | 5115736 |
| 587 | 2552746210 | 2551306352 | Bacteria | 3873115 |
| 588 | 2555671395 | 2554235341 | Bacteria | 6867980 |
| 589 | 2583793803 | 2582580891 | Bacteria | 6800976 |
| 590 | 2597859477 | 2597489887 | Bacteria | 6666321 |
| 591 | 2599328601 | 2599185155 | Bacteria | 5827168 |
| 592 | 2599354448 | 2599185160 | Bacteria | 6844013 |
| 593 | 2599359838 | 2599185161 | Bacteria | 6960462 |
| 594 | 2599366160 | 2599185162 | Bacteria | 6957254 |
| 595 | 2599372950 | 2599185163 | Bacteria | 6995158 |
| 596 | 2599379556 | 2599185164 | Bacteria | 6841688 |
| 597 | 2599385466 | 2599185165 | Bacteria | 6843250 |
| 598 | 2599391809 | 2599185166 | Bacteria | 6959206 |
| 599 | 2599403575 | 2599185168 | Bacteria | 6997636 |
| 600 | 2599461282 | 2599185181 | Bacteria | 6844519 |
| 601 | 2599469826 | 2599185182 | Bacteria | 6883168 |
| 602 | 2599482307 | 2599185185 | Bacteria | 6652270 |
| 603 | 2599490302 | 2599185186 | Bacteria | 6831633 |
| 604 | 2599504166 | 2599185188 | Bacteria | 6164180 |
| 605 | 2599613451 | 2599185212 | Bacteria | 6765997 |
| 606 | 2599772358 | 2599185248 | Bacteria | 6696816 |
| 607 | 2599803974 | 2599185257 | Bacteria | 6492581 |
| 608 | 2599888921 | 2599185289 | Bacteria | 6778765 |
| 609 | 2599900550 | 2599185291 | Bacteria | 6775623 |
| 610 | 2599933573 | 2599185300 | Bacteria | 6062622 |
| 611 | 2599943976 | 2599185302 | Bacteria | 5954930 |
| 612 | 2599955812 | 2599185304 | Bacteria | 5951361 |
| 613 | 2599961446 | 2599185305 | Bacteria | 6748700 |
| 614 | 2599969718 | 2599185306 | Bacteria | 6637356 |
| 615 | 2599975238 | 2599185307 | Bacteria | 6194719 |
| 616 | 2599981192 | 2599185308 | Bacteria | 6621546 |
| 617 | 2599985613 | 2599185309 | Bacteria | 5969593 |
| 618 | 2599989537 | 2599185310 | Bacteria | 6014457 |
| 619 | 2599994409 | 2599185311 | Bacteria | 6354990 |
| 620 | 2600000118 | 2599185312 | Bacteria | 5912071 |
| 621 | 2600009097 | 2599185313 | Bacteria | 6658188 |
| 622 | 2600015037 | 2599185314 | Bacteria | 6621749 |
| 623 | 2600019612 | 2599185315 | Bacteria | 6771107 |
| 624 | 2600023703 | 2599185316 | Bacteria | 6320029 |
| 625 | 2600032347 | 2599185317 | Bacteria | 6435722 |
| 626 | 2600038791 | 2599185318 | Bacteria | 6961590 |
| 627 | 2600044165 | 2599185319 | Bacteria | 6637840 |
| 628 | 2600048373 | 2599185320 | Bacteria | 5963263 |
| 629 | 2600054122 | 2599185321 | Bacteria | 6764560 |
| 630 | 2600060340 | 2599185322 | Bacteria | 6763055 |
| 631 | 2600066570 | 2599185323 | Bacteria | 6688755 |
| 632 | 2600074351 | 2599185324 | Bacteria | 6590677 |
| 633 | 2600078122 | 2599185325 | Bacteria | 6324919 |
| 634 | 2600213898 | 2599185356 | Bacteria | 6843884 |
| 635 | 2600361909 | 2600254930 | Bacteria | 6431253 |
| 636 | 2600364382 | 2600254931 | Bacteria | 6734225 |
| 637 | 2600443225 | 2600254954 | Bacteria | 5100516 |
| 638 | 2601626598 | 2600255283 | Bacteria | 6061572 |
| 639 | 2601774064 | 2600255313 | Bacteria | 6842543 |
| 640 | 2601795609 | 2600255318 | Bacteria | 6383414 |
| 641 | 2602009294 | 2600255389 | Bacteria | 5275336 |
| 642 | 2606075678 | 2603880185 | Bacteria | 6379190 |
| 643 | 2606128409 | 2603880199 | Bacteria | 6377649 |
| 644 | 2624479548 | 2623620443 | Bacteria | 6427864 |
| 645 | 2624493443 | 2623620446 | Bacteria | 6500345 |
| 646 | 2640733241 | 2639762793 | Bacteria | 3943681 |
| 647 | 2643842729 | 2643221565 | Bacteria | 6216018 |
| 648 | 2643952678 | 2643221589 | Bacteria | 6250934 |
| 649 | 2644022440 | 2643221602 | Bacteria | 6249926 |
| 650 | 2644185511 | 2643221633 | Bacteria | 6733554 |
| 651 | 2644286888 | 2643221650 | Bacteria | 7029547 |
| 652 | 2644363266 | 2643221665 | Bacteria | 4699229 |
| 653 | 2652544538 | 2651869719 | Bacteria | 6047974 |
| 654 | 2671093211 | 2667528170 | Bacteria | 6786960 |
| 655 | 2671097029 | 2667528171 | Bacteria | 6900659 |
| 656 | 2671128922 | 2667528176 | Bacteria | 6724917 |
| 657 | 2671770458 | 2671180172 | Bacteria | 6495783 |
| 658 | 2678230292 | 2675903507 | Bacteria | 3737791 |
| 659 | 2678264682 | 2675903515 | Bacteria | 6580491 |
| 660 | 2715753949 | 2713897148 | Bacteria | 5883533 |
| 661 | 2715757813 | 2713897149 | Bacteria | 6506249 |
| 662 | 2718633376 | 2718217725 | Bacteria | 5758958 |
| 663 | 2729147540 | 2728369097 | Bacteria | 4333476 |
| 664 | 2738691377 | 2738541271 | Bacteria | 5657310 |
| 665 | 2739201221 | 2738543004 | Bacteria | 6381073 |
| 666 | 2739262410 | 2738543015 | Bacteria | 6750701 |
| 667 | 2739267152 | 2738543016 | Bacteria | 5657564 |
| 668 | 2739316180 | 2738543025 | Bacteria | 6600348 |
| 669 | 2743739007 | 2740892503 | Bacteria | 6855563 |
| 670 | 2745005136 | 2744054620 | Bacteria | 6551379 |
| 671 | 2745161280 | 2744054655 | Bacteria | 3552603 |
| 672 | 2765585448 | 2765235841 | Bacteria | 6137024 |
| 673 | 2774119164 | 2773857670 | Bacteria | 6407454 |
| 674 | 2774128221 | 2773857672 | Bacteria | 4993178 |
| 675 | 2774138438 | 2773857673 | Bacteria | 6513460 |
| 676 | 2774389159 | 2773857761 | Bacteria | 3837365 |
| 677 | 2774439347 | 2773857770 | Bacteria | 3911866 |
| 678 | 2784265541 | 2784132063 | Bacteria | 6262788 |
| 679 | 2784314814 | 2784132072 | Bacteria | 6596533 |
| 680 | 2794595055 | 2791355520 | Bacteria | 5948615 |
| 681 | 2808857082 | 2808606361 | Bacteria | 6136259 |
| 682 | 2808926692 | 2808606376 | Bacteria | 6248667 |
| 683 | 2808927476 | 2808606377 | Bacteria | 6646337 |
| 684 | 2808937154 | 2808606378 | Bacteria | 6177535 |
| 685 | 2808939301 | 2808606379 | Bacteria | 5022697 |
| 686 | 2808948853 | 2808606380 | Bacteria | 6248705 |
| 687 | 2808949984 | 2808606381 | Bacteria | 6646461 |
| 688 | 2808959008 | 2808606382 | Bacteria | 6841132 |
| 689 | 2808965470 | 2808606383 | Bacteria | 6138645 |
| 690 | 2809000289 | 2808606389 | Bacteria | 6138126 |
| 691 | 2809216490 | 2808606445 | Bacteria | 6057339 |
| 692 | 2812371261 | 2811994881 | Bacteria | 6298475 |
| 693 | 2819654682 | 2818991456 | Bacteria | 6123676 |
| 694 | 2819702123 | 2818991464 | Bacteria | 6907494 |
| 695 | 2823424845 | 2823421272 | Bacteria | 5372474 |
| 696 | 2825656430 | 2825651385 | Bacteria | 6715909 |
| 697 | 2826584512 | 2826581358 | Bacteria | 5963467 |
| 698 | 2842818066 | 2842815866 | Bacteria | 5947510 |
| 699 | 2842832582 | 2842832357 | Bacteria | 5959113 |
| 700 | 2842848858 | 2842843487 | Bacteria | 6004777 |
| 701 | 2842849298 | 2842849001 | Bacteria | 5924277 |
| 702 | 2842856814 | 2842854478 | Bacteria | 6143501 |
| 703 | 2843694272 | 2843690924 | Bacteria | 5169057 |
| 704 | 2844671914 | 2844665904 | Bacteria | 6817974 |
| 705 | 2846035820 | 2846033681 | Bacteria | 4377894 |
| 706 | 2846040381 | 2846037992 | Bacteria | 4526407 |
| 707 | 2852659034 | 2852657418 | Bacteria | 6472974 |
| 708 | 2860339905 | 2860339153 | Bacteria | 6846989 |
| 709 | 2878031553 | 2878029506 | Bacteria | 6418441 |
| 710 | 2880232424 | 2880230671 | Bacteria | 6140320 |
| 711 | 2904523884 | 2904518522 | Bacteria | 6068986 |
| 712 | 2904552865 | 2904550169 | Bacteria | 6221258 |
| 713 | 2912967682 | 2912963787 | Bacteria | 5646108 |
| 714 | 2913041158 | 2913036834 | Bacteria | 6704877 |
| 715 | 2916701370 | 2916699645 | Bacteria | 3568996 |
| 716 | 2917075261 | 2917070673 | Bacteria | 6868303 |
| 717 | 2917835429 | 2917832318 | Bacteria | 5346010 |
| 718 | 2919063978 | 2919063839 | Bacteria | 6302690 |
| 719 | 2919129239 | 2919125081 | Bacteria | 5385106 |
| 720 | 2919159939 | 2919155634 | Bacteria | 4860545 |
| 721 | 2919185422 | 2919182534 | Bacteria | 3907101 |
| 722 | 2919386519 | 2919385768 | Bacteria | 5897293 |
| 723 | 2919457000 | 2919456309 | Bacteria | 6586567 |
| 724 | 2919486084 | 2919481497 | Bacteria | 6907839 |
| 725 | 2919491201 | 2919487758 | Bacteria | 5929766 |
| 726 | 2919508533 | 2919506607 | Bacteria | 3392955 |
| 727 | 2919699292 | 2919697872 | Bacteria | 6553725 |
| 728 | 2923158086 | 2923153595 | Bacteria | 6870622 |
| 729 | 2923525372 | 2923519811 | Bacteria | 6298479 |
| 730 | 2923590141 | 2923586266 | Bacteria | 6565975 |
| 731 | 2928516348 | 2928515477 | Bacteria | 4448421 |
| 732 | 2929148611 | 2929144301 | Bacteria | 6622272 |
| 733 | 2931373953 | 2931369376 | Bacteria | 6847892 |
| 734 | 2931400202 | 2931396565 | Bacteria | 7251677 |
| 735 | 2935356249 | 2935353572 | Unclassified | 6955622 |
| 736 | 2939639632 | 2939636861 | Bacteria | 6297853 |
| 737 | 2939655856 | 2939651529 | Bacteria | 5895393 |
| 738 | 2969306335 | 2969304461 | Bacteria | 6601805 |
| 739 | 2974292010 | 2974289157 | Bacteria | 6080362 |
| 740 | 2974299622 | 2974298342 | Bacteria | 4840922 |
| 741 | 2984288092 | 2984286254 | Bacteria | 6702062 |
| 742 | 2984501979 | 2984499530 | Bacteria | 5020881 |
| 743 | 2984504522 | 2984504281 | Bacteria | 5262371 |
| 744 | 2984572338 | 2984568884 | Bacteria | 3884413 |
| 745 | 2988730200 | 2988728565 | Bacteria | 6124362 |
| 746 | 2998141734 | 2998139840 | Bacteria | 6073514 |
| 747 | 3007256631 | 3007252601 | Bacteria | 4559114 |
| 748 | 3007319129 | 3007315729 | Bacteria | 5076637 |
| 749 | 3007397391 | 3007395558 | Bacteria | 6755444 |
| 750 | 3007515258 | 3007511990 | Bacteria | 6481491 |
| 751 | 3007616560 | 3007614139 | Bacteria | 6053559 |
| 752 | 3007620058 | 3007619802 | Bacteria | 6411688 |
| 753 | 3007719374 | 3007718800 | Bacteria | 5971527 |
| 754 | 3007809266 | 3007803356 | Bacteria | 5931491 |
| 755 | 3007856321 | 3007855910 | Bacteria | 5637581 |
| 756 | 3007863032 | 3007861166 | Bacteria | 6045338 |
| 757 | 3007870544 | 3007866637 | Bacteria | 5899198 |
| 758 | 3007875289 | 3007872151 | Bacteria | 5268868 |
| 759 | 637321717 | 637000220 | Bacteria | 7074893 |
| 760 | 651175314 | 651053060 | Bacteria | 4689946 |
| 761 | 8002750044 | 8002745576 | Bacteria | 4840272 |
| 762 | 8011353895 | 8011350971 | Bacteria | 6158957 |
| 763 | 8015692182 | 8015687852 | Bacteria | 6613826 |
| 764 | 8016733672 | 8016728285 | Bacteria | 5263933 |
| 765 | 8019773034 | 8019769354 | Bacteria | 6924660 |
| 766 | 8019776438 | 8019775933 | Bacteria | 6858656 |
| 767 | 8029999026 | 8029995093 | Bacteria | 5990776 |
| 768 | 8033233664 | 8033232454 | Bacteria | 3202805 |
| 769 | 8034962823 | 8034962539 | Bacteria | 4884839 |
| 770 | 8052495917 | 8052494512 | Bacteria | 5765634 |
| 771 | 8054932285 | 8054929484 | Bacteria | 5599761 |
| 772 | 8055775391 | 8055770955 | Bacteria | 6827675 |
| 773 | 8055878910 | 8055878733 | Bacteria | 5907058 |
| 774 | 8056130076 | 8056125926 | Bacteria | 6228218 |
| 775 | 8056138843 | 8056137416 | Bacteria | 6147080 |
| 776 | 8056144771 | 8056143049 | Bacteria | 6307666 |
| 777 | 8056156120 | 8056155041 | Bacteria | 6486948 |
| 778 | 8056169261 | 8056166840 | Bacteria | 5820959 |
| 779 | 8056175450 | 8056172158 | Bacteria | 6133900 |
| 780 | 8056181254 | 8056177738 | Bacteria | 6748268 |
| 781 | 8056571464 | 8056569372 | Bacteria | 5997322 |
| 782 | 8057804207 | 8057798959 | Bacteria | 6713499 |
| 783 | Ga0070684_100095369 | |||
| 784 | MRS2a_Contig_23 | |||
| 785 | MRS2a_Contig_6280 | |||
| 786 | SwRhRL2b_contig_2798511 | |||
| 787 | JGI25162J39368_1000251 | |||
| 788 | JGI25162J39368_1000315 | |||
| 789 | JGI25163J39215_1001111 | |||
| 790 | JGI25164J39214_1000194 | |||
| 791 | JGI25164J39214_1000411 | |||
| 792 | JGI25159J45721_1001567 | |||
| 793 | JGI25165J46597_1000348 | |||
| 794 | JGI25165J46597_1000430 | |||
| 795 | rootH2_10091229 | |||
| 796 | rootH1_10005337 | |||
| 797 | rootH1_10167004 | |||
| 798 | Ga0006562J51391_1018591 | |||
| 799 | Ga0006562J51391_1037971 | |||
| 800 | Ga0055524_1000017 | |||
| 801 | Ga0055536_1004018 | |||
| 802 | Ga0055531_10000997 | |||
| 803 | Ga0058692_1000014 | |||
| 804 | Ga0065703_1000184 | |||
| 805 | Ga0065714_10000034 | |||
| 806 | Ga0065714_10070725 | |||
| 807 | Ga0065714_10183392 | |||
| 808 | Ga0065704_10015961 | |||
| 809 | Ga0065704_10194481 | |||
| 810 | Ga0065712_10067911 | |||
| 811 | Ga0065712_10069558 | |||
| 812 | Ga0065715_10234727 | |||
| 813 | Ga0070682_100033828 | |||
| 814 | Ga0070660_100030566 | |||
| 815 | Ga0070669_100008078 | |||
| 816 | Ga0070671_100029170 | |||
| 817 | Ga0070671_100179916 | |||
| 818 | Ga0070709_10010843 | |||
| 819 | Ga0070714_100032520 | |||
| 820 | Ga0070714_100254214 | |||
| 821 | Ga0070713_100091115 | |||
| 822 | Ga0070713_100288260 | |||
| 823 | Ga0070710_10111820 | |||
| 824 | Ga0070711_100024685 | |||
| 825 | Ga0070711_100210121 | |||
| 826 | Ga0070711_100494301 | |||
| 827 | Ga0070708_100310713 | |||
| 828 | Ga0070662_100032504 | |||
| 829 | Ga0070706_100018287 | |||
| 830 | Ga0070706_100093967 | |||
| 831 | Ga0070707_100020705 | |||
| 832 | Ga0070698_100017589 | |||
| 833 | Ga0070698_100401646 | |||
| 834 | Ga0070698_100406750 | |||
| 835 | Ga0070699_100172711 | |||
| 836 | Ga0070699_100382835 | |||
| 837 | Ga0070699_100466838 | |||
| 838 | Ga0070697_100031861 | |||
| 839 | Ga0070697_100336889 | |||
| 840 | Ga0070665_100018863 | |||
| 841 | Ga0068861_100552079 | |||
| 842 | Ga0070717_10011796 | |||
| 843 | Ga0075364_10068387 | |||
| 844 | Ga0075432_10101495 | |||
| 845 | Ga0075432_10130832 | |||
| 846 | Ga0070716_100029621 | |||
| 847 | Ga0070716_100053936 | |||
| 848 | Ga0070712_100013081 | |||
| 849 | Ga0070712_100027336 | |||
| 850 | Ga0075362_10056973 | |||
| 851 | Ga0075370_10143729 | |||
| 852 | Ga0075434_100059625 | |||
| 853 | Ga0075436_100012460 | |||
| 854 | Ga0079104_1000982 | |||
| 855 | Ga0099826_10003959 | |||
| 856 | Ga0099795_10001078 | |||
| 857 | Ga0099795_10008269 | |||
| 858 | Ga0105251_10000035 | |||
| 859 | Ga0105251_10005924 | |||
| 860 | Ga0105251_10032130 | |||
| 861 | Ga0105251_10065962 | |||
| 862 | Ga0105251_10083088 | |||
| 863 | Ga0105251_10083294 | |||
| 864 | Ga0105251_10200108 | |||
| 865 | Ga0105244_10001134 | |||
| 866 | Ga0105244_10017376 | |||
| 867 | Ga0105244_10031086 | |||
| 868 | Ga0105244_10091482 | |||
| 869 | Ga0105250_10000056 | |||
| 870 | Ga0105250_10011835 | |||
| 871 | Ga0105250_10023276 | |||
| 872 | Ga0105250_10023995 | |||
| 873 | Ga0105250_10041937 | |||
| 874 | Ga0105240_10004855 | |||
| 875 | Ga0105240_10041595 | |||
| 876 | Ga0105240_10260407 | |||
| 877 | Ga0105243_10000249 | |||
| 878 | Ga0105243_10001441 | |||
| 879 | Ga0105243_10002007 | |||
| 880 | Ga0105243_10036370 | |||
| 881 | Ga0105242_10306473 | |||
| 882 | Ga0105242_10554592 | |||
| 883 | Ga0105249_10000342 | |||
| 884 | Ga0099796_10010745 | |||
| 885 | Ga0099796_10028241 | |||
| 886 | Ga0105239_10344886 | |||
| 887 | Ga0105246_10001895 | |||
| 888 | Ga0105246_10007270 | |||
| 889 | Ga0105246_10270088 | |||
| 890 | Ga0157373_10009442 | |||
| 891 | Ga0157373_10036301 | |||
| 892 | Ga0157373_10133656 | |||
| 893 | Ga0157371_10014441 | |||
| 894 | Ga0157371_10017060 | |||
| 895 | Ga0157371_10029699 | |||
| 896 | Ga0157371_10209200 | |||
| 897 | Ga0157370_10064240 | |||
| 898 | Ga0157370_10383435 | |||
| 899 | Ga0157369_10004688 | |||
| 900 | Ga0157374_10430858 | |||
| 901 | Ga0163162_10065357 | |||
| 902 | Ga0157372_10038059 | |||
| 903 | Ga0157372_10727607 | |||
| 904 | Ga0157375_10308655 | |||
| 905 | Ga0182008_10023277 | |||
| 906 | Ga0182008_10029769 | |||
| 907 | Ga0182008_10090027 | |||
| 908 | Ga0157377_10222222 | |||
| 909 | Ga0157379_10316027 | |||
| 910 | Ga0182006_1006419 | |||
| 911 | Ga0182006_1009493 | |||
| 912 | Ga0182006_1035789 | |||
| 913 | Ga0182007_10001991 | |||
| 914 | Ga0182005_1008729 | |||
| 915 | Ga0182005_1076232 | |||
| 916 | Ga0163161_10084202 | |||
| 917 | Ga0206352_11149150 | |||
| 918 | Ga0213873_10014176 | |||
| 919 | Ga0213872_10000652 | |||
| 920 | Ga0213872_10001532 | |||
| 921 | Ga0213872_10001557 | |||
| 922 | Ga0213872_10001677 | |||
| 923 | Ga0213872_10026800 | |||
| 924 | Ga0213874_10009670 | |||
| 925 | Ga0213875_10000145 | |||
| 926 | Ga0213875_10006534 | |||
| 927 | Ga0209760_100011 | |||
| 928 | Ga0209760_100064 | |||
| 929 | Ga0209563_100495 | |||
| 930 | Ga0207427_100008 | |||
| 931 | Ga0207427_100082 | |||
| 932 | Ga0209437_100006 | |||
| 933 | Ga0209437_100014 | |||
| 934 | Ga0209759_1007138 | |||
| 935 | Ga0209233_1000008 | |||
| 936 | Ga0209233_1000105 | |||
| 937 | Ga0209675_1017364 | |||
| 938 | Ga0209676_1000006 | |||
| 939 | Ga0209676_1000369 | |||
| 940 | Ga0209676_1000803 | |||
| 941 | Ga0209676_1001140 | |||
| 942 | Ga0209050_1000070 | |||
| 943 | Ga0209050_1000235 | |||
| 944 | Ga0209050_1000380 | |||
| 945 | Ga0209050_1001241 | |||
| 946 | Ga0209051_1000086 | |||
| 947 | Ga0209051_1000123 | |||
| 948 | Ga0209051_1001064 | |||
| 949 | Ga0209257_1000421 | |||
| 950 | Ga0209257_1005819 | |||
| 951 | Ga0207696_1000025 | |||
| 952 | Ga0207696_1000144 | |||
| 953 | Ga0207696_1003214 | |||
| 954 | Ga0207696_1006143 | |||
| 955 | Ga0207696_1006846 | |||
| 956 | Ga0207696_1013375 | |||
| 957 | Ga0207655_1000183 | |||
| 958 | Ga0207655_1000592 | |||
| 959 | Ga0207655_1000976 | |||
| 960 | Ga0207655_1001969 | |||
| 961 | Ga0207655_1003070 | |||
| 962 | Ga0207655_1005485 | |||
| 963 | Ga0207655_1006081 | |||
| 964 | Ga0207655_1008047 | |||
| 965 | Ga0207655_1010633 | |||
| 966 | Ga0207655_1012126 | |||
| 967 | Ga0207655_1025877 | |||
| 968 | Ga0207713_1001249 | |||
| 969 | Ga0207713_1001767 | |||
| 970 | Ga0207713_1003135 | |||
| 971 | Ga0207713_1003177 | |||
| 972 | Ga0207713_1006088 | |||
| 973 | Ga0207713_1014429 | |||
| 974 | Ga0207713_1047856 | |||
| 975 | Ga0207692_10010663 | |||
| 976 | Ga0207692_10023731 | |||
| 977 | Ga0207710_10000122 | |||
| 978 | Ga0207684_10378695 | |||
| 979 | Ga0207707_10030684 | |||
| 980 | Ga0207707_10231927 | |||
| 981 | Ga0207695_10015272 | |||
| 982 | Ga0207693_10005303 | |||
| 983 | Ga0207693_10052530 | |||
| 984 | Ga0207693_10071210 | |||
| 985 | Ga0207663_10341937 | |||
| 986 | Ga0207660_10387537 | |||
| 987 | Ga0207652_10100233 | |||
| 988 | Ga0207646_10009040 | |||
| 989 | Ga0207681_10005882 | |||
| 990 | Ga0207681_10088241 | |||
| 991 | Ga0207700_10002928 | |||
| 992 | Ga0207700_10183041 | |||
| 993 | Ga0207700_10208336 | |||
| 994 | Ga0207664_10016110 | |||
| 995 | Ga0207664_10127472 | |||
| 996 | Ga0207664_10520324 | |||
| 997 | Ga0207644_10109678 | |||
| 998 | Ga0207709_10000001 | |||
| 999 | Ga0207709_10000223 | |||
| 1000 | Ga0207709_10000835 | |||
| 1001 | Ga0207709_10030554 | |||
| 1002 | Ga0207665_10006644 | |||
| 1003 | Ga0207665_10033004 | |||
| 1004 | Ga0207665_10049356 | |||
| 1005 | Ga0207712_10001909 | |||
| 1006 | Ga0207703_10319423 | |||
| 1007 | Ga0207702_10031690 | |||
| 1008 | Ga0207641_10435466 | |||
| 1009 | Ga0207676_10416744 | |||
| 1010 | Ga0209281_1000010 | |||
| 1011 | Ga0209281_1000331 | |||
| 1012 | Ga0209281_1005471 | |||
| 1013 | Ga0209389_1000031 | |||
| 1014 | Ga0209371_1000040 | |||
| 1015 | Ga0209371_1000182 | |||
| 1016 | Ga0209371_1000589 | |||
| 1017 | Ga0209371_1017352 | |||
| 1018 | Ga0209969_1013169 | |||
| 1019 | Ga0209984_1001806 | |||
| 1020 | Ga0209179_1019988 | |||
| 1021 | Ga0209999_1002159 | |||
| 1022 | Ga0209982_1009659 | |||
| 1023 | Ga0209983_1000763 | |||
| 1024 | Ga0209282_1054335 | |||
| 1025 | Ga0209971_1000554 | |||
| 1026 | Ga0209974_10007616 | |||
| 1027 | Ga0207428_10238370 | |||
| 1028 | Ga0268266_10014923 | |||
| 1029 | Ga0268266_10055084 | |||
| 1030 | Ga0268265_10473215 | |||
| 1031 | Ga0307515_10002349 | |||
| 1032 | Ga0265338_10006011 | |||
| 1033 | Ga0265338_10155737 | |||
| 1034 | Ga0268256_1000041 | |||
| 1035 | Ga0268256_1000153 | |||
| 1036 | Ga0268256_1000511 | |||
| 1037 | Ga0268256_1019341 | |||
| 1038 | Ga0316177_1211506 | |||
| 1039 | Ga0316179_1028994 | |||
| 1040 | Ga0316178_1108793 | |||
| 1041 | Ga0316183_1189572 | |||
| 1042 | Ga0265327_10013441 | |||
| 1043 | Ga0265327_10031808 | |||
| 1044 | Ga0307408_100000025 | |||
| 1045 | Ga0307408_100000192 | |||
| 1046 | Ga0265314_10038335 | |||
| 1047 | Ga0307413_10226145 | |||
| 1048 | Ga0307406_10004592 | |||
| 1049 | Ga0307416_100018095 | |||
| 1050 | Ga0307416_100311510 | |||
| 1051 | Ga0307414_10009804 | |||
| 1052 | Ga0307510_10084516 | |||
| 1053 | Ga0316592_1010457 | |||
| 1054 | Ga0373926_0056900 | |||
| 1055 | Ga0373934_0048463 | |||
| 1056 | Ga0373936_0078468 | |||
| 1057 | Ga0373936_0144144 | |||
| 1058 | Ga0373945_0004496 | |||
| 1059 | Ga0373954_0015261 | |||
| 1060 | Ga0373956_0025169 | |||
| 1061 | Ga0373943_0015057 | |||
| 1062 | Ga0373946_0011231 | |||
| 1063 | Ga0373955_0012134 | |||
| 1064 | Ga0373931_0031538 | |||
| 1065 | Ga0373935_0070416 | |||
| 1066 | Ga0373935_0258906 | |||
| 1067 | Ga0373927_0027023 | |||
| 1068 | Ga0373933_0029653 | |||
| 1069 | Ga0373933_0086916 | |||
| 1070 | Ga0373947_0035501 | |||
| 1071 | Ga0373947_0128505 | |||
| 1072 | Ga0373937_0006327 | |||
| 1073 | Ga0373937_0020176 | |||
| 1074 | Ga0373937_0027602 | |||
| 1075 | Ga0373937_0216263 | |||
| 1076 | Ga0373925_0257410 | |||
| 1077 | Ga0395905_0004104 | |||
| 1078 | Ga0436364_0056880 | |||
| 1079 | Ga0436364_0723260 | |||
| 1080 | Ga0436364_1260460 | |||
| 1081 | Ga0395901_0180939 | |||
| 1082 | Ga0237819_09277 | |||
| 1083 | Ga0400487_28623 | |||
| 1084 | Ga0436365_0036381 | |||
| 1085 | Ga0436365_1164564 | |||
| 1086 | Ga0436360_0186592 | |||
| 1087 | Ga0436360_0307969 | |||
| 1088 | Ga0436360_0572509 | |||
| 1089 | Ga0436360_0734628 | |||
| 1090 | Ga0436360_0800231 | |||
| 1091 | Ga0436360_0839587 | |||
| 1092 | Ga0436361_0284071 | |||
| 1093 | Ga0436361_0606756 | |||
| 1094 | Ga0436361_0714916 | |||
| 1095 | Ga0436361_1053619 | |||
| 1096 | Ga0436361_1216557 | |||
| 1097 | Ga0436363_0451735 | |||
| 1098 | Ga0436363_1129503 | |||
| 1099 | Ga0436363_1381957 | |||
| 1100 | Ga0436363_1460963 | |||
| 1101 | Ga0436362_0220171 | |||
| 1102 | Ga0436362_0436236 | |||
| 1103 | Ga0436362_0656757 | |||
| 1104 | Ga0436362_0999455 | |||
| 1105 | Ga0439438_001471 | |||
| 1106 | Ga0439438_005024 | |||
| 1107 | Ga0439438_008558 | |||
| 1108 | Ga0439438_008813 | |||
| 1109 | Ga0439447_002251 | |||
| 1110 | Ga0439466_0002838 | |||
| 1111 | Ga0439466_0004194 | |||
| 1112 | Ga0439466_0008003 | |||
| 1113 | Ga0439432_000967 | |||
| 1114 | Ga0439432_002797 | |||
| 1115 | Ga0439451_015276 | |||
| 1116 | Ga0439452_001447 | |||
| 1117 | Ga0439452_005155 | |||
| 1118 | Ga0439456_003614 | |||
| 1119 | Ga0439463_003014 | |||
| 1120 | Ga0450905_003390 | |||
| 1121 | Ga0450907_000326 | |||
| 1122 | Ga0439446_0000172 | |||
| 1123 | Ga0439446_0007048 | |||
| 1124 | Ga0439444_0004568 | |||
| 1125 | Ga0439460_0002152 | |||
| 1126 | Ga0451577_0157217 | |||
| 1127 | Ga0451577_0290548 | |||
| 1128 | Ga0439440_0004886 | |||
| 1129 | Ga0466966_0102598 | |||
| 1130 | Ga0453684_0002079 | |||
| 1131 | Ga0453684_0003561 | |||
| 1132 | Ga0466957_0378394 | |||
| 1133 | Ga0466959_0620050 | |||
| 1134 | Ga0451576_0001285 | |||
| 1135 | Ga0451576_0021642 | |||
| 1136 | Ga0451576_0024670 | |||
| 1137 | Ga0466958_0001326 | |||
| 1138 | Ga0466958_0302669 | |||
| 1139 | Ga0466967_0416720 | |||
| 1140 | Ga0466967_0558682 | |||
| 1141 | Ga0495617_001158 | |||
| 1142 | Ga0495627_000040 | |||
| 1143 | Ga0495627_000137 | |||
| 1144 | Ga0495603_0003767 | |||
| 1145 | Ga0495603_0049463 | |||
| 1146 | Ga0495590_0002219 | |||
| 1147 | Ga0495591_000023 | |||
| 1148 | Ga0495591_001514 | |||
| 1149 | Ga0495591_007986 | |||
| 1150 | Ga0495638_0077961 | |||
| 1151 | Ga0495653_0029603 | |||
| 1152 | Ga0495650_0007260 | |||
| 1153 | Ga0495650_0050834 | |||
| 1154 | Ga0495580_0022084 | |||
| 1155 | Ga0495605_0000245 | |||
| 1156 | Ga0495605_0001067 | |||
| 1157 | Ga0495605_0002605 | |||
| 1158 | Ga0495605_0010029 | |||
| 1159 | Ga0495605_0029245 | |||
| 1160 | Ga0495662_0101796 | |||
| 1161 | Ga0495584_0014523 | |||
| 1162 | Ga0495585_0002457 | |||
| 1163 | Ga0495585_0011404 | |||
| 1164 | Ga0495585_0013930 | |||
| 1165 | Ga0495585_0058023 | |||
| 1166 | Ga0495596_0000001 | |||
| 1167 | Ga0495596_0000375 | |||
| 1168 | Ga0495607_0000097 | |||
| 1169 | Ga0495607_0000234 | |||
| 1170 | Ga0495607_0000893 | |||
| 1171 | Ga0495607_0000972 | |||
| 1172 | Ga0495607_0004021 | |||
| 1173 | Ga0495607_0022053 | |||
| 1174 | Ga0495583_0003081 | |||
| 1175 | Ga0495583_0003683 | |||
| 1176 | Ga0495606_0000167 | |||
| 1177 | Ga0495606_0003593 | |||
| 1178 | Ga0495606_0004329 | |||
| 1179 | Ga0495606_0045902 | |||
| 1180 | Ga0495610_0026298 | |||
| 1181 | Ga0495610_0045368 | |||
| 1182 | Ga0495616_0018868 | |||
| 1183 | Ga0495616_0039392 | |||
| 1184 | Ga0495616_0058008 | |||
| 1185 | Ga0495620_0000003 | |||
| 1186 | Ga0495620_0009640 | |||
| 1187 | Ga0495620_0052081 | |||
| 1188 | Ga0495630_0094256 | |||
| 1189 | Ga0495631_0001015 | |||
| 1190 | Ga0495631_0006645 | |||
| 1191 | Ga0495631_0055140 | |||
| 1192 | Ga0495632_0001340 | |||
| 1193 | Ga0495632_0003328 | |||
| 1194 | Ga0495632_0004266 | |||
| 1195 | Ga0495632_0079706 | |||
| 1196 | Ga0495637_0000583 | |||
| 1197 | Ga0495637_0002931 | |||
| 1198 | Ga0495637_0003057 | |||
| 1199 | Ga0495637_0024711 | |||
| 1200 | Ga0495643_0000673 | |||
| 1201 | Ga0495643_0001803 | |||
| 1202 | Ga0495644_0003207 | |||
| 1203 | Ga0495648_0003579 | |||
| 1204 | Ga0495648_0004170 | |||
| 1205 | Ga0495648_0010693 | |||
| 1206 | Ga0495642_0001942 | |||
| 1207 | Ga0495642_0006012 | |||
| 1208 | Ga0495654_0008388 | |||
| 1209 | Ga0495654_0015800 | |||
| 1210 | Ga0495654_0035682 | |||
| 1211 | Ga0495654_0040236 | |||
| 1212 | Ga0495586_0034252 | |||
| 1213 | Ga0495587_0006269 | |||
| 1214 | Ga0495609_0000167 | |||
| 1215 | Ga0495609_0003356 | |||
| 1216 | Ga0495609_0006411 | |||
| 1217 | Ga0495597_0000016 | |||
| 1218 | Ga0495597_0008843 | |||
| 1219 | Ga0495622_0001305 | |||
| 1220 | Ga0495622_0012102 | |||
| 1221 | Ga0495622_0142618 | |||
| 1222 | Ga0495633_0003087 | |||
| 1223 | Ga0495667_0031187 | |||
| 1224 | Ga0495667_0142330 | |||
| 1225 | Ga0495656_0004946 | |||
| 1226 | Ga0495625_0000134 | |||
| 1227 | Ga0495625_0051221 | |||
| 1228 | Ga0495625_0135573 | |||
| 1229 | Ga0495635_0027178 | |||
| 1230 | Ga0495635_0102510 | |||
| 1231 | Ga0495659_0001323 | |||
| 1232 | Ga0495661_0000030 | |||
| 1233 | Ga0495661_0000088 | |||
| 1234 | Ga0495661_0009503 | |||
| 1235 | Ga0495661_0025395 | |||
| 1236 | Ga0495657_0104340 | |||
| 1237 | Ga0495599_0057891 | |||
| 1238 | Ga0495623_0024699 | |||
| 1239 | Ga0495669_0033833 | |||
| 1240 | Ga0495670_0002914 | |||
| 1241 | Ga0495670_0030265 | |||
| 1242 | Ga0495671_0023443 | |||
| 1243 | Ga0495671_0030450 | |||
| 1244 | Ga0495649_0000864 | |||
| 1245 | Ga0495649_0001550 | |||
| 1246 | Ga0495649_0050595 | |||
| 1247 | Ga0495589_0000881 | |||
| 1248 | Ga0495589_0007709 | |||
| 1249 | Ga0495589_0057115 | |||
| 1250 | Ga0495600_0060110 | |||
| 1251 | Ga0495600_0096446 | |||
| 1252 | Ga0495660_0001771 | |||
| 1253 | Ga0495660_0005240 | |||
| 1254 | Ga0495660_0027927 | |||
| 1255 | Ga0495660_0084170 | |||
| 1256 | Ga0495604_0036434 | |||
| 1257 | Ga0495636_0005048 | |||
| 1258 | Ga0495636_0009958 | |||
| 1259 | Ga0495672_0002710 | |||
| 1260 | Ga0495672_0012883 | |||
| 1261 | Ga0495672_0013396 | |||
| 1262 | Ga0495672_0139527 | |||
| 1263 | Ga0495676_0000018 | |||
| 1264 | Ga0495680_0156474 | |||
| 1265 | Ga0495680_0238027 | |||
| 1266 | Ga0495683_0000081 | |||
| 1267 | Ga0495683_0001199 | |||
| 1268 | Ga0495687_011688 | |||
| 1269 | Ga0495675_0005746 | |||
| 1270 | Ga0495679_007522 | |||
| 1271 | Ga0495673_0003548 | |||
| 1272 | Ga0495673_0005161 | |||
| 1273 | Ga0495673_0011087 | |||
| 1274 | Ga0495681_0002659 | |||
| 1275 | Ga0495681_0004092 | |||
| 1276 | Ga0495681_0007297 | |||
| 1277 | Ga0495681_0018194 | |||
| 1278 | Ga0495681_0044875 | |||
| 1279 | Ga0495684_0034497 | |||
| 1280 | Ga0495593_0029162 | |||
| 1281 | Ga0495626_0000125 | |||
| 1282 | Ga0495626_0003758 | |||
| 1283 | Ga0495626_0004444 | |||
| 1284 | Ga0496102_0008143 | |||
| 1285 | Ga0496106_0247213 | |||
| 1286 | Ga0496112_0038138 | |||
| 1287 | Ga0496113_0052589 | |||
| 1288 | Ga0496114_0012877 | |||
| 1289 | Ga0496114_0014042 | |||
| 1290 | Ga0496114_0040220 | |||
| 1291 | Ga0496116_0001043 | |||
| 1292 | Ga0496117_0015449 | |||
| 1293 | Ga0496117_0105712 | |||
| 1294 | Ga0496118_0009485 | |||
| 1295 | Ga0496118_0022994 | |||
| 1296 | Ga0496118_0060355 | |||
| 1297 | Ga0496119_0000444 | |||
| 1298 | Ga0496120_0001654 | |||
| 1299 | Ga0496121_0005707 | |||
| 1300 | Ga0496121_0063203 | |||
| 1301 | Ga0496121_0185589 | |||
| 1302 | Ga0496122_0006709 | |||
| 1303 | Ga0496122_0020183 | |||
| 1304 | Ga0496122_0077198 | |||
| 1305 | Ga0496123_0000887 | |||
| 1306 | Ga0496123_0001511 | |||
| 1307 | Ga0496123_0027233 | |||
| 1308 | Ga0496124_0022637 | |||
| 1309 | Ga0496124_0033678 | |||
| 1310 | Ga0496124_0098145 | |||
| 1311 | Ga0496124_0145885 | |||
| 1312 | Ga0496124_0295162 | |||
| 1313 | Ga0496125_0003525 | |||
| 1314 | Ga0496125_0034533 | |||
| 1315 | Ga0496125_0151532 | |||
| 1316 | Ga0496126_0050942 | |||
| 1317 | Ga0496126_0070794 | |||
| 1318 | Ga0496126_0099536 | |||
| 1319 | Ga0495678_000918 | |||
| 1320 | Ga0495682_0000050 | |||
| 1321 | Ga0495682_0001437 | |||
| 1322 | Ga0495682_0009054 | |||
| 1323 | Ga0501315_006626 | |||
| 1324 | Ga0501034_0000150 | |||
| 1325 | Ga0501034_0081970 | |||
| 1326 | Ga0501034_0101361 | |||
| 1327 | Ga0501034_0131785 | |||
| 1328 | Ga0501037_0019636 | |||
| 1329 | Ga0501070_0509753 | |||
| 1330 | Ga0501076_0353512 | |||
| 1331 | Ga0501083_0007057 | |||
| 1332 | nmdc:mga0n895_145778_c1 | |||
| 1333 | nmdc:mga0n895_381445_c1 | |||
| 1334 | nmdc:mga0rr50_54084_c1 | |||
| 1335 | Ga0495601_0008558 | |||
| 1336 | Ga0495601_0091978 | |||
| 1337 | Ga0495619_0010468 | |||
| 1338 | Ga0495619_0050642 | |||
| 1339 | Ga0495619_0134760 | |||
| 1340 | Ga0495619_0183361 | |||
| 1341 | Ga0495619_0322549 | |||
| 1342 | Ga0500659_0002281 | |||
| 1343 | Ga0501082_0020563 | |||
| 1344 | 2510285129 | |||
| 1345 | 2510294034 | |||
| 1346 | 2510313068 | |||
| 1347 | 2511254566 | |||
| 1348 | 2511267037 | |||
| 1349 | 2511273791 | |||
| 1350 | 2511276685 | |||
| 1351 | 2511292990 | |||
| 1352 | 2511293233 | |||
| 1353 | 2511301881 | |||
| 1354 | 2511314629 | |||
| 1355 | 2511317210 | |||
| 1356 | 2511323969 | |||
| 1357 | 2511331559 | |||
| 1358 | 2511339606 | |||
| 1359 | 2511344680 | |||
| 1360 | 2511349360 | |||
| 1361 | 2511355243 | |||
| 1362 | 2511366151 | |||
| 1363 | 2511368708 | |||
| 1364 | 2511374558 | |||
| 1365 | 2511413526 | |||
| 1366 | 2511826334 | |||
| 1367 | 2512324133 | |||
| 1368 | 2547373211 | |||
| 1369 | 2552746210 | |||
| 1370 | 2555671395 | |||
| 1371 | 2583793803 | |||
| 1372 | 2597859477 | |||
| 1373 | 2599328601 | |||
| 1374 | 2599354448 | |||
| 1375 | 2599359838 | |||
| 1376 | 2599366160 | |||
| 1377 | 2599372950 | |||
| 1378 | 2599379556 | |||
| 1379 | 2599385466 | |||
| 1380 | 2599391809 | |||
| 1381 | 2599403575 | |||
| 1382 | 2599461282 | |||
| 1383 | 2599469826 | |||
| 1384 | 2599482307 | |||
| 1385 | 2599490302 | |||
| 1386 | 2599504166 | |||
| 1387 | 2599613451 | |||
| 1388 | 2599772358 | |||
| 1389 | 2599803974 | |||
| 1390 | 2599888921 | |||
| 1391 | 2599900550 | |||
| 1392 | 2599933573 | |||
| 1393 | 2599943976 | |||
| 1394 | 2599955812 | |||
| 1395 | 2599961446 | |||
| 1396 | 2599969718 | |||
| 1397 | 2599975238 | |||
| 1398 | 2599981192 | |||
| 1399 | 2599985613 | |||
| 1400 | 2599989537 | |||
| 1401 | 2599994409 | |||
| 1402 | 2600000118 | |||
| 1403 | 2600009097 | |||
| 1404 | 2600015037 | |||
| 1405 | 2600019612 | |||
| 1406 | 2600023703 | |||
| 1407 | 2600032347 | |||
| 1408 | 2600038791 | |||
| 1409 | 2600044165 | |||
| 1410 | 2600048373 | |||
| 1411 | 2600054122 | |||
| 1412 | 2600060340 | |||
| 1413 | 2600066570 | |||
| 1414 | 2600074351 | |||
| 1415 | 2600078122 | |||
| 1416 | 2600213898 | |||
| 1417 | 2600361909 | |||
| 1418 | 2600364382 | |||
| 1419 | 2600443225 | |||
| 1420 | 2601626598 | |||
| 1421 | 2601774064 | |||
| 1422 | 2601795609 | |||
| 1423 | 2602009294 | |||
| 1424 | 2606075678 | |||
| 1425 | 2606128409 | |||
| 1426 | 2624479548 | |||
| 1427 | 2624493443 | |||
| 1428 | 2640733241 | |||
| 1429 | 2643842729 | |||
| 1430 | 2643952678 | |||
| 1431 | 2644022440 | |||
| 1432 | 2644185511 | |||
| 1433 | 2644286888 | |||
| 1434 | 2644363266 | |||
| 1435 | 2652544538 | |||
| 1436 | 2671093211 | |||
| 1437 | 2671097029 | |||
| 1438 | 2671128922 | |||
| 1439 | 2671770458 | |||
| 1440 | 2678230292 | |||
| 1441 | 2678264682 | |||
| 1442 | 2715753949 | |||
| 1443 | 2715757813 | |||
| 1444 | 2718633376 | |||
| 1445 | 2729147540 | |||
| 1446 | 2738691377 | |||
| 1447 | 2739201221 | |||
| 1448 | 2739262410 | |||
| 1449 | 2739267152 | |||
| 1450 | 2739316180 | |||
| 1451 | 2743739007 | |||
| 1452 | 2745005136 | |||
| 1453 | 2745161280 | |||
| 1454 | 2765585448 | |||
| 1455 | 2774119164 | |||
| 1456 | 2774128221 | |||
| 1457 | 2774138438 | |||
| 1458 | 2774389159 | |||
| 1459 | 2774439347 | |||
| 1460 | 2784265541 | |||
| 1461 | 2784314814 | |||
| 1462 | 2794595055 | |||
| 1463 | 2808857082 | |||
| 1464 | 2808926692 | |||
| 1465 | 2808927476 | |||
| 1466 | 2808937154 | |||
| 1467 | 2808939301 | |||
| 1468 | 2808948853 | |||
| 1469 | 2808949984 | |||
| 1470 | 2808959008 | |||
| 1471 | 2808965470 | |||
| 1472 | 2809000289 | |||
| 1473 | 2809216490 | |||
| 1474 | 2812371261 | |||
| 1475 | 2819654682 | |||
| 1476 | 2819702123 | |||
| 1477 | 2823424845 | |||
| 1478 | 2825656430 | |||
| 1479 | 2826584512 | |||
| 1480 | 2842818066 | |||
| 1481 | 2842832582 | |||
| 1482 | 2842848858 | |||
| 1483 | 2842849298 | |||
| 1484 | 2842856814 | |||
| 1485 | 2843694272 | |||
| 1486 | 2844671914 | |||
| 1487 | 2846035820 | |||
| 1488 | 2846040381 | |||
| 1489 | 2852659034 | |||
| 1490 | 2860339905 | |||
| 1491 | 2878031553 | |||
| 1492 | 2880232424 | |||
| 1493 | 2904523884 | |||
| 1494 | 2904552865 | |||
| 1495 | 2912967682 | |||
| 1496 | 2913041158 | |||
| 1497 | 2916701370 | |||
| 1498 | 2917075261 | |||
| 1499 | 2917835429 | |||
| 1500 | 2919063978 | |||
| 1501 | 2919129239 | |||
| 1502 | 2919159939 | |||
| 1503 | 2919185422 | |||
| 1504 | 2919386519 | |||
| 1505 | 2919457000 | |||
| 1506 | 2919486084 | |||
| 1507 | 2919491201 | |||
| 1508 | 2919508533 | |||
| 1509 | 2919699292 | |||
| 1510 | 2923158086 | |||
| 1511 | 2923525372 | |||
| 1512 | 2923590141 | |||
| 1513 | 2928516348 | |||
| 1514 | 2929148611 | |||
| 1515 | 2931373953 | |||
| 1516 | 2931400202 | |||
| 1517 | 2935356249 | |||
| 1518 | 2939639632 | |||
| 1519 | 2939655856 | |||
| 1520 | 2969306335 | |||
| 1521 | 2974292010 | |||
| 1522 | 2974299622 | |||
| 1523 | 2984288092 | |||
| 1524 | 2984501979 | |||
| 1525 | 2984504522 | |||
| 1526 | 2984572338 | |||
| 1527 | 2988730200 | |||
| 1528 | 2998141734 | |||
| 1529 | 3007256631 | |||
| 1530 | 3007319129 | |||
| 1531 | 3007397391 | |||
| 1532 | 3007515258 | |||
| 1533 | 3007616560 | |||
| 1534 | 3007620058 | |||
| 1535 | 3007719374 | |||
| 1536 | 3007809266 | |||
| 1537 | 3007856321 | |||
| 1538 | 3007863032 | |||
| 1539 | 3007870544 | |||
| 1540 | 3007875289 | |||
| 1541 | 637321717 | |||
| 1542 | 651175314 | |||
| 1543 | 8002750044 | |||
| 1544 | 8011353895 | |||
| 1545 | 8015692182 | |||
| 1546 | 8016733672 | |||
| 1547 | 8019773034 | |||
| 1548 | 8019776438 | |||
| 1549 | 8029999026 | |||
| 1550 | 8033233664 | |||
| 1551 | 8034962823 | |||
| 1552 | 8052495917 | |||
| 1553 | 8054932285 | |||
| 1554 | 8055775391 | |||
| 1555 | 8055878910 | |||
| 1556 | 8056130076 | |||
| 1557 | 8056138843 | |||
| 1558 | 8056144771 | |||
| 1559 | 8056156120 | |||
| 1560 | 8056169261 | |||
| 1561 | 8056175450 | |||
| 1562 | 8056181254 | |||
| 1563 | 8056571464 | |||
| 1564 | 8057804207 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6riq-assembly1.cif.gz_C | mincd filament from pseudomonas aeruginosa | 0.9852 | 2 | 255 |
| 3q9l-assembly1.cif.gz_A | the structure of the dimeric e.coli mind-atp complex | 0.985 | 2 | 257 |
| 6riq-assembly1.cif.gz_C | mincd filament from pseudomonas aeruginosa | 0.9814 | 2 | 255 |
| 3r9i-assembly2.cif.gz_C | 2.6a resolution structure of mind complexed with mine (12-31) peptide | 0.9812 | 2 | 257 |
| 3q9l-assembly1.cif.gz_A | the structure of the dimeric e.coli mind-atp complex | 0.9774 | 2 | 257 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3r9iC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9812 | 2 | 257 | 3.40.50.300 |
| 3r9iC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9774 | 2 | 257 | 3.40.50.300 |
| 4v02A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9267 | 2 | 257 | 3.40.50.300 |
| 4v02A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9231 | 2 | 257 | 3.40.50.300 |
| af_K7L057_1_178_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9037 | 17 | 159 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A381GKQ0-F1-model_v4 | deleted | 0.9938 | 131 | 214 |
|
| AF-A0A3D0CB54-F1-model_v4 | Septum site-determining protein MinD | 0.9936 | 86 | 234 |
GO:0005524
GO:0005829 GO:0009898 GO:0016887 GO:0051782 |
| AF-A0A7Y0SDY5-F1-model_v4 | Septum site-determining protein MinD | 0.9934 | 134 | 225 |
GO:0005524
GO:0005829 GO:0009898 GO:0016887 GO:0051782 |
| AF-W7QEY8-F1-model_v4 | Septum site-determining protein MinD (Cell division inhibitor MinD) | 0.9927 | 1 | 238 |
GO:0000917
GO:0005524 GO:0005829 GO:0009898 GO:0016887 GO:0051782 |
| AF-A0A2M7WVW0-F1-model_v4 | Septum site-determining protein MinD (Cell division inhibitor MinD) | 0.9918 | 1 | 248 |
GO:0000917
GO:0005524 GO:0005829 GO:0009898 GO:0016887 GO:0051782 |