F480601

General Info

Members Datasets Scaffolds Average Seq Length
782 510 1564 270

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100095369|Ga0070684_1000953693
Length 304
Sequence MPCAIGVARHSGHAGKYRAGAGRRTGASFGGRRILAKVVVITSGKGGVGKTTSSAAFAAGLALRGHRTVVIDFDVGLRNLDLIMGCERRVVFDFINVINRDANLNQALIKDKRNDNLYVFPTSQTRDKDALKREGVERVLEELRQQFDYIVCDSPAGIEHGAITALYFADAAIIVTNPEVSSVRDSDRIIGILASRSRRAERNEAPVELNLLLTRYDSGRVSRGEMMTVEDVQEILSIPLLGVIPESESVLRASNTGTPVTFDTESPAGRAYHDAVARFLGETREMRFVKPERRNFFRVLFGRA

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
49 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
50 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
78 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
79 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
117 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
118 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
126 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
134 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
135 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
136 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
137 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
148 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
149 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
167 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
170 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
171 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
172 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
173 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
174 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
175 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
176 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
177 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
178 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
179 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
180 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
181 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
182 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
183 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
184 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
185 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
196 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
199 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
205 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
206 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
207 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
208 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
209 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
210 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
211 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
212 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
213 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
214 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
217 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
218 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
219 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
220 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
221 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
222 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
223 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
224 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
225 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
226 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
227 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
228 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
229 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
232 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
235 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
236 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
237 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
238 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
239 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
240 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
241 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
242 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
243 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
244 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
245 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
246 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
247 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
248 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
249 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
250 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
251 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
252 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
253 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
254 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
255 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
256 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
257 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
258 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
259 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
266 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
267 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
268 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
269 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
270 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
271 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
272 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
273 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
274 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
277 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
278 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
282 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
283 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
284 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
285 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
286 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
287 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
288 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
289 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
290 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
291 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
292 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
293 2511231004 Pseudomonas sp. GM102 Isolate Nodule
294 2511231006 Pseudomonas sp. GM17 Isolate Nodule
295 2511231007 Pseudomonas sp. GM18 Isolate Nodule
296 2511231008 Pseudomonas sp. GM21 Isolate Nodule
297 2511231010 Pseudomonas sp. GM25 Isolate Nodule
298 2511231011 Pseudomonas sp. GM30 Isolate Nodule
299 2511231012 Pseudomonas sp. GM33 Isolate Nodule
300 2511231014 Pseudomonas sp. GM48 Isolate Nodule
301 2511231015 Pseudomonas sp. GM49 Isolate Nodule
302 2511231016 Pseudomonas sp. GM50 Isolate Nodule
303 2511231017 Pseudomonas sp. GM55 Isolate Nodule
304 2511231018 Pseudomonas sp. GM60 Isolate Nodule
305 2511231019 Pseudomonas sp. GM67 Isolate Nodule
306 2511231020 Pseudomonas sp. GM74 Isolate Nodule
307 2511231021 Pseudomonas sp. GM78 Isolate Nodule
308 2511231022 Pseudomonas sp. GM79 Isolate Nodule
309 2511231023 Pseudomonas sp. GM80 Isolate Nodule
310 2511231024 Pseudomonas sp. GM84 Isolate Nodule
311 2511231031 Pseudomonas sp. GM16 Isolate Nodule
312 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
313 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
314 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
315 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
316 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
317 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
318 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
319 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
320 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
321 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
322 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
323 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
324 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
325 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
326 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
327 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
328 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
329 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
330 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
331 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
332 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
333 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
334 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
335 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
336 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
337 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
338 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
339 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
340 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
341 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
342 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
343 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
344 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
345 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
346 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
347 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
348 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
349 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
350 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
351 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
352 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
353 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
354 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
355 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
356 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
357 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
358 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
359 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
360 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
361 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
362 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
363 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
364 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
365 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
366 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
367 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
368 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
369 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
370 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
371 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
372 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
373 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
374 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
375 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
376 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
377 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
378 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
379 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
380 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
381 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
382 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
383 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
384 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
385 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
386 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
387 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
388 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
389 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
390 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
391 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
392 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
393 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
394 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
395 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
396 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
397 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
398 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
399 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
400 2765235841 Pseudomonas putida AA7 Isolate Unclassified
401 2773857670 Pseudomonas sp. 478 Isolate Unclassified
402 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
403 2773857673 Pseudomonas sp. 443 Isolate Unclassified
404 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
405 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
406 2784132063 Pseudomonas sp. 424 Isolate Unclassified
407 2784132072 Pseudomonas sp. 460 Isolate Unclassified
408 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
409 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
410 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
411 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
412 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
413 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
414 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
415 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
416 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
417 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
418 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
419 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
420 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
421 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
422 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
423 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
424 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
425 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
426 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
427 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
428 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
429 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
430 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
431 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
432 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
433 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
434 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
435 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
436 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
437 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
438 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
439 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
440 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
441 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
442 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
443 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
444 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
445 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
446 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
447 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
448 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
449 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
450 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
451 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
452 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
453 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
454 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
455 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
456 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
457 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
458 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
459 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
460 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
461 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
462 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
463 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
464 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
465 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
466 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
467 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
468 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
469 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
470 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
471 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
472 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
473 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
474 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
475 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
476 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
477 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
478 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
479 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
480 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
481 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
482 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
483 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
484 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
485 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
486 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
487 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
488 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
489 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
490 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
491 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
492 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
493 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
494 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
495 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
496 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
497 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
498 8052494512 Pseudomonas putida LD6 Isolate Unclassified
499 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
500 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
501 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
502 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
503 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
504 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
505 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
506 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
507 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
508 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
509 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
510 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.1
Metatranscriptomes 0.64
Isolates 28.26

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 4.86
Nodule 3.32
Rhizoplane 8.44
Rhizosphere 69.05
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_100095369 3300005535 Bacteria 2650
2 MRS2a_Contig_23 2124908027 Bacteria 55080
3 MRS2a_Contig_6280 2124908027 Bacteria 1660
4 SwRhRL2b_contig_2798511 2162886007 Bacteria 2305
5 JGI25162J39368_1000251 3300002737 Bacteria 52332
6 JGI25162J39368_1000315 3300002737 Bacteria 42934
7 JGI25163J39215_1001111 3300002771 Bacteria 5465
8 JGI25164J39214_1000194 3300002772 Bacteria 52332
9 JGI25164J39214_1000411 3300002772 Bacteria 24391
10 JGI25159J45721_1001567 3300002987 Bacteria 9372
11 JGI25165J46597_1000348 3300003214 Bacteria 52332
12 JGI25165J46597_1000430 3300003214 Bacteria 42934
13 rootH2_10091229 3300003320 Bacteria 5621
14 rootH1_10005337 3300003323 Bacteria 42291
15 rootH1_10167004 3300003323 Bacteria 9914
16 Ga0006562J51391_1018591 3300003578 Bacteria 3510
17 Ga0006562J51391_1037971 3300003578 Bacteria 1941
18 Ga0055524_1000017 3300003775 Bacteria 235608
19 Ga0055536_1004018 3300003781 Bacteria 7673
20 Ga0055531_10000997 3300003794 Bacteria 22497
21 Ga0058692_1000014 3300003856 Bacteria 313984
22 Ga0065703_1000184 3300005272 Bacteria 28729
23 Ga0065714_10000034 3300005288 Bacteria 15985
24 Ga0065714_10070725 3300005288 Bacteria 3783
25 Ga0065714_10183392 3300005288 Bacteria 954
26 Ga0065704_10015961 3300005289 Bacteria 3535
27 Ga0065704_10194481 3300005289 Bacteria 1174
28 Ga0065712_10067911 3300005290 Bacteria 21555
29 Ga0065712_10069558 3300005290 Bacteria 7067
30 Ga0065715_10234727 3300005293 Bacteria 1215
31 Ga0070682_100033828 3300005337 Bacteria 3108
32 Ga0070660_100030566 3300005339 Bacteria 4040
33 Ga0070669_100008078 3300005353 Bacteria 7518
34 Ga0070671_100029170 3300005355 Bacteria 4550
35 Ga0070671_100179916 3300005355 Bacteria 1790
36 Ga0070709_10010843 3300005434 Bacteria 5058
37 Ga0070714_100032520 3300005435 Bacteria 4355
38 Ga0070714_100254214 3300005435 Bacteria 1626
39 Ga0070713_100091115 3300005436 Bacteria 2622
40 Ga0070713_100288260 3300005436 Bacteria 1508
41 Ga0070710_10111820 3300005437 Bacteria 1641
42 Ga0070711_100024685 3300005439 Bacteria 3925
43 Ga0070711_100210121 3300005439 Bacteria 1507
44 Ga0070711_100494301 3300005439 Bacteria 1008
45 Ga0070708_100310713 3300005445 Bacteria 1485
46 Ga0070662_100032504 3300005457 Bacteria 3667
47 Ga0070706_100018287 3300005467 Bacteria 6467
48 Ga0070706_100093967 3300005467 Bacteria 2783
49 Ga0070707_100020705 3300005468 Bacteria 6207
50 Ga0070698_100017589 3300005471 Bacteria 7533
51 Ga0070698_100401646 3300005471 Bacteria 1304
52 Ga0070698_100406750 3300005471 Bacteria 1295
53 Ga0070699_100172711 3300005518 Bacteria 1915
54 Ga0070699_100382835 3300005518 Bacteria 1270
55 Ga0070699_100466838 3300005518 Bacteria 1145
56 Ga0070697_100031861 3300005536 Bacteria 4242
57 Ga0070697_100336889 3300005536 Bacteria 1301
58 Ga0070665_100018863 3300005548 Bacteria 6917
59 Ga0068861_100552079 3300005719 Bacteria 1050
60 Ga0070717_10011796 3300006028 Bacteria 6647
61 Ga0075364_10068387 3300006051 Bacteria 2336
62 Ga0075432_10101495 3300006058 Bacteria 1063
63 Ga0075432_10130832 3300006058 Bacteria 950
64 Ga0070716_100029621 3300006173 Bacteria 2962
65 Ga0070716_100053936 3300006173 Bacteria 2294
66 Ga0070712_100013081 3300006175 Bacteria 5292
67 Ga0070712_100027336 3300006175 Bacteria 3809
68 Ga0075362_10056973 3300006177 Bacteria 1760
69 Ga0075370_10143729 3300006353 Bacteria 1395
70 Ga0075434_100059625 3300006871 Bacteria 3794
71 Ga0075436_100012460 3300006914 Bacteria 5827
72 Ga0079104_1000982 3300006946 Bacteria 22250
73 Ga0099826_10003959 3300006948 Bacteria 10255
74 Ga0099795_10001078 3300007788 Bacteria 5642
75 Ga0099795_10008269 3300007788 Bacteria 2958
76 Ga0105251_10000035 3300009011 Bacteria 117861
77 Ga0105251_10005924 3300009011 Bacteria 7901
78 Ga0105251_10032130 3300009011 Bacteria 2619
79 Ga0105251_10065962 3300009011 Bacteria 1693
80 Ga0105251_10083088 3300009011 Bacteria 1479
81 Ga0105251_10083294 3300009011 Bacteria 1477
82 Ga0105251_10200108 3300009011 Bacteria 900
83 Ga0105244_10001134 3300009036 Bacteria 22154
84 Ga0105244_10017376 3300009036 Bacteria 4066
85 Ga0105244_10031086 3300009036 Bacteria 2835
86 Ga0105244_10091482 3300009036 Bacteria 1495
87 Ga0105250_10000056 3300009092 Bacteria 114085
88 Ga0105250_10011835 3300009092 Bacteria 3616
89 Ga0105250_10023276 3300009092 Bacteria 2496
90 Ga0105250_10023995 3300009092 Bacteria 2458
91 Ga0105250_10041937 3300009092 Bacteria 1834
92 Ga0105240_10004855 3300009093 Bacteria 20243
93 Ga0105240_10041595 3300009093 Bacteria 5864
94 Ga0105240_10260407 3300009093 Bacteria 2001
95 Ga0105243_10000249 3300009148 Bacteria 61872
96 Ga0105243_10001441 3300009148 Bacteria 20939
97 Ga0105243_10002007 3300009148 Bacteria 17310
98 Ga0105243_10036370 3300009148 Bacteria 3822
99 Ga0105242_10306473 3300009176 Bacteria 1451
100 Ga0105242_10554592 3300009176 Bacteria 1102
101 Ga0105249_10000342 3300009553 Bacteria 47083
102 Ga0099796_10010745 3300010159 Bacteria 2527
103 Ga0099796_10028241 3300010159 Bacteria 1799
104 Ga0105239_10344886 3300010375 Bacteria 1681
105 Ga0105246_10001895 3300011119 Bacteria 12596
106 Ga0105246_10007270 3300011119 Bacteria 6785
107 Ga0105246_10270088 3300011119 Bacteria 1359
108 Ga0157373_10009442 3300013100 Bacteria 7206
109 Ga0157373_10036301 3300013100 Bacteria 3538
110 Ga0157373_10133656 3300013100 Bacteria 1744
111 Ga0157371_10014441 3300013102 Bacteria 5959
112 Ga0157371_10017060 3300013102 Bacteria 5402
113 Ga0157371_10029699 3300013102 Bacteria 3949
114 Ga0157371_10209200 3300013102 Bacteria 1400
115 Ga0157370_10064240 3300013104 Bacteria 3475
116 Ga0157370_10383435 3300013104 Bacteria 1294
117 Ga0157369_10004688 3300013105 Bacteria 16077
118 Ga0157374_10430858 3300013296 Bacteria 1318
119 Ga0163162_10065357 3300013306 Bacteria 3684
120 Ga0157372_10038059 3300013307 Bacteria 5308
121 Ga0157372_10727607 3300013307 Bacteria 1154
122 Ga0157375_10308655 3300013308 Bacteria 1746
123 Ga0182008_10023277 3300014497 Bacteria 3166
124 Ga0182008_10029769 3300014497 Bacteria 2756
125 Ga0182008_10090027 3300014497 Bacteria 1512
126 Ga0157377_10222222 3300014745 Bacteria 1210
127 Ga0157379_10316027 3300014968 Bacteria 1425
128 Ga0182006_1006419 3300015261 Bacteria 5469
129 Ga0182006_1009493 3300015261 Bacteria 4358
130 Ga0182006_1035789 3300015261 Bacteria 1976
131 Ga0182007_10001991 3300015262 Bacteria 10535
132 Ga0182005_1008729 3300015265 Bacteria 2976
133 Ga0182005_1076232 3300015265 Bacteria 923
134 Ga0163161_10084202 3300017792 Bacteria 2345
135 Ga0206352_11149150 3300020078 Bacteria 2530
136 Ga0213873_10014176 3300021358 Bacteria 1762
137 Ga0213872_10000652 3300021361 Bacteria 26299
138 Ga0213872_10001532 3300021361 Bacteria 14857
139 Ga0213872_10001557 3300021361 Bacteria 14685
140 Ga0213872_10001677 3300021361 Bacteria 13937
141 Ga0213872_10026800 3300021361 Bacteria 2647
142 Ga0213874_10009670 3300021377 Bacteria 2391
143 Ga0213875_10000145 3300021388 Bacteria 75194
144 Ga0213875_10006534 3300021388 Bacteria 6104
145 Ga0209760_100011 3300025207 Bacteria 197221
146 Ga0209760_100064 3300025207 Bacteria 91180
147 Ga0209563_100495 3300025230 Bacteria 13358
148 Ga0207427_100008 3300025231 Bacteria 740731
149 Ga0207427_100082 3300025231 Bacteria 142809
150 Ga0209437_100006 3300025233 Bacteria 1042724
151 Ga0209437_100014 3300025233 Bacteria 740714
152 Ga0209759_1007138 3300025256 Bacteria 3642
153 Ga0209233_1000008 3300025261 Bacteria 1356712
154 Ga0209233_1000105 3300025261 Bacteria 272035
155 Ga0209675_1017364 3300025291 Bacteria 2058
156 Ga0209676_1000006 3300025292 Bacteria 1039588
157 Ga0209676_1000369 3300025292 Bacteria 83704
158 Ga0209676_1000803 3300025292 Bacteria 41332
159 Ga0209676_1001140 3300025292 Bacteria 29053
160 Ga0209050_1000070 3300025298 Bacteria 296366
161 Ga0209050_1000235 3300025298 Bacteria 121420
162 Ga0209050_1000380 3300025298 Bacteria 83704
163 Ga0209050_1001241 3300025298 Bacteria 29500
164 Ga0209051_1000086 3300025303 Bacteria 183550
165 Ga0209051_1000123 3300025303 Bacteria 144298
166 Ga0209051_1001064 3300025303 Bacteria 25530
167 Ga0209257_1000421 3300025304 Bacteria 81748
168 Ga0209257_1005819 3300025304 Bacteria 8368
169 Ga0207696_1000025 3300025711 Bacteria 418650
170 Ga0207696_1000144 3300025711 Bacteria 122345
171 Ga0207696_1003214 3300025711 Bacteria 7545
172 Ga0207696_1006143 3300025711 Bacteria 4883
173 Ga0207696_1006846 3300025711 Bacteria 4537
174 Ga0207696_1013375 3300025711 Bacteria 2862
175 Ga0207655_1000183 3300025728 Bacteria 112295
176 Ga0207655_1000592 3300025728 Bacteria 44578
177 Ga0207655_1000976 3300025728 Bacteria 29345
178 Ga0207655_1001969 3300025728 Bacteria 17531
179 Ga0207655_1003070 3300025728 Bacteria 12720
180 Ga0207655_1005485 3300025728 Bacteria 8608
181 Ga0207655_1006081 3300025728 Bacteria 8057
182 Ga0207655_1008047 3300025728 Bacteria 6758
183 Ga0207655_1010633 3300025728 Bacteria 5564
184 Ga0207655_1012126 3300025728 Bacteria 5067
185 Ga0207655_1025877 3300025728 Bacteria 2835
186 Ga0207713_1001249 3300025735 Bacteria 21049
187 Ga0207713_1001767 3300025735 Bacteria 16571
188 Ga0207713_1003135 3300025735 Bacteria 11460
189 Ga0207713_1003177 3300025735 Bacteria 11369
190 Ga0207713_1006088 3300025735 Bacteria 7431
191 Ga0207713_1014429 3300025735 Bacteria 4108
192 Ga0207713_1047856 3300025735 Bacteria 1727
193 Ga0207692_10010663 3300025898 Bacteria 3882
194 Ga0207692_10023731 3300025898 Bacteria 2841
195 Ga0207710_10000122 3300025900 Bacteria 94509
196 Ga0207684_10378695 3300025910 Bacteria 1217
197 Ga0207707_10030684 3300025912 Bacteria 4703
198 Ga0207707_10231927 3300025912 Bacteria 1606
199 Ga0207695_10015272 3300025913 Bacteria 9052
200 Ga0207693_10005303 3300025915 Bacteria 10773
201 Ga0207693_10052530 3300025915 Bacteria 3197
202 Ga0207693_10071210 3300025915 Bacteria 2721
203 Ga0207663_10341937 3300025916 Bacteria 1130
204 Ga0207660_10387537 3300025917 Bacteria 1124
205 Ga0207652_10100233 3300025921 Bacteria 2557
206 Ga0207646_10009040 3300025922 Bacteria 9898
207 Ga0207681_10005882 3300025923 Bacteria 7524
208 Ga0207681_10088241 3300025923 Bacteria 2208
209 Ga0207700_10002928 3300025928 Bacteria 9849
210 Ga0207700_10183041 3300025928 Bacteria 1756
211 Ga0207700_10208336 3300025928 Bacteria 1651
212 Ga0207664_10016110 3300025929 Bacteria 5446
213 Ga0207664_10127472 3300025929 Bacteria 2138
214 Ga0207664_10520324 3300025929 Bacteria 1066
215 Ga0207644_10109678 3300025931 Bacteria 2085
216 Ga0207709_10000001 3300025935 Bacteria 2228154
217 Ga0207709_10000223 3300025935 Bacteria 71537
218 Ga0207709_10000835 3300025935 Bacteria 23621
219 Ga0207709_10030554 3300025935 Bacteria 3135
220 Ga0207665_10006644 3300025939 Bacteria 7673
221 Ga0207665_10033004 3300025939 Bacteria 3429
222 Ga0207665_10049356 3300025939 Bacteria 2827
223 Ga0207712_10001909 3300025961 Bacteria 13702
224 Ga0207703_10319423 3300026035 Bacteria 1422
225 Ga0207702_10031690 3300026078 Bacteria 4407
226 Ga0207641_10435466 3300026088 Bacteria 1265
227 Ga0207676_10416744 3300026095 Bacteria 1259
228 Ga0209281_1000010 3300027111 Bacteria 726106
229 Ga0209281_1000331 3300027111 Bacteria 81645
230 Ga0209281_1005471 3300027111 Bacteria 3515
231 Ga0209389_1000031 3300027296 Bacteria 138036
232 Ga0209371_1000040 3300027312 Bacteria 340804
233 Ga0209371_1000182 3300027312 Bacteria 92399
234 Ga0209371_1000589 3300027312 Bacteria 32598
235 Ga0209371_1017352 3300027312 Bacteria 1867
236 Ga0209969_1013169 3300027360 Bacteria 1196
237 Ga0209984_1001806 3300027424 Bacteria 2351
238 Ga0209179_1019988 3300027512 Bacteria 1295
239 Ga0209999_1002159 3300027543 Bacteria 3443
240 Ga0209982_1009659 3300027552 Bacteria 1427
241 Ga0209983_1000763 3300027665 Bacteria 7000
242 Ga0209282_1054335 3300027666 Bacteria 2273
243 Ga0209971_1000554 3300027682 Bacteria 9762
244 Ga0209974_10007616 3300027876 Bacteria 3729
245 Ga0207428_10238370 3300027907 Bacteria 1360
246 Ga0268266_10014923 3300028379 Bacteria 6671
247 Ga0268266_10055084 3300028379 Bacteria 3418
248 Ga0268265_10473215 3300028380 Bacteria 1175
249 Ga0307515_10002349 3300028794 Bacteria 41308
250 Ga0265338_10006011 3300028800 Bacteria 15594
251 Ga0265338_10155737 3300028800 Bacteria 1770
252 Ga0268256_1000041 3300030500 Bacteria 340725
253 Ga0268256_1000153 3300030500 Bacteria 92399
254 Ga0268256_1000511 3300030500 Bacteria 32598
255 Ga0268256_1019341 3300030500 Bacteria 1867
256 Ga0316177_1211506 3300030731 Bacteria 2006
257 Ga0316179_1028994 3300030734 Bacteria 2584
258 Ga0316178_1108793 3300030735 Bacteria 13326
259 Ga0316183_1189572 3300030742 Bacteria 1868
260 Ga0265327_10013441 3300031251 Bacteria 5435
261 Ga0265327_10031808 3300031251 Bacteria 2960
262 Ga0307408_100000025 3300031548 Bacteria 267563
263 Ga0307408_100000192 3300031548 Bacteria 65993
264 Ga0265314_10038335 3300031711 Bacteria 3463
265 Ga0307413_10226145 3300031824 Bacteria 1370
266 Ga0307406_10004592 3300031901 Bacteria 7515
267 Ga0307416_100018095 3300032002 Bacteria 4953
268 Ga0307416_100311510 3300032002 Bacteria 1571
269 Ga0307414_10009804 3300032004 Bacteria 5521
270 Ga0307510_10084516 3300033180 Bacteria 3056
271 Ga0316592_1010457 3300033524 Bacteria 1873
272 Ga0373926_0056900 3300035083 Bacteria 1419
273 Ga0373934_0048463 3300035086 Bacteria 1682
274 Ga0373936_0078468 3300035113 Bacteria 1371
275 Ga0373936_0144144 3300035113 Bacteria 1030
276 Ga0373945_0004496 3300035116 Bacteria 4435
277 Ga0373954_0015261 3300035118 Bacteria 3433
278 Ga0373956_0025169 3300035119 Bacteria 2570
279 Ga0373943_0015057 3300035170 Bacteria 3511
280 Ga0373946_0011231 3300035171 Bacteria 3336
281 Ga0373955_0012134 3300035172 Bacteria 4135
282 Ga0373931_0031538 3300035691 Bacteria 2736
283 Ga0373935_0070416 3300035692 Bacteria 2254
284 Ga0373935_0258906 3300035692 Bacteria 1220
285 Ga0373927_0027023 3300035695 Bacteria 3750
286 Ga0373933_0029653 3300035724 Bacteria 3165
287 Ga0373933_0086916 3300035724 Bacteria 1925
288 Ga0373947_0035501 3300035725 Bacteria 2952
289 Ga0373947_0128505 3300035725 Bacteria 1615
290 Ga0373937_0006327 3300036401 Bacteria 10209
291 Ga0373937_0020176 3300036401 Bacteria 5973
292 Ga0373937_0027602 3300036401 Bacteria 5135
293 Ga0373937_0216263 3300036401 Bacteria 1804
294 Ga0373925_0257410 3300037068 Bacteria 1401
295 Ga0395905_0004104 3300037471 Bacteria 15258
296 Ga0436364_0056880 3300037853 Bacteria 87492
297 Ga0436364_0723260 3300037853 Bacteria 46751
298 Ga0436364_1260460 3300037853 Bacteria 34019
299 Ga0395901_0180939 3300038443 Bacteria 2211
300 Ga0237819_09277 3300038705 Bacteria 1326
301 Ga0400487_28623 3300039110 Bacteria 17274
302 Ga0436365_0036381 3300039437 Bacteria 1551
303 Ga0436365_1164564 3300039437 Bacteria 2425
304 Ga0436360_0186592 3300039438 Bacteria 4129
305 Ga0436360_0307969 3300039438 Bacteria 1537
306 Ga0436360_0572509 3300039438 Bacteria 1403
307 Ga0436360_0734628 3300039438 Bacteria 2392
308 Ga0436360_0800231 3300039438 Bacteria 2473
309 Ga0436360_0839587 3300039438 Bacteria 1977
310 Ga0436361_0284071 3300039447 Bacteria 50310
311 Ga0436361_0606756 3300039447 Bacteria 2209
312 Ga0436361_0714916 3300039447 Bacteria 984
313 Ga0436361_1053619 3300039447 Bacteria 7181
314 Ga0436361_1216557 3300039447 Bacteria 1915
315 Ga0436363_0451735 3300039450 Bacteria 2405
316 Ga0436363_1129503 3300039450 Bacteria 1188
317 Ga0436363_1381957 3300039450 Bacteria 1375
318 Ga0436363_1460963 3300039450 Bacteria 4458
319 Ga0436362_0220171 3300039453 Bacteria 1319
320 Ga0436362_0436236 3300039453 Bacteria 3595
321 Ga0436362_0656757 3300039453 Bacteria 2439
322 Ga0436362_0999455 3300039453 Bacteria 1321
323 Ga0439438_001471 3300041405 Bacteria 10380
324 Ga0439438_005024 3300041405 Bacteria 4936
325 Ga0439438_008558 3300041405 Bacteria 3382
326 Ga0439438_008813 3300041405 Bacteria 3309
327 Ga0439447_002251 3300041407 Bacteria 7074
328 Ga0439466_0002838 3300041411 Bacteria 6779
329 Ga0439466_0004194 3300041411 Bacteria 5560
330 Ga0439466_0008003 3300041411 Bacteria 3986
331 Ga0439432_000967 3300042006 Bacteria 10835
332 Ga0439432_002797 3300042006 Bacteria 6506
333 Ga0439451_015276 3300042009 Bacteria 1547
334 Ga0439452_001447 3300042010 Bacteria 9700
335 Ga0439452_005155 3300042010 Bacteria 4250
336 Ga0439456_003614 3300042013 Bacteria 3141
337 Ga0439463_003014 3300042016 Bacteria 4274
338 Ga0450905_003390 3300042142 Bacteria 2094
339 Ga0450907_000326 3300042146 Bacteria 15234
340 Ga0439446_0000172 3300042156 Bacteria 11417
341 Ga0439446_0007048 3300042156 Bacteria 2946
342 Ga0439444_0004568 3300042437 Bacteria 2020
343 Ga0439460_0002152 3300042461 Bacteria 4727
344 Ga0451577_0157217 3300042876 Bacteria 2046
345 Ga0451577_0290548 3300042876 Bacteria 1481
346 Ga0439440_0004886 3300042993 Bacteria 2644
347 Ga0466966_0102598 3300044684 Bacteria 1768
348 Ga0453684_0002079 3300044712 Bacteria 50825
349 Ga0453684_0003561 3300044712 Bacteria 34833
350 Ga0466957_0378394 3300044842 Bacteria 965
351 Ga0466959_0620050 3300045049 Unclassified 727
352 Ga0451576_0001285 3300045051 Bacteria 43656
353 Ga0451576_0021642 3300045051 Bacteria 6987
354 Ga0451576_0024670 3300045051 Bacteria 6492
355 Ga0466958_0001326 3300045836 Bacteria 11669
356 Ga0466958_0302669 3300045836 Bacteria 1027
357 Ga0466967_0416720 3300045976 Bacteria 1308
358 Ga0466967_0558682 3300045976 Bacteria 1127
359 Ga0495617_001158 3300046452 Bacteria 11919
360 Ga0495627_000040 3300046453 Bacteria 195248
361 Ga0495627_000137 3300046453 Bacteria 87495
362 Ga0495603_0003767 3300046455 Bacteria 9020
363 Ga0495603_0049463 3300046455 Bacteria 2502
364 Ga0495590_0002219 3300046457 Bacteria 8116
365 Ga0495591_000023 3300046458 Bacteria 191598
366 Ga0495591_001514 3300046458 Bacteria 14316
367 Ga0495591_007986 3300046458 Bacteria 4398
368 Ga0495638_0077961 3300046460 Bacteria 2016
369 Ga0495653_0029603 3300046463 Bacteria 4369
370 Ga0495650_0007260 3300046471 Bacteria 6710
371 Ga0495650_0050834 3300046471 Bacteria 1711
372 Ga0495580_0022084 3300046472 Bacteria 4689
373 Ga0495605_0000245 3300046474 Bacteria 64374
374 Ga0495605_0001067 3300046474 Bacteria 18295
375 Ga0495605_0002605 3300046474 Bacteria 11085
376 Ga0495605_0010029 3300046474 Bacteria 5306
377 Ga0495605_0029245 3300046474 Bacteria 2839
378 Ga0495662_0101796 3300046476 Bacteria 1405
379 Ga0495584_0014523 3300046491 Bacteria 4011
380 Ga0495585_0002457 3300046492 Bacteria 13263
381 Ga0495585_0011404 3300046492 Bacteria 5259
382 Ga0495585_0013930 3300046492 Bacteria 4696
383 Ga0495585_0058023 3300046492 Bacteria 2135
384 Ga0495596_0000001 3300046500 Bacteria 501331
385 Ga0495596_0000375 3300046500 Bacteria 28559
386 Ga0495607_0000097 3300046501 Bacteria 92021
387 Ga0495607_0000234 3300046501 Bacteria 59488
388 Ga0495607_0000893 3300046501 Bacteria 27775
389 Ga0495607_0000972 3300046501 Bacteria 26545
390 Ga0495607_0004021 3300046501 Bacteria 11034
391 Ga0495607_0022053 3300046501 Bacteria 4003
392 Ga0495583_0003081 3300046506 Bacteria 13200
393 Ga0495583_0003683 3300046506 Bacteria 11408
394 Ga0495606_0000167 3300046507 Bacteria 115739
395 Ga0495606_0003593 3300046507 Bacteria 16335
396 Ga0495606_0004329 3300046507 Bacteria 14275
397 Ga0495606_0045902 3300046507 Bacteria 2891
398 Ga0495610_0026298 3300046512 Bacteria 3108
399 Ga0495610_0045368 3300046512 Bacteria 2175
400 Ga0495616_0018868 3300046513 Bacteria 3772
401 Ga0495616_0039392 3300046513 Bacteria 2420
402 Ga0495616_0058008 3300046513 Bacteria 1907
403 Ga0495620_0000003 3300046515 Bacteria 345923
404 Ga0495620_0009640 3300046515 Bacteria 5125
405 Ga0495620_0052081 3300046515 Bacteria 1740
406 Ga0495630_0094256 3300046517 Bacteria 2263
407 Ga0495631_0001015 3300046518 Bacteria 17434
408 Ga0495631_0006645 3300046518 Bacteria 5946
409 Ga0495631_0055140 3300046518 Bacteria 1731
410 Ga0495632_0001340 3300046519 Bacteria 20692
411 Ga0495632_0003328 3300046519 Bacteria 11458
412 Ga0495632_0004266 3300046519 Bacteria 9758
413 Ga0495632_0079706 3300046519 Bacteria 1563
414 Ga0495637_0000583 3300046520 Bacteria 25971
415 Ga0495637_0002931 3300046520 Bacteria 9200
416 Ga0495637_0003057 3300046520 Bacteria 8945
417 Ga0495637_0024711 3300046520 Bacteria 2717
418 Ga0495643_0000673 3300046522 Bacteria 40197
419 Ga0495643_0001803 3300046522 Bacteria 18339
420 Ga0495644_0003207 3300046523 Bacteria 6461
421 Ga0495648_0003579 3300046524 Bacteria 13596
422 Ga0495648_0004170 3300046524 Bacteria 12431
423 Ga0495648_0010693 3300046524 Bacteria 6971
424 Ga0495642_0001942 3300046528 Bacteria 8738
425 Ga0495642_0006012 3300046528 Bacteria 4661
426 Ga0495654_0008388 3300046530 Bacteria 5712
427 Ga0495654_0015800 3300046530 Bacteria 4003
428 Ga0495654_0035682 3300046530 Bacteria 2501
429 Ga0495654_0040236 3300046530 Bacteria 2330
430 Ga0495586_0034252 3300046535 Bacteria 2727
431 Ga0495587_0006269 3300046536 Bacteria 7762
432 Ga0495609_0000167 3300046538 Bacteria 68911
433 Ga0495609_0003356 3300046538 Bacteria 9226
434 Ga0495609_0006411 3300046538 Bacteria 6005
435 Ga0495597_0000016 3300046542 Bacteria 167456
436 Ga0495597_0008843 3300046542 Bacteria 5024
437 Ga0495622_0001305 3300046557 Bacteria 12775
438 Ga0495622_0012102 3300046557 Bacteria 3990
439 Ga0495622_0142618 3300046557 Bacteria 1087
440 Ga0495633_0003087 3300046558 Bacteria 11324
441 Ga0495667_0031187 3300046559 Bacteria 3579
442 Ga0495667_0142330 3300046559 Bacteria 1545
443 Ga0495656_0004946 3300046615 Bacteria 4588
444 Ga0495625_0000134 3300046660 Bacteria 115073
445 Ga0495625_0051221 3300046660 Bacteria 2960
446 Ga0495625_0135573 3300046660 Bacteria 1664
447 Ga0495635_0027178 3300046663 Bacteria 3981
448 Ga0495635_0102510 3300046663 Bacteria 1956
449 Ga0495659_0001323 3300046664 Bacteria 8509
450 Ga0495661_0000030 3300046665 Bacteria 171980
451 Ga0495661_0000088 3300046665 Bacteria 111782
452 Ga0495661_0009503 3300046665 Bacteria 6674
453 Ga0495661_0025395 3300046665 Bacteria 3826
454 Ga0495657_0104340 3300046675 Bacteria 1803
455 Ga0495599_0057891 3300046678 Bacteria 2425
456 Ga0495623_0024699 3300046679 Bacteria 3869
457 Ga0495669_0033833 3300046684 Bacteria 2251
458 Ga0495670_0002914 3300046691 Bacteria 8429
459 Ga0495670_0030265 3300046691 Bacteria 2689
460 Ga0495671_0023443 3300046692 Bacteria 3224
461 Ga0495671_0030450 3300046692 Bacteria 2763
462 Ga0495649_0000864 3300046694 Bacteria 24358
463 Ga0495649_0001550 3300046694 Bacteria 17244
464 Ga0495649_0050595 3300046694 Bacteria 2254
465 Ga0495589_0000881 3300046794 Bacteria 18650
466 Ga0495589_0007709 3300046794 Bacteria 5633
467 Ga0495589_0057115 3300046794 Bacteria 1920
468 Ga0495600_0060110 3300046809 Bacteria 2481
469 Ga0495600_0096446 3300046809 Bacteria 1928
470 Ga0495660_0001771 3300046810 Bacteria 14286
471 Ga0495660_0005240 3300046810 Bacteria 7778
472 Ga0495660_0027927 3300046810 Bacteria 3190
473 Ga0495660_0084170 3300046810 Bacteria 1663
474 Ga0495604_0036434 3300047317 Bacteria 3878
475 Ga0495636_0005048 3300047318 Bacteria 5181
476 Ga0495636_0009958 3300047318 Bacteria 3745
477 Ga0495672_0002710 3300047320 Bacteria 15891
478 Ga0495672_0012883 3300047320 Bacteria 5799
479 Ga0495672_0013396 3300047320 Bacteria 5659
480 Ga0495672_0139527 3300047320 Bacteria 1267
481 Ga0495676_0000018 3300047321 Bacteria 178380
482 Ga0495680_0156474 3300047322 Bacteria 1657
483 Ga0495680_0238027 3300047322 Bacteria 1294
484 Ga0495683_0000081 3300047323 Bacteria 95260
485 Ga0495683_0001199 3300047323 Bacteria 17691
486 Ga0495687_011688 3300047443 Bacteria 4696
487 Ga0495675_0005746 3300047444 Bacteria 7588
488 Ga0495679_007522 3300047446 Bacteria 4528
489 Ga0495673_0003548 3300047469 Bacteria 10270
490 Ga0495673_0005161 3300047469 Bacteria 7955
491 Ga0495673_0011087 3300047469 Bacteria 4870
492 Ga0495681_0002659 3300047470 Bacteria 12664
493 Ga0495681_0004092 3300047470 Bacteria 10026
494 Ga0495681_0007297 3300047470 Bacteria 7087
495 Ga0495681_0018194 3300047470 Bacteria 3878
496 Ga0495681_0044875 3300047470 Bacteria 2120
497 Ga0495684_0034497 3300047471 Bacteria 3882
498 Ga0495593_0029162 3300047673 Bacteria 3027
499 Ga0495626_0000125 3300048091 Bacteria 99451
500 Ga0495626_0003758 3300048091 Bacteria 9556
501 Ga0495626_0004444 3300048091 Bacteria 8605
502 Ga0496102_0008143 3300048905 Bacteria 8969
503 Ga0496106_0247213 3300048909 Bacteria 1426
504 Ga0496112_0038138 3300048915 Bacteria 4692
505 Ga0496113_0052589 3300048916 Bacteria 3043
506 Ga0496114_0012877 3300048917 Bacteria 6699
507 Ga0496114_0014042 3300048917 Bacteria 6423
508 Ga0496114_0040220 3300048917 Bacteria 3870
509 Ga0496116_0001043 3300048919 Bacteria 33784
510 Ga0496117_0015449 3300048920 Bacteria 6510
511 Ga0496117_0105712 3300048920 Bacteria 1768
512 Ga0496118_0009485 3300048921 Bacteria 9816
513 Ga0496118_0022994 3300048921 Bacteria 5428
514 Ga0496118_0060355 3300048921 Bacteria 2816
515 Ga0496119_0000444 3300048922 Bacteria 56759
516 Ga0496120_0001654 3300048923 Bacteria 25753
517 Ga0496121_0005707 3300048924 Bacteria 15809
518 Ga0496121_0063203 3300048924 Bacteria 3027
519 Ga0496121_0185589 3300048924 Bacteria 1496
520 Ga0496122_0006709 3300048925 Bacteria 13098
521 Ga0496122_0020183 3300048925 Bacteria 6039
522 Ga0496122_0077198 3300048925 Bacteria 2340
523 Ga0496123_0000887 3300048926 Bacteria 47327
524 Ga0496123_0001511 3300048926 Bacteria 32223
525 Ga0496123_0027233 3300048926 Bacteria 4262
526 Ga0496124_0022637 3300048927 Bacteria 5754
527 Ga0496124_0033678 3300048927 Bacteria 4505
528 Ga0496124_0098145 3300048927 Bacteria 2377
529 Ga0496124_0145885 3300048927 Bacteria 1862
530 Ga0496124_0295162 3300048927 Bacteria 1174
531 Ga0496125_0003525 3300048928 Bacteria 18884
532 Ga0496125_0034533 3300048928 Bacteria 4456
533 Ga0496125_0151532 3300048928 Bacteria 1591
534 Ga0496126_0050942 3300048929 Bacteria 3772
535 Ga0496126_0070794 3300048929 Bacteria 3106
536 Ga0496126_0099536 3300048929 Bacteria 2546
537 Ga0495678_000918 3300049459 Bacteria 25900
538 Ga0495682_0000050 3300049460 Bacteria 110280
539 Ga0495682_0001437 3300049460 Bacteria 12877
540 Ga0495682_0009054 3300049460 Bacteria 3904
541 Ga0501315_006626 3300049531 Bacteria 1295
542 Ga0501034_0000150 3300049571 Bacteria 131760
543 Ga0501034_0081970 3300049571 Bacteria 3228
544 Ga0501034_0101361 3300049571 Bacteria 2873
545 Ga0501034_0131785 3300049571 Bacteria 2483
546 Ga0501037_0019636 3300049573 Bacteria 4986
547 Ga0501070_0509753 3300049586 Bacteria 966
548 Ga0501076_0353512 3300049592 Bacteria 1207
549 Ga0501083_0007057 3300049744 Bacteria 7978
550 nmdc:mga0n895_145778_c1 3300050512 Bacteria 2397
551 nmdc:mga0n895_381445_c1 3300050512 Bacteria 1426
552 nmdc:mga0rr50_54084_c1 3300050513 Bacteria 2989
553 Ga0495601_0008558 3300053077 Bacteria 6043
554 Ga0495601_0091978 3300053077 Bacteria 1953
555 Ga0495619_0010468 3300053085 Bacteria 5833
556 Ga0495619_0050642 3300053085 Bacteria 2742
557 Ga0495619_0134760 3300053085 Bacteria 1698
558 Ga0495619_0183361 3300053085 Bacteria 1448
559 Ga0495619_0322549 3300053085 Bacteria 1069
560 Ga0500659_0002281 3300053135 Bacteria 11593
561 Ga0501082_0020563 3300060353 Bacteria 5689
562 2510285129 2510065053 Bacteria 5005518
563 2510294034 2510065055 Bacteria 5037935
564 2510313068 2510065058 Bacteria 5005894
565 2511254566 2511231004 Bacteria 6669789
566 2511267037 2511231006 Bacteria 6794709
567 2511273791 2511231007 Bacteria 6306603
568 2511276685 2511231008 Bacteria 6624100
569 2511292990 2511231010 Bacteria 6373152
570 2511293233 2511231011 Bacteria 6149768
571 2511301881 2511231012 Bacteria 6738011
572 2511314629 2511231014 Bacteria 6462302
573 2511317210 2511231015 Bacteria 6598026
574 2511323969 2511231016 Bacteria 6704427
575 2511331559 2511231017 Bacteria 6503007
576 2511339606 2511231018 Bacteria 6436256
577 2511344680 2511231019 Bacteria 6520662
578 2511349360 2511231020 Bacteria 6115223
579 2511355243 2511231021 Bacteria 7302637
580 2511366151 2511231022 Bacteria 6719296
581 2511368708 2511231023 Bacteria 6808468
582 2511374558 2511231024 Bacteria 5835885
583 2511413526 2511231031 Bacteria 6558529
584 2511826334 2511231156 Bacteria 6845832
585 2512324133 2512047018 Bacteria 6663241
586 2547373211 2547132103 Bacteria 5115736
587 2552746210 2551306352 Bacteria 3873115
588 2555671395 2554235341 Bacteria 6867980
589 2583793803 2582580891 Bacteria 6800976
590 2597859477 2597489887 Bacteria 6666321
591 2599328601 2599185155 Bacteria 5827168
592 2599354448 2599185160 Bacteria 6844013
593 2599359838 2599185161 Bacteria 6960462
594 2599366160 2599185162 Bacteria 6957254
595 2599372950 2599185163 Bacteria 6995158
596 2599379556 2599185164 Bacteria 6841688
597 2599385466 2599185165 Bacteria 6843250
598 2599391809 2599185166 Bacteria 6959206
599 2599403575 2599185168 Bacteria 6997636
600 2599461282 2599185181 Bacteria 6844519
601 2599469826 2599185182 Bacteria 6883168
602 2599482307 2599185185 Bacteria 6652270
603 2599490302 2599185186 Bacteria 6831633
604 2599504166 2599185188 Bacteria 6164180
605 2599613451 2599185212 Bacteria 6765997
606 2599772358 2599185248 Bacteria 6696816
607 2599803974 2599185257 Bacteria 6492581
608 2599888921 2599185289 Bacteria 6778765
609 2599900550 2599185291 Bacteria 6775623
610 2599933573 2599185300 Bacteria 6062622
611 2599943976 2599185302 Bacteria 5954930
612 2599955812 2599185304 Bacteria 5951361
613 2599961446 2599185305 Bacteria 6748700
614 2599969718 2599185306 Bacteria 6637356
615 2599975238 2599185307 Bacteria 6194719
616 2599981192 2599185308 Bacteria 6621546
617 2599985613 2599185309 Bacteria 5969593
618 2599989537 2599185310 Bacteria 6014457
619 2599994409 2599185311 Bacteria 6354990
620 2600000118 2599185312 Bacteria 5912071
621 2600009097 2599185313 Bacteria 6658188
622 2600015037 2599185314 Bacteria 6621749
623 2600019612 2599185315 Bacteria 6771107
624 2600023703 2599185316 Bacteria 6320029
625 2600032347 2599185317 Bacteria 6435722
626 2600038791 2599185318 Bacteria 6961590
627 2600044165 2599185319 Bacteria 6637840
628 2600048373 2599185320 Bacteria 5963263
629 2600054122 2599185321 Bacteria 6764560
630 2600060340 2599185322 Bacteria 6763055
631 2600066570 2599185323 Bacteria 6688755
632 2600074351 2599185324 Bacteria 6590677
633 2600078122 2599185325 Bacteria 6324919
634 2600213898 2599185356 Bacteria 6843884
635 2600361909 2600254930 Bacteria 6431253
636 2600364382 2600254931 Bacteria 6734225
637 2600443225 2600254954 Bacteria 5100516
638 2601626598 2600255283 Bacteria 6061572
639 2601774064 2600255313 Bacteria 6842543
640 2601795609 2600255318 Bacteria 6383414
641 2602009294 2600255389 Bacteria 5275336
642 2606075678 2603880185 Bacteria 6379190
643 2606128409 2603880199 Bacteria 6377649
644 2624479548 2623620443 Bacteria 6427864
645 2624493443 2623620446 Bacteria 6500345
646 2640733241 2639762793 Bacteria 3943681
647 2643842729 2643221565 Bacteria 6216018
648 2643952678 2643221589 Bacteria 6250934
649 2644022440 2643221602 Bacteria 6249926
650 2644185511 2643221633 Bacteria 6733554
651 2644286888 2643221650 Bacteria 7029547
652 2644363266 2643221665 Bacteria 4699229
653 2652544538 2651869719 Bacteria 6047974
654 2671093211 2667528170 Bacteria 6786960
655 2671097029 2667528171 Bacteria 6900659
656 2671128922 2667528176 Bacteria 6724917
657 2671770458 2671180172 Bacteria 6495783
658 2678230292 2675903507 Bacteria 3737791
659 2678264682 2675903515 Bacteria 6580491
660 2715753949 2713897148 Bacteria 5883533
661 2715757813 2713897149 Bacteria 6506249
662 2718633376 2718217725 Bacteria 5758958
663 2729147540 2728369097 Bacteria 4333476
664 2738691377 2738541271 Bacteria 5657310
665 2739201221 2738543004 Bacteria 6381073
666 2739262410 2738543015 Bacteria 6750701
667 2739267152 2738543016 Bacteria 5657564
668 2739316180 2738543025 Bacteria 6600348
669 2743739007 2740892503 Bacteria 6855563
670 2745005136 2744054620 Bacteria 6551379
671 2745161280 2744054655 Bacteria 3552603
672 2765585448 2765235841 Bacteria 6137024
673 2774119164 2773857670 Bacteria 6407454
674 2774128221 2773857672 Bacteria 4993178
675 2774138438 2773857673 Bacteria 6513460
676 2774389159 2773857761 Bacteria 3837365
677 2774439347 2773857770 Bacteria 3911866
678 2784265541 2784132063 Bacteria 6262788
679 2784314814 2784132072 Bacteria 6596533
680 2794595055 2791355520 Bacteria 5948615
681 2808857082 2808606361 Bacteria 6136259
682 2808926692 2808606376 Bacteria 6248667
683 2808927476 2808606377 Bacteria 6646337
684 2808937154 2808606378 Bacteria 6177535
685 2808939301 2808606379 Bacteria 5022697
686 2808948853 2808606380 Bacteria 6248705
687 2808949984 2808606381 Bacteria 6646461
688 2808959008 2808606382 Bacteria 6841132
689 2808965470 2808606383 Bacteria 6138645
690 2809000289 2808606389 Bacteria 6138126
691 2809216490 2808606445 Bacteria 6057339
692 2812371261 2811994881 Bacteria 6298475
693 2819654682 2818991456 Bacteria 6123676
694 2819702123 2818991464 Bacteria 6907494
695 2823424845 2823421272 Bacteria 5372474
696 2825656430 2825651385 Bacteria 6715909
697 2826584512 2826581358 Bacteria 5963467
698 2842818066 2842815866 Bacteria 5947510
699 2842832582 2842832357 Bacteria 5959113
700 2842848858 2842843487 Bacteria 6004777
701 2842849298 2842849001 Bacteria 5924277
702 2842856814 2842854478 Bacteria 6143501
703 2843694272 2843690924 Bacteria 5169057
704 2844671914 2844665904 Bacteria 6817974
705 2846035820 2846033681 Bacteria 4377894
706 2846040381 2846037992 Bacteria 4526407
707 2852659034 2852657418 Bacteria 6472974
708 2860339905 2860339153 Bacteria 6846989
709 2878031553 2878029506 Bacteria 6418441
710 2880232424 2880230671 Bacteria 6140320
711 2904523884 2904518522 Bacteria 6068986
712 2904552865 2904550169 Bacteria 6221258
713 2912967682 2912963787 Bacteria 5646108
714 2913041158 2913036834 Bacteria 6704877
715 2916701370 2916699645 Bacteria 3568996
716 2917075261 2917070673 Bacteria 6868303
717 2917835429 2917832318 Bacteria 5346010
718 2919063978 2919063839 Bacteria 6302690
719 2919129239 2919125081 Bacteria 5385106
720 2919159939 2919155634 Bacteria 4860545
721 2919185422 2919182534 Bacteria 3907101
722 2919386519 2919385768 Bacteria 5897293
723 2919457000 2919456309 Bacteria 6586567
724 2919486084 2919481497 Bacteria 6907839
725 2919491201 2919487758 Bacteria 5929766
726 2919508533 2919506607 Bacteria 3392955
727 2919699292 2919697872 Bacteria 6553725
728 2923158086 2923153595 Bacteria 6870622
729 2923525372 2923519811 Bacteria 6298479
730 2923590141 2923586266 Bacteria 6565975
731 2928516348 2928515477 Bacteria 4448421
732 2929148611 2929144301 Bacteria 6622272
733 2931373953 2931369376 Bacteria 6847892
734 2931400202 2931396565 Bacteria 7251677
735 2935356249 2935353572 Unclassified 6955622
736 2939639632 2939636861 Bacteria 6297853
737 2939655856 2939651529 Bacteria 5895393
738 2969306335 2969304461 Bacteria 6601805
739 2974292010 2974289157 Bacteria 6080362
740 2974299622 2974298342 Bacteria 4840922
741 2984288092 2984286254 Bacteria 6702062
742 2984501979 2984499530 Bacteria 5020881
743 2984504522 2984504281 Bacteria 5262371
744 2984572338 2984568884 Bacteria 3884413
745 2988730200 2988728565 Bacteria 6124362
746 2998141734 2998139840 Bacteria 6073514
747 3007256631 3007252601 Bacteria 4559114
748 3007319129 3007315729 Bacteria 5076637
749 3007397391 3007395558 Bacteria 6755444
750 3007515258 3007511990 Bacteria 6481491
751 3007616560 3007614139 Bacteria 6053559
752 3007620058 3007619802 Bacteria 6411688
753 3007719374 3007718800 Bacteria 5971527
754 3007809266 3007803356 Bacteria 5931491
755 3007856321 3007855910 Bacteria 5637581
756 3007863032 3007861166 Bacteria 6045338
757 3007870544 3007866637 Bacteria 5899198
758 3007875289 3007872151 Bacteria 5268868
759 637321717 637000220 Bacteria 7074893
760 651175314 651053060 Bacteria 4689946
761 8002750044 8002745576 Bacteria 4840272
762 8011353895 8011350971 Bacteria 6158957
763 8015692182 8015687852 Bacteria 6613826
764 8016733672 8016728285 Bacteria 5263933
765 8019773034 8019769354 Bacteria 6924660
766 8019776438 8019775933 Bacteria 6858656
767 8029999026 8029995093 Bacteria 5990776
768 8033233664 8033232454 Bacteria 3202805
769 8034962823 8034962539 Bacteria 4884839
770 8052495917 8052494512 Bacteria 5765634
771 8054932285 8054929484 Bacteria 5599761
772 8055775391 8055770955 Bacteria 6827675
773 8055878910 8055878733 Bacteria 5907058
774 8056130076 8056125926 Bacteria 6228218
775 8056138843 8056137416 Bacteria 6147080
776 8056144771 8056143049 Bacteria 6307666
777 8056156120 8056155041 Bacteria 6486948
778 8056169261 8056166840 Bacteria 5820959
779 8056175450 8056172158 Bacteria 6133900
780 8056181254 8056177738 Bacteria 6748268
781 8056571464 8056569372 Bacteria 5997322
782 8057804207 8057798959 Bacteria 6713499
783 Ga0070684_100095369
784 MRS2a_Contig_23
785 MRS2a_Contig_6280
786 SwRhRL2b_contig_2798511
787 JGI25162J39368_1000251
788 JGI25162J39368_1000315
789 JGI25163J39215_1001111
790 JGI25164J39214_1000194
791 JGI25164J39214_1000411
792 JGI25159J45721_1001567
793 JGI25165J46597_1000348
794 JGI25165J46597_1000430
795 rootH2_10091229
796 rootH1_10005337
797 rootH1_10167004
798 Ga0006562J51391_1018591
799 Ga0006562J51391_1037971
800 Ga0055524_1000017
801 Ga0055536_1004018
802 Ga0055531_10000997
803 Ga0058692_1000014
804 Ga0065703_1000184
805 Ga0065714_10000034
806 Ga0065714_10070725
807 Ga0065714_10183392
808 Ga0065704_10015961
809 Ga0065704_10194481
810 Ga0065712_10067911
811 Ga0065712_10069558
812 Ga0065715_10234727
813 Ga0070682_100033828
814 Ga0070660_100030566
815 Ga0070669_100008078
816 Ga0070671_100029170
817 Ga0070671_100179916
818 Ga0070709_10010843
819 Ga0070714_100032520
820 Ga0070714_100254214
821 Ga0070713_100091115
822 Ga0070713_100288260
823 Ga0070710_10111820
824 Ga0070711_100024685
825 Ga0070711_100210121
826 Ga0070711_100494301
827 Ga0070708_100310713
828 Ga0070662_100032504
829 Ga0070706_100018287
830 Ga0070706_100093967
831 Ga0070707_100020705
832 Ga0070698_100017589
833 Ga0070698_100401646
834 Ga0070698_100406750
835 Ga0070699_100172711
836 Ga0070699_100382835
837 Ga0070699_100466838
838 Ga0070697_100031861
839 Ga0070697_100336889
840 Ga0070665_100018863
841 Ga0068861_100552079
842 Ga0070717_10011796
843 Ga0075364_10068387
844 Ga0075432_10101495
845 Ga0075432_10130832
846 Ga0070716_100029621
847 Ga0070716_100053936
848 Ga0070712_100013081
849 Ga0070712_100027336
850 Ga0075362_10056973
851 Ga0075370_10143729
852 Ga0075434_100059625
853 Ga0075436_100012460
854 Ga0079104_1000982
855 Ga0099826_10003959
856 Ga0099795_10001078
857 Ga0099795_10008269
858 Ga0105251_10000035
859 Ga0105251_10005924
860 Ga0105251_10032130
861 Ga0105251_10065962
862 Ga0105251_10083088
863 Ga0105251_10083294
864 Ga0105251_10200108
865 Ga0105244_10001134
866 Ga0105244_10017376
867 Ga0105244_10031086
868 Ga0105244_10091482
869 Ga0105250_10000056
870 Ga0105250_10011835
871 Ga0105250_10023276
872 Ga0105250_10023995
873 Ga0105250_10041937
874 Ga0105240_10004855
875 Ga0105240_10041595
876 Ga0105240_10260407
877 Ga0105243_10000249
878 Ga0105243_10001441
879 Ga0105243_10002007
880 Ga0105243_10036370
881 Ga0105242_10306473
882 Ga0105242_10554592
883 Ga0105249_10000342
884 Ga0099796_10010745
885 Ga0099796_10028241
886 Ga0105239_10344886
887 Ga0105246_10001895
888 Ga0105246_10007270
889 Ga0105246_10270088
890 Ga0157373_10009442
891 Ga0157373_10036301
892 Ga0157373_10133656
893 Ga0157371_10014441
894 Ga0157371_10017060
895 Ga0157371_10029699
896 Ga0157371_10209200
897 Ga0157370_10064240
898 Ga0157370_10383435
899 Ga0157369_10004688
900 Ga0157374_10430858
901 Ga0163162_10065357
902 Ga0157372_10038059
903 Ga0157372_10727607
904 Ga0157375_10308655
905 Ga0182008_10023277
906 Ga0182008_10029769
907 Ga0182008_10090027
908 Ga0157377_10222222
909 Ga0157379_10316027
910 Ga0182006_1006419
911 Ga0182006_1009493
912 Ga0182006_1035789
913 Ga0182007_10001991
914 Ga0182005_1008729
915 Ga0182005_1076232
916 Ga0163161_10084202
917 Ga0206352_11149150
918 Ga0213873_10014176
919 Ga0213872_10000652
920 Ga0213872_10001532
921 Ga0213872_10001557
922 Ga0213872_10001677
923 Ga0213872_10026800
924 Ga0213874_10009670
925 Ga0213875_10000145
926 Ga0213875_10006534
927 Ga0209760_100011
928 Ga0209760_100064
929 Ga0209563_100495
930 Ga0207427_100008
931 Ga0207427_100082
932 Ga0209437_100006
933 Ga0209437_100014
934 Ga0209759_1007138
935 Ga0209233_1000008
936 Ga0209233_1000105
937 Ga0209675_1017364
938 Ga0209676_1000006
939 Ga0209676_1000369
940 Ga0209676_1000803
941 Ga0209676_1001140
942 Ga0209050_1000070
943 Ga0209050_1000235
944 Ga0209050_1000380
945 Ga0209050_1001241
946 Ga0209051_1000086
947 Ga0209051_1000123
948 Ga0209051_1001064
949 Ga0209257_1000421
950 Ga0209257_1005819
951 Ga0207696_1000025
952 Ga0207696_1000144
953 Ga0207696_1003214
954 Ga0207696_1006143
955 Ga0207696_1006846
956 Ga0207696_1013375
957 Ga0207655_1000183
958 Ga0207655_1000592
959 Ga0207655_1000976
960 Ga0207655_1001969
961 Ga0207655_1003070
962 Ga0207655_1005485
963 Ga0207655_1006081
964 Ga0207655_1008047
965 Ga0207655_1010633
966 Ga0207655_1012126
967 Ga0207655_1025877
968 Ga0207713_1001249
969 Ga0207713_1001767
970 Ga0207713_1003135
971 Ga0207713_1003177
972 Ga0207713_1006088
973 Ga0207713_1014429
974 Ga0207713_1047856
975 Ga0207692_10010663
976 Ga0207692_10023731
977 Ga0207710_10000122
978 Ga0207684_10378695
979 Ga0207707_10030684
980 Ga0207707_10231927
981 Ga0207695_10015272
982 Ga0207693_10005303
983 Ga0207693_10052530
984 Ga0207693_10071210
985 Ga0207663_10341937
986 Ga0207660_10387537
987 Ga0207652_10100233
988 Ga0207646_10009040
989 Ga0207681_10005882
990 Ga0207681_10088241
991 Ga0207700_10002928
992 Ga0207700_10183041
993 Ga0207700_10208336
994 Ga0207664_10016110
995 Ga0207664_10127472
996 Ga0207664_10520324
997 Ga0207644_10109678
998 Ga0207709_10000001
999 Ga0207709_10000223
1000 Ga0207709_10000835
1001 Ga0207709_10030554
1002 Ga0207665_10006644
1003 Ga0207665_10033004
1004 Ga0207665_10049356
1005 Ga0207712_10001909
1006 Ga0207703_10319423
1007 Ga0207702_10031690
1008 Ga0207641_10435466
1009 Ga0207676_10416744
1010 Ga0209281_1000010
1011 Ga0209281_1000331
1012 Ga0209281_1005471
1013 Ga0209389_1000031
1014 Ga0209371_1000040
1015 Ga0209371_1000182
1016 Ga0209371_1000589
1017 Ga0209371_1017352
1018 Ga0209969_1013169
1019 Ga0209984_1001806
1020 Ga0209179_1019988
1021 Ga0209999_1002159
1022 Ga0209982_1009659
1023 Ga0209983_1000763
1024 Ga0209282_1054335
1025 Ga0209971_1000554
1026 Ga0209974_10007616
1027 Ga0207428_10238370
1028 Ga0268266_10014923
1029 Ga0268266_10055084
1030 Ga0268265_10473215
1031 Ga0307515_10002349
1032 Ga0265338_10006011
1033 Ga0265338_10155737
1034 Ga0268256_1000041
1035 Ga0268256_1000153
1036 Ga0268256_1000511
1037 Ga0268256_1019341
1038 Ga0316177_1211506
1039 Ga0316179_1028994
1040 Ga0316178_1108793
1041 Ga0316183_1189572
1042 Ga0265327_10013441
1043 Ga0265327_10031808
1044 Ga0307408_100000025
1045 Ga0307408_100000192
1046 Ga0265314_10038335
1047 Ga0307413_10226145
1048 Ga0307406_10004592
1049 Ga0307416_100018095
1050 Ga0307416_100311510
1051 Ga0307414_10009804
1052 Ga0307510_10084516
1053 Ga0316592_1010457
1054 Ga0373926_0056900
1055 Ga0373934_0048463
1056 Ga0373936_0078468
1057 Ga0373936_0144144
1058 Ga0373945_0004496
1059 Ga0373954_0015261
1060 Ga0373956_0025169
1061 Ga0373943_0015057
1062 Ga0373946_0011231
1063 Ga0373955_0012134
1064 Ga0373931_0031538
1065 Ga0373935_0070416
1066 Ga0373935_0258906
1067 Ga0373927_0027023
1068 Ga0373933_0029653
1069 Ga0373933_0086916
1070 Ga0373947_0035501
1071 Ga0373947_0128505
1072 Ga0373937_0006327
1073 Ga0373937_0020176
1074 Ga0373937_0027602
1075 Ga0373937_0216263
1076 Ga0373925_0257410
1077 Ga0395905_0004104
1078 Ga0436364_0056880
1079 Ga0436364_0723260
1080 Ga0436364_1260460
1081 Ga0395901_0180939
1082 Ga0237819_09277
1083 Ga0400487_28623
1084 Ga0436365_0036381
1085 Ga0436365_1164564
1086 Ga0436360_0186592
1087 Ga0436360_0307969
1088 Ga0436360_0572509
1089 Ga0436360_0734628
1090 Ga0436360_0800231
1091 Ga0436360_0839587
1092 Ga0436361_0284071
1093 Ga0436361_0606756
1094 Ga0436361_0714916
1095 Ga0436361_1053619
1096 Ga0436361_1216557
1097 Ga0436363_0451735
1098 Ga0436363_1129503
1099 Ga0436363_1381957
1100 Ga0436363_1460963
1101 Ga0436362_0220171
1102 Ga0436362_0436236
1103 Ga0436362_0656757
1104 Ga0436362_0999455
1105 Ga0439438_001471
1106 Ga0439438_005024
1107 Ga0439438_008558
1108 Ga0439438_008813
1109 Ga0439447_002251
1110 Ga0439466_0002838
1111 Ga0439466_0004194
1112 Ga0439466_0008003
1113 Ga0439432_000967
1114 Ga0439432_002797
1115 Ga0439451_015276
1116 Ga0439452_001447
1117 Ga0439452_005155
1118 Ga0439456_003614
1119 Ga0439463_003014
1120 Ga0450905_003390
1121 Ga0450907_000326
1122 Ga0439446_0000172
1123 Ga0439446_0007048
1124 Ga0439444_0004568
1125 Ga0439460_0002152
1126 Ga0451577_0157217
1127 Ga0451577_0290548
1128 Ga0439440_0004886
1129 Ga0466966_0102598
1130 Ga0453684_0002079
1131 Ga0453684_0003561
1132 Ga0466957_0378394
1133 Ga0466959_0620050
1134 Ga0451576_0001285
1135 Ga0451576_0021642
1136 Ga0451576_0024670
1137 Ga0466958_0001326
1138 Ga0466958_0302669
1139 Ga0466967_0416720
1140 Ga0466967_0558682
1141 Ga0495617_001158
1142 Ga0495627_000040
1143 Ga0495627_000137
1144 Ga0495603_0003767
1145 Ga0495603_0049463
1146 Ga0495590_0002219
1147 Ga0495591_000023
1148 Ga0495591_001514
1149 Ga0495591_007986
1150 Ga0495638_0077961
1151 Ga0495653_0029603
1152 Ga0495650_0007260
1153 Ga0495650_0050834
1154 Ga0495580_0022084
1155 Ga0495605_0000245
1156 Ga0495605_0001067
1157 Ga0495605_0002605
1158 Ga0495605_0010029
1159 Ga0495605_0029245
1160 Ga0495662_0101796
1161 Ga0495584_0014523
1162 Ga0495585_0002457
1163 Ga0495585_0011404
1164 Ga0495585_0013930
1165 Ga0495585_0058023
1166 Ga0495596_0000001
1167 Ga0495596_0000375
1168 Ga0495607_0000097
1169 Ga0495607_0000234
1170 Ga0495607_0000893
1171 Ga0495607_0000972
1172 Ga0495607_0004021
1173 Ga0495607_0022053
1174 Ga0495583_0003081
1175 Ga0495583_0003683
1176 Ga0495606_0000167
1177 Ga0495606_0003593
1178 Ga0495606_0004329
1179 Ga0495606_0045902
1180 Ga0495610_0026298
1181 Ga0495610_0045368
1182 Ga0495616_0018868
1183 Ga0495616_0039392
1184 Ga0495616_0058008
1185 Ga0495620_0000003
1186 Ga0495620_0009640
1187 Ga0495620_0052081
1188 Ga0495630_0094256
1189 Ga0495631_0001015
1190 Ga0495631_0006645
1191 Ga0495631_0055140
1192 Ga0495632_0001340
1193 Ga0495632_0003328
1194 Ga0495632_0004266
1195 Ga0495632_0079706
1196 Ga0495637_0000583
1197 Ga0495637_0002931
1198 Ga0495637_0003057
1199 Ga0495637_0024711
1200 Ga0495643_0000673
1201 Ga0495643_0001803
1202 Ga0495644_0003207
1203 Ga0495648_0003579
1204 Ga0495648_0004170
1205 Ga0495648_0010693
1206 Ga0495642_0001942
1207 Ga0495642_0006012
1208 Ga0495654_0008388
1209 Ga0495654_0015800
1210 Ga0495654_0035682
1211 Ga0495654_0040236
1212 Ga0495586_0034252
1213 Ga0495587_0006269
1214 Ga0495609_0000167
1215 Ga0495609_0003356
1216 Ga0495609_0006411
1217 Ga0495597_0000016
1218 Ga0495597_0008843
1219 Ga0495622_0001305
1220 Ga0495622_0012102
1221 Ga0495622_0142618
1222 Ga0495633_0003087
1223 Ga0495667_0031187
1224 Ga0495667_0142330
1225 Ga0495656_0004946
1226 Ga0495625_0000134
1227 Ga0495625_0051221
1228 Ga0495625_0135573
1229 Ga0495635_0027178
1230 Ga0495635_0102510
1231 Ga0495659_0001323
1232 Ga0495661_0000030
1233 Ga0495661_0000088
1234 Ga0495661_0009503
1235 Ga0495661_0025395
1236 Ga0495657_0104340
1237 Ga0495599_0057891
1238 Ga0495623_0024699
1239 Ga0495669_0033833
1240 Ga0495670_0002914
1241 Ga0495670_0030265
1242 Ga0495671_0023443
1243 Ga0495671_0030450
1244 Ga0495649_0000864
1245 Ga0495649_0001550
1246 Ga0495649_0050595
1247 Ga0495589_0000881
1248 Ga0495589_0007709
1249 Ga0495589_0057115
1250 Ga0495600_0060110
1251 Ga0495600_0096446
1252 Ga0495660_0001771
1253 Ga0495660_0005240
1254 Ga0495660_0027927
1255 Ga0495660_0084170
1256 Ga0495604_0036434
1257 Ga0495636_0005048
1258 Ga0495636_0009958
1259 Ga0495672_0002710
1260 Ga0495672_0012883
1261 Ga0495672_0013396
1262 Ga0495672_0139527
1263 Ga0495676_0000018
1264 Ga0495680_0156474
1265 Ga0495680_0238027
1266 Ga0495683_0000081
1267 Ga0495683_0001199
1268 Ga0495687_011688
1269 Ga0495675_0005746
1270 Ga0495679_007522
1271 Ga0495673_0003548
1272 Ga0495673_0005161
1273 Ga0495673_0011087
1274 Ga0495681_0002659
1275 Ga0495681_0004092
1276 Ga0495681_0007297
1277 Ga0495681_0018194
1278 Ga0495681_0044875
1279 Ga0495684_0034497
1280 Ga0495593_0029162
1281 Ga0495626_0000125
1282 Ga0495626_0003758
1283 Ga0495626_0004444
1284 Ga0496102_0008143
1285 Ga0496106_0247213
1286 Ga0496112_0038138
1287 Ga0496113_0052589
1288 Ga0496114_0012877
1289 Ga0496114_0014042
1290 Ga0496114_0040220
1291 Ga0496116_0001043
1292 Ga0496117_0015449
1293 Ga0496117_0105712
1294 Ga0496118_0009485
1295 Ga0496118_0022994
1296 Ga0496118_0060355
1297 Ga0496119_0000444
1298 Ga0496120_0001654
1299 Ga0496121_0005707
1300 Ga0496121_0063203
1301 Ga0496121_0185589
1302 Ga0496122_0006709
1303 Ga0496122_0020183
1304 Ga0496122_0077198
1305 Ga0496123_0000887
1306 Ga0496123_0001511
1307 Ga0496123_0027233
1308 Ga0496124_0022637
1309 Ga0496124_0033678
1310 Ga0496124_0098145
1311 Ga0496124_0145885
1312 Ga0496124_0295162
1313 Ga0496125_0003525
1314 Ga0496125_0034533
1315 Ga0496125_0151532
1316 Ga0496126_0050942
1317 Ga0496126_0070794
1318 Ga0496126_0099536
1319 Ga0495678_000918
1320 Ga0495682_0000050
1321 Ga0495682_0001437
1322 Ga0495682_0009054
1323 Ga0501315_006626
1324 Ga0501034_0000150
1325 Ga0501034_0081970
1326 Ga0501034_0101361
1327 Ga0501034_0131785
1328 Ga0501037_0019636
1329 Ga0501070_0509753
1330 Ga0501076_0353512
1331 Ga0501083_0007057
1332 nmdc:mga0n895_145778_c1
1333 nmdc:mga0n895_381445_c1
1334 nmdc:mga0rr50_54084_c1
1335 Ga0495601_0008558
1336 Ga0495601_0091978
1337 Ga0495619_0010468
1338 Ga0495619_0050642
1339 Ga0495619_0134760
1340 Ga0495619_0183361
1341 Ga0495619_0322549
1342 Ga0500659_0002281
1343 Ga0501082_0020563
1344 2510285129
1345 2510294034
1346 2510313068
1347 2511254566
1348 2511267037
1349 2511273791
1350 2511276685
1351 2511292990
1352 2511293233
1353 2511301881
1354 2511314629
1355 2511317210
1356 2511323969
1357 2511331559
1358 2511339606
1359 2511344680
1360 2511349360
1361 2511355243
1362 2511366151
1363 2511368708
1364 2511374558
1365 2511413526
1366 2511826334
1367 2512324133
1368 2547373211
1369 2552746210
1370 2555671395
1371 2583793803
1372 2597859477
1373 2599328601
1374 2599354448
1375 2599359838
1376 2599366160
1377 2599372950
1378 2599379556
1379 2599385466
1380 2599391809
1381 2599403575
1382 2599461282
1383 2599469826
1384 2599482307
1385 2599490302
1386 2599504166
1387 2599613451
1388 2599772358
1389 2599803974
1390 2599888921
1391 2599900550
1392 2599933573
1393 2599943976
1394 2599955812
1395 2599961446
1396 2599969718
1397 2599975238
1398 2599981192
1399 2599985613
1400 2599989537
1401 2599994409
1402 2600000118
1403 2600009097
1404 2600015037
1405 2600019612
1406 2600023703
1407 2600032347
1408 2600038791
1409 2600044165
1410 2600048373
1411 2600054122
1412 2600060340
1413 2600066570
1414 2600074351
1415 2600078122
1416 2600213898
1417 2600361909
1418 2600364382
1419 2600443225
1420 2601626598
1421 2601774064
1422 2601795609
1423 2602009294
1424 2606075678
1425 2606128409
1426 2624479548
1427 2624493443
1428 2640733241
1429 2643842729
1430 2643952678
1431 2644022440
1432 2644185511
1433 2644286888
1434 2644363266
1435 2652544538
1436 2671093211
1437 2671097029
1438 2671128922
1439 2671770458
1440 2678230292
1441 2678264682
1442 2715753949
1443 2715757813
1444 2718633376
1445 2729147540
1446 2738691377
1447 2739201221
1448 2739262410
1449 2739267152
1450 2739316180
1451 2743739007
1452 2745005136
1453 2745161280
1454 2765585448
1455 2774119164
1456 2774128221
1457 2774138438
1458 2774389159
1459 2774439347
1460 2784265541
1461 2784314814
1462 2794595055
1463 2808857082
1464 2808926692
1465 2808927476
1466 2808937154
1467 2808939301
1468 2808948853
1469 2808949984
1470 2808959008
1471 2808965470
1472 2809000289
1473 2809216490
1474 2812371261
1475 2819654682
1476 2819702123
1477 2823424845
1478 2825656430
1479 2826584512
1480 2842818066
1481 2842832582
1482 2842848858
1483 2842849298
1484 2842856814
1485 2843694272
1486 2844671914
1487 2846035820
1488 2846040381
1489 2852659034
1490 2860339905
1491 2878031553
1492 2880232424
1493 2904523884
1494 2904552865
1495 2912967682
1496 2913041158
1497 2916701370
1498 2917075261
1499 2917835429
1500 2919063978
1501 2919129239
1502 2919159939
1503 2919185422
1504 2919386519
1505 2919457000
1506 2919486084
1507 2919491201
1508 2919508533
1509 2919699292
1510 2923158086
1511 2923525372
1512 2923590141
1513 2928516348
1514 2929148611
1515 2931373953
1516 2931400202
1517 2935356249
1518 2939639632
1519 2939655856
1520 2969306335
1521 2974292010
1522 2974299622
1523 2984288092
1524 2984501979
1525 2984504522
1526 2984572338
1527 2988730200
1528 2998141734
1529 3007256631
1530 3007319129
1531 3007397391
1532 3007515258
1533 3007616560
1534 3007620058
1535 3007719374
1536 3007809266
1537 3007856321
1538 3007863032
1539 3007870544
1540 3007875289
1541 637321717
1542 651175314
1543 8002750044
1544 8011353895
1545 8015692182
1546 8016733672
1547 8019773034
1548 8019776438
1549 8029999026
1550 8033233664
1551 8034962823
1552 8052495917
1553 8054932285
1554 8055775391
1555 8055878910
1556 8056130076
1557 8056138843
1558 8056144771
1559 8056156120
1560 8056169261
1561 8056175450
1562 8056181254
1563 8056571464
1564 8057804207

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

39

260

0.95

PF02374

ArsA_ATPase

Anion-transporting ATPase

37

84

0.93

PF13614

AAA_31

AAA domain

36

203

0.84

PF06564

CBP_BcsQ

Cellulose biosynthesis protein BcsQ

36

188

0.82

PF10609

ParA

NUBPL iron-transfer P-loop NTPase

34

280

0.75

PF09140

MipZ

ATPase MipZ

37

202

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
6riq-assembly1.cif.gz_C mincd filament from pseudomonas aeruginosa 0.9852 2 255
3q9l-assembly1.cif.gz_A the structure of the dimeric e.coli mind-atp complex 0.985 2 257
6riq-assembly1.cif.gz_C mincd filament from pseudomonas aeruginosa 0.9814 2 255
3r9i-assembly2.cif.gz_C 2.6a resolution structure of mind complexed with mine (12-31) peptide 0.9812 2 257
3q9l-assembly1.cif.gz_A the structure of the dimeric e.coli mind-atp complex 0.9774 2 257
ID Description Score Start End Superfamily
3r9iC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9812 2 257 3.40.50.300
3r9iC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9774 2 257 3.40.50.300
4v02A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9267 2 257 3.40.50.300
4v02A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9231 2 257 3.40.50.300
af_K7L057_1_178_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9037 17 159 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A381GKQ0-F1-model_v4 deleted 0.9938 131 214
AF-A0A3D0CB54-F1-model_v4 Septum site-determining protein MinD 0.9936 86 234 GO:0005524
GO:0005829
GO:0009898
GO:0016887
GO:0051782
AF-A0A7Y0SDY5-F1-model_v4 Septum site-determining protein MinD 0.9934 134 225 GO:0005524
GO:0005829
GO:0009898
GO:0016887
GO:0051782
AF-W7QEY8-F1-model_v4 Septum site-determining protein MinD (Cell division inhibitor MinD) 0.9927 1 238 GO:0000917
GO:0005524
GO:0005829
GO:0009898
GO:0016887
GO:0051782
AF-A0A2M7WVW0-F1-model_v4 Septum site-determining protein MinD (Cell division inhibitor MinD) 0.9918 1 248 GO:0000917
GO:0005524
GO:0005829
GO:0009898
GO:0016887
GO:0051782

Map