F480613
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 782 | 361 | 1564 | 171 |
Family's Representative Sequence
| Representative Sequence | 3300014497|Ga0182008_10000255|Ga0182008_100002555 |
| Length | 196 |
| Sequence | MQMEAKRKIATMNQTIQVGVVMGSNSDWETMRHAVEILQQFGIAHEARVVSAHRMPDELFAYAESAAPRGLAAIIAGAGGAAHLPGMLAAKTTVPVLGVPVASRHLQGVDSLYSIVQMPKGVPVATFAIGNAGAANAALFAIAMLAVGNPRLRTQLDTFRTAQTAAAQAMTLPPPEAGAPVAPAVSPFSPQGGGAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 38 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 40 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 41 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 42 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 43 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 61 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 62 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 67 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 77 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 113 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 114 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 115 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 116 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 117 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 118 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 119 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 120 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 121 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 122 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 123 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 124 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 125 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 126 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 127 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 128 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 129 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 130 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 131 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 132 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 133 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 134 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 135 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 136 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 137 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 138 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 139 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 140 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 141 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 142 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 143 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 144 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 145 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 146 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 147 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 148 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 149 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 150 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 151 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 152 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 153 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 154 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 155 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 254 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 255 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 256 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 257 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 258 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 259 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 262 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 263 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 264 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 265 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 266 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 267 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 268 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 269 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 270 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 271 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 272 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 273 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 274 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 275 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 294 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 295 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 296 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 297 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 300 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 303 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 304 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 305 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 306 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 307 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 308 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 309 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 310 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 311 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 312 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 313 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 314 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 315 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 316 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 317 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 318 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 319 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 320 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 321 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 322 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 323 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 324 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 325 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 326 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 327 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 328 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 329 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 330 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 331 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 332 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 333 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 334 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 335 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 336 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 337 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 338 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 339 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 340 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 341 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 342 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 343 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 344 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 345 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 346 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 347 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 348 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 349 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 350 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 351 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 352 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 353 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 354 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 355 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 356 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 357 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 358 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 359 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 360 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 361 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.69 |
| Metatranscriptomes | 0.77 |
| Isolates | 7.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.52 |
| Nodule | 1.41 |
| Rhizoplane | 4.73 |
| Rhizosphere | 78.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0182008_10000255 | 3300014497 | Bacteria | 41477 |
| 2 | JGI24740J21852_10006227 | 3300001979 | Bacteria | 4966 |
| 3 | JGI24739J22299_10011480 | 3300001989 | Bacteria | 3270 |
| 4 | JGI24739J22299_10027379 | 3300001989 | Bacteria | 1993 |
| 5 | JGI24735J21928_10000136 | 3300002067 | Bacteria | 26186 |
| 6 | JGI24735J21928_10013457 | 3300002067 | Bacteria | 2572 |
| 7 | JGI24735J21928_10023546 | 3300002067 | Bacteria | 1867 |
| 8 | JGI24738J21930_10017553 | 3300002075 | Bacteria | 1503 |
| 9 | JGI25156J39149_1000674 | 3300002705 | Bacteria | 18425 |
| 10 | JGI25156J39149_1002675 | 3300002705 | Bacteria | 6246 |
| 11 | JGI25156J39149_1011008 | 3300002705 | Bacteria | 2078 |
| 12 | JGI25165J46597_1001478 | 3300003214 | Bacteria | 12097 |
| 13 | rootL2_10000821 | 3300003322 | Bacteria | 2165 |
| 14 | Ga0055533_1000390 | 3300003756 | Bacteria | 17395 |
| 15 | Ga0055533_1016887 | 3300003756 | Bacteria | 698 |
| 16 | Ga0055532_1000012 | 3300003758 | Bacteria | 382698 |
| 17 | Ga0055525_1000009 | 3300003759 | Bacteria | 596899 |
| 18 | Ga0055527_1000011 | 3300003760 | Bacteria | 354560 |
| 19 | Ga0055535_1000009 | 3300003761 | Bacteria | 382698 |
| 20 | Ga0055542_1000015 | 3300003762 | Bacteria | 382698 |
| 21 | Ga0055529_1000011 | 3300003763 | Bacteria | 382698 |
| 22 | Ga0055536_1009340 | 3300003781 | Bacteria | 4066 |
| 23 | Ga0055536_1027862 | 3300003781 | Bacteria | 1552 |
| 24 | Ga0055534_1001587 | 3300003784 | Bacteria | 8817 |
| 25 | Ga0055540_1003891 | 3300003792 | Bacteria | 7009 |
| 26 | Ga0055531_10000469 | 3300003794 | Bacteria | 37355 |
| 27 | Ga0055531_10092978 | 3300003794 | Bacteria | 635 |
| 28 | Ga0070658_10230962 | 3300005327 | Bacteria | 1566 |
| 29 | Ga0068869_100067024 | 3300005334 | Bacteria | 2647 |
| 30 | Ga0070680_100734772 | 3300005336 | Bacteria | 850 |
| 31 | Ga0070682_101078438 | 3300005337 | Bacteria | 671 |
| 32 | Ga0070660_100016381 | 3300005339 | Bacteria | 5379 |
| 33 | Ga0070669_100040138 | 3300005353 | Bacteria | 3402 |
| 34 | Ga0070669_100203884 | 3300005353 | Bacteria | 1557 |
| 35 | Ga0070674_100253742 | 3300005356 | Bacteria | 1383 |
| 36 | Ga0070674_100373067 | 3300005356 | Bacteria | 1159 |
| 37 | Ga0070674_100907855 | 3300005356 | Bacteria | 768 |
| 38 | Ga0070673_100792251 | 3300005364 | Bacteria | 875 |
| 39 | Ga0070673_100992374 | 3300005364 | Bacteria | 782 |
| 40 | Ga0070673_101514779 | 3300005364 | Bacteria | 633 |
| 41 | Ga0070659_100084873 | 3300005366 | Bacteria | 2532 |
| 42 | Ga0070667_100196363 | 3300005367 | Bacteria | 1789 |
| 43 | Ga0070678_100083648 | 3300005456 | Bacteria | 2426 |
| 44 | Ga0070678_100235138 | 3300005456 | Bacteria | 1529 |
| 45 | Ga0070678_100239716 | 3300005456 | Bacteria | 1516 |
| 46 | Ga0070662_100116959 | 3300005457 | Bacteria | 2039 |
| 47 | Ga0068867_100923339 | 3300005459 | Bacteria | 787 |
| 48 | Ga0070672_100704739 | 3300005543 | Bacteria | 884 |
| 49 | Ga0068855_100323237 | 3300005563 | Bacteria | 1705 |
| 50 | Ga0068855_100437666 | 3300005563 | Bacteria | 1428 |
| 51 | Ga0068855_100544837 | 3300005563 | Bacteria | 1256 |
| 52 | Ga0070664_100321735 | 3300005564 | Bacteria | 1401 |
| 53 | Ga0070664_100581719 | 3300005564 | Bacteria | 1037 |
| 54 | Ga0068852_100470373 | 3300005616 | Bacteria | 1247 |
| 55 | Ga0075365_10027748 | 3300006038 | Bacteria | 3605 |
| 56 | Ga0070712_100105936 | 3300006175 | Bacteria | 2089 |
| 57 | Ga0075362_10083634 | 3300006177 | Bacteria | 1474 |
| 58 | Ga0075367_10085941 | 3300006178 | Bacteria | 1909 |
| 59 | Ga0075366_10017453 | 3300006195 | Bacteria | 4130 |
| 60 | Ga0075370_10063470 | 3300006353 | Bacteria | 2106 |
| 61 | Ga0075370_10483346 | 3300006353 | Bacteria | 747 |
| 62 | Ga0105251_10000047 | 3300009011 | Bacteria | 110996 |
| 63 | Ga0105240_10528292 | 3300009093 | Bacteria | 1308 |
| 64 | Ga0105245_10118126 | 3300009098 | Bacteria | 2474 |
| 65 | Ga0105243_10013664 | 3300009148 | Bacteria | 6142 |
| 66 | Ga0105241_10182545 | 3300009174 | Bacteria | 1741 |
| 67 | Ga0105241_10203249 | 3300009174 | Bacteria | 1656 |
| 68 | Ga0105242_10043759 | 3300009176 | Bacteria | 3624 |
| 69 | Ga0105242_10466953 | 3300009176 | Bacteria | 1193 |
| 70 | Ga0105242_11713033 | 3300009176 | Bacteria | 665 |
| 71 | Ga0105238_10117726 | 3300009551 | Bacteria | 2637 |
| 72 | Ga0105238_10245911 | 3300009551 | Bacteria | 1766 |
| 73 | Ga0105239_10239181 | 3300010375 | Bacteria | 2038 |
| 74 | Ga0157371_10000399 | 3300013102 | Bacteria | 54380 |
| 75 | Ga0157370_10118509 | 3300013104 | Bacteria | 2472 |
| 76 | Ga0157369_10002846 | 3300013105 | Bacteria | 20661 |
| 77 | Ga0157369_10034311 | 3300013105 | Bacteria | 5570 |
| 78 | Ga0157369_10068323 | 3300013105 | Bacteria | 3818 |
| 79 | Ga0157369_10069847 | 3300013105 | Bacteria | 3773 |
| 80 | Ga0163162_11571931 | 3300013306 | Bacteria | 750 |
| 81 | Ga0157372_10245435 | 3300013307 | Bacteria | 2078 |
| 82 | Ga0157372_11407497 | 3300013307 | Bacteria | 804 |
| 83 | Ga0163163_10750582 | 3300014325 | Bacteria | 1039 |
| 84 | Ga0182008_10004921 | 3300014497 | Bacteria | 7702 |
| 85 | Ga0182008_10041786 | 3300014497 | Bacteria | 2286 |
| 86 | Ga0157379_10372979 | 3300014968 | Bacteria | 1309 |
| 87 | Ga0157376_10784099 | 3300014969 | Bacteria | 965 |
| 88 | Ga0182006_1009113 | 3300015261 | Bacteria | 4462 |
| 89 | Ga0182006_1045863 | 3300015261 | Bacteria | 1699 |
| 90 | Ga0182006_1061159 | 3300015261 | Bacteria | 1421 |
| 91 | Ga0182007_10000168 | 3300015262 | Bacteria | 44905 |
| 92 | Ga0182007_10001372 | 3300015262 | Bacteria | 13100 |
| 93 | Ga0183362_10004 | 3300015683 | Bacteria | 569303 |
| 94 | Ga0183361_10001 | 3300016635 | Bacteria | 908583 |
| 95 | Ga0163161_10096335 | 3300017792 | Bacteria | 2196 |
| 96 | Ga0163161_10407024 | 3300017792 | Bacteria | 1092 |
| 97 | Ga0206354_10241356 | 3300020081 | Bacteria | 1571 |
| 98 | Ga0206353_11984652 | 3300020082 | Bacteria | 1626 |
| 99 | Ga0213872_10000117 | 3300021361 | Bacteria | 73833 |
| 100 | Ga0224712_10000748 | 3300022467 | Bacteria | 6773 |
| 101 | Ga0209566_111655 | 3300025225 | Bacteria | 855 |
| 102 | Ga0209674_100013 | 3300025226 | Bacteria | 813140 |
| 103 | Ga0209674_100276 | 3300025226 | Bacteria | 38687 |
| 104 | Ga0209672_100010 | 3300025228 | Bacteria | 873151 |
| 105 | Ga0209147_100006 | 3300025229 | Bacteria | 873276 |
| 106 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 107 | Ga0209563_101557 | 3300025230 | Bacteria | 5966 |
| 108 | Ga0209258_100010 | 3300025242 | Bacteria | 873276 |
| 109 | Ga0209677_110384 | 3300025253 | Bacteria | 1553 |
| 110 | Ga0209148_1000018 | 3300025254 | Bacteria | 756247 |
| 111 | Ga0209759_1000132 | 3300025256 | Bacteria | 127521 |
| 112 | Ga0209759_1000181 | 3300025256 | Bacteria | 103230 |
| 113 | Ga0209759_1000276 | 3300025256 | Bacteria | 72540 |
| 114 | Ga0209233_1000093 | 3300025261 | Bacteria | 306016 |
| 115 | Ga0209565_1040718 | 3300025263 | Bacteria | 866 |
| 116 | Ga0209455_1000015 | 3300025272 | Bacteria | 756128 |
| 117 | Ga0209130_1001785 | 3300025284 | Bacteria | 12655 |
| 118 | Ga0209675_1006181 | 3300025291 | Bacteria | 4861 |
| 119 | Ga0209676_1000209 | 3300025292 | Bacteria | 130388 |
| 120 | Ga0209025_1067990 | 3300025294 | Bacteria | 1283 |
| 121 | Ga0209564_1006638 | 3300025295 | Bacteria | 6179 |
| 122 | Ga0209050_1002179 | 3300025298 | Bacteria | 17697 |
| 123 | Ga0209051_1000156 | 3300025303 | Bacteria | 128246 |
| 124 | Ga0209051_1026424 | 3300025303 | Bacteria | 2340 |
| 125 | Ga0209051_1053279 | 3300025303 | Bacteria | 1330 |
| 126 | Ga0209257_1000016 | 3300025304 | Bacteria | 908015 |
| 127 | Ga0209257_1011157 | 3300025304 | Bacteria | 4377 |
| 128 | Ga0207713_1000041 | 3300025735 | Bacteria | 244768 |
| 129 | Ga0207705_10003612 | 3300025909 | Bacteria | 11782 |
| 130 | Ga0207654_10009376 | 3300025911 | Bacteria | 4971 |
| 131 | Ga0207654_10064549 | 3300025911 | Bacteria | 2153 |
| 132 | Ga0207654_10099784 | 3300025911 | Bacteria | 1787 |
| 133 | Ga0207693_10113574 | 3300025915 | Bacteria | 2125 |
| 134 | Ga0207660_10122631 | 3300025917 | Bacteria | 1970 |
| 135 | Ga0207657_10870940 | 3300025919 | Bacteria | 695 |
| 136 | Ga0207681_10171480 | 3300025923 | Bacteria | 1645 |
| 137 | Ga0207681_10356499 | 3300025923 | Bacteria | 1172 |
| 138 | Ga0207694_10172106 | 3300025924 | Bacteria | 1754 |
| 139 | Ga0207709_10020122 | 3300025935 | Bacteria | 3762 |
| 140 | Ga0207669_10185421 | 3300025937 | Bacteria | 1496 |
| 141 | Ga0207669_10304911 | 3300025937 | Bacteria | 1212 |
| 142 | Ga0207691_10236308 | 3300025940 | Bacteria | 1581 |
| 143 | Ga0207691_10521962 | 3300025940 | Bacteria | 1008 |
| 144 | Ga0207689_10167246 | 3300025942 | Bacteria | 1812 |
| 145 | Ga0207679_10190547 | 3300025945 | Bacteria | 1704 |
| 146 | Ga0207679_10726348 | 3300025945 | Bacteria | 902 |
| 147 | Ga0207667_10008081 | 3300025949 | Bacteria | 12539 |
| 148 | Ga0207667_10393788 | 3300025949 | Bacteria | 1411 |
| 149 | Ga0207651_10210427 | 3300025960 | Bacteria | 1565 |
| 150 | Ga0207651_10232109 | 3300025960 | Bacteria | 1499 |
| 151 | Ga0207651_10527841 | 3300025960 | Bacteria | 1024 |
| 152 | Ga0207651_10625919 | 3300025960 | Bacteria | 943 |
| 153 | Ga0207640_11048885 | 3300025981 | Bacteria | 719 |
| 154 | Ga0207658_10524730 | 3300025986 | Bacteria | 1057 |
| 155 | Ga0207658_10892404 | 3300025986 | Bacteria | 809 |
| 156 | Ga0207678_10111967 | 3300026067 | Bacteria | 2328 |
| 157 | Ga0207678_10121222 | 3300026067 | Bacteria | 2232 |
| 158 | Ga0207648_10393420 | 3300026089 | Bacteria | 1255 |
| 159 | Ga0207648_10519129 | 3300026089 | Bacteria | 1091 |
| 160 | Ga0207674_10360552 | 3300026116 | Bacteria | 1405 |
| 161 | Ga0207675_100769421 | 3300026118 | Bacteria | 975 |
| 162 | Ga0207683_10205122 | 3300026121 | Bacteria | 1793 |
| 163 | Ga0207683_10272587 | 3300026121 | Bacteria | 1546 |
| 164 | Ga0207683_10321271 | 3300026121 | Bacteria | 1418 |
| 165 | Ga0207698_10418237 | 3300026142 | Bacteria | 1285 |
| 166 | Ga0209371_1006456 | 3300027312 | Bacteria | 4338 |
| 167 | Ga0307515_10000034 | 3300028794 | Bacteria | 344640 |
| 168 | Ga0307515_10060941 | 3300028794 | Bacteria | 5367 |
| 169 | Ga0307515_10095998 | 3300028794 | Bacteria | 3641 |
| 170 | Ga0268256_1006487 | 3300030500 | Bacteria | 4337 |
| 171 | Ga0265328_10006713 | 3300031239 | Bacteria | 4846 |
| 172 | Ga0265331_10022083 | 3300031250 | Bacteria | 3250 |
| 173 | Ga0265327_10000080 | 3300031251 | Bacteria | 206086 |
| 174 | Ga0265327_10002797 | 3300031251 | Bacteria | 17626 |
| 175 | Ga0307513_10053318 | 3300031456 | Bacteria | 4348 |
| 176 | Ga0307509_10235937 | 3300031507 | Bacteria | 1627 |
| 177 | Ga0307509_10404268 | 3300031507 | Bacteria | 1071 |
| 178 | Ga0307408_100170460 | 3300031548 | Bacteria | 1737 |
| 179 | Ga0307514_10007369 | 3300031649 | Bacteria | 9478 |
| 180 | Ga0307518_10009169 | 3300031838 | Bacteria | 7063 |
| 181 | Ga0307406_10406363 | 3300031901 | Bacteria | 1081 |
| 182 | Ga0307412_10000016 | 3300031911 | Bacteria | 312878 |
| 183 | Ga0307416_100222234 | 3300032002 | Bacteria | 1812 |
| 184 | Ga0395899_0000093 | 3300037312 | Bacteria | 153541 |
| 185 | Ga0395899_0002578 | 3300037312 | Bacteria | 14617 |
| 186 | Ga0395899_0010125 | 3300037312 | Bacteria | 7230 |
| 187 | Ga0395899_0010132 | 3300037312 | Bacteria | 7227 |
| 188 | Ga0395899_0023836 | 3300037312 | Bacteria | 4630 |
| 189 | Ga0395899_0104374 | 3300037312 | Bacteria | 2042 |
| 190 | Ga0395899_0676788 | 3300037312 | Bacteria | 649 |
| 191 | Ga0395899_0678490 | 3300037312 | Bacteria | 648 |
| 192 | Ga0395900_0005674 | 3300037418 | Bacteria | 13050 |
| 193 | Ga0395900_0045762 | 3300037418 | Bacteria | 4507 |
| 194 | Ga0395900_0077340 | 3300037418 | Bacteria | 3418 |
| 195 | Ga0395900_0109150 | 3300037418 | Bacteria | 2842 |
| 196 | Ga0395900_0201478 | 3300037418 | Bacteria | 2013 |
| 197 | Ga0395900_0214321 | 3300037418 | Bacteria | 1943 |
| 198 | Ga0395900_0217458 | 3300037418 | Bacteria | 1927 |
| 199 | Ga0395900_0227721 | 3300037418 | Bacteria | 1876 |
| 200 | Ga0395900_0795408 | 3300037418 | Bacteria | 874 |
| 201 | Ga0395900_0827393 | 3300037418 | Bacteria | 852 |
| 202 | Ga0395900_1091802 | 3300037418 | Bacteria | 715 |
| 203 | Ga0395900_1136921 | 3300037418 | Bacteria | 697 |
| 204 | Ga0395900_1197652 | 3300037418 | Bacteria | 675 |
| 205 | Ga0395898_0057456 | 3300037466 | Bacteria | 3791 |
| 206 | Ga0395898_0123185 | 3300037466 | Bacteria | 2484 |
| 207 | Ga0395898_0261850 | 3300037466 | Bacteria | 1649 |
| 208 | Ga0395898_1181967 | 3300037466 | Bacteria | 696 |
| 209 | Ga0395898_1357084 | 3300037466 | Bacteria | 639 |
| 210 | Ga0395905_0000014 | 3300037471 | Bacteria | 394209 |
| 211 | Ga0395905_0000137 | 3300037471 | Bacteria | 120800 |
| 212 | Ga0395905_0009356 | 3300037471 | Bacteria | 9581 |
| 213 | Ga0395905_0100043 | 3300037471 | Bacteria | 2722 |
| 214 | Ga0395905_0147300 | 3300037471 | Bacteria | 2215 |
| 215 | Ga0395905_0180372 | 3300037471 | Bacteria | 1982 |
| 216 | Ga0395905_0303769 | 3300037471 | Bacteria | 1483 |
| 217 | Ga0395905_0353560 | 3300037471 | Bacteria | 1361 |
| 218 | Ga0395901_0057848 | 3300038443 | Bacteria | 4032 |
| 219 | Ga0395901_0083899 | 3300038443 | Bacteria | 3330 |
| 220 | Ga0395901_0224936 | 3300038443 | Bacteria | 1960 |
| 221 | Ga0436361_0108899 | 3300039447 | Bacteria | 37383 |
| 222 | Ga0436361_0114800 | 3300039447 | Bacteria | 693 |
| 223 | Ga0436361_0487158 | 3300039447 | Bacteria | 12381 |
| 224 | Ga0436361_0688328 | 3300039447 | Bacteria | 1487 |
| 225 | Ga0439436_0020293 | 3300041404 | Bacteria | 1980 |
| 226 | Ga0451851_0772830 | 3300041507 | Bacteria | 1426 |
| 227 | Ga0439445_0107143 | 3300042004 | Bacteria | 796 |
| 228 | Ga0439448_0006541 | 3300042005 | Bacteria | 3355 |
| 229 | Ga0439450_008689 | 3300042008 | Bacteria | 1903 |
| 230 | Ga0439457_031350 | 3300042014 | Bacteria | 1179 |
| 231 | Ga0450911_003679 | 3300042115 | Bacteria | 2651 |
| 232 | Ga0450898_057944 | 3300042134 | Bacteria | 758 |
| 233 | Ga0450900_004838 | 3300042136 | Bacteria | 1567 |
| 234 | Ga0466969_0048470 | 3300044656 | Bacteria | 2100 |
| 235 | Ga0466969_0079797 | 3300044656 | Bacteria | 1563 |
| 236 | Ga0466969_0170106 | 3300044656 | Bacteria | 999 |
| 237 | Ga0466972_0064916 | 3300044658 | Bacteria | 1746 |
| 238 | Ga0466965_0003362 | 3300044683 | Bacteria | 7010 |
| 239 | Ga0466966_0001804 | 3300044684 | Bacteria | 13879 |
| 240 | Ga0466966_0142603 | 3300044684 | Bacteria | 1463 |
| 241 | Ga0466966_0321960 | 3300044684 | Bacteria | 929 |
| 242 | Ga0466966_0357477 | 3300044684 | Bacteria | 877 |
| 243 | Ga0466961_0134300 | 3300044693 | Bacteria | 1550 |
| 244 | Ga0466961_0166429 | 3300044693 | Bacteria | 1372 |
| 245 | Ga0466961_0214824 | 3300044693 | Bacteria | 1186 |
| 246 | Ga0466964_0001091 | 3300044706 | Bacteria | 9090 |
| 247 | Ga0466964_0037609 | 3300044706 | Bacteria | 1944 |
| 248 | Ga0466971_0029260 | 3300044719 | Bacteria | 2463 |
| 249 | Ga0466971_0034133 | 3300044719 | Bacteria | 2280 |
| 250 | Ga0466971_0079370 | 3300044719 | Bacteria | 1495 |
| 251 | Ga0466968_0016377 | 3300044735 | Bacteria | 2951 |
| 252 | Ga0466970_0003911 | 3300044765 | Bacteria | 7297 |
| 253 | Ga0466970_0237559 | 3300044765 | Bacteria | 1019 |
| 254 | Ga0466970_0388275 | 3300044765 | Bacteria | 795 |
| 255 | Ga0466957_0021820 | 3300044842 | Bacteria | 3774 |
| 256 | Ga0466957_0046928 | 3300044842 | Bacteria | 2624 |
| 257 | Ga0466957_0198331 | 3300044842 | Bacteria | 1317 |
| 258 | Ga0466960_0105980 | 3300044901 | Bacteria | 1454 |
| 259 | Ga0466959_0170750 | 3300045049 | Bacteria | 1525 |
| 260 | Ga0451576_0260296 | 3300045051 | Bacteria | 1813 |
| 261 | Ga0466958_0137609 | 3300045836 | Bacteria | 1536 |
| 262 | Ga0466958_0376245 | 3300045836 | Bacteria | 915 |
| 263 | Ga0466967_0009867 | 3300045976 | Bacteria | 7120 |
| 264 | Ga0466967_0397721 | 3300045976 | Bacteria | 1340 |
| 265 | Ga0495617_000002 | 3300046452 | Bacteria | 710121 |
| 266 | Ga0495627_000915 | 3300046453 | Bacteria | 20456 |
| 267 | Ga0495627_002699 | 3300046453 | Bacteria | 8299 |
| 268 | Ga0495592_0031364 | 3300046454 | Bacteria | 4017 |
| 269 | Ga0495603_0009529 | 3300046455 | Bacteria | 5866 |
| 270 | Ga0495603_0052336 | 3300046455 | Bacteria | 2424 |
| 271 | Ga0495603_0065833 | 3300046455 | Bacteria | 2135 |
| 272 | Ga0495590_0000061 | 3300046457 | Bacteria | 88102 |
| 273 | Ga0495590_0003836 | 3300046457 | Bacteria | 6117 |
| 274 | Ga0495590_0005278 | 3300046457 | Bacteria | 5128 |
| 275 | Ga0495590_0007300 | 3300046457 | Bacteria | 4269 |
| 276 | Ga0495590_0014839 | 3300046457 | Bacteria | 2840 |
| 277 | Ga0495590_0022635 | 3300046457 | Bacteria | 2222 |
| 278 | Ga0495591_000893 | 3300046458 | Bacteria | 20883 |
| 279 | Ga0495591_019982 | 3300046458 | Bacteria | 2226 |
| 280 | Ga0495629_0001114 | 3300046459 | Bacteria | 21253 |
| 281 | Ga0495629_0006338 | 3300046459 | Bacteria | 8775 |
| 282 | Ga0495629_0239464 | 3300046459 | Bacteria | 1250 |
| 283 | Ga0495629_0245042 | 3300046459 | Bacteria | 1233 |
| 284 | Ga0495638_0003750 | 3300046460 | Bacteria | 11826 |
| 285 | Ga0495638_0083131 | 3300046460 | Bacteria | 1940 |
| 286 | Ga0495638_0100151 | 3300046460 | Bacteria | 1734 |
| 287 | Ga0495641_0038221 | 3300046461 | Bacteria | 2243 |
| 288 | Ga0495641_0453179 | 3300046461 | Bacteria | 584 |
| 289 | Ga0495651_0005508 | 3300046462 | Bacteria | 9658 |
| 290 | Ga0495651_0094042 | 3300046462 | Bacteria | 2243 |
| 291 | Ga0495651_0139475 | 3300046462 | Bacteria | 1760 |
| 292 | Ga0495653_0014614 | 3300046463 | Bacteria | 6405 |
| 293 | Ga0495653_0032931 | 3300046463 | Bacteria | 4110 |
| 294 | Ga0495653_0130417 | 3300046463 | Bacteria | 1780 |
| 295 | Ga0495650_0005346 | 3300046471 | Bacteria | 8380 |
| 296 | Ga0495650_0058861 | 3300046471 | Bacteria | 1549 |
| 297 | Ga0495580_0001589 | 3300046472 | Bacteria | 19947 |
| 298 | Ga0495580_0001825 | 3300046472 | Bacteria | 18732 |
| 299 | Ga0495580_0007802 | 3300046472 | Bacteria | 8573 |
| 300 | Ga0495580_0025409 | 3300046472 | Bacteria | 4328 |
| 301 | Ga0495582_0012841 | 3300046473 | Bacteria | 4614 |
| 302 | Ga0495582_0034143 | 3300046473 | Bacteria | 2796 |
| 303 | Ga0495582_0373620 | 3300046473 | Bacteria | 821 |
| 304 | Ga0495605_0000276 | 3300046474 | Bacteria | 57745 |
| 305 | Ga0495605_0000463 | 3300046474 | Bacteria | 36335 |
| 306 | Ga0495605_0004948 | 3300046474 | Bacteria | 7784 |
| 307 | Ga0495605_0009339 | 3300046474 | Bacteria | 5510 |
| 308 | Ga0495605_0013900 | 3300046474 | Bacteria | 4421 |
| 309 | Ga0495605_0045776 | 3300046474 | Bacteria | 2154 |
| 310 | Ga0495605_0066113 | 3300046474 | Bacteria | 1718 |
| 311 | Ga0495605_0110707 | 3300046474 | Bacteria | 1253 |
| 312 | Ga0495605_0291116 | 3300046474 | Bacteria | 692 |
| 313 | Ga0495662_0014554 | 3300046476 | Bacteria | 3825 |
| 314 | Ga0495664_0010156 | 3300046477 | Bacteria | 5282 |
| 315 | Ga0495584_0000011 | 3300046491 | Bacteria | 208322 |
| 316 | Ga0495584_0002588 | 3300046491 | Bacteria | 10195 |
| 317 | Ga0495584_0003149 | 3300046491 | Bacteria | 9161 |
| 318 | Ga0495584_0021406 | 3300046491 | Bacteria | 3285 |
| 319 | Ga0495584_0042079 | 3300046491 | Bacteria | 2305 |
| 320 | Ga0495584_0047462 | 3300046491 | Bacteria | 2165 |
| 321 | Ga0495584_0174594 | 3300046491 | Bacteria | 1092 |
| 322 | Ga0495584_0297986 | 3300046491 | Bacteria | 819 |
| 323 | Ga0495585_0000231 | 3300046492 | Bacteria | 57572 |
| 324 | Ga0495585_0003484 | 3300046492 | Bacteria | 10619 |
| 325 | Ga0495585_0004055 | 3300046492 | Bacteria | 9635 |
| 326 | Ga0495585_0033732 | 3300046492 | Bacteria | 2896 |
| 327 | Ga0495585_0279534 | 3300046492 | Bacteria | 825 |
| 328 | Ga0495594_0066322 | 3300046499 | Bacteria | 2002 |
| 329 | Ga0495594_0187363 | 3300046499 | Bacteria | 1178 |
| 330 | Ga0495594_0193293 | 3300046499 | Bacteria | 1159 |
| 331 | Ga0495596_0003219 | 3300046500 | Bacteria | 8376 |
| 332 | Ga0495596_0010600 | 3300046500 | Bacteria | 4006 |
| 333 | Ga0495596_0051280 | 3300046500 | Bacteria | 1616 |
| 334 | Ga0495596_0079219 | 3300046500 | Bacteria | 1275 |
| 335 | Ga0495596_0095618 | 3300046500 | Bacteria | 1153 |
| 336 | Ga0495596_0109931 | 3300046500 | Bacteria | 1070 |
| 337 | Ga0495596_0122702 | 3300046500 | Bacteria | 1008 |
| 338 | Ga0495607_0003527 | 3300046501 | Bacteria | 11933 |
| 339 | Ga0495607_0004161 | 3300046501 | Bacteria | 10763 |
| 340 | Ga0495607_0008583 | 3300046501 | Bacteria | 6976 |
| 341 | Ga0495607_0022290 | 3300046501 | Bacteria | 3979 |
| 342 | Ga0495607_0045420 | 3300046501 | Bacteria | 2584 |
| 343 | Ga0495607_0063288 | 3300046501 | Bacteria | 2093 |
| 344 | Ga0495607_0184582 | 3300046501 | Bacteria | 1043 |
| 345 | Ga0495583_0000204 | 3300046506 | Bacteria | 99749 |
| 346 | Ga0495583_0001332 | 3300046506 | Bacteria | 25640 |
| 347 | Ga0495583_0001924 | 3300046506 | Bacteria | 19210 |
| 348 | Ga0495583_0003312 | 3300046506 | Bacteria | 12483 |
| 349 | Ga0495583_0006060 | 3300046506 | Bacteria | 8002 |
| 350 | Ga0495583_0010695 | 3300046506 | Bacteria | 5330 |
| 351 | Ga0495583_0015642 | 3300046506 | Bacteria | 4114 |
| 352 | Ga0495583_0094737 | 3300046506 | Bacteria | 1281 |
| 353 | Ga0495606_0023164 | 3300046507 | Bacteria | 4508 |
| 354 | Ga0495606_0110012 | 3300046507 | Bacteria | 1663 |
| 355 | Ga0495606_0123172 | 3300046507 | Bacteria | 1549 |
| 356 | Ga0495606_0173384 | 3300046507 | Bacteria | 1249 |
| 357 | Ga0495608_0004411 | 3300046511 | Bacteria | 10081 |
| 358 | Ga0495608_0231575 | 3300046511 | Bacteria | 1156 |
| 359 | Ga0495610_0000670 | 3300046512 | Bacteria | 33331 |
| 360 | Ga0495610_0001832 | 3300046512 | Bacteria | 18443 |
| 361 | Ga0495616_0015323 | 3300046513 | Bacteria | 4264 |
| 362 | Ga0495616_0017237 | 3300046513 | Bacteria | 3984 |
| 363 | Ga0495616_0023105 | 3300046513 | Bacteria | 3349 |
| 364 | Ga0495616_0026767 | 3300046513 | Bacteria | 3065 |
| 365 | Ga0495616_0050953 | 3300046513 | Bacteria | 2067 |
| 366 | Ga0495616_0095298 | 3300046513 | Bacteria | 1403 |
| 367 | Ga0495618_0031728 | 3300046514 | Bacteria | 3307 |
| 368 | Ga0495618_0062857 | 3300046514 | Bacteria | 2356 |
| 369 | Ga0495618_0312934 | 3300046514 | Bacteria | 974 |
| 370 | Ga0495620_0001084 | 3300046515 | Bacteria | 16654 |
| 371 | Ga0495620_0045982 | 3300046515 | Bacteria | 1887 |
| 372 | Ga0495628_0000887 | 3300046516 | Bacteria | 27589 |
| 373 | Ga0495628_0258035 | 3300046516 | Bacteria | 1299 |
| 374 | Ga0495628_0453132 | 3300046516 | Bacteria | 931 |
| 375 | Ga0495630_0008801 | 3300046517 | Bacteria | 7248 |
| 376 | Ga0495630_0023428 | 3300046517 | Bacteria | 4564 |
| 377 | Ga0495630_0058937 | 3300046517 | Bacteria | 2879 |
| 378 | Ga0495630_0546183 | 3300046517 | Bacteria | 888 |
| 379 | Ga0495631_0009278 | 3300046518 | Bacteria | 4920 |
| 380 | Ga0495631_0071888 | 3300046518 | Bacteria | 1494 |
| 381 | Ga0495631_0332527 | 3300046518 | Bacteria | 646 |
| 382 | Ga0495632_0000559 | 3300046519 | Bacteria | 34765 |
| 383 | Ga0495637_0001263 | 3300046520 | Bacteria | 15271 |
| 384 | Ga0495637_0005121 | 3300046520 | Bacteria | 6724 |
| 385 | Ga0495637_0075204 | 3300046520 | Bacteria | 1355 |
| 386 | Ga0495637_0135530 | 3300046520 | Bacteria | 937 |
| 387 | Ga0495643_0002736 | 3300046522 | Bacteria | 13571 |
| 388 | Ga0495643_0058583 | 3300046522 | Bacteria | 2049 |
| 389 | Ga0495643_0122112 | 3300046522 | Bacteria | 1315 |
| 390 | Ga0495643_0130970 | 3300046522 | Bacteria | 1259 |
| 391 | Ga0495644_0028574 | 3300046523 | Bacteria | 2110 |
| 392 | Ga0495644_0055886 | 3300046523 | Bacteria | 1483 |
| 393 | Ga0495644_0060116 | 3300046523 | Bacteria | 1428 |
| 394 | Ga0495644_0085687 | 3300046523 | Bacteria | 1187 |
| 395 | Ga0495648_0001937 | 3300046524 | Bacteria | 19717 |
| 396 | Ga0495648_0014897 | 3300046524 | Bacteria | 5664 |
| 397 | Ga0495648_0028844 | 3300046524 | Bacteria | 3691 |
| 398 | Ga0495648_0051359 | 3300046524 | Bacteria | 2513 |
| 399 | Ga0495648_0086732 | 3300046524 | Bacteria | 1764 |
| 400 | Ga0495648_0198688 | 3300046524 | Bacteria | 1005 |
| 401 | Ga0495648_0231009 | 3300046524 | Bacteria | 905 |
| 402 | Ga0495648_0243777 | 3300046524 | Bacteria | 871 |
| 403 | Ga0495666_0000739 | 3300046526 | Bacteria | 15005 |
| 404 | Ga0495666_0002291 | 3300046526 | Bacteria | 9532 |
| 405 | Ga0495666_0008012 | 3300046526 | Bacteria | 5292 |
| 406 | Ga0495666_0210364 | 3300046526 | Bacteria | 892 |
| 407 | Ga0495642_0000183 | 3300046528 | Bacteria | 37080 |
| 408 | Ga0495642_0016949 | 3300046528 | Bacteria | 2844 |
| 409 | Ga0495642_0242071 | 3300046528 | Bacteria | 788 |
| 410 | Ga0495652_0023852 | 3300046529 | Bacteria | 5419 |
| 411 | Ga0495652_0338545 | 3300046529 | Bacteria | 1081 |
| 412 | Ga0495654_0016355 | 3300046530 | Bacteria | 3925 |
| 413 | Ga0495654_0033546 | 3300046530 | Bacteria | 2597 |
| 414 | Ga0495665_0019967 | 3300046531 | Bacteria | 3602 |
| 415 | Ga0495665_0035068 | 3300046531 | Bacteria | 2681 |
| 416 | Ga0495665_0045144 | 3300046531 | Bacteria | 2340 |
| 417 | Ga0495640_0007337 | 3300046533 | Bacteria | 8676 |
| 418 | Ga0495640_0021147 | 3300046533 | Bacteria | 4780 |
| 419 | Ga0495640_0201399 | 3300046533 | Bacteria | 1261 |
| 420 | Ga0495586_0014970 | 3300046535 | Bacteria | 4122 |
| 421 | Ga0495587_0013315 | 3300046536 | Bacteria | 5170 |
| 422 | Ga0495587_0051523 | 3300046536 | Bacteria | 2433 |
| 423 | Ga0495609_0021428 | 3300046538 | Bacteria | 2981 |
| 424 | Ga0495609_0071018 | 3300046538 | Bacteria | 1530 |
| 425 | Ga0495609_0072283 | 3300046538 | Bacteria | 1514 |
| 426 | Ga0495609_0133006 | 3300046538 | Bacteria | 1064 |
| 427 | Ga0495621_0049110 | 3300046539 | Bacteria | 1504 |
| 428 | Ga0495597_0000413 | 3300046542 | Bacteria | 36843 |
| 429 | Ga0495597_0000750 | 3300046542 | Bacteria | 25631 |
| 430 | Ga0495597_0001696 | 3300046542 | Bacteria | 15257 |
| 431 | Ga0495597_0002784 | 3300046542 | Bacteria | 10762 |
| 432 | Ga0495597_0267172 | 3300046542 | Bacteria | 669 |
| 433 | Ga0495645_0000622 | 3300046543 | Bacteria | 24407 |
| 434 | Ga0495622_0000589 | 3300046557 | Bacteria | 21290 |
| 435 | Ga0495622_0023243 | 3300046557 | Bacteria | 2890 |
| 436 | Ga0495633_0003294 | 3300046558 | Bacteria | 10855 |
| 437 | Ga0495633_0004042 | 3300046558 | Bacteria | 9489 |
| 438 | Ga0495633_0004541 | 3300046558 | Bacteria | 8764 |
| 439 | Ga0495633_0015697 | 3300046558 | Bacteria | 3925 |
| 440 | Ga0495633_0041829 | 3300046558 | Bacteria | 2178 |
| 441 | Ga0495667_0209403 | 3300046559 | Bacteria | 1246 |
| 442 | Ga0495656_0001009 | 3300046615 | Bacteria | 9102 |
| 443 | Ga0495668_0000927 | 3300046616 | Bacteria | 32722 |
| 444 | Ga0495668_0003809 | 3300046616 | Bacteria | 11047 |
| 445 | Ga0495668_0127953 | 3300046616 | Bacteria | 1390 |
| 446 | Ga0495668_0151385 | 3300046616 | Bacteria | 1270 |
| 447 | Ga0495634_0005337 | 3300046642 | Bacteria | 9905 |
| 448 | Ga0495634_0014334 | 3300046642 | Bacteria | 5719 |
| 449 | Ga0495634_0171398 | 3300046642 | Bacteria | 1363 |
| 450 | Ga0495634_0333601 | 3300046642 | Bacteria | 911 |
| 451 | Ga0495611_0056501 | 3300046648 | Bacteria | 1777 |
| 452 | Ga0495611_0072181 | 3300046648 | Bacteria | 1579 |
| 453 | Ga0495611_0411703 | 3300046648 | Bacteria | 617 |
| 454 | Ga0495625_0005512 | 3300046660 | Bacteria | 11504 |
| 455 | Ga0495625_0047194 | 3300046660 | Bacteria | 3106 |
| 456 | Ga0495635_0008126 | 3300046663 | Bacteria | 7331 |
| 457 | Ga0495635_0015608 | 3300046663 | Bacteria | 5308 |
| 458 | Ga0495659_0046943 | 3300046664 | Bacteria | 1560 |
| 459 | Ga0495661_0001624 | 3300046665 | Bacteria | 18413 |
| 460 | Ga0495661_0006198 | 3300046665 | Bacteria | 8420 |
| 461 | Ga0495661_0010766 | 3300046665 | Bacteria | 6225 |
| 462 | Ga0495661_0014047 | 3300046665 | Bacteria | 5367 |
| 463 | Ga0495661_0022128 | 3300046665 | Bacteria | 4138 |
| 464 | Ga0495661_0032612 | 3300046665 | Bacteria | 3291 |
| 465 | Ga0495661_0089403 | 3300046665 | Bacteria | 1755 |
| 466 | Ga0495661_0135824 | 3300046665 | Bacteria | 1342 |
| 467 | Ga0495661_0192364 | 3300046665 | Bacteria | 1073 |
| 468 | Ga0495661_0192957 | 3300046665 | Bacteria | 1071 |
| 469 | Ga0495661_0263621 | 3300046665 | Bacteria | 874 |
| 470 | Ga0495588_0000070 | 3300046674 | Bacteria | 227611 |
| 471 | Ga0495588_0014429 | 3300046674 | Bacteria | 3782 |
| 472 | Ga0495588_0022714 | 3300046674 | Bacteria | 3101 |
| 473 | Ga0495657_0182848 | 3300046675 | Bacteria | 1285 |
| 474 | Ga0495599_0012678 | 3300046678 | Bacteria | 5198 |
| 475 | Ga0495599_0046905 | 3300046678 | Bacteria | 2709 |
| 476 | Ga0495599_0165547 | 3300046678 | Bacteria | 1366 |
| 477 | Ga0495623_0000855 | 3300046679 | Bacteria | 20625 |
| 478 | Ga0495623_0007019 | 3300046679 | Bacteria | 7321 |
| 479 | Ga0495623_0028617 | 3300046679 | Bacteria | 3584 |
| 480 | Ga0495646_0016813 | 3300046680 | Bacteria | 4647 |
| 481 | Ga0495646_0017968 | 3300046680 | Bacteria | 4480 |
| 482 | Ga0495646_0165873 | 3300046680 | Bacteria | 1220 |
| 483 | Ga0495669_0020630 | 3300046684 | Bacteria | 2853 |
| 484 | Ga0495669_0069390 | 3300046684 | Bacteria | 1604 |
| 485 | Ga0495613_0010020 | 3300046689 | Bacteria | 7038 |
| 486 | Ga0495613_0102101 | 3300046689 | Bacteria | 2071 |
| 487 | Ga0495613_0276752 | 3300046689 | Bacteria | 1166 |
| 488 | Ga0495613_0341811 | 3300046689 | Bacteria | 1029 |
| 489 | Ga0495624_0011763 | 3300046690 | Bacteria | 6007 |
| 490 | Ga0495624_0014170 | 3300046690 | Bacteria | 5418 |
| 491 | Ga0495624_0110958 | 3300046690 | Bacteria | 1686 |
| 492 | Ga0495624_0268155 | 3300046690 | Bacteria | 1031 |
| 493 | Ga0495624_0513433 | 3300046690 | Bacteria | 716 |
| 494 | Ga0495670_0009767 | 3300046691 | Bacteria | 4716 |
| 495 | Ga0495670_0019128 | 3300046691 | Bacteria | 3375 |
| 496 | Ga0495670_0063760 | 3300046691 | Bacteria | 1855 |
| 497 | Ga0495670_0151894 | 3300046691 | Bacteria | 1214 |
| 498 | Ga0495670_0248803 | 3300046691 | Bacteria | 947 |
| 499 | Ga0495671_0000919 | 3300046692 | Bacteria | 20872 |
| 500 | Ga0495671_0020352 | 3300046692 | Bacteria | 3496 |
| 501 | Ga0495671_0027299 | 3300046692 | Bacteria | 2949 |
| 502 | Ga0495671_0143050 | 3300046692 | Bacteria | 1165 |
| 503 | Ga0495671_0260010 | 3300046692 | Bacteria | 837 |
| 504 | Ga0495671_0354017 | 3300046692 | Bacteria | 704 |
| 505 | Ga0495649_0000150 | 3300046694 | Bacteria | 60827 |
| 506 | Ga0495649_0012060 | 3300046694 | Bacteria | 5043 |
| 507 | Ga0495649_0020292 | 3300046694 | Bacteria | 3729 |
| 508 | Ga0495649_0023212 | 3300046694 | Bacteria | 3466 |
| 509 | Ga0495649_0024235 | 3300046694 | Bacteria | 3384 |
| 510 | Ga0495649_0066575 | 3300046694 | Bacteria | 1933 |
| 511 | Ga0495649_0161541 | 3300046694 | Bacteria | 1174 |
| 512 | Ga0495589_0000175 | 3300046794 | Bacteria | 57368 |
| 513 | Ga0495589_0002373 | 3300046794 | Bacteria | 10575 |
| 514 | Ga0495589_0002609 | 3300046794 | Bacteria | 10003 |
| 515 | Ga0495589_0028641 | 3300046794 | Bacteria | 2810 |
| 516 | Ga0495589_0047415 | 3300046794 | Bacteria | 2129 |
| 517 | Ga0495589_0141821 | 3300046794 | Bacteria | 1150 |
| 518 | Ga0495589_0242741 | 3300046794 | Bacteria | 843 |
| 519 | Ga0495600_0154334 | 3300046809 | Bacteria | 1485 |
| 520 | Ga0495600_0221500 | 3300046809 | Bacteria | 1210 |
| 521 | Ga0495660_0000113 | 3300046810 | Bacteria | 86593 |
| 522 | Ga0495660_0018484 | 3300046810 | Bacteria | 4008 |
| 523 | Ga0495660_0041108 | 3300046810 | Bacteria | 2561 |
| 524 | Ga0495660_0050022 | 3300046810 | Bacteria | 2278 |
| 525 | Ga0495660_0100099 | 3300046810 | Bacteria | 1493 |
| 526 | Ga0495660_0126156 | 3300046810 | Bacteria | 1289 |
| 527 | Ga0495581_0010695 | 3300047315 | Bacteria | 5306 |
| 528 | Ga0495581_0015553 | 3300047315 | Bacteria | 4416 |
| 529 | Ga0495581_0158173 | 3300047315 | Bacteria | 1324 |
| 530 | Ga0495604_0000937 | 3300047317 | Bacteria | 24269 |
| 531 | Ga0495604_0019093 | 3300047317 | Bacteria | 5489 |
| 532 | Ga0495604_0032359 | 3300047317 | Bacteria | 4146 |
| 533 | Ga0495636_0008508 | 3300047318 | Bacteria | 4049 |
| 534 | Ga0495674_0005690 | 3300047319 | Bacteria | 11937 |
| 535 | Ga0495674_0080884 | 3300047319 | Bacteria | 2787 |
| 536 | Ga0495674_0107723 | 3300047319 | Bacteria | 2365 |
| 537 | Ga0495674_0486404 | 3300047319 | Bacteria | 988 |
| 538 | Ga0495672_0000802 | 3300047320 | Bacteria | 33855 |
| 539 | Ga0495672_0008822 | 3300047320 | Bacteria | 7381 |
| 540 | Ga0495672_0037556 | 3300047320 | Bacteria | 2962 |
| 541 | Ga0495672_0072717 | 3300047320 | Bacteria | 1941 |
| 542 | Ga0495672_0193511 | 3300047320 | Bacteria | 1021 |
| 543 | Ga0495676_0014594 | 3300047321 | Bacteria | 7026 |
| 544 | Ga0495676_0105672 | 3300047321 | Bacteria | 2075 |
| 545 | Ga0495676_0227918 | 3300047321 | Bacteria | 1281 |
| 546 | Ga0495676_0239909 | 3300047321 | Bacteria | 1241 |
| 547 | Ga0495680_0008917 | 3300047322 | Bacteria | 9068 |
| 548 | Ga0495680_0054198 | 3300047322 | Bacteria | 3115 |
| 549 | Ga0495680_0121560 | 3300047322 | Bacteria | 1927 |
| 550 | Ga0495680_0446847 | 3300047322 | Bacteria | 885 |
| 551 | Ga0495683_0000088 | 3300047323 | Bacteria | 92118 |
| 552 | Ga0495683_0002367 | 3300047323 | Bacteria | 11438 |
| 553 | Ga0495683_0004158 | 3300047323 | Bacteria | 8284 |
| 554 | Ga0495683_0005945 | 3300047323 | Bacteria | 6700 |
| 555 | Ga0495683_0044563 | 3300047323 | Bacteria | 2231 |
| 556 | Ga0495683_0053159 | 3300047323 | Bacteria | 2020 |
| 557 | Ga0495683_0059410 | 3300047323 | Bacteria | 1897 |
| 558 | Ga0495683_0102018 | 3300047323 | Bacteria | 1378 |
| 559 | Ga0495683_0209927 | 3300047323 | Bacteria | 873 |
| 560 | Ga0495687_001033 | 3300047443 | Bacteria | 27654 |
| 561 | Ga0495687_003432 | 3300047443 | Bacteria | 11495 |
| 562 | Ga0495687_003733 | 3300047443 | Bacteria | 10794 |
| 563 | Ga0495687_004752 | 3300047443 | Bacteria | 8979 |
| 564 | Ga0495687_018142 | 3300047443 | Bacteria | 3485 |
| 565 | Ga0495687_031878 | 3300047443 | Bacteria | 2412 |
| 566 | Ga0495687_044107 | 3300047443 | Bacteria | 1940 |
| 567 | Ga0495687_069170 | 3300047443 | Bacteria | 1422 |
| 568 | Ga0495675_0003264 | 3300047444 | Bacteria | 9743 |
| 569 | Ga0495675_0063863 | 3300047444 | Bacteria | 2329 |
| 570 | Ga0495675_0079046 | 3300047444 | Bacteria | 2072 |
| 571 | Ga0495675_0115533 | 3300047444 | Bacteria | 1673 |
| 572 | Ga0495677_0001895 | 3300047445 | Bacteria | 8353 |
| 573 | Ga0495677_0003610 | 3300047445 | Bacteria | 5996 |
| 574 | Ga0495677_0004003 | 3300047445 | Bacteria | 5691 |
| 575 | Ga0495677_0005176 | 3300047445 | Bacteria | 4961 |
| 576 | Ga0495677_0007072 | 3300047445 | Bacteria | 4201 |
| 577 | Ga0495677_0012257 | 3300047445 | Bacteria | 3128 |
| 578 | Ga0495677_0387710 | 3300047445 | Bacteria | 552 |
| 579 | Ga0495679_000044 | 3300047446 | Bacteria | 138399 |
| 580 | Ga0495679_007739 | 3300047446 | Bacteria | 4445 |
| 581 | Ga0495679_011151 | 3300047446 | Bacteria | 3487 |
| 582 | Ga0495679_034360 | 3300047446 | Bacteria | 1614 |
| 583 | Ga0495685_009748 | 3300047447 | Bacteria | 3214 |
| 584 | Ga0495685_093958 | 3300047447 | Bacteria | 992 |
| 585 | Ga0495673_0002409 | 3300047469 | Bacteria | 13186 |
| 586 | Ga0495681_0000736 | 3300047470 | Bacteria | 25134 |
| 587 | Ga0495681_0001595 | 3300047470 | Bacteria | 16866 |
| 588 | Ga0495681_0022036 | 3300047470 | Bacteria | 3417 |
| 589 | Ga0495681_0027146 | 3300047470 | Bacteria | 2967 |
| 590 | Ga0495681_0031098 | 3300047470 | Bacteria | 2708 |
| 591 | Ga0495681_0119464 | 3300047470 | Bacteria | 1132 |
| 592 | Ga0495681_0167372 | 3300047470 | Bacteria | 911 |
| 593 | Ga0495681_0170671 | 3300047470 | Bacteria | 900 |
| 594 | Ga0495684_0032818 | 3300047471 | Bacteria | 3988 |
| 595 | Ga0495684_0269426 | 3300047471 | Bacteria | 1233 |
| 596 | Ga0495686_0049890 | 3300047472 | Bacteria | 2631 |
| 597 | Ga0495686_0275735 | 3300047472 | Bacteria | 936 |
| 598 | Ga0495593_0001133 | 3300047673 | Bacteria | 15521 |
| 599 | Ga0495593_0004509 | 3300047673 | Bacteria | 8273 |
| 600 | Ga0495593_0023169 | 3300047673 | Bacteria | 3453 |
| 601 | Ga0495602_0010570 | 3300048088 | Bacteria | 9574 |
| 602 | Ga0495602_0023055 | 3300048088 | Bacteria | 6075 |
| 603 | Ga0495602_0050470 | 3300048088 | Bacteria | 3716 |
| 604 | Ga0495602_0345828 | 3300048088 | Bacteria | 1074 |
| 605 | Ga0495614_0004234 | 3300048089 | Bacteria | 6466 |
| 606 | Ga0495614_0019117 | 3300048089 | Bacteria | 2965 |
| 607 | Ga0495614_0023062 | 3300048089 | Bacteria | 2684 |
| 608 | Ga0495614_0039931 | 3300048089 | Bacteria | 2014 |
| 609 | Ga0495615_0024376 | 3300048090 | Bacteria | 1395 |
| 610 | Ga0495626_0001606 | 3300048091 | Bacteria | 17620 |
| 611 | Ga0495626_0003353 | 3300048091 | Bacteria | 10321 |
| 612 | Ga0495626_0028196 | 3300048091 | Bacteria | 2724 |
| 613 | Ga0495626_0058651 | 3300048091 | Bacteria | 1758 |
| 614 | Ga0495626_0059131 | 3300048091 | Bacteria | 1749 |
| 615 | Ga0495626_0075118 | 3300048091 | Bacteria | 1511 |
| 616 | Ga0495626_0079822 | 3300048091 | Bacteria | 1455 |
| 617 | Ga0495626_0102774 | 3300048091 | Bacteria | 1244 |
| 618 | Ga0495626_0114332 | 3300048091 | Bacteria | 1165 |
| 619 | Ga0495626_0121499 | 3300048091 | Bacteria | 1122 |
| 620 | Ga0495626_0206026 | 3300048091 | Bacteria | 804 |
| 621 | Ga0496100_0049502 | 3300048903 | Bacteria | 2718 |
| 622 | Ga0496100_0117790 | 3300048903 | Bacteria | 1854 |
| 623 | Ga0496100_1431172 | 3300048903 | Bacteria | 546 |
| 624 | Ga0496101_0230288 | 3300048904 | Bacteria | 1440 |
| 625 | Ga0496102_0067069 | 3300048905 | Bacteria | 3290 |
| 626 | Ga0496102_0111252 | 3300048905 | Bacteria | 2553 |
| 627 | Ga0496102_0455015 | 3300048905 | Bacteria | 1201 |
| 628 | Ga0496102_0664578 | 3300048905 | Bacteria | 965 |
| 629 | Ga0496103_0009005 | 3300048906 | Bacteria | 5913 |
| 630 | Ga0496103_0263592 | 3300048906 | Bacteria | 1109 |
| 631 | Ga0496104_0115453 | 3300048907 | Bacteria | 2576 |
| 632 | Ga0496104_0157529 | 3300048907 | Bacteria | 2179 |
| 633 | Ga0496105_0137013 | 3300048908 | Bacteria | 2016 |
| 634 | Ga0496105_0212094 | 3300048908 | Bacteria | 1578 |
| 635 | Ga0496106_0362338 | 3300048909 | Bacteria | 1165 |
| 636 | Ga0496107_0082026 | 3300048910 | Bacteria | 2352 |
| 637 | Ga0496107_0216247 | 3300048910 | Bacteria | 1425 |
| 638 | Ga0496107_0231432 | 3300048910 | Bacteria | 1375 |
| 639 | Ga0496108_0347719 | 3300048911 | Bacteria | 1294 |
| 640 | Ga0496108_0514458 | 3300048911 | Bacteria | 1045 |
| 641 | Ga0496108_0522057 | 3300048911 | Bacteria | 1037 |
| 642 | Ga0496109_0282889 | 3300048912 | Bacteria | 1563 |
| 643 | Ga0496109_0290346 | 3300048912 | Bacteria | 1542 |
| 644 | Ga0496109_0395044 | 3300048912 | Bacteria | 1306 |
| 645 | Ga0496110_0000073 | 3300048913 | Bacteria | 51301 |
| 646 | Ga0496110_0046195 | 3300048913 | Bacteria | 3809 |
| 647 | Ga0496110_0146736 | 3300048913 | Bacteria | 2134 |
| 648 | Ga0496111_0217851 | 3300048914 | Bacteria | 1418 |
| 649 | Ga0496111_0237181 | 3300048914 | Bacteria | 1355 |
| 650 | Ga0496111_0838359 | 3300048914 | Bacteria | 664 |
| 651 | Ga0496113_0268419 | 3300048916 | Bacteria | 1363 |
| 652 | Ga0496113_0382140 | 3300048916 | Bacteria | 1130 |
| 653 | Ga0496114_0395847 | 3300048917 | Bacteria | 1223 |
| 654 | Ga0496114_0550457 | 3300048917 | Bacteria | 1019 |
| 655 | Ga0496115_0887585 | 3300048918 | Bacteria | 688 |
| 656 | Ga0496115_1067077 | 3300048918 | Bacteria | 614 |
| 657 | Ga0496116_0032673 | 3300048919 | Bacteria | 3705 |
| 658 | Ga0496116_0105816 | 3300048919 | Bacteria | 1668 |
| 659 | Ga0496117_0004681 | 3300048920 | Bacteria | 14860 |
| 660 | Ga0496117_0021618 | 3300048920 | Bacteria | 5197 |
| 661 | Ga0496118_0001537 | 3300048921 | Bacteria | 34298 |
| 662 | Ga0496118_0003702 | 3300048921 | Bacteria | 18949 |
| 663 | Ga0496118_0024239 | 3300048921 | Bacteria | 5245 |
| 664 | Ga0496121_0008010 | 3300048924 | Bacteria | 12611 |
| 665 | Ga0496121_0047291 | 3300048924 | Bacteria | 3673 |
| 666 | Ga0496122_0000080 | 3300048925 | Bacteria | 212397 |
| 667 | Ga0496122_0016475 | 3300048925 | Bacteria | 6990 |
| 668 | Ga0496122_0032257 | 3300048925 | Bacteria | 4336 |
| 669 | Ga0496122_0276155 | 3300048925 | Bacteria | 922 |
| 670 | Ga0496123_0000072 | 3300048926 | Bacteria | 198524 |
| 671 | Ga0496123_0013378 | 3300048926 | Bacteria | 6896 |
| 672 | Ga0496123_0171469 | 3300048926 | Bacteria | 1144 |
| 673 | Ga0496124_0021358 | 3300048927 | Bacteria | 5966 |
| 674 | Ga0496124_0206783 | 3300048927 | Bacteria | 1488 |
| 675 | Ga0496124_0239476 | 3300048927 | Bacteria | 1350 |
| 676 | Ga0496125_0541174 | 3300048928 | Bacteria | 647 |
| 677 | Ga0496126_0001219 | 3300048929 | Bacteria | 41827 |
| 678 | Ga0496126_0003161 | 3300048929 | Bacteria | 21211 |
| 679 | Ga0496126_0003330 | 3300048929 | Bacteria | 20433 |
| 680 | Ga0496126_0448868 | 3300048929 | Bacteria | 1038 |
| 681 | Ga0501308_000534 | 3300049128 | Bacteria | 2528 |
| 682 | Ga0495678_000603 | 3300049459 | Bacteria | 33820 |
| 683 | Ga0495678_001473 | 3300049459 | Bacteria | 18420 |
| 684 | Ga0495678_005875 | 3300049459 | Bacteria | 6644 |
| 685 | Ga0495678_011517 | 3300049459 | Bacteria | 4229 |
| 686 | Ga0495678_038116 | 3300049459 | Bacteria | 1947 |
| 687 | Ga0495678_146146 | 3300049459 | Bacteria | 768 |
| 688 | Ga0495678_146655 | 3300049459 | Bacteria | 766 |
| 689 | Ga0495682_0000518 | 3300049460 | Bacteria | 26647 |
| 690 | Ga0495682_0020284 | 3300049460 | Bacteria | 2495 |
| 691 | Ga0495682_0087003 | 3300049460 | Bacteria | 1123 |
| 692 | Ga0495682_0107931 | 3300049460 | Bacteria | 997 |
| 693 | Ga0501315_019818 | 3300049531 | Bacteria | 898 |
| 694 | Ga0501032_0136634 | 3300049569 | Bacteria | 1616 |
| 695 | Ga0501034_0000273 | 3300049571 | Bacteria | 93198 |
| 696 | Ga0501034_0609314 | 3300049571 | Bacteria | 997 |
| 697 | Ga0501036_0187645 | 3300049572 | Bacteria | 1740 |
| 698 | Ga0501036_0294041 | 3300049572 | Bacteria | 1359 |
| 699 | Ga0501036_0603858 | 3300049572 | Bacteria | 910 |
| 700 | Ga0501036_0820474 | 3300049572 | Bacteria | 765 |
| 701 | Ga0501040_0135086 | 3300049576 | Bacteria | 1736 |
| 702 | Ga0501042_0046065 | 3300049578 | Bacteria | 3109 |
| 703 | Ga0501048_0234369 | 3300049582 | Bacteria | 1302 |
| 704 | Ga0501072_0296620 | 3300049588 | Bacteria | 1285 |
| 705 | Ga0501074_0406957 | 3300049590 | Bacteria | 965 |
| 706 | Ga0501075_0268318 | 3300049591 | Bacteria | 1301 |
| 707 | Ga0501079_0704658 | 3300049741 | Bacteria | 795 |
| 708 | Ga0501080_0873291 | 3300049742 | Bacteria | 785 |
| 709 | Ga0501035_0149489 | 3300049822 | Bacteria | 2028 |
| 710 | Ga0501044_0279904 | 3300049823 | Bacteria | 1602 |
| 711 | Ga0501045_0036966 | 3300049824 | Bacteria | 3548 |
| 712 | nmdc:mga03683_113332_c1 | 3300050489 | Bacteria | 1201 |
| 713 | nmdc:mga0k408_65731_c1 | 3300050493 | Bacteria | 2112 |
| 714 | nmdc:mga06z11_43022_c1 | 3300050494 | Bacteria | 2269 |
| 715 | nmdc:mga07m45_5482_c2 | 3300050496 | Bacteria | 5104 |
| 716 | nmdc:mga07m45_54858_c1 | 3300050496 | Bacteria | 2252 |
| 717 | Ga0495655_0052003 | 3300053083 | Bacteria | 1088 |
| 718 | Ga0495595_0120696 | 3300053084 | Bacteria | 1277 |
| 719 | Ga0500594_0080417 | 3300053118 | Bacteria | 974 |
| 720 | Ga0501084_0638414 | 3300054114 | Bacteria | 899 |
| 721 | Ga0587076_119841 | 3300059645 | Bacteria | 608 |
| 722 | Ga0466962_0161978 | 3300061719 | Bacteria | 1087 |
| 723 | Ga0466962_0626255 | 3300061719 | Bacteria | 549 |
| 724 | 2509130259 | 2508501125 | Bacteria | 7208311 |
| 725 | 2510252220 | 2510065045 | Bacteria | 7761063 |
| 726 | 2512344857 | 2512047030 | Bacteria | 9031815 |
| 727 | 2514047472 | 2513237166 | Bacteria | 10373764 |
| 728 | 2515682631 | 2515154122 | Bacteria | 8609520 |
| 729 | 2521556694 | 2521172590 | Bacteria | 5047645 |
| 730 | 2527077836 | 2526164713 | Bacteria | 6780608 |
| 731 | 2563059625 | 2562617112 | Bacteria | 10918404 |
| 732 | 2600810480 | 2600255067 | Bacteria | 6795583 |
| 733 | 2643797591 | 2643221556 | Bacteria | 7251154 |
| 734 | 2644466528 | 2643221683 | Bacteria | 5749203 |
| 735 | 2644470627 | 2643221684 | Bacteria | 7145183 |
| 736 | 2713479429 | 2711768613 | Bacteria | 11048459 |
| 737 | 2719641315 | 2718217991 | Bacteria | 7829542 |
| 738 | 2738821787 | 2738541296 | Bacteria | 7285013 |
| 739 | 2738834269 | 2738541298 | Bacteria | 7286732 |
| 740 | 2738875473 | 2738541306 | Bacteria | 7284992 |
| 741 | 2739187426 | 2738543002 | Bacteria | 7284546 |
| 742 | 2739222071 | 2738543008 | Bacteria | 7282815 |
| 743 | 2739247828 | 2738543013 | Bacteria | 5618633 |
| 744 | 2746088507 | 2744054900 | Bacteria | 8399525 |
| 745 | 2746092546 | 2744054901 | Bacteria | 8397047 |
| 746 | 2765567876 | 2765235838 | Bacteria | 5445269 |
| 747 | 2792839521 | 2791355137 | Bacteria | 9654227 |
| 748 | 2819545322 | 2818991436 | Bacteria | 5376622 |
| 749 | 2819618060 | 2818991449 | Bacteria | 5518009 |
| 750 | 2819621999 | 2818991450 | Bacteria | 6962147 |
| 751 | 2839097837 | 2839094727 | Bacteria | 5534556 |
| 752 | 2842738633 | 2842733646 | Bacteria | 5716726 |
| 753 | 2842750133 | 2842747753 | Bacteria | 5578255 |
| 754 | 2885274028 | 2885270888 | Bacteria | 9831543 |
| 755 | 2900637464 | 2900634093 | Bacteria | 10263517 |
| 756 | 2902691081 | 2902682994 | Bacteria | 8951596 |
| 757 | 2904435452 | 2904434214 | Bacteria | 6230908 |
| 758 | 2904441923 | 2904439833 | Bacteria | 5931679 |
| 759 | 2904451124 | 2904449895 | Bacteria | 6927402 |
| 760 | 2904457978 | 2904456579 | Bacteria | 6819253 |
| 761 | 2904487747 | 2904483920 | Bacteria | 7545285 |
| 762 | 2904533220 | 2904530477 | Bacteria | 5876334 |
| 763 | 2904586167 | 2904584206 | Bacteria | 6028872 |
| 764 | 2904592019 | 2904589729 | Bacteria | 6113573 |
| 765 | 2904601819 | 2904601388 | Bacteria | 5884906 |
| 766 | 2904620546 | 2904615490 | Bacteria | 10047340 |
| 767 | 2919049465 | 2919046199 | Bacteria | 5567169 |
| 768 | 2919083854 | 2919079590 | Bacteria | 5946433 |
| 769 | 2919529052 | 2919527303 | Bacteria | 7718827 |
| 770 | 2928111219 | 2928108538 | Bacteria | 7360024 |
| 771 | 2928118831 | 2928115317 | Bacteria | 6477646 |
| 772 | 2928137244 | 2928135762 | Bacteria | 7259641 |
| 773 | 2928506048 | 2928503688 | Bacteria | 7268108 |
| 774 | 2945938021 | 2945934425 | Bacteria | 7444609 |
| 775 | 2945974402 | 2945972063 | Bacteria | 6086495 |
| 776 | 2990705263 | 2990703756 | Bacteria | 7715990 |
| 777 | 642424281 | 641736151 | Bacteria | 7477263 |
| 778 | 642592227 | 642555112 | Bacteria | 8676562 |
| 779 | 642622846 | 642555113 | Bacteria | 8214658 |
| 780 | 8047678885 | 8047673197 | Bacteria | 7395230 |
| 781 | 8055267323 | 8055266321 | Bacteria | 7999742 |
| 782 | 8055301375 | 8055301274 | Bacteria | 8587385 |
| 783 | Ga0182008_10000255 | |||
| 784 | JGI24740J21852_10006227 | |||
| 785 | JGI24739J22299_10011480 | |||
| 786 | JGI24739J22299_10027379 | |||
| 787 | JGI24735J21928_10000136 | |||
| 788 | JGI24735J21928_10013457 | |||
| 789 | JGI24735J21928_10023546 | |||
| 790 | JGI24738J21930_10017553 | |||
| 791 | JGI25156J39149_1000674 | |||
| 792 | JGI25156J39149_1002675 | |||
| 793 | JGI25156J39149_1011008 | |||
| 794 | JGI25165J46597_1001478 | |||
| 795 | rootL2_10000821 | |||
| 796 | Ga0055533_1000390 | |||
| 797 | Ga0055533_1016887 | |||
| 798 | Ga0055532_1000012 | |||
| 799 | Ga0055525_1000009 | |||
| 800 | Ga0055527_1000011 | |||
| 801 | Ga0055535_1000009 | |||
| 802 | Ga0055542_1000015 | |||
| 803 | Ga0055529_1000011 | |||
| 804 | Ga0055536_1009340 | |||
| 805 | Ga0055536_1027862 | |||
| 806 | Ga0055534_1001587 | |||
| 807 | Ga0055540_1003891 | |||
| 808 | Ga0055531_10000469 | |||
| 809 | Ga0055531_10092978 | |||
| 810 | Ga0070658_10230962 | |||
| 811 | Ga0068869_100067024 | |||
| 812 | Ga0070680_100734772 | |||
| 813 | Ga0070682_101078438 | |||
| 814 | Ga0070660_100016381 | |||
| 815 | Ga0070669_100040138 | |||
| 816 | Ga0070669_100203884 | |||
| 817 | Ga0070674_100253742 | |||
| 818 | Ga0070674_100373067 | |||
| 819 | Ga0070674_100907855 | |||
| 820 | Ga0070673_100792251 | |||
| 821 | Ga0070673_100992374 | |||
| 822 | Ga0070673_101514779 | |||
| 823 | Ga0070659_100084873 | |||
| 824 | Ga0070667_100196363 | |||
| 825 | Ga0070678_100083648 | |||
| 826 | Ga0070678_100235138 | |||
| 827 | Ga0070678_100239716 | |||
| 828 | Ga0070662_100116959 | |||
| 829 | Ga0068867_100923339 | |||
| 830 | Ga0070672_100704739 | |||
| 831 | Ga0068855_100323237 | |||
| 832 | Ga0068855_100437666 | |||
| 833 | Ga0068855_100544837 | |||
| 834 | Ga0070664_100321735 | |||
| 835 | Ga0070664_100581719 | |||
| 836 | Ga0068852_100470373 | |||
| 837 | Ga0075365_10027748 | |||
| 838 | Ga0070712_100105936 | |||
| 839 | Ga0075362_10083634 | |||
| 840 | Ga0075367_10085941 | |||
| 841 | Ga0075366_10017453 | |||
| 842 | Ga0075370_10063470 | |||
| 843 | Ga0075370_10483346 | |||
| 844 | Ga0105251_10000047 | |||
| 845 | Ga0105240_10528292 | |||
| 846 | Ga0105245_10118126 | |||
| 847 | Ga0105243_10013664 | |||
| 848 | Ga0105241_10182545 | |||
| 849 | Ga0105241_10203249 | |||
| 850 | Ga0105242_10043759 | |||
| 851 | Ga0105242_10466953 | |||
| 852 | Ga0105242_11713033 | |||
| 853 | Ga0105238_10117726 | |||
| 854 | Ga0105238_10245911 | |||
| 855 | Ga0105239_10239181 | |||
| 856 | Ga0157371_10000399 | |||
| 857 | Ga0157370_10118509 | |||
| 858 | Ga0157369_10002846 | |||
| 859 | Ga0157369_10034311 | |||
| 860 | Ga0157369_10068323 | |||
| 861 | Ga0157369_10069847 | |||
| 862 | Ga0163162_11571931 | |||
| 863 | Ga0157372_10245435 | |||
| 864 | Ga0157372_11407497 | |||
| 865 | Ga0163163_10750582 | |||
| 866 | Ga0182008_10004921 | |||
| 867 | Ga0182008_10041786 | |||
| 868 | Ga0157379_10372979 | |||
| 869 | Ga0157376_10784099 | |||
| 870 | Ga0182006_1009113 | |||
| 871 | Ga0182006_1045863 | |||
| 872 | Ga0182006_1061159 | |||
| 873 | Ga0182007_10000168 | |||
| 874 | Ga0182007_10001372 | |||
| 875 | Ga0183362_10004 | |||
| 876 | Ga0183361_10001 | |||
| 877 | Ga0163161_10096335 | |||
| 878 | Ga0163161_10407024 | |||
| 879 | Ga0206354_10241356 | |||
| 880 | Ga0206353_11984652 | |||
| 881 | Ga0213872_10000117 | |||
| 882 | Ga0224712_10000748 | |||
| 883 | Ga0209566_111655 | |||
| 884 | Ga0209674_100013 | |||
| 885 | Ga0209674_100276 | |||
| 886 | Ga0209672_100010 | |||
| 887 | Ga0209147_100006 | |||
| 888 | Ga0209563_100015 | |||
| 889 | Ga0209563_101557 | |||
| 890 | Ga0209258_100010 | |||
| 891 | Ga0209677_110384 | |||
| 892 | Ga0209148_1000018 | |||
| 893 | Ga0209759_1000132 | |||
| 894 | Ga0209759_1000181 | |||
| 895 | Ga0209759_1000276 | |||
| 896 | Ga0209233_1000093 | |||
| 897 | Ga0209565_1040718 | |||
| 898 | Ga0209455_1000015 | |||
| 899 | Ga0209130_1001785 | |||
| 900 | Ga0209675_1006181 | |||
| 901 | Ga0209676_1000209 | |||
| 902 | Ga0209025_1067990 | |||
| 903 | Ga0209564_1006638 | |||
| 904 | Ga0209050_1002179 | |||
| 905 | Ga0209051_1000156 | |||
| 906 | Ga0209051_1026424 | |||
| 907 | Ga0209051_1053279 | |||
| 908 | Ga0209257_1000016 | |||
| 909 | Ga0209257_1011157 | |||
| 910 | Ga0207713_1000041 | |||
| 911 | Ga0207705_10003612 | |||
| 912 | Ga0207654_10009376 | |||
| 913 | Ga0207654_10064549 | |||
| 914 | Ga0207654_10099784 | |||
| 915 | Ga0207693_10113574 | |||
| 916 | Ga0207660_10122631 | |||
| 917 | Ga0207657_10870940 | |||
| 918 | Ga0207681_10171480 | |||
| 919 | Ga0207681_10356499 | |||
| 920 | Ga0207694_10172106 | |||
| 921 | Ga0207709_10020122 | |||
| 922 | Ga0207669_10185421 | |||
| 923 | Ga0207669_10304911 | |||
| 924 | Ga0207691_10236308 | |||
| 925 | Ga0207691_10521962 | |||
| 926 | Ga0207689_10167246 | |||
| 927 | Ga0207679_10190547 | |||
| 928 | Ga0207679_10726348 | |||
| 929 | Ga0207667_10008081 | |||
| 930 | Ga0207667_10393788 | |||
| 931 | Ga0207651_10210427 | |||
| 932 | Ga0207651_10232109 | |||
| 933 | Ga0207651_10527841 | |||
| 934 | Ga0207651_10625919 | |||
| 935 | Ga0207640_11048885 | |||
| 936 | Ga0207658_10524730 | |||
| 937 | Ga0207658_10892404 | |||
| 938 | Ga0207678_10111967 | |||
| 939 | Ga0207678_10121222 | |||
| 940 | Ga0207648_10393420 | |||
| 941 | Ga0207648_10519129 | |||
| 942 | Ga0207674_10360552 | |||
| 943 | Ga0207675_100769421 | |||
| 944 | Ga0207683_10205122 | |||
| 945 | Ga0207683_10272587 | |||
| 946 | Ga0207683_10321271 | |||
| 947 | Ga0207698_10418237 | |||
| 948 | Ga0209371_1006456 | |||
| 949 | Ga0307515_10000034 | |||
| 950 | Ga0307515_10060941 | |||
| 951 | Ga0307515_10095998 | |||
| 952 | Ga0268256_1006487 | |||
| 953 | Ga0265328_10006713 | |||
| 954 | Ga0265331_10022083 | |||
| 955 | Ga0265327_10000080 | |||
| 956 | Ga0265327_10002797 | |||
| 957 | Ga0307513_10053318 | |||
| 958 | Ga0307509_10235937 | |||
| 959 | Ga0307509_10404268 | |||
| 960 | Ga0307408_100170460 | |||
| 961 | Ga0307514_10007369 | |||
| 962 | Ga0307518_10009169 | |||
| 963 | Ga0307406_10406363 | |||
| 964 | Ga0307412_10000016 | |||
| 965 | Ga0307416_100222234 | |||
| 966 | Ga0395899_0000093 | |||
| 967 | Ga0395899_0002578 | |||
| 968 | Ga0395899_0010125 | |||
| 969 | Ga0395899_0010132 | |||
| 970 | Ga0395899_0023836 | |||
| 971 | Ga0395899_0104374 | |||
| 972 | Ga0395899_0676788 | |||
| 973 | Ga0395899_0678490 | |||
| 974 | Ga0395900_0005674 | |||
| 975 | Ga0395900_0045762 | |||
| 976 | Ga0395900_0077340 | |||
| 977 | Ga0395900_0109150 | |||
| 978 | Ga0395900_0201478 | |||
| 979 | Ga0395900_0214321 | |||
| 980 | Ga0395900_0217458 | |||
| 981 | Ga0395900_0227721 | |||
| 982 | Ga0395900_0795408 | |||
| 983 | Ga0395900_0827393 | |||
| 984 | Ga0395900_1091802 | |||
| 985 | Ga0395900_1136921 | |||
| 986 | Ga0395900_1197652 | |||
| 987 | Ga0395898_0057456 | |||
| 988 | Ga0395898_0123185 | |||
| 989 | Ga0395898_0261850 | |||
| 990 | Ga0395898_1181967 | |||
| 991 | Ga0395898_1357084 | |||
| 992 | Ga0395905_0000014 | |||
| 993 | Ga0395905_0000137 | |||
| 994 | Ga0395905_0009356 | |||
| 995 | Ga0395905_0100043 | |||
| 996 | Ga0395905_0147300 | |||
| 997 | Ga0395905_0180372 | |||
| 998 | Ga0395905_0303769 | |||
| 999 | Ga0395905_0353560 | |||
| 1000 | Ga0395901_0057848 | |||
| 1001 | Ga0395901_0083899 | |||
| 1002 | Ga0395901_0224936 | |||
| 1003 | Ga0436361_0108899 | |||
| 1004 | Ga0436361_0114800 | |||
| 1005 | Ga0436361_0487158 | |||
| 1006 | Ga0436361_0688328 | |||
| 1007 | Ga0439436_0020293 | |||
| 1008 | Ga0451851_0772830 | |||
| 1009 | Ga0439445_0107143 | |||
| 1010 | Ga0439448_0006541 | |||
| 1011 | Ga0439450_008689 | |||
| 1012 | Ga0439457_031350 | |||
| 1013 | Ga0450911_003679 | |||
| 1014 | Ga0450898_057944 | |||
| 1015 | Ga0450900_004838 | |||
| 1016 | Ga0466969_0048470 | |||
| 1017 | Ga0466969_0079797 | |||
| 1018 | Ga0466969_0170106 | |||
| 1019 | Ga0466972_0064916 | |||
| 1020 | Ga0466965_0003362 | |||
| 1021 | Ga0466966_0001804 | |||
| 1022 | Ga0466966_0142603 | |||
| 1023 | Ga0466966_0321960 | |||
| 1024 | Ga0466966_0357477 | |||
| 1025 | Ga0466961_0134300 | |||
| 1026 | Ga0466961_0166429 | |||
| 1027 | Ga0466961_0214824 | |||
| 1028 | Ga0466964_0001091 | |||
| 1029 | Ga0466964_0037609 | |||
| 1030 | Ga0466971_0029260 | |||
| 1031 | Ga0466971_0034133 | |||
| 1032 | Ga0466971_0079370 | |||
| 1033 | Ga0466968_0016377 | |||
| 1034 | Ga0466970_0003911 | |||
| 1035 | Ga0466970_0237559 | |||
| 1036 | Ga0466970_0388275 | |||
| 1037 | Ga0466957_0021820 | |||
| 1038 | Ga0466957_0046928 | |||
| 1039 | Ga0466957_0198331 | |||
| 1040 | Ga0466960_0105980 | |||
| 1041 | Ga0466959_0170750 | |||
| 1042 | Ga0451576_0260296 | |||
| 1043 | Ga0466958_0137609 | |||
| 1044 | Ga0466958_0376245 | |||
| 1045 | Ga0466967_0009867 | |||
| 1046 | Ga0466967_0397721 | |||
| 1047 | Ga0495617_000002 | |||
| 1048 | Ga0495627_000915 | |||
| 1049 | Ga0495627_002699 | |||
| 1050 | Ga0495592_0031364 | |||
| 1051 | Ga0495603_0009529 | |||
| 1052 | Ga0495603_0052336 | |||
| 1053 | Ga0495603_0065833 | |||
| 1054 | Ga0495590_0000061 | |||
| 1055 | Ga0495590_0003836 | |||
| 1056 | Ga0495590_0005278 | |||
| 1057 | Ga0495590_0007300 | |||
| 1058 | Ga0495590_0014839 | |||
| 1059 | Ga0495590_0022635 | |||
| 1060 | Ga0495591_000893 | |||
| 1061 | Ga0495591_019982 | |||
| 1062 | Ga0495629_0001114 | |||
| 1063 | Ga0495629_0006338 | |||
| 1064 | Ga0495629_0239464 | |||
| 1065 | Ga0495629_0245042 | |||
| 1066 | Ga0495638_0003750 | |||
| 1067 | Ga0495638_0083131 | |||
| 1068 | Ga0495638_0100151 | |||
| 1069 | Ga0495641_0038221 | |||
| 1070 | Ga0495641_0453179 | |||
| 1071 | Ga0495651_0005508 | |||
| 1072 | Ga0495651_0094042 | |||
| 1073 | Ga0495651_0139475 | |||
| 1074 | Ga0495653_0014614 | |||
| 1075 | Ga0495653_0032931 | |||
| 1076 | Ga0495653_0130417 | |||
| 1077 | Ga0495650_0005346 | |||
| 1078 | Ga0495650_0058861 | |||
| 1079 | Ga0495580_0001589 | |||
| 1080 | Ga0495580_0001825 | |||
| 1081 | Ga0495580_0007802 | |||
| 1082 | Ga0495580_0025409 | |||
| 1083 | Ga0495582_0012841 | |||
| 1084 | Ga0495582_0034143 | |||
| 1085 | Ga0495582_0373620 | |||
| 1086 | Ga0495605_0000276 | |||
| 1087 | Ga0495605_0000463 | |||
| 1088 | Ga0495605_0004948 | |||
| 1089 | Ga0495605_0009339 | |||
| 1090 | Ga0495605_0013900 | |||
| 1091 | Ga0495605_0045776 | |||
| 1092 | Ga0495605_0066113 | |||
| 1093 | Ga0495605_0110707 | |||
| 1094 | Ga0495605_0291116 | |||
| 1095 | Ga0495662_0014554 | |||
| 1096 | Ga0495664_0010156 | |||
| 1097 | Ga0495584_0000011 | |||
| 1098 | Ga0495584_0002588 | |||
| 1099 | Ga0495584_0003149 | |||
| 1100 | Ga0495584_0021406 | |||
| 1101 | Ga0495584_0042079 | |||
| 1102 | Ga0495584_0047462 | |||
| 1103 | Ga0495584_0174594 | |||
| 1104 | Ga0495584_0297986 | |||
| 1105 | Ga0495585_0000231 | |||
| 1106 | Ga0495585_0003484 | |||
| 1107 | Ga0495585_0004055 | |||
| 1108 | Ga0495585_0033732 | |||
| 1109 | Ga0495585_0279534 | |||
| 1110 | Ga0495594_0066322 | |||
| 1111 | Ga0495594_0187363 | |||
| 1112 | Ga0495594_0193293 | |||
| 1113 | Ga0495596_0003219 | |||
| 1114 | Ga0495596_0010600 | |||
| 1115 | Ga0495596_0051280 | |||
| 1116 | Ga0495596_0079219 | |||
| 1117 | Ga0495596_0095618 | |||
| 1118 | Ga0495596_0109931 | |||
| 1119 | Ga0495596_0122702 | |||
| 1120 | Ga0495607_0003527 | |||
| 1121 | Ga0495607_0004161 | |||
| 1122 | Ga0495607_0008583 | |||
| 1123 | Ga0495607_0022290 | |||
| 1124 | Ga0495607_0045420 | |||
| 1125 | Ga0495607_0063288 | |||
| 1126 | Ga0495607_0184582 | |||
| 1127 | Ga0495583_0000204 | |||
| 1128 | Ga0495583_0001332 | |||
| 1129 | Ga0495583_0001924 | |||
| 1130 | Ga0495583_0003312 | |||
| 1131 | Ga0495583_0006060 | |||
| 1132 | Ga0495583_0010695 | |||
| 1133 | Ga0495583_0015642 | |||
| 1134 | Ga0495583_0094737 | |||
| 1135 | Ga0495606_0023164 | |||
| 1136 | Ga0495606_0110012 | |||
| 1137 | Ga0495606_0123172 | |||
| 1138 | Ga0495606_0173384 | |||
| 1139 | Ga0495608_0004411 | |||
| 1140 | Ga0495608_0231575 | |||
| 1141 | Ga0495610_0000670 | |||
| 1142 | Ga0495610_0001832 | |||
| 1143 | Ga0495616_0015323 | |||
| 1144 | Ga0495616_0017237 | |||
| 1145 | Ga0495616_0023105 | |||
| 1146 | Ga0495616_0026767 | |||
| 1147 | Ga0495616_0050953 | |||
| 1148 | Ga0495616_0095298 | |||
| 1149 | Ga0495618_0031728 | |||
| 1150 | Ga0495618_0062857 | |||
| 1151 | Ga0495618_0312934 | |||
| 1152 | Ga0495620_0001084 | |||
| 1153 | Ga0495620_0045982 | |||
| 1154 | Ga0495628_0000887 | |||
| 1155 | Ga0495628_0258035 | |||
| 1156 | Ga0495628_0453132 | |||
| 1157 | Ga0495630_0008801 | |||
| 1158 | Ga0495630_0023428 | |||
| 1159 | Ga0495630_0058937 | |||
| 1160 | Ga0495630_0546183 | |||
| 1161 | Ga0495631_0009278 | |||
| 1162 | Ga0495631_0071888 | |||
| 1163 | Ga0495631_0332527 | |||
| 1164 | Ga0495632_0000559 | |||
| 1165 | Ga0495637_0001263 | |||
| 1166 | Ga0495637_0005121 | |||
| 1167 | Ga0495637_0075204 | |||
| 1168 | Ga0495637_0135530 | |||
| 1169 | Ga0495643_0002736 | |||
| 1170 | Ga0495643_0058583 | |||
| 1171 | Ga0495643_0122112 | |||
| 1172 | Ga0495643_0130970 | |||
| 1173 | Ga0495644_0028574 | |||
| 1174 | Ga0495644_0055886 | |||
| 1175 | Ga0495644_0060116 | |||
| 1176 | Ga0495644_0085687 | |||
| 1177 | Ga0495648_0001937 | |||
| 1178 | Ga0495648_0014897 | |||
| 1179 | Ga0495648_0028844 | |||
| 1180 | Ga0495648_0051359 | |||
| 1181 | Ga0495648_0086732 | |||
| 1182 | Ga0495648_0198688 | |||
| 1183 | Ga0495648_0231009 | |||
| 1184 | Ga0495648_0243777 | |||
| 1185 | Ga0495666_0000739 | |||
| 1186 | Ga0495666_0002291 | |||
| 1187 | Ga0495666_0008012 | |||
| 1188 | Ga0495666_0210364 | |||
| 1189 | Ga0495642_0000183 | |||
| 1190 | Ga0495642_0016949 | |||
| 1191 | Ga0495642_0242071 | |||
| 1192 | Ga0495652_0023852 | |||
| 1193 | Ga0495652_0338545 | |||
| 1194 | Ga0495654_0016355 | |||
| 1195 | Ga0495654_0033546 | |||
| 1196 | Ga0495665_0019967 | |||
| 1197 | Ga0495665_0035068 | |||
| 1198 | Ga0495665_0045144 | |||
| 1199 | Ga0495640_0007337 | |||
| 1200 | Ga0495640_0021147 | |||
| 1201 | Ga0495640_0201399 | |||
| 1202 | Ga0495586_0014970 | |||
| 1203 | Ga0495587_0013315 | |||
| 1204 | Ga0495587_0051523 | |||
| 1205 | Ga0495609_0021428 | |||
| 1206 | Ga0495609_0071018 | |||
| 1207 | Ga0495609_0072283 | |||
| 1208 | Ga0495609_0133006 | |||
| 1209 | Ga0495621_0049110 | |||
| 1210 | Ga0495597_0000413 | |||
| 1211 | Ga0495597_0000750 | |||
| 1212 | Ga0495597_0001696 | |||
| 1213 | Ga0495597_0002784 | |||
| 1214 | Ga0495597_0267172 | |||
| 1215 | Ga0495645_0000622 | |||
| 1216 | Ga0495622_0000589 | |||
| 1217 | Ga0495622_0023243 | |||
| 1218 | Ga0495633_0003294 | |||
| 1219 | Ga0495633_0004042 | |||
| 1220 | Ga0495633_0004541 | |||
| 1221 | Ga0495633_0015697 | |||
| 1222 | Ga0495633_0041829 | |||
| 1223 | Ga0495667_0209403 | |||
| 1224 | Ga0495656_0001009 | |||
| 1225 | Ga0495668_0000927 | |||
| 1226 | Ga0495668_0003809 | |||
| 1227 | Ga0495668_0127953 | |||
| 1228 | Ga0495668_0151385 | |||
| 1229 | Ga0495634_0005337 | |||
| 1230 | Ga0495634_0014334 | |||
| 1231 | Ga0495634_0171398 | |||
| 1232 | Ga0495634_0333601 | |||
| 1233 | Ga0495611_0056501 | |||
| 1234 | Ga0495611_0072181 | |||
| 1235 | Ga0495611_0411703 | |||
| 1236 | Ga0495625_0005512 | |||
| 1237 | Ga0495625_0047194 | |||
| 1238 | Ga0495635_0008126 | |||
| 1239 | Ga0495635_0015608 | |||
| 1240 | Ga0495659_0046943 | |||
| 1241 | Ga0495661_0001624 | |||
| 1242 | Ga0495661_0006198 | |||
| 1243 | Ga0495661_0010766 | |||
| 1244 | Ga0495661_0014047 | |||
| 1245 | Ga0495661_0022128 | |||
| 1246 | Ga0495661_0032612 | |||
| 1247 | Ga0495661_0089403 | |||
| 1248 | Ga0495661_0135824 | |||
| 1249 | Ga0495661_0192364 | |||
| 1250 | Ga0495661_0192957 | |||
| 1251 | Ga0495661_0263621 | |||
| 1252 | Ga0495588_0000070 | |||
| 1253 | Ga0495588_0014429 | |||
| 1254 | Ga0495588_0022714 | |||
| 1255 | Ga0495657_0182848 | |||
| 1256 | Ga0495599_0012678 | |||
| 1257 | Ga0495599_0046905 | |||
| 1258 | Ga0495599_0165547 | |||
| 1259 | Ga0495623_0000855 | |||
| 1260 | Ga0495623_0007019 | |||
| 1261 | Ga0495623_0028617 | |||
| 1262 | Ga0495646_0016813 | |||
| 1263 | Ga0495646_0017968 | |||
| 1264 | Ga0495646_0165873 | |||
| 1265 | Ga0495669_0020630 | |||
| 1266 | Ga0495669_0069390 | |||
| 1267 | Ga0495613_0010020 | |||
| 1268 | Ga0495613_0102101 | |||
| 1269 | Ga0495613_0276752 | |||
| 1270 | Ga0495613_0341811 | |||
| 1271 | Ga0495624_0011763 | |||
| 1272 | Ga0495624_0014170 | |||
| 1273 | Ga0495624_0110958 | |||
| 1274 | Ga0495624_0268155 | |||
| 1275 | Ga0495624_0513433 | |||
| 1276 | Ga0495670_0009767 | |||
| 1277 | Ga0495670_0019128 | |||
| 1278 | Ga0495670_0063760 | |||
| 1279 | Ga0495670_0151894 | |||
| 1280 | Ga0495670_0248803 | |||
| 1281 | Ga0495671_0000919 | |||
| 1282 | Ga0495671_0020352 | |||
| 1283 | Ga0495671_0027299 | |||
| 1284 | Ga0495671_0143050 | |||
| 1285 | Ga0495671_0260010 | |||
| 1286 | Ga0495671_0354017 | |||
| 1287 | Ga0495649_0000150 | |||
| 1288 | Ga0495649_0012060 | |||
| 1289 | Ga0495649_0020292 | |||
| 1290 | Ga0495649_0023212 | |||
| 1291 | Ga0495649_0024235 | |||
| 1292 | Ga0495649_0066575 | |||
| 1293 | Ga0495649_0161541 | |||
| 1294 | Ga0495589_0000175 | |||
| 1295 | Ga0495589_0002373 | |||
| 1296 | Ga0495589_0002609 | |||
| 1297 | Ga0495589_0028641 | |||
| 1298 | Ga0495589_0047415 | |||
| 1299 | Ga0495589_0141821 | |||
| 1300 | Ga0495589_0242741 | |||
| 1301 | Ga0495600_0154334 | |||
| 1302 | Ga0495600_0221500 | |||
| 1303 | Ga0495660_0000113 | |||
| 1304 | Ga0495660_0018484 | |||
| 1305 | Ga0495660_0041108 | |||
| 1306 | Ga0495660_0050022 | |||
| 1307 | Ga0495660_0100099 | |||
| 1308 | Ga0495660_0126156 | |||
| 1309 | Ga0495581_0010695 | |||
| 1310 | Ga0495581_0015553 | |||
| 1311 | Ga0495581_0158173 | |||
| 1312 | Ga0495604_0000937 | |||
| 1313 | Ga0495604_0019093 | |||
| 1314 | Ga0495604_0032359 | |||
| 1315 | Ga0495636_0008508 | |||
| 1316 | Ga0495674_0005690 | |||
| 1317 | Ga0495674_0080884 | |||
| 1318 | Ga0495674_0107723 | |||
| 1319 | Ga0495674_0486404 | |||
| 1320 | Ga0495672_0000802 | |||
| 1321 | Ga0495672_0008822 | |||
| 1322 | Ga0495672_0037556 | |||
| 1323 | Ga0495672_0072717 | |||
| 1324 | Ga0495672_0193511 | |||
| 1325 | Ga0495676_0014594 | |||
| 1326 | Ga0495676_0105672 | |||
| 1327 | Ga0495676_0227918 | |||
| 1328 | Ga0495676_0239909 | |||
| 1329 | Ga0495680_0008917 | |||
| 1330 | Ga0495680_0054198 | |||
| 1331 | Ga0495680_0121560 | |||
| 1332 | Ga0495680_0446847 | |||
| 1333 | Ga0495683_0000088 | |||
| 1334 | Ga0495683_0002367 | |||
| 1335 | Ga0495683_0004158 | |||
| 1336 | Ga0495683_0005945 | |||
| 1337 | Ga0495683_0044563 | |||
| 1338 | Ga0495683_0053159 | |||
| 1339 | Ga0495683_0059410 | |||
| 1340 | Ga0495683_0102018 | |||
| 1341 | Ga0495683_0209927 | |||
| 1342 | Ga0495687_001033 | |||
| 1343 | Ga0495687_003432 | |||
| 1344 | Ga0495687_003733 | |||
| 1345 | Ga0495687_004752 | |||
| 1346 | Ga0495687_018142 | |||
| 1347 | Ga0495687_031878 | |||
| 1348 | Ga0495687_044107 | |||
| 1349 | Ga0495687_069170 | |||
| 1350 | Ga0495675_0003264 | |||
| 1351 | Ga0495675_0063863 | |||
| 1352 | Ga0495675_0079046 | |||
| 1353 | Ga0495675_0115533 | |||
| 1354 | Ga0495677_0001895 | |||
| 1355 | Ga0495677_0003610 | |||
| 1356 | Ga0495677_0004003 | |||
| 1357 | Ga0495677_0005176 | |||
| 1358 | Ga0495677_0007072 | |||
| 1359 | Ga0495677_0012257 | |||
| 1360 | Ga0495677_0387710 | |||
| 1361 | Ga0495679_000044 | |||
| 1362 | Ga0495679_007739 | |||
| 1363 | Ga0495679_011151 | |||
| 1364 | Ga0495679_034360 | |||
| 1365 | Ga0495685_009748 | |||
| 1366 | Ga0495685_093958 | |||
| 1367 | Ga0495673_0002409 | |||
| 1368 | Ga0495681_0000736 | |||
| 1369 | Ga0495681_0001595 | |||
| 1370 | Ga0495681_0022036 | |||
| 1371 | Ga0495681_0027146 | |||
| 1372 | Ga0495681_0031098 | |||
| 1373 | Ga0495681_0119464 | |||
| 1374 | Ga0495681_0167372 | |||
| 1375 | Ga0495681_0170671 | |||
| 1376 | Ga0495684_0032818 | |||
| 1377 | Ga0495684_0269426 | |||
| 1378 | Ga0495686_0049890 | |||
| 1379 | Ga0495686_0275735 | |||
| 1380 | Ga0495593_0001133 | |||
| 1381 | Ga0495593_0004509 | |||
| 1382 | Ga0495593_0023169 | |||
| 1383 | Ga0495602_0010570 | |||
| 1384 | Ga0495602_0023055 | |||
| 1385 | Ga0495602_0050470 | |||
| 1386 | Ga0495602_0345828 | |||
| 1387 | Ga0495614_0004234 | |||
| 1388 | Ga0495614_0019117 | |||
| 1389 | Ga0495614_0023062 | |||
| 1390 | Ga0495614_0039931 | |||
| 1391 | Ga0495615_0024376 | |||
| 1392 | Ga0495626_0001606 | |||
| 1393 | Ga0495626_0003353 | |||
| 1394 | Ga0495626_0028196 | |||
| 1395 | Ga0495626_0058651 | |||
| 1396 | Ga0495626_0059131 | |||
| 1397 | Ga0495626_0075118 | |||
| 1398 | Ga0495626_0079822 | |||
| 1399 | Ga0495626_0102774 | |||
| 1400 | Ga0495626_0114332 | |||
| 1401 | Ga0495626_0121499 | |||
| 1402 | Ga0495626_0206026 | |||
| 1403 | Ga0496100_0049502 | |||
| 1404 | Ga0496100_0117790 | |||
| 1405 | Ga0496100_1431172 | |||
| 1406 | Ga0496101_0230288 | |||
| 1407 | Ga0496102_0067069 | |||
| 1408 | Ga0496102_0111252 | |||
| 1409 | Ga0496102_0455015 | |||
| 1410 | Ga0496102_0664578 | |||
| 1411 | Ga0496103_0009005 | |||
| 1412 | Ga0496103_0263592 | |||
| 1413 | Ga0496104_0115453 | |||
| 1414 | Ga0496104_0157529 | |||
| 1415 | Ga0496105_0137013 | |||
| 1416 | Ga0496105_0212094 | |||
| 1417 | Ga0496106_0362338 | |||
| 1418 | Ga0496107_0082026 | |||
| 1419 | Ga0496107_0216247 | |||
| 1420 | Ga0496107_0231432 | |||
| 1421 | Ga0496108_0347719 | |||
| 1422 | Ga0496108_0514458 | |||
| 1423 | Ga0496108_0522057 | |||
| 1424 | Ga0496109_0282889 | |||
| 1425 | Ga0496109_0290346 | |||
| 1426 | Ga0496109_0395044 | |||
| 1427 | Ga0496110_0000073 | |||
| 1428 | Ga0496110_0046195 | |||
| 1429 | Ga0496110_0146736 | |||
| 1430 | Ga0496111_0217851 | |||
| 1431 | Ga0496111_0237181 | |||
| 1432 | Ga0496111_0838359 | |||
| 1433 | Ga0496113_0268419 | |||
| 1434 | Ga0496113_0382140 | |||
| 1435 | Ga0496114_0395847 | |||
| 1436 | Ga0496114_0550457 | |||
| 1437 | Ga0496115_0887585 | |||
| 1438 | Ga0496115_1067077 | |||
| 1439 | Ga0496116_0032673 | |||
| 1440 | Ga0496116_0105816 | |||
| 1441 | Ga0496117_0004681 | |||
| 1442 | Ga0496117_0021618 | |||
| 1443 | Ga0496118_0001537 | |||
| 1444 | Ga0496118_0003702 | |||
| 1445 | Ga0496118_0024239 | |||
| 1446 | Ga0496121_0008010 | |||
| 1447 | Ga0496121_0047291 | |||
| 1448 | Ga0496122_0000080 | |||
| 1449 | Ga0496122_0016475 | |||
| 1450 | Ga0496122_0032257 | |||
| 1451 | Ga0496122_0276155 | |||
| 1452 | Ga0496123_0000072 | |||
| 1453 | Ga0496123_0013378 | |||
| 1454 | Ga0496123_0171469 | |||
| 1455 | Ga0496124_0021358 | |||
| 1456 | Ga0496124_0206783 | |||
| 1457 | Ga0496124_0239476 | |||
| 1458 | Ga0496125_0541174 | |||
| 1459 | Ga0496126_0001219 | |||
| 1460 | Ga0496126_0003161 | |||
| 1461 | Ga0496126_0003330 | |||
| 1462 | Ga0496126_0448868 | |||
| 1463 | Ga0501308_000534 | |||
| 1464 | Ga0495678_000603 | |||
| 1465 | Ga0495678_001473 | |||
| 1466 | Ga0495678_005875 | |||
| 1467 | Ga0495678_011517 | |||
| 1468 | Ga0495678_038116 | |||
| 1469 | Ga0495678_146146 | |||
| 1470 | Ga0495678_146655 | |||
| 1471 | Ga0495682_0000518 | |||
| 1472 | Ga0495682_0020284 | |||
| 1473 | Ga0495682_0087003 | |||
| 1474 | Ga0495682_0107931 | |||
| 1475 | Ga0501315_019818 | |||
| 1476 | Ga0501032_0136634 | |||
| 1477 | Ga0501034_0000273 | |||
| 1478 | Ga0501034_0609314 | |||
| 1479 | Ga0501036_0187645 | |||
| 1480 | Ga0501036_0294041 | |||
| 1481 | Ga0501036_0603858 | |||
| 1482 | Ga0501036_0820474 | |||
| 1483 | Ga0501040_0135086 | |||
| 1484 | Ga0501042_0046065 | |||
| 1485 | Ga0501048_0234369 | |||
| 1486 | Ga0501072_0296620 | |||
| 1487 | Ga0501074_0406957 | |||
| 1488 | Ga0501075_0268318 | |||
| 1489 | Ga0501079_0704658 | |||
| 1490 | Ga0501080_0873291 | |||
| 1491 | Ga0501035_0149489 | |||
| 1492 | Ga0501044_0279904 | |||
| 1493 | Ga0501045_0036966 | |||
| 1494 | nmdc:mga03683_113332_c1 | |||
| 1495 | nmdc:mga0k408_65731_c1 | |||
| 1496 | nmdc:mga06z11_43022_c1 | |||
| 1497 | nmdc:mga07m45_5482_c2 | |||
| 1498 | nmdc:mga07m45_54858_c1 | |||
| 1499 | Ga0495655_0052003 | |||
| 1500 | Ga0495595_0120696 | |||
| 1501 | Ga0500594_0080417 | |||
| 1502 | Ga0501084_0638414 | |||
| 1503 | Ga0587076_119841 | |||
| 1504 | Ga0466962_0161978 | |||
| 1505 | Ga0466962_0626255 | |||
| 1506 | 2509130259 | |||
| 1507 | 2510252220 | |||
| 1508 | 2512344857 | |||
| 1509 | 2514047472 | |||
| 1510 | 2515682631 | |||
| 1511 | 2521556694 | |||
| 1512 | 2527077836 | |||
| 1513 | 2563059625 | |||
| 1514 | 2600810480 | |||
| 1515 | 2643797591 | |||
| 1516 | 2644466528 | |||
| 1517 | 2644470627 | |||
| 1518 | 2713479429 | |||
| 1519 | 2719641315 | |||
| 1520 | 2738821787 | |||
| 1521 | 2738834269 | |||
| 1522 | 2738875473 | |||
| 1523 | 2739187426 | |||
| 1524 | 2739222071 | |||
| 1525 | 2739247828 | |||
| 1526 | 2746088507 | |||
| 1527 | 2746092546 | |||
| 1528 | 2765567876 | |||
| 1529 | 2792839521 | |||
| 1530 | 2819545322 | |||
| 1531 | 2819618060 | |||
| 1532 | 2819621999 | |||
| 1533 | 2839097837 | |||
| 1534 | 2842738633 | |||
| 1535 | 2842750133 | |||
| 1536 | 2885274028 | |||
| 1537 | 2900637464 | |||
| 1538 | 2902691081 | |||
| 1539 | 2904435452 | |||
| 1540 | 2904441923 | |||
| 1541 | 2904451124 | |||
| 1542 | 2904457978 | |||
| 1543 | 2904487747 | |||
| 1544 | 2904533220 | |||
| 1545 | 2904586167 | |||
| 1546 | 2904592019 | |||
| 1547 | 2904601819 | |||
| 1548 | 2904620546 | |||
| 1549 | 2919049465 | |||
| 1550 | 2919083854 | |||
| 1551 | 2919529052 | |||
| 1552 | 2928111219 | |||
| 1553 | 2928118831 | |||
| 1554 | 2928137244 | |||
| 1555 | 2928506048 | |||
| 1556 | 2945938021 | |||
| 1557 | 2945974402 | |||
| 1558 | 2990705263 | |||
| 1559 | 642424281 | |||
| 1560 | 642592227 | |||
| 1561 | 642622846 | |||
| 1562 | 8047678885 | |||
| 1563 | 8055267323 | |||
| 1564 | 8055301375 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3oow-assembly1.cif.gz_D | octameric structure of the phosphoribosylaminoimidazole carboxylase catalytic subunit from francisella tularensis subsp. tularensis schu s4. | 0.9808 | 13 | 162 |
| 4grd-assembly1.cif.gz_A | crystal structure of phosphoribosylaminoimidazole carboxylase catalytic subunit from burkholderia cenocepacia j2315 | 0.9803 | 6 | 172 |
| 3kuu-assembly1.cif.gz_A | structure of the pure phosphoribosylaminoimidazole carboxylase catalytic subunit from yersinia pestis | 0.973 | 11 | 162 |
| 1o4v-assembly1.cif.gz_A | crystal structure of the catalytic subunit of a phosphoribosylaminoimidazole mutase (tm0446) from thermotoga maritima at 1.77 a resolution | 0.9692 | 13 | 164 |
| 4grd-assembly1.cif.gz_A | crystal structure of phosphoribosylaminoimidazole carboxylase catalytic subunit from burkholderia cenocepacia j2315 | 0.9689 | 6 | 172 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9SJ42_1_162_3.40.50.1970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9723 | 19 | 162 | 3.40.50.1970 |
| af_Q2FZJ5_1_139_3.40.50.1970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9717 | 35 | 165 | 3.40.50.1970 |
| 2ywxA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9644 | 15 | 166 | 3.40.50.1970 |
| 5cvtB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9519 | 11 | 172 | 3.40.50.1970 |
| 3trhI00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.943 | 15 | 165 | 3.40.50.1970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U1DF56-F1-model_v4 | N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) | 0.9837 | 13 | 166 |
GO:0006189
GO:0034023 |
| AF-A0A100HTP6-F1-model_v4 | deleted | 0.9837 | 19 | 170 |
|
| AF-A0A2E2AQH0-F1-model_v4 | N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) | 0.9835 | 19 | 165 |
GO:0006189
GO:0034023 |
| AF-A0A6B1IQ45-F1-model_v4 | deleted | 0.9834 | 12 | 172 |
|
| AF-A0A3D4GCI0-F1-model_v4 | deleted | 0.9833 | 12 | 171 |
|