F480620

General Info

Members Datasets Scaffolds Average Seq Length
782 384 1564 80

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_1437416|Ga0373925_1437416_121_408
Length 95
Sequence VTVSILVKLDDMLYKRRMTLTELSERIGITLANLSVLKTGKARAIRFSTLDAICAALQCQPGDLLEFAPASLAASTEAASAPGHETETALCDQEK

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
131 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
132 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
211 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
212 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
213 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
214 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
215 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
216 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
217 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
218 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
219 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
220 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
221 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
222 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
223 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
224 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
225 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
228 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
229 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
230 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
231 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
233 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
234 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
236 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
237 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
240 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
241 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
242 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
243 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
244 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
245 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
246 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
247 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
248 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
249 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
250 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
251 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
252 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
253 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
254 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
255 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
256 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
257 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
258 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
259 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
260 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
261 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
262 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
263 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
264 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
265 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
266 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
267 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
268 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
269 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
270 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
271 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
272 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
273 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
274 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
275 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
276 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
277 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
278 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
279 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
280 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
281 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
282 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
291 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
292 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
293 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
294 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
295 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
296 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
297 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
298 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
309 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
310 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
311 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
312 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
313 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
314 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
315 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
316 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
317 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
318 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
319 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
320 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
321 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
322 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
323 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
324 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
325 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
326 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
327 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
328 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
329 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
330 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
331 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
332 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
333 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
334 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
335 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
336 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
337 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
338 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
339 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
340 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
341 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
342 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
343 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
344 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
345 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
346 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
347 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
348 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
349 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
350 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
351 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
352 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
353 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
356 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
357 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
358 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
359 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
360 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
361 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
362 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
363 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
364 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
365 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
366 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
367 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
368 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
369 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
370 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
371 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
372 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
373 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
374 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
375 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
376 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
377 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
378 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
379 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
380 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
381 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
382 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
383 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
384 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.22
Nodule 0
Rhizoplane 1.53
Rhizosphere 90.79
Stem 0
Stem Tuber 0
Unclassified 8.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_1437416 3300037068 Bacteria 565
2 JGI24736J21556_1052156 3300001904 Bacteria 630
3 JGI24747J21853_1012191 3300001978 Bacteria 876
4 JGI24739J22299_10048843 3300001989 Bacteria 1374
5 JGI24739J22299_10194073 3300001989 Bacteria 597
6 JGI24035J26624_1005731 3300002126 Bacteria 1191
7 JGI25406J46586_10069815 3300003203 Bacteria 1106
8 rootH2_10160658 3300003320 Bacteria 5083
9 rootL2_10070106 3300003322 Bacteria 1445
10 rootL2_10073661 3300003322 Bacteria 7556
11 rootL2_10091401 3300003322 Bacteria 5185
12 rootL2_10184100 3300003322 Bacteria 4327
13 rootH1_10105934 3300003323 Bacteria 15610
14 rootH1_10383511 3300003323 Bacteria 1710
15 Ga0006562J51391_1119555 3300003578 Bacteria 5890
16 Ga0006562J51391_1119556 3300003578 Bacteria 1533
17 Ga0055536_1006393 3300003781 Bacteria 5515
18 Ga0055530_10036705 3300003791 Bacteria 1231
19 Ga0055531_10029761 3300003794 Bacteria 1852
20 Ga0065712_10725522 3300005290 Bacteria 537
21 Ga0065715_10449225 3300005293 Unclassified 828
22 Ga0065707_11145933 3300005295 Bacteria 506
23 Ga0070658_10010053 3300005327 Bacteria 7599
24 Ga0070658_10030908 3300005327 Bacteria 4301
25 Ga0070658_10159387 3300005327 Bacteria 1893
26 Ga0070658_10521310 3300005327 Bacteria 1027
27 Ga0070658_10901181 3300005327 Bacteria 769
28 Ga0070658_11199205 3300005327 Bacteria 660
29 Ga0070676_10010398 3300005328 Bacteria 5048
30 Ga0070676_10061929 3300005328 Bacteria 2225
31 Ga0070676_10414761 3300005328 Bacteria 940
32 Ga0070683_100146345 3300005329 Bacteria 2239
33 Ga0070690_100143048 3300005330 Unclassified 1625
34 Ga0070670_100007844 3300005331 Bacteria 9082
35 Ga0070670_100014544 3300005331 Bacteria 6757
36 Ga0070677_10002785 3300005333 Bacteria 5598
37 Ga0070677_10151832 3300005333 Unclassified 1079
38 Ga0068869_100182584 3300005334 Bacteria 1645
39 Ga0068869_100250964 3300005334 Bacteria 1413
40 Ga0068869_100384877 3300005334 Bacteria 1150
41 Ga0068869_100710112 3300005334 Bacteria 858
42 Ga0070666_10000388 3300005335 Bacteria 27657
43 Ga0070666_10005249 3300005335 Bacteria 7936
44 Ga0070666_10160576 3300005335 Unclassified 1571
45 Ga0070680_100053130 3300005336 Bacteria 3307
46 Ga0070682_100953854 3300005337 Bacteria 709
47 Ga0068868_100018131 3300005338 Bacteria 5256
48 Ga0068868_100269493 3300005338 Bacteria 1438
49 Ga0068868_100348892 3300005338 Bacteria 1267
50 Ga0068868_100417975 3300005338 Bacteria 1160
51 Ga0070660_100116819 3300005339 Bacteria 2127
52 Ga0070660_100168453 3300005339 Bacteria 1768
53 Ga0070660_100188129 3300005339 Bacteria 1672
54 Ga0070660_100442553 3300005339 Bacteria 1078
55 Ga0070660_101360589 3300005339 Bacteria 603
56 Ga0070689_100032234 3300005340 Bacteria 3985
57 Ga0070689_100202779 3300005340 Bacteria 1620
58 Ga0070687_100313852 3300005343 Bacteria 999
59 Ga0070661_100002976 3300005344 Bacteria 11677
60 Ga0070661_100005691 3300005344 Bacteria 8587
61 Ga0070661_100108162 3300005344 Bacteria 2074
62 Ga0070661_100275393 3300005344 Bacteria 1304
63 Ga0070661_100601760 3300005344 Bacteria 889
64 Ga0070661_100678884 3300005344 Bacteria 838
65 Ga0070668_100016390 3300005347 Bacteria 5541
66 Ga0070668_100953672 3300005347 Bacteria 769
67 Ga0070668_101494269 3300005347 Bacteria 617
68 Ga0070669_100007475 3300005353 Bacteria 7828
69 Ga0070669_100077191 3300005353 Bacteria 2474
70 Ga0070669_100706011 3300005353 Bacteria 852
71 Ga0070669_101694824 3300005353 Bacteria 551
72 Ga0070675_100015430 3300005354 Bacteria 6039
73 Ga0070675_100040566 3300005354 Bacteria 3801
74 Ga0070675_100079115 3300005354 Bacteria 2739
75 Ga0070675_100340640 3300005354 Bacteria 1328
76 Ga0070671_100035411 3300005355 Bacteria 4136
77 Ga0070671_100102643 3300005355 Bacteria 2399
78 Ga0070671_101626043 3300005355 Bacteria 573
79 Ga0070674_100021041 3300005356 Bacteria 4181
80 Ga0070674_100522718 3300005356 Bacteria 992
81 Ga0070674_100531266 3300005356 Bacteria 984
82 Ga0070673_100234382 3300005364 Bacteria 1593
83 Ga0070673_100519402 3300005364 Bacteria 1079
84 Ga0070673_100552015 3300005364 Bacteria 1047
85 Ga0070673_100744826 3300005364 Bacteria 902
86 Ga0070673_101281039 3300005364 Bacteria 688
87 Ga0070688_100047056 3300005365 Bacteria 2674
88 Ga0070688_100088207 3300005365 Bacteria 2022
89 Ga0070659_100066587 3300005366 Bacteria 2854
90 Ga0070659_100343086 3300005366 Bacteria 1252
91 Ga0070659_100480995 3300005366 Bacteria 1057
92 Ga0070659_101133068 3300005366 Bacteria 690
93 Ga0070667_100034883 3300005367 Bacteria 4212
94 Ga0070667_100397497 3300005367 Bacteria 1254
95 Ga0070667_101946813 3300005367 Bacteria 554
96 Ga0070714_101093563 3300005435 Bacteria 777
97 Ga0070713_100340293 3300005436 Bacteria 1390
98 Ga0070701_10056419 3300005438 Bacteria 2055
99 Ga0070711_100048957 3300005439 Bacteria 2893
100 Ga0070700_100137718 3300005441 Bacteria 1655
101 Ga0070700_100749855 3300005441 Bacteria 781
102 Ga0070700_101021707 3300005441 Bacteria 681
103 Ga0070694_100542464 3300005444 Bacteria 930
104 Ga0070708_100007994 3300005445 Bacteria 8472
105 Ga0070708_100556570 3300005445 Bacteria 1082
106 Ga0070663_100265701 3300005455 Bacteria 1362
107 Ga0070663_101560047 3300005455 Bacteria 588
108 Ga0070678_100012385 3300005456 Bacteria 5297
109 Ga0070678_100670259 3300005456 Bacteria 932
110 Ga0070662_100040247 3300005457 Bacteria 3327
111 Ga0070662_101488481 3300005457 Bacteria 584
112 Ga0070662_102000758 3300005457 Bacteria 501
113 Ga0070681_10013929 3300005458 Bacteria 8001
114 Ga0070681_10019453 3300005458 Bacteria 6797
115 Ga0068867_100016610 3300005459 Bacteria 5227
116 Ga0068867_100067192 3300005459 Bacteria 2672
117 Ga0068867_100130323 3300005459 Bacteria 1953
118 Ga0070685_10394697 3300005466 Bacteria 957
119 Ga0070706_100130225 3300005467 Bacteria 2348
120 Ga0070707_100276737 3300005468 Bacteria 1632
121 Ga0070698_100057454 3300005471 Bacteria 3937
122 Ga0070698_100106360 3300005471 Bacteria 2775
123 Ga0070698_100666886 3300005471 Bacteria 981
124 Ga0070698_100842955 3300005471 Bacteria 861
125 Ga0070699_100808819 3300005518 Bacteria 858
126 Ga0070679_100008268 3300005530 Bacteria 9788
127 Ga0070679_100008928 3300005530 Bacteria 9457
128 Ga0070679_100084368 3300005530 Bacteria 3165
129 Ga0070679_100213471 3300005530 Bacteria 1893
130 Ga0070679_100656327 3300005530 Bacteria 992
131 Ga0070679_100720910 3300005530 Bacteria 940
132 Ga0070679_102127708 3300005530 Bacteria 511
133 Ga0070684_100095266 3300005535 Unclassified 2652
134 Ga0070684_100178542 3300005535 Bacteria 1930
135 Ga0070684_100543603 3300005535 Bacteria 1078
136 Ga0070684_100771932 3300005535 Bacteria 898
137 Ga0070697_100502780 3300005536 Bacteria 1060
138 Ga0070697_101155573 3300005536 Unclassified 690
139 Ga0068853_100019875 3300005539 Bacteria 5579
140 Ga0068853_100162420 3300005539 Bacteria 2017
141 Ga0068853_101168231 3300005539 Bacteria 743
142 Ga0068853_101299531 3300005539 Bacteria 703
143 Ga0070672_100017344 3300005543 Bacteria 5179
144 Ga0070672_100043660 3300005543 Bacteria 3458
145 Ga0070672_100240776 3300005543 Bacteria 1521
146 Ga0070672_100513187 3300005543 Bacteria 1038
147 Ga0070686_101877681 3300005544 Bacteria 511
148 Ga0070695_101625235 3300005545 Bacteria 540
149 Ga0070696_100040310 3300005546 Bacteria 3225
150 Ga0070696_101290577 3300005546 Bacteria 619
151 Ga0070696_101478602 3300005546 Unclassified 581
152 Ga0070696_101773459 3300005546 Bacteria 533
153 Ga0070693_100960539 3300005547 Bacteria 644
154 Ga0070665_100000177 3300005548 Bacteria 113201
155 Ga0070665_100335899 3300005548 Bacteria 1515
156 Ga0070665_100546294 3300005548 Bacteria 1171
157 Ga0070665_100920963 3300005548 Bacteria 887
158 Ga0070704_102163481 3300005549 Bacteria 517
159 Ga0068855_100014514 3300005563 Bacteria 9488
160 Ga0068855_100043739 3300005563 Bacteria 5303
161 Ga0068855_100724191 3300005563 Bacteria 1063
162 Ga0070664_100010339 3300005564 Bacteria 7571
163 Ga0070664_100036054 3300005564 Bacteria 4154
164 Ga0070664_101376567 3300005564 Bacteria 667
165 Ga0070664_101384068 3300005564 Bacteria 665
166 Ga0070664_101543241 3300005564 Bacteria 629
167 Ga0068857_100025106 3300005577 Bacteria 5249
168 Ga0068857_100026776 3300005577 Bacteria 5084
169 Ga0068857_100768169 3300005577 Bacteria 919
170 Ga0068854_100194027 3300005578 Bacteria 1593
171 Ga0068854_100250679 3300005578 Bacteria 1413
172 Ga0068854_101181698 3300005578 Bacteria 685
173 Ga0068856_100858403 3300005614 Bacteria 927
174 Ga0070702_100261172 3300005615 Bacteria 1179
175 Ga0070702_100713622 3300005615 Bacteria 766
176 Ga0070702_100804902 3300005615 Bacteria 727
177 Ga0068852_100032090 3300005616 Bacteria 4344
178 Ga0068852_101351117 3300005616 Bacteria 734
179 Ga0068852_101791592 3300005616 Bacteria 636
180 Ga0068852_101898609 3300005616 Bacteria 618
181 Ga0068852_102332195 3300005616 Bacteria 556
182 Ga0068859_100021389 3300005617 Bacteria 6493
183 Ga0068859_100090103 3300005617 Bacteria 3117
184 Ga0068859_100128919 3300005617 Bacteria 2600
185 Ga0068859_100447557 3300005617 Bacteria 1388
186 Ga0068859_102018840 3300005617 Bacteria 637
187 Ga0068859_102571272 3300005617 Bacteria 560
188 Ga0068864_100372874 3300005618 Bacteria 1351
189 Ga0068864_100382497 3300005618 Bacteria 1334
190 Ga0068864_100533065 3300005618 Unclassified 1133
191 Ga0068864_100610376 3300005618 Bacteria 1059
192 Ga0068864_101197152 3300005618 Bacteria 758
193 Ga0068866_10280367 3300005718 Bacteria 1032
194 Ga0068861_100029019 3300005719 Bacteria 4042
195 Ga0068861_100072938 3300005719 Bacteria 2665
196 Ga0068861_100430022 3300005719 Bacteria 1178
197 Ga0068851_10001553 3300005834 Bacteria 10061
198 Ga0068851_10184408 3300005834 Unclassified 1157
199 Ga0068851_10205708 3300005834 Bacteria 1100
200 Ga0068870_10011808 3300005840 Bacteria 4063
201 Ga0068870_10073800 3300005840 Bacteria 1867
202 Ga0068863_100043823 3300005841 Bacteria 4248
203 Ga0068863_100386789 3300005841 Bacteria 1366
204 Ga0068863_100555063 3300005841 Bacteria 1134
205 Ga0068863_100573618 3300005841 Bacteria 1115
206 Ga0068863_101153254 3300005841 Bacteria 780
207 Ga0068863_102707564 3300005841 Bacteria 504
208 Ga0068858_100548365 3300005842 Unclassified 1119
209 Ga0068858_100773715 3300005842 Bacteria 936
210 Ga0068858_101863209 3300005842 Bacteria 594
211 Ga0068860_100193418 3300005843 Bacteria 1969
212 Ga0068860_100208759 3300005843 Bacteria 1894
213 Ga0068860_100425815 3300005843 Bacteria 1316
214 Ga0068860_100845949 3300005843 Bacteria 929
215 Ga0068860_102153611 3300005843 Bacteria 579
216 Ga0068862_100142400 3300005844 Bacteria 2129
217 Ga0068862_100309311 3300005844 Bacteria 1456
218 Ga0068862_101111238 3300005844 Unclassified 786
219 Ga0081539_10012496 3300005985 Bacteria 6537
220 Ga0070717_11225474 3300006028 Unclassified 683
221 Ga0070715_10488034 3300006163 Bacteria 703
222 Ga0070716_101145553 3300006173 Bacteria 622
223 Ga0070712_100161126 3300006175 Bacteria 1732
224 Ga0070712_100403729 3300006175 Bacteria 1129
225 Ga0070712_101931974 3300006175 Unclassified 517
226 Ga0075366_10577930 3300006195 Bacteria 696
227 Ga0097621_100020405 3300006237 Bacteria 5105
228 Ga0097621_101780000 3300006237 Bacteria 587
229 Ga0068871_100194110 3300006358 Bacteria 1750
230 Ga0068871_100311048 3300006358 Bacteria 1385
231 Ga0068871_102390497 3300006358 Bacteria 504
232 Ga0075428_100113448 3300006844 Bacteria 2952
233 Ga0075430_100854207 3300006846 Bacteria 750
234 Ga0075429_100011858 3300006880 Bacteria 7558
235 Ga0075429_101955628 3300006880 Bacteria 508
236 Ga0068865_100241297 3300006881 Bacteria 1422
237 Ga0068865_100448457 3300006881 Bacteria 1066
238 Ga0068865_101036649 3300006881 Bacteria 720
239 Ga0097620_100021389 3300006931 Bacteria 6493
240 Ga0097620_100090099 3300006931 Bacteria 3117
241 Ga0097620_100128925 3300006931 Bacteria 2600
242 Ga0097620_100447609 3300006931 Bacteria 1388
243 Ga0097620_102572182 3300006931 Bacteria 560
244 Ga0105240_10029957 3300009093 Bacteria 7080
245 Ga0105240_10190937 3300009093 Bacteria 2409
246 Ga0105240_11210355 3300009093 Unclassified 799
247 Ga0105240_12104156 3300009093 Unclassified 586
248 Ga0111539_10050233 3300009094 Bacteria 4968
249 Ga0111539_10094115 3300009094 Bacteria 3520
250 Ga0111539_10852178 3300009094 Bacteria 1060
251 Ga0105245_10022565 3300009098 Bacteria 5525
252 Ga0105245_10252924 3300009098 Bacteria 1712
253 Ga0105245_11561666 3300009098 Bacteria 711
254 Ga0105245_11594150 3300009098 Unclassified 704
255 Ga0105245_12273977 3300009098 Bacteria 596
256 Ga0105247_10157761 3300009101 Bacteria 1500
257 Ga0105247_10918100 3300009101 Bacteria 677
258 Ga0105247_11559078 3300009101 Unclassified 541
259 Ga0105247_11801490 3300009101 Bacteria 509
260 Ga0114129_10363833 3300009147 Bacteria 1913
261 Ga0114129_11842004 3300009147 Bacteria 735
262 Ga0105243_12433106 3300009148 Bacteria 562
263 Ga0105242_10159824 3300009176 Bacteria 1971
264 Ga0105242_10259574 3300009176 Bacteria 1569
265 Ga0105248_10030382 3300009177 Bacteria 6032
266 Ga0105248_10066217 3300009177 Bacteria 4057
267 Ga0105248_10729908 3300009177 Bacteria 1118
268 Ga0105248_11317800 3300009177 Bacteria 817
269 Ga0105237_11490998 3300009545 Bacteria 683
270 Ga0105237_11991015 3300009545 Bacteria 589
271 Ga0105237_12708781 3300009545 Bacteria 507
272 Ga0105238_10104954 3300009551 Bacteria 2807
273 Ga0105238_10290479 3300009551 Bacteria 1617
274 Ga0105249_10003625 3300009553 Bacteria 13351
275 Ga0105249_10170520 3300009553 Bacteria 2110
276 Ga0105249_11103879 3300009553 Bacteria 863
277 Ga0105239_10037431 3300010375 Bacteria 5319
278 Ga0105239_10435582 3300010375 Bacteria 1486
279 Ga0105239_10496396 3300010375 Bacteria 1387
280 Ga0105239_10568164 3300010375 Bacteria 1292
281 Ga0105246_10445516 3300011119 Unclassified 1087
282 Ga0105246_10567661 3300011119 Bacteria 975
283 Ga0105246_11557809 3300011119 Bacteria 623
284 Ga0157373_10012335 3300013100 Bacteria 6283
285 Ga0157373_10016427 3300013100 Bacteria 5400
286 Ga0157373_10023871 3300013100 Bacteria 4431
287 Ga0157373_10042879 3300013100 Bacteria 3232
288 Ga0157373_10652699 3300013100 Bacteria 768
289 Ga0157371_10013650 3300013102 Bacteria 6164
290 Ga0157370_10012080 3300013104 Bacteria 8987
291 Ga0157370_10014613 3300013104 Bacteria 8022
292 Ga0157370_10062872 3300013104 Bacteria 3519
293 Ga0157369_10017322 3300013105 Bacteria 8099
294 Ga0157369_11622486 3300013105 Bacteria 657
295 Ga0157374_10138601 3300013296 Bacteria 2360
296 Ga0157374_10201392 3300013296 Bacteria 1949
297 Ga0157374_10628085 3300013296 Bacteria 1085
298 Ga0157378_10377083 3300013297 Bacteria 1392
299 Ga0157378_10477006 3300013297 Bacteria 1242
300 Ga0157378_10664884 3300013297 Bacteria 1058
301 Ga0157378_11529829 3300013297 Bacteria 712
302 Ga0163162_10134062 3300013306 Bacteria 2587
303 Ga0163162_11273815 3300013306 Bacteria 835
304 Ga0163162_12224738 3300013306 Bacteria 630
305 Ga0157372_10017454 3300013307 Bacteria 7705
306 Ga0157372_10492078 3300013307 Bacteria 1430
307 Ga0157372_11194517 3300013307 Bacteria 879
308 Ga0157372_11200813 3300013307 Bacteria 876
309 Ga0157375_10013745 3300013308 Bacteria 7216
310 Ga0157375_10088173 3300013308 Bacteria 3157
311 Ga0157375_10129028 3300013308 Bacteria 2647
312 Ga0157375_10596135 3300013308 Bacteria 1264
313 Ga0157375_10682173 3300013308 Bacteria 1182
314 Ga0157375_11819765 3300013308 Bacteria 722
315 Ga0163163_10009985 3300014325 Bacteria 8511
316 Ga0163163_11235720 3300014325 Bacteria 810
317 Ga0163163_12222336 3300014325 Unclassified 608
318 Ga0157380_10034947 3300014326 Bacteria 3879
319 Ga0157380_11169494 3300014326 Bacteria 811
320 Ga0157380_13237887 3300014326 Bacteria 520
321 Ga0182008_10014455 3300014497 Unclassified 4133
322 Ga0182008_10907935 3300014497 Unclassified 519
323 Ga0157377_10647784 3300014745 Bacteria 760
324 Ga0157379_10583845 3300014968 Unclassified 1042
325 Ga0157379_11079198 3300014968 Bacteria 768
326 Ga0157379_11240199 3300014968 Bacteria 718
327 Ga0157376_10214649 3300014969 Unclassified 1778
328 Ga0157376_11093024 3300014969 Unclassified 823
329 Ga0157376_12017935 3300014969 Bacteria 615
330 Ga0157376_12847837 3300014969 Bacteria 523
331 Ga0163161_10093594 3300017792 Bacteria 2227
332 Ga0213874_10216528 3300021377 Bacteria 694
333 Ga0213876_10004842 3300021384 Bacteria 7465
334 Ga0213876_10554949 3300021384 Unclassified 611
335 Ga0209436_100591 3300025208 Bacteria 15534
336 Ga0209130_1005113 3300025284 Bacteria 4672
337 Ga0209676_1000115 3300025292 Bacteria 205183
338 Ga0209050_1004487 3300025298 Bacteria 9396
339 Ga0207426_1000250 3300025302 Bacteria 117492
340 Ga0209257_1000005 3300025304 Bacteria 1592528
341 Ga0209257_1000090 3300025304 Bacteria 274746
342 Ga0209257_1069912 3300025304 Bacteria 928
343 Ga0207697_10062671 3300025315 Bacteria 1549
344 Ga0207697_10316523 3300025315 Bacteria 693
345 Ga0207656_10036331 3300025321 Bacteria 2067
346 Ga0207656_10117704 3300025321 Unclassified 1234
347 Ga0207696_1035889 3300025711 Bacteria 1473
348 Ga0207713_1030908 3300025735 Bacteria 2377
349 Ga0207682_10005081 3300025893 Bacteria 5391
350 Ga0207682_10279690 3300025893 Bacteria 780
351 Ga0207692_10233387 3300025898 Unclassified 1096
352 Ga0207692_10243665 3300025898 Bacteria 1074
353 Ga0207642_10142711 3300025899 Bacteria 1265
354 Ga0207710_10201828 3300025900 Bacteria 982
355 Ga0207710_10685502 3300025900 Unclassified 537
356 Ga0207688_10124271 3300025901 Bacteria 1508
357 Ga0207680_10000227 3300025903 Bacteria 27167
358 Ga0207680_10198240 3300025903 Bacteria 1367
359 Ga0207680_10941264 3300025903 Bacteria 619
360 Ga0207647_10008681 3300025904 Bacteria 7259
361 Ga0207685_10125684 3300025905 Bacteria 1132
362 Ga0207645_10010784 3300025907 Bacteria 6266
363 Ga0207645_10178830 3300025907 Bacteria 1391
364 Ga0207645_10328983 3300025907 Bacteria 1020
365 Ga0207643_10211443 3300025908 Bacteria 1184
366 Ga0207705_10003074 3300025909 Bacteria 12725
367 Ga0207705_10093884 3300025909 Bacteria 2200
368 Ga0207705_10223742 3300025909 Bacteria 1430
369 Ga0207705_10289774 3300025909 Bacteria 1254
370 Ga0207705_10484386 3300025909 Bacteria 960
371 Ga0207705_11275934 3300025909 Bacteria 562
372 Ga0207684_10039058 3300025910 Bacteria 4028
373 Ga0207684_10239548 3300025910 Bacteria 1565
374 Ga0207707_10013978 3300025912 Bacteria 6999
375 Ga0207695_10241589 3300025913 Bacteria 1707
376 Ga0207695_10552910 3300025913 Bacteria 1033
377 Ga0207671_10545019 3300025914 Bacteria 925
378 Ga0207693_10051226 3300025915 Bacteria 3240
379 Ga0207663_10155575 3300025916 Bacteria 1608
380 Ga0207663_11557363 3300025916 Bacteria 532
381 Ga0207660_10193448 3300025917 Bacteria 1585
382 Ga0207660_10533355 3300025917 Unclassified 954
383 Ga0207662_10355237 3300025918 Bacteria 985
384 Ga0207662_10553977 3300025918 Unclassified 796
385 Ga0207662_10739076 3300025918 Bacteria 691
386 Ga0207662_11371141 3300025918 Unclassified 502
387 Ga0207657_10040675 3300025919 Bacteria 4117
388 Ga0207657_10092704 3300025919 Bacteria 2517
389 Ga0207657_10142104 3300025919 Unclassified 1961
390 Ga0207657_10339567 3300025919 Bacteria 1185
391 Ga0207649_10082851 3300025920 Unclassified 2081
392 Ga0207649_10659789 3300025920 Bacteria 809
393 Ga0207652_10613757 3300025921 Bacteria 975
394 Ga0207652_11886901 3300025921 Bacteria 503
395 Ga0207681_10014242 3300025923 Bacteria 4937
396 Ga0207681_10096066 3300025923 Bacteria 2127
397 Ga0207681_10804635 3300025923 Bacteria 785
398 Ga0207681_11343244 3300025923 Bacteria 600
399 Ga0207694_10383256 3300025924 Bacteria 1167
400 Ga0207650_10020128 3300025925 Bacteria 4701
401 Ga0207650_10035826 3300025925 Bacteria 3606
402 Ga0207650_10110115 3300025925 Unclassified 2131
403 Ga0207650_10563878 3300025925 Bacteria 955
404 Ga0207659_10027515 3300025926 Bacteria 3851
405 Ga0207659_10061946 3300025926 Bacteria 2699
406 Ga0207659_10299967 3300025926 Bacteria 1319
407 Ga0207687_10009501 3300025927 Bacteria 6360
408 Ga0207687_10471931 3300025927 Bacteria 1043
409 Ga0207687_11547132 3300025927 Bacteria 569
410 Ga0207700_10849582 3300025928 Bacteria 817
411 Ga0207700_10913738 3300025928 Bacteria 786
412 Ga0207664_11128272 3300025929 Bacteria 700
413 Ga0207644_10019062 3300025931 Bacteria 4649
414 Ga0207644_10440092 3300025931 Bacteria 1070
415 Ga0207644_11573722 3300025931 Bacteria 551
416 Ga0207690_10066972 3300025932 Bacteria 2462
417 Ga0207690_10120461 3300025932 Bacteria 1905
418 Ga0207706_10120564 3300025933 Bacteria 2306
419 Ga0207686_10094263 3300025934 Unclassified 1984
420 Ga0207686_10580891 3300025934 Bacteria 879
421 Ga0207670_10135581 3300025936 Bacteria 1809
422 Ga0207670_10351922 3300025936 Bacteria 1167
423 Ga0207670_10391126 3300025936 Bacteria 1110
424 Ga0207669_10074303 3300025937 Bacteria 2149
425 Ga0207669_11903602 3300025937 Bacteria 508
426 Ga0207704_10235882 3300025938 Bacteria 1363
427 Ga0207691_10005468 3300025940 Bacteria 12263
428 Ga0207691_10025812 3300025940 Bacteria 5513
429 Ga0207691_10408237 3300025940 Bacteria 1158
430 Ga0207711_10228124 3300025941 Bacteria 1705
431 Ga0207711_10512926 3300025941 Bacteria 1118
432 Ga0207711_10950352 3300025941 Bacteria 798
433 Ga0207689_10087967 3300025942 Bacteria 2552
434 Ga0207689_10180912 3300025942 Bacteria 1739
435 Ga0207689_10662438 3300025942 Bacteria 880
436 Ga0207689_10822918 3300025942 Bacteria 784
437 Ga0207661_10028540 3300025944 Unclassified 4274
438 Ga0207661_10101708 3300025944 Bacteria 2415
439 Ga0207679_10002235 3300025945 Bacteria 11964
440 Ga0207679_10024575 3300025945 Bacteria 4132
441 Ga0207667_10037886 3300025949 Bacteria 5152
442 Ga0207667_10336464 3300025949 Bacteria 1541
443 Ga0207651_10002810 3300025960 Bacteria 8372
444 Ga0207651_10070960 3300025960 Bacteria 2467
445 Ga0207651_10442961 3300025960 Bacteria 1113
446 Ga0207651_10547644 3300025960 Bacteria 1006
447 Ga0207651_10553483 3300025960 Bacteria 1001
448 Ga0207651_10972556 3300025960 Bacteria 758
449 Ga0207712_10175655 3300025961 Bacteria 1678
450 Ga0207668_10421096 3300025972 Bacteria 1133
451 Ga0207668_10898433 3300025972 Bacteria 788
452 Ga0207668_11140859 3300025972 Bacteria 699
453 Ga0207640_10546922 3300025981 Bacteria 972
454 Ga0207658_10307905 3300025986 Bacteria 1367
455 Ga0207658_10928093 3300025986 Bacteria 793
456 Ga0207658_11504786 3300025986 Bacteria 616
457 Ga0207658_11813046 3300025986 Bacteria 556
458 Ga0207658_11960268 3300025986 Bacteria 533
459 Ga0207677_10019474 3300026023 Bacteria 4098
460 Ga0207677_12308061 3300026023 Bacteria 501
461 Ga0207703_10091401 3300026035 Bacteria 2560
462 Ga0207639_10316618 3300026041 Bacteria 1384
463 Ga0207678_10085767 3300026067 Bacteria 2691
464 Ga0207708_10213897 3300026075 Bacteria 1542
465 Ga0207708_11001623 3300026075 Bacteria 726
466 Ga0207702_11043188 3300026078 Bacteria 811
467 Ga0207641_10115119 3300026088 Bacteria 2390
468 Ga0207641_10336755 3300026088 Bacteria 1435
469 Ga0207641_10406308 3300026088 Unclassified 1308
470 Ga0207641_10858299 3300026088 Bacteria 900
471 Ga0207648_10004895 3300026089 Bacteria 13651
472 Ga0207648_10084074 3300026089 Bacteria 2776
473 Ga0207648_10088136 3300026089 Bacteria 2710
474 Ga0207648_10487089 3300026089 Bacteria 1127
475 Ga0207676_10325585 3300026095 Bacteria 1412
476 Ga0207676_10482354 3300026095 Unclassified 1174
477 Ga0207676_11090255 3300026095 Bacteria 789
478 Ga0207676_11479470 3300026095 Bacteria 676
479 Ga0207676_12163251 3300026095 Bacteria 555
480 Ga0207674_10001732 3300026116 Bacteria 27879
481 Ga0207674_10031936 3300026116 Bacteria 5527
482 Ga0207675_100045591 3300026118 Bacteria 4096
483 Ga0207675_100059402 3300026118 Bacteria 3568
484 Ga0207675_100099289 3300026118 Bacteria 2742
485 Ga0207683_10058507 3300026121 Bacteria 3384
486 Ga0207683_10232456 3300026121 Bacteria 1682
487 Ga0207698_10246540 3300026142 Bacteria 1632
488 Ga0207698_10453810 3300026142 Bacteria 1238
489 Ga0207698_11197878 3300026142 Bacteria 773
490 Ga0207698_12001786 3300026142 Bacteria 593
491 Ga0209967_1052926 3300027364 Bacteria 625
492 Ga0209995_1002705 3300027471 Bacteria 2811
493 Ga0209999_1007476 3300027543 Bacteria 1968
494 Ga0209971_1040406 3300027682 Unclassified 1122
495 Ga0209998_10002536 3300027717 Bacteria 4158
496 Ga0209974_10003157 3300027876 Bacteria 5965
497 Ga0207428_10554248 3300027907 Bacteria 831
498 Ga0268266_10015888 3300028379 Bacteria 6442
499 Ga0268266_10467418 3300028379 Bacteria 1201
500 Ga0268266_10725958 3300028379 Bacteria 958
501 Ga0268266_10781781 3300028379 Bacteria 922
502 Ga0268266_10860166 3300028379 Bacteria 876
503 Ga0268265_10180581 3300028380 Bacteria 1813
504 Ga0268265_10392743 3300028380 Bacteria 1280
505 Ga0268265_10923291 3300028380 Unclassified 858
506 Ga0268265_11210242 3300028380 Bacteria 753
507 Ga0268264_10019038 3300028381 Bacteria 5613
508 Ga0268264_10394342 3300028381 Bacteria 1329
509 Ga0265338_10151853 3300028800 Bacteria 1799
510 Ga0307511_10000884 3300030521 Bacteria 31692
511 Ga0316183_1007432 3300030742 Bacteria 4241
512 Ga0316182_1130225 3300030745 Bacteria 2711
513 Ga0265330_10163408 3300031235 Bacteria 945
514 Ga0265316_10337394 3300031344 Bacteria 1093
515 Ga0307408_100026639 3300031548 Bacteria 3974
516 Ga0307408_100399732 3300031548 Bacteria 1179
517 Ga0307408_100447984 3300031548 Unclassified 1119
518 Ga0307408_100478895 3300031548 Bacteria 1085
519 Ga0307405_10008856 3300031731 Bacteria 5130
520 Ga0307405_10027639 3300031731 Bacteria 3292
521 Ga0307405_10062459 3300031731 Bacteria 2359
522 Ga0307405_10146378 3300031731 Bacteria 1655
523 Ga0307405_10615295 3300031731 Bacteria 888
524 Ga0307405_10849367 3300031731 Bacteria 768
525 Ga0307405_10929832 3300031731 Bacteria 737
526 Ga0307413_10122289 3300031824 Bacteria 1765
527 Ga0307413_10264522 3300031824 Bacteria 1284
528 Ga0307413_10327888 3300031824 Bacteria 1172
529 Ga0307413_10346732 3300031824 Bacteria 1144
530 Ga0307413_10616073 3300031824 Bacteria 890
531 Ga0307413_10831296 3300031824 Bacteria 779
532 Ga0307410_10022387 3300031852 Bacteria 3905
533 Ga0307410_10112313 3300031852 Unclassified 1973
534 Ga0307410_10170829 3300031852 Bacteria 1638
535 Ga0307410_10317415 3300031852 Bacteria 1235
536 Ga0307410_10761245 3300031852 Bacteria 821
537 Ga0307410_11396949 3300031852 Bacteria 614
538 Ga0307410_11818460 3300031852 Bacteria 541
539 Ga0307406_10007743 3300031901 Bacteria 5968
540 Ga0307406_10034662 3300031901 Bacteria 3098
541 Ga0307406_10092728 3300031901 Bacteria 2037
542 Ga0307406_10232739 3300031901 Bacteria 1377
543 Ga0307406_10289554 3300031901 Bacteria 1253
544 Ga0307406_10430318 3300031901 Bacteria 1054
545 Ga0307406_10745876 3300031901 Bacteria 821
546 Ga0307407_10017774 3300031903 Bacteria 3578
547 Ga0307407_10196823 3300031903 Bacteria 1347
548 Ga0307407_10345067 3300031903 Bacteria 1053
549 Ga0307412_10005721 3300031911 Bacteria 6989
550 Ga0307412_10016709 3300031911 Bacteria 4377
551 Ga0307412_10354522 3300031911 Bacteria 1179
552 Ga0307409_100007252 3300031995 Bacteria 6612
553 Ga0307409_100389195 3300031995 Bacteria 1328
554 Ga0307409_100488427 3300031995 Bacteria 1196
555 Ga0307416_100036010 3300032002 Bacteria 3789
556 Ga0307416_100265469 3300032002 Bacteria 1681
557 Ga0307416_100373631 3300032002 Bacteria 1453
558 Ga0307416_100504941 3300032002 Bacteria 1274
559 Ga0307416_102067088 3300032002 Bacteria 672
560 Ga0307416_102172566 3300032002 Bacteria 656
561 Ga0307414_10112017 3300032004 Bacteria 2079
562 Ga0307414_10239449 3300032004 Bacteria 1501
563 Ga0307414_10480812 3300032004 Bacteria 1095
564 Ga0307414_10558806 3300032004 Bacteria 1021
565 Ga0307414_10698481 3300032004 Bacteria 918
566 Ga0307414_10746344 3300032004 Bacteria 889
567 Ga0307414_11431496 3300032004 Bacteria 642
568 Ga0307411_10049752 3300032005 Bacteria 2726
569 Ga0307411_10053137 3300032005 Bacteria 2652
570 Ga0307411_10102130 3300032005 Bacteria 2031
571 Ga0307411_10131052 3300032005 Bacteria 1832
572 Ga0307411_10147754 3300032005 Bacteria 1742
573 Ga0307411_10186597 3300032005 Bacteria 1579
574 Ga0307411_10839768 3300032005 Bacteria 812
575 Ga0307411_12198582 3300032005 Bacteria 517
576 Ga0307415_100087442 3300032126 Bacteria 2245
577 Ga0307415_100273286 3300032126 Bacteria 1385
578 Ga0307415_100514123 3300032126 Bacteria 1050
579 Ga0307415_101091614 3300032126 Bacteria 746
580 Ga0307415_102141735 3300032126 Bacteria 546
581 Ga0307510_10003850 3300033180 Bacteria 17591
582 Ga0373926_0020391 3300035083 Bacteria 2290
583 Ga0373956_0187113 3300035119 Bacteria 980
584 Ga0373935_1369273 3300035692 Unclassified 529
585 Ga0373927_0004162 3300035695 Bacteria 10167
586 Ga0373927_0016917 3300035695 Bacteria 4807
587 Ga0373927_0389482 3300035695 Bacteria 919
588 Ga0373933_0087586 3300035724 Unclassified 1918
589 Ga0373933_0512951 3300035724 Bacteria 786
590 Ga0373933_1073774 3300035724 Bacteria 530
591 Ga0373937_0254397 3300036401 Bacteria 1656
592 Ga0373925_0190524 3300037068 Bacteria 1627
593 Ga0373925_0212833 3300037068 Unclassified 1540
594 Ga0373925_0415112 3300037068 Bacteria 1099
595 Ga0373925_1113007 3300037068 Bacteria 650
596 Ga0395899_0147933 3300037312 Unclassified 1666
597 Ga0395899_0753232 3300037312 Bacteria 606
598 Ga0395900_0153111 3300037418 Unclassified 2355
599 Ga0395900_0318787 3300037418 Bacteria 1535
600 Ga0395900_0532935 3300037418 Bacteria 1121
601 Ga0395900_0869441 3300037418 Bacteria 826
602 Ga0395900_0959049 3300037418 Bacteria 776
603 Ga0395900_1629729 3300037418 Bacteria 556
604 Ga0395898_0041822 3300037466 Plasmid 4524
605 Ga0395898_0172669 3300037466 Bacteria 2066
606 Ga0395898_1562404 3300037466 Bacteria 585
607 Ga0395905_0053030 3300037471 Plasmid 3796
608 Ga0395905_0242760 3300037471 Bacteria 1683
609 Ga0395905_0267775 3300037471 Bacteria 1594
610 Ga0395905_0459661 3300037471 Bacteria 1171
611 Ga0395905_0990870 3300037471 Bacteria 743
612 Ga0436364_1035450 3300037853 Bacteria 678
613 Ga0395901_0019192 3300038443 Bacteria 6989
614 Ga0395901_0363744 3300038443 Bacteria 1491
615 Ga0237819_04260 3300038705 Bacteria 2376
616 Ga0436365_0064527 3300039437 Bacteria 32229
617 Ga0436365_0176077 3300039437 Unclassified 712
618 Ga0436365_0723875 3300039437 Bacteria 733
619 Ga0436363_0849015 3300039450 Bacteria 1116
620 Ga0439466_0279620 3300041411 Bacteria 506
621 Ga0451789_0891629 3300041443 Bacteria 1054
622 Ga0451791_0779858 3300041451 Bacteria 510
623 Ga0451804_0479665 3300041463 Bacteria 909
624 Ga0451807_0589435 3300041486 Unclassified 1588
625 Ga0451837_1865023 3300041494 Unclassified 546
626 Ga0451853_0008946 3300041512 Bacteria 1510
627 Ga0439448_0053507 3300042005 Bacteria 1325
628 Ga0439455_0052303 3300042012 Bacteria 1069
629 Ga0450890_088189 3300042127 Bacteria 512
630 Ga0439446_0021586 3300042156 Bacteria 1821
631 Ga0439458_0094916 3300042157 Bacteria 770
632 Ga0451577_0009474 3300042876 Bacteria 9374
633 Ga0451577_0725838 3300042876 Bacteria 899
634 Ga0453683_0165836 3300044673 Bacteria 1398
635 Ga0453683_0186899 3300044673 Bacteria 1314
636 Ga0453684_0000167 3300044712 Bacteria 290200
637 Ga0453684_0000284 3300044712 Bacteria 218640
638 Ga0451576_0950625 3300045051 Bacteria 901
639 Ga0466967_0312984 3300045976 Bacteria 1513
640 Ga0495629_0606387 3300046459 Bacteria 732
641 Ga0495580_0029698 3300046472 Bacteria 3966
642 Ga0495594_0025607 3300046499 Bacteria 3171
643 Ga0495643_0000307 3300046522 Bacteria 67608
644 Ga0495644_0387208 3300046523 Bacteria 553
645 Ga0495648_0000039 3300046524 Bacteria 185430
646 Ga0495663_0000501 3300046525 Bacteria 14104
647 Ga0495663_0002001 3300046525 Bacteria 6266
648 Ga0495665_0076666 3300046531 Bacteria 1760
649 Ga0495640_0298038 3300046533 Bacteria 1002
650 Ga0495586_0343417 3300046535 Bacteria 857
651 Ga0495597_0301781 3300046542 Bacteria 621
652 Ga0495668_0017551 3300046616 Bacteria 4148
653 Ga0495634_0207852 3300046642 Bacteria 1213
654 Ga0495625_0025028 3300046660 Bacteria 4532
655 Ga0495625_0124009 3300046660 Bacteria 1755
656 Ga0495669_0287095 3300046684 Bacteria 792
657 Ga0495613_0260187 3300046689 Bacteria 1209
658 Ga0495671_0148001 3300046692 Bacteria 1143
659 Ga0495671_0584912 3300046692 Bacteria 531
660 Ga0495581_0322362 3300047315 Bacteria 903
661 Ga0495672_0000006 3300047320 Bacteria 589807
662 Ga0495683_0133256 3300047323 Bacteria 1170
663 Ga0495673_0000148 3300047469 Bacteria 124135
664 Ga0495602_0571599 3300048088 Bacteria 781
665 Ga0496100_0246866 3300048903 Bacteria 1319
666 Ga0496104_0041190 3300048907 Bacteria 4330
667 Ga0496106_0110493 3300048909 Bacteria 2140
668 Ga0496109_1150370 3300048912 Bacteria 713
669 Ga0496113_1288444 3300048916 Bacteria 569
670 Ga0496114_0031627 3300048917 Bacteria 4353
671 Ga0496114_0869569 3300048917 Bacteria 782
672 Ga0496115_0182934 3300048918 Bacteria 1732
673 Ga0496122_0006171 3300048925 Bacteria 13933
674 Ga0496123_0001218 3300048926 Bacteria 37586
675 Ga0496124_0298596 3300048927 Bacteria 1165
676 Ga0496124_0650463 3300048927 Bacteria 677
677 Ga0496126_0900073 3300048929 Bacteria 671
678 Ga0501292_111648 3300049515 Unclassified 551
679 Ga0501294_049719 3300049517 Unclassified 535
680 Ga0501298_012219 3300049521 Bacteria 1503
681 Ga0501300_068771 3300049523 Unclassified 570
682 Ga0501032_0126934 3300049569 Bacteria 1685
683 Ga0501033_0153770 3300049570 Bacteria 1658
684 Ga0501034_0514414 3300049571 Bacteria 1109
685 Ga0501038_0130853 3300049574 Bacteria 2061
686 Ga0501039_0541071 3300049575 Bacteria 914
687 Ga0501041_0953380 3300049577 Bacteria 552
688 Ga0501042_0654553 3300049578 Bacteria 764
689 Ga0501043_0254836 3300049579 Bacteria 1351
690 Ga0501043_0406205 3300049579 Bacteria 1028
691 Ga0501046_0024430 3300049580 Bacteria 4958
692 Ga0501047_0046092 3300049581 Bacteria 4214
693 Ga0501047_0320744 3300049581 Bacteria 1389
694 Ga0501070_1551826 3300049586 Bacteria 500
695 Ga0501073_0354632 3300049589 Bacteria 1013
696 Ga0501073_0496053 3300049589 Bacteria 844
697 Ga0501198_012182 3300049649 Unclassified 1290
698 Ga0501202_000394 3300049652 Bacteria 6087
699 Ga0501206_022968 3300049653 Unclassified 897
700 Ga0501208_006031 3300049655 Unclassified 1523
701 Ga0501216_000093 3300049660 Bacteria 8536
702 Ga0501223_023705 3300049663 Unclassified 1196
703 Ga0501224_000292 3300049664 Bacteria 5787
704 Ga0501227_009937 3300049665 Bacteria 2058
705 Ga0501228_003485 3300049666 Unclassified 1299
706 Ga0501233_000355 3300049668 Bacteria 7160
707 Ga0501235_002165 3300049669 Bacteria 4215
708 Ga0501236_004539 3300049670 Unclassified 1650
709 Ga0501239_085233 3300049672 Unclassified 513
710 Ga0501240_003855 3300049673 Bacteria 1704
711 Ga0501242_001847 3300049674 Bacteria 2177
712 Ga0501243_000433 3300049675 Bacteria 5555
713 Ga0501247_002240 3300049677 Bacteria 1992
714 Ga0501249_000835 3300049679 Bacteria 6807
715 Ga0501251_021274 3300049681 Unclassified 863
716 Ga0501252_001093 3300049682 Bacteria 2400
717 Ga0501256_001858 3300049685 Unclassified 1618
718 Ga0501257_007726 3300049686 Bacteria 2405
719 Ga0501259_001036 3300049688 Bacteria 4628
720 Ga0501260_001647 3300049689 Bacteria 1857
721 Ga0501261_000819 3300049690 Bacteria 3885
722 Ga0501219_008694 3300049703 Unclassified 745
723 Ga0501221_000083 3300049704 Bacteria 10820
724 Ga0501225_0002327 3300049705 Bacteria 5861
725 Ga0501229_004951 3300049706 Bacteria 1626
726 Ga0501234_000699 3300049707 Bacteria 5178
727 Ga0501079_0813125 3300049741 Bacteria 736
728 Ga0501080_0007302 3300049742 Bacteria 9967
729 Ga0501080_0099106 3300049742 Bacteria 2704
730 Ga0501081_0266617 3300049743 Bacteria 1252
731 Ga0501083_0008004 3300049744 Bacteria 7486
732 Ga0501083_0493963 3300049744 Bacteria 797
733 Ga0501262_001325 3300049759 Bacteria 2769
734 Ga0501263_000868 3300049760 Bacteria 2591
735 Ga0501266_000368 3300049763 Bacteria 6009
736 Ga0501268_000039 3300049765 Bacteria 10915
737 Ga0501268_159978 3300049765 Bacteria 525
738 Ga0501270_000589 3300049767 Bacteria 3148
739 Ga0501270_108704 3300049767 Bacteria 589
740 Ga0501271_014589 3300049768 Unclassified 871
741 Ga0501274_001615 3300049771 Bacteria 1728
742 Ga0501275_003412 3300049772 Bacteria 1463
743 Ga0501279_000426 3300049775 Bacteria 5569
744 Ga0501035_0575139 3300049822 Bacteria 920
745 Ga0501044_0095748 3300049823 Bacteria 2991
746 Ga0501044_0290252 3300049823 Bacteria 1567
747 Ga0501204_016960 3300049850 Unclassified 919
748 Ga0501212_001054 3300049851 Bacteria 2994
749 nmdc:mga0k408_18214_c1 3300050493 Bacteria 3918
750 nmdc:mga07m45_169690_c1 3300050496 Bacteria 1268
751 nmdc:mga09592_7127_c1 3300050508 Bacteria 9089
752 nmdc:mga0qj67_1240879_c1 3300050509 Bacteria 579
753 nmdc:mga0qj67_2521_c1 3300050509 Bacteria 13087
754 nmdc:mga0qj67_560003_c1 3300050509 Bacteria 916
755 nmdc:mga06r32_1943755_c1 3300050510 Bacteria 522
756 nmdc:mga06r32_233401_c1 3300050510 Bacteria 1828
757 nmdc:mga08y16_1232046_c1 3300050511 Bacteria 718
758 nmdc:mga08y16_1348903_c1 3300050511 Bacteria 678
759 nmdc:mga08x19_523597_c1 3300050514 Bacteria 838
760 Ga0495619_0198291 3300053085 Bacteria 1390
761 Ga0500643_049529 3300053087 Bacteria 1204
762 Ga0500644_0000368 3300053088 Bacteria 22094
763 Ga0500651_0006283 3300053093 Bacteria 6833
764 Ga0500650_0025842 3300053098 Bacteria 2629
765 Ga0500556_0000222 3300053104 Bacteria 45971
766 Ga0500562_017365 3300053108 Bacteria 1855
767 Ga0500597_337681 3300053120 Bacteria 590
768 Ga0500642_0000011 3300053130 Bacteria 215963
769 Ga0500658_0394216 3300053134 Bacteria 634
770 Ga0500564_000200 3300053138 Bacteria 16311
771 Ga0500568_0032237 3300053139 Bacteria 2156
772 Ga0500577_0100378 3300053142 Bacteria 1182
773 Ga0500588_0192502 3300053146 Bacteria 753
774 Ga0500616_0001825 3300053153 Bacteria 19303
775 Ga0500620_024372 3300053155 Bacteria 1847
776 Ga0500627_0428287 3300053158 Bacteria 560
777 Ga0500645_003390 3300053730 Bacteria 6508
778 Ga0500645_221190 3300053730 Bacteria 507
779 Ga0500609_057780 3300053731 Bacteria 541
780 Ga0501084_0627408 3300054114 Bacteria 908
781 Ga0501082_0002676 3300060353 Bacteria 15565
782 Ga0501082_1636570 3300060353 Bacteria 562
783 Ga0373925_1437416
784 JGI24736J21556_1052156
785 JGI24747J21853_1012191
786 JGI24739J22299_10048843
787 JGI24739J22299_10194073
788 JGI24035J26624_1005731
789 JGI25406J46586_10069815
790 rootH2_10160658
791 rootL2_10070106
792 rootL2_10073661
793 rootL2_10091401
794 rootL2_10184100
795 rootH1_10105934
796 rootH1_10383511
797 Ga0006562J51391_1119555
798 Ga0006562J51391_1119556
799 Ga0055536_1006393
800 Ga0055530_10036705
801 Ga0055531_10029761
802 Ga0065712_10725522
803 Ga0065715_10449225
804 Ga0065707_11145933
805 Ga0070658_10010053
806 Ga0070658_10030908
807 Ga0070658_10159387
808 Ga0070658_10521310
809 Ga0070658_10901181
810 Ga0070658_11199205
811 Ga0070676_10010398
812 Ga0070676_10061929
813 Ga0070676_10414761
814 Ga0070683_100146345
815 Ga0070690_100143048
816 Ga0070670_100007844
817 Ga0070670_100014544
818 Ga0070677_10002785
819 Ga0070677_10151832
820 Ga0068869_100182584
821 Ga0068869_100250964
822 Ga0068869_100384877
823 Ga0068869_100710112
824 Ga0070666_10000388
825 Ga0070666_10005249
826 Ga0070666_10160576
827 Ga0070680_100053130
828 Ga0070682_100953854
829 Ga0068868_100018131
830 Ga0068868_100269493
831 Ga0068868_100348892
832 Ga0068868_100417975
833 Ga0070660_100116819
834 Ga0070660_100168453
835 Ga0070660_100188129
836 Ga0070660_100442553
837 Ga0070660_101360589
838 Ga0070689_100032234
839 Ga0070689_100202779
840 Ga0070687_100313852
841 Ga0070661_100002976
842 Ga0070661_100005691
843 Ga0070661_100108162
844 Ga0070661_100275393
845 Ga0070661_100601760
846 Ga0070661_100678884
847 Ga0070668_100016390
848 Ga0070668_100953672
849 Ga0070668_101494269
850 Ga0070669_100007475
851 Ga0070669_100077191
852 Ga0070669_100706011
853 Ga0070669_101694824
854 Ga0070675_100015430
855 Ga0070675_100040566
856 Ga0070675_100079115
857 Ga0070675_100340640
858 Ga0070671_100035411
859 Ga0070671_100102643
860 Ga0070671_101626043
861 Ga0070674_100021041
862 Ga0070674_100522718
863 Ga0070674_100531266
864 Ga0070673_100234382
865 Ga0070673_100519402
866 Ga0070673_100552015
867 Ga0070673_100744826
868 Ga0070673_101281039
869 Ga0070688_100047056
870 Ga0070688_100088207
871 Ga0070659_100066587
872 Ga0070659_100343086
873 Ga0070659_100480995
874 Ga0070659_101133068
875 Ga0070667_100034883
876 Ga0070667_100397497
877 Ga0070667_101946813
878 Ga0070714_101093563
879 Ga0070713_100340293
880 Ga0070701_10056419
881 Ga0070711_100048957
882 Ga0070700_100137718
883 Ga0070700_100749855
884 Ga0070700_101021707
885 Ga0070694_100542464
886 Ga0070708_100007994
887 Ga0070708_100556570
888 Ga0070663_100265701
889 Ga0070663_101560047
890 Ga0070678_100012385
891 Ga0070678_100670259
892 Ga0070662_100040247
893 Ga0070662_101488481
894 Ga0070662_102000758
895 Ga0070681_10013929
896 Ga0070681_10019453
897 Ga0068867_100016610
898 Ga0068867_100067192
899 Ga0068867_100130323
900 Ga0070685_10394697
901 Ga0070706_100130225
902 Ga0070707_100276737
903 Ga0070698_100057454
904 Ga0070698_100106360
905 Ga0070698_100666886
906 Ga0070698_100842955
907 Ga0070699_100808819
908 Ga0070679_100008268
909 Ga0070679_100008928
910 Ga0070679_100084368
911 Ga0070679_100213471
912 Ga0070679_100656327
913 Ga0070679_100720910
914 Ga0070679_102127708
915 Ga0070684_100095266
916 Ga0070684_100178542
917 Ga0070684_100543603
918 Ga0070684_100771932
919 Ga0070697_100502780
920 Ga0070697_101155573
921 Ga0068853_100019875
922 Ga0068853_100162420
923 Ga0068853_101168231
924 Ga0068853_101299531
925 Ga0070672_100017344
926 Ga0070672_100043660
927 Ga0070672_100240776
928 Ga0070672_100513187
929 Ga0070686_101877681
930 Ga0070695_101625235
931 Ga0070696_100040310
932 Ga0070696_101290577
933 Ga0070696_101478602
934 Ga0070696_101773459
935 Ga0070693_100960539
936 Ga0070665_100000177
937 Ga0070665_100335899
938 Ga0070665_100546294
939 Ga0070665_100920963
940 Ga0070704_102163481
941 Ga0068855_100014514
942 Ga0068855_100043739
943 Ga0068855_100724191
944 Ga0070664_100010339
945 Ga0070664_100036054
946 Ga0070664_101376567
947 Ga0070664_101384068
948 Ga0070664_101543241
949 Ga0068857_100025106
950 Ga0068857_100026776
951 Ga0068857_100768169
952 Ga0068854_100194027
953 Ga0068854_100250679
954 Ga0068854_101181698
955 Ga0068856_100858403
956 Ga0070702_100261172
957 Ga0070702_100713622
958 Ga0070702_100804902
959 Ga0068852_100032090
960 Ga0068852_101351117
961 Ga0068852_101791592
962 Ga0068852_101898609
963 Ga0068852_102332195
964 Ga0068859_100021389
965 Ga0068859_100090103
966 Ga0068859_100128919
967 Ga0068859_100447557
968 Ga0068859_102018840
969 Ga0068859_102571272
970 Ga0068864_100372874
971 Ga0068864_100382497
972 Ga0068864_100533065
973 Ga0068864_100610376
974 Ga0068864_101197152
975 Ga0068866_10280367
976 Ga0068861_100029019
977 Ga0068861_100072938
978 Ga0068861_100430022
979 Ga0068851_10001553
980 Ga0068851_10184408
981 Ga0068851_10205708
982 Ga0068870_10011808
983 Ga0068870_10073800
984 Ga0068863_100043823
985 Ga0068863_100386789
986 Ga0068863_100555063
987 Ga0068863_100573618
988 Ga0068863_101153254
989 Ga0068863_102707564
990 Ga0068858_100548365
991 Ga0068858_100773715
992 Ga0068858_101863209
993 Ga0068860_100193418
994 Ga0068860_100208759
995 Ga0068860_100425815
996 Ga0068860_100845949
997 Ga0068860_102153611
998 Ga0068862_100142400
999 Ga0068862_100309311
1000 Ga0068862_101111238
1001 Ga0081539_10012496
1002 Ga0070717_11225474
1003 Ga0070715_10488034
1004 Ga0070716_101145553
1005 Ga0070712_100161126
1006 Ga0070712_100403729
1007 Ga0070712_101931974
1008 Ga0075366_10577930
1009 Ga0097621_100020405
1010 Ga0097621_101780000
1011 Ga0068871_100194110
1012 Ga0068871_100311048
1013 Ga0068871_102390497
1014 Ga0075428_100113448
1015 Ga0075430_100854207
1016 Ga0075429_100011858
1017 Ga0075429_101955628
1018 Ga0068865_100241297
1019 Ga0068865_100448457
1020 Ga0068865_101036649
1021 Ga0097620_100021389
1022 Ga0097620_100090099
1023 Ga0097620_100128925
1024 Ga0097620_100447609
1025 Ga0097620_102572182
1026 Ga0105240_10029957
1027 Ga0105240_10190937
1028 Ga0105240_11210355
1029 Ga0105240_12104156
1030 Ga0111539_10050233
1031 Ga0111539_10094115
1032 Ga0111539_10852178
1033 Ga0105245_10022565
1034 Ga0105245_10252924
1035 Ga0105245_11561666
1036 Ga0105245_11594150
1037 Ga0105245_12273977
1038 Ga0105247_10157761
1039 Ga0105247_10918100
1040 Ga0105247_11559078
1041 Ga0105247_11801490
1042 Ga0114129_10363833
1043 Ga0114129_11842004
1044 Ga0105243_12433106
1045 Ga0105242_10159824
1046 Ga0105242_10259574
1047 Ga0105248_10030382
1048 Ga0105248_10066217
1049 Ga0105248_10729908
1050 Ga0105248_11317800
1051 Ga0105237_11490998
1052 Ga0105237_11991015
1053 Ga0105237_12708781
1054 Ga0105238_10104954
1055 Ga0105238_10290479
1056 Ga0105249_10003625
1057 Ga0105249_10170520
1058 Ga0105249_11103879
1059 Ga0105239_10037431
1060 Ga0105239_10435582
1061 Ga0105239_10496396
1062 Ga0105239_10568164
1063 Ga0105246_10445516
1064 Ga0105246_10567661
1065 Ga0105246_11557809
1066 Ga0157373_10012335
1067 Ga0157373_10016427
1068 Ga0157373_10023871
1069 Ga0157373_10042879
1070 Ga0157373_10652699
1071 Ga0157371_10013650
1072 Ga0157370_10012080
1073 Ga0157370_10014613
1074 Ga0157370_10062872
1075 Ga0157369_10017322
1076 Ga0157369_11622486
1077 Ga0157374_10138601
1078 Ga0157374_10201392
1079 Ga0157374_10628085
1080 Ga0157378_10377083
1081 Ga0157378_10477006
1082 Ga0157378_10664884
1083 Ga0157378_11529829
1084 Ga0163162_10134062
1085 Ga0163162_11273815
1086 Ga0163162_12224738
1087 Ga0157372_10017454
1088 Ga0157372_10492078
1089 Ga0157372_11194517
1090 Ga0157372_11200813
1091 Ga0157375_10013745
1092 Ga0157375_10088173
1093 Ga0157375_10129028
1094 Ga0157375_10596135
1095 Ga0157375_10682173
1096 Ga0157375_11819765
1097 Ga0163163_10009985
1098 Ga0163163_11235720
1099 Ga0163163_12222336
1100 Ga0157380_10034947
1101 Ga0157380_11169494
1102 Ga0157380_13237887
1103 Ga0182008_10014455
1104 Ga0182008_10907935
1105 Ga0157377_10647784
1106 Ga0157379_10583845
1107 Ga0157379_11079198
1108 Ga0157379_11240199
1109 Ga0157376_10214649
1110 Ga0157376_11093024
1111 Ga0157376_12017935
1112 Ga0157376_12847837
1113 Ga0163161_10093594
1114 Ga0213874_10216528
1115 Ga0213876_10004842
1116 Ga0213876_10554949
1117 Ga0209436_100591
1118 Ga0209130_1005113
1119 Ga0209676_1000115
1120 Ga0209050_1004487
1121 Ga0207426_1000250
1122 Ga0209257_1000005
1123 Ga0209257_1000090
1124 Ga0209257_1069912
1125 Ga0207697_10062671
1126 Ga0207697_10316523
1127 Ga0207656_10036331
1128 Ga0207656_10117704
1129 Ga0207696_1035889
1130 Ga0207713_1030908
1131 Ga0207682_10005081
1132 Ga0207682_10279690
1133 Ga0207692_10233387
1134 Ga0207692_10243665
1135 Ga0207642_10142711
1136 Ga0207710_10201828
1137 Ga0207710_10685502
1138 Ga0207688_10124271
1139 Ga0207680_10000227
1140 Ga0207680_10198240
1141 Ga0207680_10941264
1142 Ga0207647_10008681
1143 Ga0207685_10125684
1144 Ga0207645_10010784
1145 Ga0207645_10178830
1146 Ga0207645_10328983
1147 Ga0207643_10211443
1148 Ga0207705_10003074
1149 Ga0207705_10093884
1150 Ga0207705_10223742
1151 Ga0207705_10289774
1152 Ga0207705_10484386
1153 Ga0207705_11275934
1154 Ga0207684_10039058
1155 Ga0207684_10239548
1156 Ga0207707_10013978
1157 Ga0207695_10241589
1158 Ga0207695_10552910
1159 Ga0207671_10545019
1160 Ga0207693_10051226
1161 Ga0207663_10155575
1162 Ga0207663_11557363
1163 Ga0207660_10193448
1164 Ga0207660_10533355
1165 Ga0207662_10355237
1166 Ga0207662_10553977
1167 Ga0207662_10739076
1168 Ga0207662_11371141
1169 Ga0207657_10040675
1170 Ga0207657_10092704
1171 Ga0207657_10142104
1172 Ga0207657_10339567
1173 Ga0207649_10082851
1174 Ga0207649_10659789
1175 Ga0207652_10613757
1176 Ga0207652_11886901
1177 Ga0207681_10014242
1178 Ga0207681_10096066
1179 Ga0207681_10804635
1180 Ga0207681_11343244
1181 Ga0207694_10383256
1182 Ga0207650_10020128
1183 Ga0207650_10035826
1184 Ga0207650_10110115
1185 Ga0207650_10563878
1186 Ga0207659_10027515
1187 Ga0207659_10061946
1188 Ga0207659_10299967
1189 Ga0207687_10009501
1190 Ga0207687_10471931
1191 Ga0207687_11547132
1192 Ga0207700_10849582
1193 Ga0207700_10913738
1194 Ga0207664_11128272
1195 Ga0207644_10019062
1196 Ga0207644_10440092
1197 Ga0207644_11573722
1198 Ga0207690_10066972
1199 Ga0207690_10120461
1200 Ga0207706_10120564
1201 Ga0207686_10094263
1202 Ga0207686_10580891
1203 Ga0207670_10135581
1204 Ga0207670_10351922
1205 Ga0207670_10391126
1206 Ga0207669_10074303
1207 Ga0207669_11903602
1208 Ga0207704_10235882
1209 Ga0207691_10005468
1210 Ga0207691_10025812
1211 Ga0207691_10408237
1212 Ga0207711_10228124
1213 Ga0207711_10512926
1214 Ga0207711_10950352
1215 Ga0207689_10087967
1216 Ga0207689_10180912
1217 Ga0207689_10662438
1218 Ga0207689_10822918
1219 Ga0207661_10028540
1220 Ga0207661_10101708
1221 Ga0207679_10002235
1222 Ga0207679_10024575
1223 Ga0207667_10037886
1224 Ga0207667_10336464
1225 Ga0207651_10002810
1226 Ga0207651_10070960
1227 Ga0207651_10442961
1228 Ga0207651_10547644
1229 Ga0207651_10553483
1230 Ga0207651_10972556
1231 Ga0207712_10175655
1232 Ga0207668_10421096
1233 Ga0207668_10898433
1234 Ga0207668_11140859
1235 Ga0207640_10546922
1236 Ga0207658_10307905
1237 Ga0207658_10928093
1238 Ga0207658_11504786
1239 Ga0207658_11813046
1240 Ga0207658_11960268
1241 Ga0207677_10019474
1242 Ga0207677_12308061
1243 Ga0207703_10091401
1244 Ga0207639_10316618
1245 Ga0207678_10085767
1246 Ga0207708_10213897
1247 Ga0207708_11001623
1248 Ga0207702_11043188
1249 Ga0207641_10115119
1250 Ga0207641_10336755
1251 Ga0207641_10406308
1252 Ga0207641_10858299
1253 Ga0207648_10004895
1254 Ga0207648_10084074
1255 Ga0207648_10088136
1256 Ga0207648_10487089
1257 Ga0207676_10325585
1258 Ga0207676_10482354
1259 Ga0207676_11090255
1260 Ga0207676_11479470
1261 Ga0207676_12163251
1262 Ga0207674_10001732
1263 Ga0207674_10031936
1264 Ga0207675_100045591
1265 Ga0207675_100059402
1266 Ga0207675_100099289
1267 Ga0207683_10058507
1268 Ga0207683_10232456
1269 Ga0207698_10246540
1270 Ga0207698_10453810
1271 Ga0207698_11197878
1272 Ga0207698_12001786
1273 Ga0209967_1052926
1274 Ga0209995_1002705
1275 Ga0209999_1007476
1276 Ga0209971_1040406
1277 Ga0209998_10002536
1278 Ga0209974_10003157
1279 Ga0207428_10554248
1280 Ga0268266_10015888
1281 Ga0268266_10467418
1282 Ga0268266_10725958
1283 Ga0268266_10781781
1284 Ga0268266_10860166
1285 Ga0268265_10180581
1286 Ga0268265_10392743
1287 Ga0268265_10923291
1288 Ga0268265_11210242
1289 Ga0268264_10019038
1290 Ga0268264_10394342
1291 Ga0265338_10151853
1292 Ga0307511_10000884
1293 Ga0316183_1007432
1294 Ga0316182_1130225
1295 Ga0265330_10163408
1296 Ga0265316_10337394
1297 Ga0307408_100026639
1298 Ga0307408_100399732
1299 Ga0307408_100447984
1300 Ga0307408_100478895
1301 Ga0307405_10008856
1302 Ga0307405_10027639
1303 Ga0307405_10062459
1304 Ga0307405_10146378
1305 Ga0307405_10615295
1306 Ga0307405_10849367
1307 Ga0307405_10929832
1308 Ga0307413_10122289
1309 Ga0307413_10264522
1310 Ga0307413_10327888
1311 Ga0307413_10346732
1312 Ga0307413_10616073
1313 Ga0307413_10831296
1314 Ga0307410_10022387
1315 Ga0307410_10112313
1316 Ga0307410_10170829
1317 Ga0307410_10317415
1318 Ga0307410_10761245
1319 Ga0307410_11396949
1320 Ga0307410_11818460
1321 Ga0307406_10007743
1322 Ga0307406_10034662
1323 Ga0307406_10092728
1324 Ga0307406_10232739
1325 Ga0307406_10289554
1326 Ga0307406_10430318
1327 Ga0307406_10745876
1328 Ga0307407_10017774
1329 Ga0307407_10196823
1330 Ga0307407_10345067
1331 Ga0307412_10005721
1332 Ga0307412_10016709
1333 Ga0307412_10354522
1334 Ga0307409_100007252
1335 Ga0307409_100389195
1336 Ga0307409_100488427
1337 Ga0307416_100036010
1338 Ga0307416_100265469
1339 Ga0307416_100373631
1340 Ga0307416_100504941
1341 Ga0307416_102067088
1342 Ga0307416_102172566
1343 Ga0307414_10112017
1344 Ga0307414_10239449
1345 Ga0307414_10480812
1346 Ga0307414_10558806
1347 Ga0307414_10698481
1348 Ga0307414_10746344
1349 Ga0307414_11431496
1350 Ga0307411_10049752
1351 Ga0307411_10053137
1352 Ga0307411_10102130
1353 Ga0307411_10131052
1354 Ga0307411_10147754
1355 Ga0307411_10186597
1356 Ga0307411_10839768
1357 Ga0307411_12198582
1358 Ga0307415_100087442
1359 Ga0307415_100273286
1360 Ga0307415_100514123
1361 Ga0307415_101091614
1362 Ga0307415_102141735
1363 Ga0307510_10003850
1364 Ga0373926_0020391
1365 Ga0373956_0187113
1366 Ga0373935_1369273
1367 Ga0373927_0004162
1368 Ga0373927_0016917
1369 Ga0373927_0389482
1370 Ga0373933_0087586
1371 Ga0373933_0512951
1372 Ga0373933_1073774
1373 Ga0373937_0254397
1374 Ga0373925_0190524
1375 Ga0373925_0212833
1376 Ga0373925_0415112
1377 Ga0373925_1113007
1378 Ga0395899_0147933
1379 Ga0395899_0753232
1380 Ga0395900_0153111
1381 Ga0395900_0318787
1382 Ga0395900_0532935
1383 Ga0395900_0869441
1384 Ga0395900_0959049
1385 Ga0395900_1629729
1386 Ga0395898_0041822
1387 Ga0395898_0172669
1388 Ga0395898_1562404
1389 Ga0395905_0053030
1390 Ga0395905_0242760
1391 Ga0395905_0267775
1392 Ga0395905_0459661
1393 Ga0395905_0990870
1394 Ga0436364_1035450
1395 Ga0395901_0019192
1396 Ga0395901_0363744
1397 Ga0237819_04260
1398 Ga0436365_0064527
1399 Ga0436365_0176077
1400 Ga0436365_0723875
1401 Ga0436363_0849015
1402 Ga0439466_0279620
1403 Ga0451789_0891629
1404 Ga0451791_0779858
1405 Ga0451804_0479665
1406 Ga0451807_0589435
1407 Ga0451837_1865023
1408 Ga0451853_0008946
1409 Ga0439448_0053507
1410 Ga0439455_0052303
1411 Ga0450890_088189
1412 Ga0439446_0021586
1413 Ga0439458_0094916
1414 Ga0451577_0009474
1415 Ga0451577_0725838
1416 Ga0453683_0165836
1417 Ga0453683_0186899
1418 Ga0453684_0000167
1419 Ga0453684_0000284
1420 Ga0451576_0950625
1421 Ga0466967_0312984
1422 Ga0495629_0606387
1423 Ga0495580_0029698
1424 Ga0495594_0025607
1425 Ga0495643_0000307
1426 Ga0495644_0387208
1427 Ga0495648_0000039
1428 Ga0495663_0000501
1429 Ga0495663_0002001
1430 Ga0495665_0076666
1431 Ga0495640_0298038
1432 Ga0495586_0343417
1433 Ga0495597_0301781
1434 Ga0495668_0017551
1435 Ga0495634_0207852
1436 Ga0495625_0025028
1437 Ga0495625_0124009
1438 Ga0495669_0287095
1439 Ga0495613_0260187
1440 Ga0495671_0148001
1441 Ga0495671_0584912
1442 Ga0495581_0322362
1443 Ga0495672_0000006
1444 Ga0495683_0133256
1445 Ga0495673_0000148
1446 Ga0495602_0571599
1447 Ga0496100_0246866
1448 Ga0496104_0041190
1449 Ga0496106_0110493
1450 Ga0496109_1150370
1451 Ga0496113_1288444
1452 Ga0496114_0031627
1453 Ga0496114_0869569
1454 Ga0496115_0182934
1455 Ga0496122_0006171
1456 Ga0496123_0001218
1457 Ga0496124_0298596
1458 Ga0496124_0650463
1459 Ga0496126_0900073
1460 Ga0501292_111648
1461 Ga0501294_049719
1462 Ga0501298_012219
1463 Ga0501300_068771
1464 Ga0501032_0126934
1465 Ga0501033_0153770
1466 Ga0501034_0514414
1467 Ga0501038_0130853
1468 Ga0501039_0541071
1469 Ga0501041_0953380
1470 Ga0501042_0654553
1471 Ga0501043_0254836
1472 Ga0501043_0406205
1473 Ga0501046_0024430
1474 Ga0501047_0046092
1475 Ga0501047_0320744
1476 Ga0501070_1551826
1477 Ga0501073_0354632
1478 Ga0501073_0496053
1479 Ga0501198_012182
1480 Ga0501202_000394
1481 Ga0501206_022968
1482 Ga0501208_006031
1483 Ga0501216_000093
1484 Ga0501223_023705
1485 Ga0501224_000292
1486 Ga0501227_009937
1487 Ga0501228_003485
1488 Ga0501233_000355
1489 Ga0501235_002165
1490 Ga0501236_004539
1491 Ga0501239_085233
1492 Ga0501240_003855
1493 Ga0501242_001847
1494 Ga0501243_000433
1495 Ga0501247_002240
1496 Ga0501249_000835
1497 Ga0501251_021274
1498 Ga0501252_001093
1499 Ga0501256_001858
1500 Ga0501257_007726
1501 Ga0501259_001036
1502 Ga0501260_001647
1503 Ga0501261_000819
1504 Ga0501219_008694
1505 Ga0501221_000083
1506 Ga0501225_0002327
1507 Ga0501229_004951
1508 Ga0501234_000699
1509 Ga0501079_0813125
1510 Ga0501080_0007302
1511 Ga0501080_0099106
1512 Ga0501081_0266617
1513 Ga0501083_0008004
1514 Ga0501083_0493963
1515 Ga0501262_001325
1516 Ga0501263_000868
1517 Ga0501266_000368
1518 Ga0501268_000039
1519 Ga0501268_159978
1520 Ga0501270_000589
1521 Ga0501270_108704
1522 Ga0501271_014589
1523 Ga0501274_001615
1524 Ga0501275_003412
1525 Ga0501279_000426
1526 Ga0501035_0575139
1527 Ga0501044_0095748
1528 Ga0501044_0290252
1529 Ga0501204_016960
1530 Ga0501212_001054
1531 nmdc:mga0k408_18214_c1
1532 nmdc:mga07m45_169690_c1
1533 nmdc:mga09592_7127_c1
1534 nmdc:mga0qj67_1240879_c1
1535 nmdc:mga0qj67_2521_c1
1536 nmdc:mga0qj67_560003_c1
1537 nmdc:mga06r32_1943755_c1
1538 nmdc:mga06r32_233401_c1
1539 nmdc:mga08y16_1232046_c1
1540 nmdc:mga08y16_1348903_c1
1541 nmdc:mga08x19_523597_c1
1542 Ga0495619_0198291
1543 Ga0500643_049529
1544 Ga0500644_0000368
1545 Ga0500651_0006283
1546 Ga0500650_0025842
1547 Ga0500556_0000222
1548 Ga0500562_017365
1549 Ga0500597_337681
1550 Ga0500642_0000011
1551 Ga0500658_0394216
1552 Ga0500564_000200
1553 Ga0500568_0032237
1554 Ga0500577_0100378
1555 Ga0500588_0192502
1556 Ga0500616_0001825
1557 Ga0500620_024372
1558 Ga0500627_0428287
1559 Ga0500645_003390
1560 Ga0500645_221190
1561 Ga0500609_057780
1562 Ga0501084_0627408
1563 Ga0501082_0002676
1564 Ga0501082_1636570

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

8

70

0.97

PF01381

HTH_3

Helix-turn-helix

12

64

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f51-assembly1.cif.gz_A crystal structure of the clp gene regulator clgr from corynebacterium glutamicum 0.9381 7 62
3zkc-assembly1.cif.gz_B crystal structure of the master regulator for biofilm formation sinr in complex with dna. 0.9347 6 62
3zkc-assembly1.cif.gz_A crystal structure of the master regulator for biofilm formation sinr in complex with dna. 0.9342 6 62
3f52-assembly1.cif.gz_E crystal structure of the clp gene regulator clgr from c. glutamicum 0.9305 7 62
1b0n-assembly1.cif.gz_A sinr protein/sini protein complex 0.9276 6 62
ID Description Score Start End Superfamily
3f51A00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9381 7 62 1.10.260.40
3zkcB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9347 6 62 1.10.260.40
3zkcA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9342 6 62 1.10.260.40
3f51C00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9311 7 62 1.10.260.40
3f52E00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9305 7 62 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A6I4V562-F1-model_v4 Helix-turn-helix domain-containing protein 0.9814 2 66 GO:0003677
AF-S3X7D6-F1-model_v4 HTH cro/C1-type domain-containing protein 0.9796 2 66 GO:0003677
AF-A0A7Z0BWH4-F1-model_v4 Putative transcriptional regulator 0.9793 2 66 GO:0003677
AF-I9WD21-F1-model_v4 Putative transcriptional regulator 0.979 2 67 GO:0003677
AF-A0A1M6KAK0-F1-model_v4 Putative transcriptional regulator 0.9784 2 67 GO:0003677

Map