F480642

General Info

Members Datasets Scaffolds Average Seq Length
782 435 1564 290

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2895660088|2895663140
Length 322
Sequence TNMPAVNPGASGSGSGSGAGLPSTTDAPRLPSLSRRSSSAPAARRAKAPMSIGTTLVLLIGALYCLTPVLWVVIASTKDGSELFSTFTFLPSSHLWDNIVELTQYRGGLYWRWMVNTALYAGVGAILSTYVSMLSGYALAKFTFPGKSGVFKVLLMGVLVPGVILAIPQYFMLAQVGMTNTYWAVLLPQIISPYGIYLARIYAAAAVPTEIIESGRTEGASELFILHRLAMPMMLPGLVTVFLFQFVAIWNNFMLPYIMLGDDKLFPITVGLSGLLNQGSTVPALYTLVITGALLSIIPLIALFLVLQRYWRVDLAAGAVKA

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
101 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
102 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
103 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
104 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
105 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
106 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
107 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
108 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
111 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
112 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
113 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
114 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
115 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
116 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
125 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
144 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
154 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
155 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
156 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
157 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
158 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
161 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
162 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
163 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
164 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
165 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
166 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
167 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
168 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
169 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
170 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
171 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
177 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
186 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
193 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
197 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
200 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
201 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
208 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
209 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
210 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
232 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
235 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
236 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
247 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
248 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
249 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
250 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
251 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
252 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
253 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
254 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
255 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
256 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
266 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
267 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
268 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
269 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
270 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
271 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
272 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
288 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
289 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
290 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
291 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
292 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
293 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
294 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
295 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
296 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
297 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
298 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
301 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
302 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
303 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
304 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
305 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
306 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
307 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
308 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
311 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
312 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
313 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
314 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
315 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
316 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
317 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
318 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
319 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
320 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
321 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
322 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
323 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
324 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
325 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
326 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
327 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
328 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
329 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
330 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
331 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
332 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
333 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
334 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
335 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
336 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
337 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
338 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
339 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
340 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
341 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
342 2643221548 Streptomyces sp. Root55 Isolate Unclassified
343 2643221553 Microbacterium sp. Root553 Isolate Unclassified
344 2643221572 Leifsonia sp. Root60 Isolate Unclassified
345 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
346 2643221613 Oerskovia sp. Root22 Isolate Unclassified
347 2643221616 Leifsonia sp. Root227 Isolate Unclassified
348 2643221630 Microbacterium sp. Root322 Isolate Unclassified
349 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
350 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
351 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
352 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
353 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
354 2643221714 Streptomyces sp. Root264 Isolate Unclassified
355 2643221721 Oerskovia sp. Root918 Isolate Unclassified
356 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
357 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
358 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
359 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
360 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
361 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
362 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
363 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
364 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
365 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
366 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
367 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
368 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
369 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
370 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
371 2808606372 Agromyces sp. 23-23 Isolate Unclassified
372 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
373 2808606394 Promicromonospora sp. C35 Isolate Unclassified
374 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
375 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
376 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
377 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
378 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
379 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
380 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
381 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
382 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
383 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
384 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
385 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
386 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
387 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
388 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
389 2867428634 Streptomyces sp. RP5T Isolate Unclassified
390 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
391 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
392 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
393 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
394 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
395 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
396 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
397 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
398 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
399 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
400 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
401 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
402 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
403 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
404 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
405 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
406 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
407 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
408 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
409 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
410 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
411 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
412 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
413 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
414 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
415 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
416 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
417 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
418 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
419 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
420 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
421 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
422 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
423 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
424 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
425 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
426 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
427 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
428 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
429 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
430 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
431 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
432 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
433 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
434 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
435 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.53
Metatranscriptomes 0.51
Isolates 14.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.37
Nodule 0.26
Rhizoplane 1.92
Rhizosphere 76.21
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10013390 3300001989 Bacteria 2995
2 JGI24739J22299_10018856 3300001989 Bacteria 2475
3 JGI25406J46586_10003396 3300003203 Bacteria 7491
4 JGI25406J46586_10020748 3300003203 Bacteria 2650
5 rootH1_10016398 3300003316 Bacteria 16490
6 rootL2_10004889 3300003322 Bacteria 4333
7 rootL2_10106867 3300003322 Bacteria 2652
8 rootL2_10187667 3300003322 Bacteria 1211
9 rootH1_10041099 3300003323 Bacteria 3405
10 rootH1_10061199 3300003323 Bacteria 2200
11 Ga0006562J51391_1136929 3300003578 Bacteria 2050
12 Ga0055539_1002865 3300003752 Bacteria 2520
13 Ga0065714_10003307 3300005288 Bacteria 7769
14 Ga0070658_10029441 3300005327 Bacteria 4411
15 Ga0070658_10132103 3300005327 Bacteria 2081
16 Ga0070683_100343311 3300005329 Bacteria 1422
17 Ga0070682_100058749 3300005337 Bacteria 2426
18 Ga0070660_100198461 3300005339 Bacteria 1627
19 Ga0070668_100000386 3300005347 Bacteria 29165
20 Ga0070668_100008412 3300005347 Bacteria 7663
21 Ga0070668_100029140 3300005347 Bacteria 4192
22 Ga0070667_100531654 3300005367 Bacteria 1079
23 Ga0070667_100635003 3300005367 Bacteria 985
24 Ga0070714_100107991 3300005435 Bacteria 2460
25 Ga0070714_100194716 3300005435 Bacteria 1852
26 Ga0070714_100451474 3300005435 Bacteria 1221
27 Ga0070713_100049127 3300005436 Bacteria 3479
28 Ga0070713_100117129 3300005436 Bacteria 2331
29 Ga0070713_100427765 3300005436 Bacteria 1240
30 Ga0070710_10000347 3300005437 Bacteria 22041
31 Ga0070711_100242187 3300005439 Bacteria 1411
32 Ga0070663_100002487 3300005455 Bacteria 10392
33 Ga0070663_100002529 3300005455 Bacteria 10326
34 Ga0070681_10132594 3300005458 Bacteria 2423
35 Ga0070679_100011830 3300005530 Bacteria 8324
36 Ga0070679_100110853 3300005530 Bacteria 2730
37 Ga0070684_100087888 3300005535 Bacteria 2760
38 Ga0068853_100017090 3300005539 Bacteria 5983
39 Ga0068853_100060366 3300005539 Bacteria 3276
40 Ga0070665_100046261 3300005548 Bacteria 4372
41 Ga0070665_100195507 3300005548 Bacteria 2023
42 Ga0070665_100518515 3300005548 Bacteria 1204
43 Ga0068855_100006547 3300005563 Bacteria 14157
44 Ga0068855_100012980 3300005563 Bacteria 10052
45 Ga0068855_100338767 3300005563 Bacteria 1659
46 Ga0068854_100096558 3300005578 Bacteria 2208
47 Ga0068854_100384325 3300005578 Bacteria 1157
48 Ga0068856_100074324 3300005614 Bacteria 3365
49 Ga0068856_100134800 3300005614 Bacteria 2475
50 Ga0068856_100321322 3300005614 Bacteria 1565
51 Ga0068856_100469775 3300005614 Bacteria 1279
52 Ga0068852_100044441 3300005616 Bacteria 3773
53 Ga0068859_100120643 3300005617 Bacteria 2689
54 Ga0068859_100320127 3300005617 Bacteria 1645
55 Ga0068859_100346138 3300005617 Bacteria 1581
56 Ga0068861_100197337 3300005719 Bacteria 1687
57 Ga0068863_100664981 3300005841 Bacteria 1034
58 Ga0068858_100175704 3300005842 Bacteria 2021
59 Ga0068860_100020130 3300005843 Bacteria 6465
60 Ga0068862_100096266 3300005844 Bacteria 2583
61 Ga0068862_100117355 3300005844 Bacteria 2342
62 Ga0081455_10000198 3300005937 Bacteria 76277
63 Ga0081455_10015011 3300005937 Bacteria 7544
64 Ga0081539_10000116 3300005985 Bacteria 186861
65 Ga0081539_10002529 3300005985 Bacteria 25532
66 Ga0070717_10122055 3300006028 Bacteria 2233
67 Ga0075363_100017793 3300006048 Bacteria 3530
68 Ga0075363_100116128 3300006048 Bacteria 1490
69 Ga0075363_100230939 3300006048 Bacteria 1062
70 Ga0070712_100121179 3300006175 Bacteria 1968
71 Ga0075367_10000224 3300006178 Bacteria 18937
72 Ga0075428_100001094 3300006844 Bacteria 28851
73 Ga0075430_100003000 3300006846 Bacteria 14122
74 Ga0075431_100015982 3300006847 Bacteria 7615
75 Ga0075429_100000494 3300006880 Bacteria 29616
76 Ga0097620_100120643 3300006931 Bacteria 2689
77 Ga0097620_100320119 3300006931 Bacteria 1645
78 Ga0097620_100346170 3300006931 Bacteria 1581
79 Ga0105240_10020634 3300009093 Bacteria 8783
80 Ga0105240_10186938 3300009093 Bacteria 2439
81 Ga0114129_10372288 3300009147 Bacteria 1888
82 Ga0105243_10113361 3300009148 Bacteria 2273
83 Ga0105243_10237872 3300009148 Bacteria 1619
84 Ga0105243_10394335 3300009148 Bacteria 1284
85 Ga0105241_10000490 3300009174 Bacteria 29892
86 Ga0105241_10017053 3300009174 Bacteria 5332
87 Ga0105242_10149434 3300009176 Bacteria 2036
88 Ga0105248_10706662 3300009177 Bacteria 1137
89 Ga0105237_10051232 3300009545 Bacteria 4146
90 Ga0105238_10057219 3300009551 Bacteria 3910
91 Ga0105238_10240753 3300009551 Bacteria 1787
92 Ga0105238_10449884 3300009551 Bacteria 1285
93 Ga0105029_100341 3300009984 Bacteria 2445
94 Ga0105239_10086406 3300010375 Bacteria 3457
95 Ga0105239_10432100 3300010375 Bacteria 1492
96 Ga0105239_10495921 3300010375 Bacteria 1388
97 Ga0157370_10272139 3300013104 Bacteria 1565
98 Ga0157370_10280396 3300013104 Bacteria 1540
99 Ga0157369_10020878 3300013105 Bacteria 7322
100 Ga0157369_10027187 3300013105 Bacteria 6344
101 Ga0157369_10029746 3300013105 Bacteria 6033
102 Ga0157369_10043041 3300013105 Bacteria 4923
103 Ga0157374_10047880 3300013296 Bacteria 3965
104 Ga0157378_10034741 3300013297 Bacteria 4458
105 Ga0163162_10539534 3300013306 Bacteria 1295
106 Ga0157372_10172262 3300013307 Bacteria 2504
107 Ga0183367_1003 3300015688 Bacteria 814276
108 Ga0183367_1004 3300015688 Bacteria 716880
109 Ga0206354_11401955 3300020081 Bacteria 2037
110 Ga0206353_10480480 3300020082 Bacteria 1988
111 Ga0206353_11206199 3300020082 Bacteria 21902
112 Ga0209563_100586 3300025230 Bacteria 12043
113 Ga0209677_100513 3300025253 Bacteria 21624
114 Ga0209233_1031932 3300025261 Unclassified 1223
115 Ga0209455_1004394 3300025272 Bacteria 4635
116 Ga0207713_1042807 3300025735 Bacteria 1877
117 Ga0207692_10001270 3300025898 Bacteria 9367
118 Ga0207692_10030878 3300025898 Bacteria 2560
119 Ga0207647_10003321 3300025904 Bacteria 12087
120 Ga0207647_10019597 3300025904 Bacteria 4548
121 Ga0207647_10096604 3300025904 Bacteria 1758
122 Ga0207705_10030365 3300025909 Bacteria 3857
123 Ga0207705_10258415 3300025909 Bacteria 1329
124 Ga0207654_10002631 3300025911 Bacteria 9108
125 Ga0207695_10010930 3300025913 Bacteria 11042
126 Ga0207695_10054521 3300025913 Bacteria 4174
127 Ga0207671_10000594 3300025914 Bacteria 48267
128 Ga0207671_10000886 3300025914 Bacteria 37914
129 Ga0207693_10001642 3300025915 Bacteria 19747
130 Ga0207663_10147136 3300025916 Bacteria 1648
131 Ga0207657_10275951 3300025919 Bacteria 1335
132 Ga0207649_10031095 3300025920 Bacteria 3170
133 Ga0207652_10053262 3300025921 Bacteria 3476
134 Ga0207652_10578466 3300025921 Bacteria 1008
135 Ga0207694_10005786 3300025924 Bacteria 9469
136 Ga0207694_10019245 3300025924 Bacteria 5161
137 Ga0207700_10017247 3300025928 Bacteria 4819
138 Ga0207700_10046721 3300025928 Bacteria 3204
139 Ga0207664_10010108 3300025929 Bacteria 6653
140 Ga0207664_10016938 3300025929 Bacteria 5330
141 Ga0207664_10061056 3300025929 Bacteria 3006
142 Ga0207709_10175179 3300025935 Bacteria 1509
143 Ga0207689_10143456 3300025942 Bacteria 1968
144 Ga0207667_10133297 3300025949 Bacteria 2559
145 Ga0207667_10418265 3300025949 Bacteria 1364
146 Ga0207668_10000190 3300025972 Bacteria 41980
147 Ga0207668_10000377 3300025972 Bacteria 28306
148 Ga0207668_10335183 3300025972 Bacteria 1260
149 Ga0207640_10049087 3300025981 Bacteria 2731
150 Ga0207658_10107442 3300025986 Bacteria 2199
151 Ga0207658_10232424 3300025986 Bacteria 1557
152 Ga0207639_10062019 3300026041 Bacteria 2890
153 Ga0207639_10197851 3300026041 Bacteria 1721
154 Ga0207678_10000057 3300026067 Bacteria 86102
155 Ga0207678_10003078 3300026067 Bacteria 15084
156 Ga0207678_10009503 3300026067 Bacteria 8554
157 Ga0207678_10149131 3300026067 Bacteria 1997
158 Ga0207678_10341324 3300026067 Bacteria 1291
159 Ga0207702_10346897 3300026078 Bacteria 1419
160 Ga0207641_10511515 3300026088 Bacteria 1167
161 Ga0207676_10264424 3300026095 Bacteria 1555
162 Ga0207674_10033596 3300026116 Bacteria 5368
163 Ga0207674_10205211 3300026116 Bacteria 1920
164 Ga0207675_100185237 3300026118 Bacteria 1995
165 Ga0207698_10075011 3300026142 Bacteria 2701
166 Ga0268265_10105682 3300028380 Bacteria 2285
167 Ga0268265_10227924 3300028380 Bacteria 1635
168 Ga0268264_10045199 3300028381 Bacteria 3656
169 Ga0268264_10046328 3300028381 Bacteria 3612
170 Ga0268264_10181849 3300028381 Bacteria 1910
171 Ga0265337_1001738 3300028556 Bacteria 10531
172 Ga0265326_10002457 3300028558 Bacteria 6246
173 Ga0265319_1004500 3300028563 Bacteria 6887
174 Ga0265334_10000913 3300028573 Bacteria 14757
175 Ga0265318_10009741 3300028577 Bacteria 4211
176 Ga0265323_10001725 3300028653 Bacteria 10381
177 Ga0265336_10001366 3300028666 Bacteria 11252
178 Ga0307517_10006227 3300028786 Bacteria 17741
179 Ga0307515_10002799 3300028794 Bacteria 37130
180 Ga0307515_10004403 3300028794 Bacteria 29167
181 Ga0307515_10019161 3300028794 Bacteria 12337
182 Ga0307515_10029984 3300028794 Bacteria 9165
183 Ga0307515_10037368 3300028794 Bacteria 7811
184 Ga0307515_10054150 3300028794 Bacteria 5897
185 Ga0307515_10089723 3300028794 Bacteria 3866
186 Ga0307515_10109953 3300028794 Bacteria 3231
187 Ga0307515_10149095 3300028794 Bacteria 2456
188 Ga0265338_10006593 3300028800 Bacteria 14716
189 Ga0265338_10135552 3300028800 Unclassified 1936
190 Ga0265324_10005341 3300029957 Bacteria 5569
191 Ga0307511_10001462 3300030521 Bacteria 24966
192 Ga0307511_10053588 3300030521 Bacteria 3194
193 Ga0307511_10158716 3300030521 Bacteria 1276
194 Ga0307512_10002105 3300030522 Bacteria 26166
195 Ga0307512_10004222 3300030522 Bacteria 15874
196 Ga0307512_10004835 3300030522 Bacteria 14451
197 Ga0307512_10006577 3300030522 Bacteria 11745
198 Ga0307512_10032588 3300030522 Bacteria 4497
199 Ga0307512_10204837 3300030522 Bacteria 1060
200 Ga0316177_1007692 3300030731 Bacteria 1600
201 Ga0316176_1054292 3300030732 Bacteria 2502
202 Ga0314311_1140623 3300030733 Bacteria 3660
203 Ga0316180_1169781 3300030736 Bacteria 1848
204 Ga0265320_10007956 3300031240 Bacteria 6534
205 Ga0265325_10010420 3300031241 Bacteria 5385
206 Ga0265340_10003865 3300031247 Bacteria 8433
207 Ga0265339_10071730 3300031249 Bacteria 1844
208 Ga0307513_10001463 3300031456 Bacteria 33963
209 Ga0307513_10036257 3300031456 Bacteria 5505
210 Ga0307513_10043474 3300031456 Bacteria 4933
211 Ga0307509_10017853 3300031507 Bacteria 8149
212 Ga0307509_10024530 3300031507 Bacteria 6750
213 Ga0307509_10029137 3300031507 Bacteria 6131
214 Ga0307509_10051308 3300031507 Bacteria 4413
215 Ga0307509_10182643 3300031507 Bacteria 1960
216 Ga0307408_100089169 3300031548 Bacteria 2324
217 Ga0307408_100116272 3300031548 Bacteria 2064
218 Ga0307508_10000746 3300031616 Bacteria 38597
219 Ga0307508_10067173 3300031616 Bacteria 3155
220 Ga0307508_10108473 3300031616 Bacteria 2375
221 Ga0307514_10215513 3300031649 Bacteria 1185
222 Ga0265314_10012450 3300031711 Bacteria 6941
223 Ga0265342_10007950 3300031712 Bacteria 7684
224 Ga0307516_10000177 3300031730 Bacteria 82023
225 Ga0307516_10000894 3300031730 Bacteria 41096
226 Ga0307516_10014914 3300031730 Bacteria 8199
227 Ga0307516_10015544 3300031730 Bacteria 8005
228 Ga0307516_10019656 3300031730 Bacteria 6992
229 Ga0307516_10020601 3300031730 Bacteria 6810
230 Ga0307516_10024519 3300031730 Bacteria 6160
231 Ga0307516_10084527 3300031730 Bacteria 3012
232 Ga0307516_10157400 3300031730 Bacteria 2025
233 Ga0307516_10191573 3300031730 Bacteria 1770
234 Ga0307405_10005419 3300031731 Bacteria 6153
235 Ga0307405_10022393 3300031731 Bacteria 3572
236 Ga0307413_10001707 3300031824 Bacteria 8572
237 Ga0307413_10046803 3300031824 Bacteria 2575
238 Ga0307518_10096566 3300031838 Bacteria 2120
239 Ga0307410_10210276 3300031852 Bacteria 1490
240 Ga0307410_10468596 3300031852 Bacteria 1031
241 Ga0307406_10000115 3300031901 Bacteria 46616
242 Ga0307406_10000119 3300031901 Bacteria 46191
243 Ga0307406_10097764 3300031901 Bacteria 1992
244 Ga0307406_10114537 3300031901 Bacteria 1862
245 Ga0307407_10008833 3300031903 Bacteria 4654
246 Ga0307407_10017144 3300031903 Bacteria 3626
247 Ga0307412_10009796 3300031911 Bacteria 5501
248 Ga0307412_10014019 3300031911 Bacteria 4719
249 Ga0307412_10038248 3300031911 Bacteria 3088
250 Ga0307412_10187559 3300031911 Bacteria 1561
251 Ga0307409_100000181 3300031995 Bacteria 24481
252 Ga0307409_100052591 3300031995 Bacteria 3124
253 Ga0307409_100764783 3300031995 Bacteria 971
254 Ga0307416_100039664 3300032002 Bacteria 3649
255 Ga0307416_100059910 3300032002 Bacteria 3097
256 Ga0307414_10006971 3300032004 Bacteria 6333
257 Ga0307414_10008517 3300032004 Bacteria 5822
258 Ga0307411_10031162 3300032005 Bacteria 3277
259 Ga0307411_10274438 3300032005 Bacteria 1339
260 Ga0307411_10485742 3300032005 Bacteria 1041
261 Ga0307415_100000148 3300032126 Bacteria 31023
262 Ga0307415_100028775 3300032126 Bacteria 3541
263 Ga0307415_100086027 3300032126 Bacteria 2261
264 Ga0307415_100089198 3300032126 Bacteria 2227
265 Ga0307415_100136665 3300032126 Bacteria 1865
266 Ga0307507_10000016 3300033179 Bacteria 225984
267 Ga0307507_10022239 3300033179 Bacteria 7016
268 Ga0307507_10043043 3300033179 Bacteria 4487
269 Ga0307507_10058272 3300033179 Bacteria 3628
270 Ga0307507_10138680 3300033179 Bacteria 1872
271 Ga0307510_10097614 3300033180 Bacteria 2747
272 Ga0307510_10155598 3300033180 Bacteria 1893
273 Ga0307510_10236896 3300033180 Bacteria 1323
274 Ga0373950_0018230 3300034818 Bacteria 1216
275 Ga0373951_0000300 3300035091 Bacteria 15760
276 Ga0373955_0287960 3300035172 Bacteria 989
277 Ga0373942_0000443 3300035207 Bacteria 11609
278 Ga0373935_0001950 3300035692 Bacteria 11604
279 Ga0373925_0000237 3300037068 Bacteria 58351
280 Ga0395899_0000833 3300037312 Bacteria 29778
281 Ga0395899_0002077 3300037312 Bacteria 16450
282 Ga0395900_0177717 3300037418 Bacteria 2165
283 Ga0395898_0116450 3300037466 Bacteria 2561
284 Ga0395901_0273843 3300038443 Bacteria 1755
285 Ga0439436_0001148 3300041404 Bacteria 7520
286 Ga0439436_0008662 3300041404 Bacteria 3127
287 Ga0439439_0004980 3300041406 Bacteria 3014
288 Ga0451793_1147289 3300041452 Bacteria 1486
289 Ga0451798_0658012 3300041458 Bacteria 1205
290 Ga0451802_1239871 3300041460 Bacteria 1650
291 Ga0451833_0184157 3300041491 Bacteria 1581
292 Ga0451833_0615816 3300041491 Bacteria 1548
293 Ga0451853_0437132 3300041512 Bacteria 8360
294 Ga0451853_1338476 3300041512 Bacteria 5597
295 Ga0439431_0024570 3300041997 Bacteria 1467
296 Ga0439433_0003978 3300041999 Bacteria 3180
297 Ga0439449_0000771 3300042007 Bacteria 12317
298 Ga0439449_0008913 3300042007 Bacteria 3806
299 Ga0439449_0083501 3300042007 Bacteria 1178
300 Ga0439457_000064 3300042014 Bacteria 22792
301 Ga0439457_004083 3300042014 Bacteria 3865
302 Ga0439457_005509 3300042014 Bacteria 3181
303 Ga0439457_016910 3300042014 Bacteria 1623
304 Ga0450890_011050 3300042127 Bacteria 1164
305 Ga0450899_000219 3300042135 Bacteria 6008
306 Ga0450899_002676 3300042135 Bacteria 1925
307 Ga0450903_003756 3300042138 Bacteria 2619
308 Ga0450906_000627 3300042145 Bacteria 7564
309 Ga0439458_0037620 3300042157 Bacteria 1167
310 Ga0450908_001411 3300042184 Bacteria 4661
311 Ga0466969_0013971 3300044656 Bacteria 4226
312 Ga0466969_0016209 3300044656 Bacteria 3903
313 Ga0466969_0016800 3300044656 Bacteria 3826
314 Ga0466969_0040940 3300044656 Bacteria 2320
315 Ga0466969_0056891 3300044656 Bacteria 1908
316 Ga0466969_0082872 3300044656 Bacteria 1528
317 Ga0466969_0142197 3300044656 Bacteria 1108
318 Ga0466972_0004270 3300044658 Bacteria 7138
319 Ga0466972_0006665 3300044658 Bacteria 5794
320 Ga0466972_0010681 3300044658 Bacteria 4607
321 Ga0466972_0014568 3300044658 Bacteria 3937
322 Ga0466972_0025925 3300044658 Bacteria 2904
323 Ga0466972_0030850 3300044658 Bacteria 2638
324 Ga0466972_0042953 3300044658 Bacteria 2196
325 Ga0466965_0000006 3300044683 Bacteria 158069
326 Ga0466965_0005771 3300044683 Bacteria 5587
327 Ga0466965_0008284 3300044683 Bacteria 4806
328 Ga0466965_0010777 3300044683 Bacteria 4276
329 Ga0466966_0004721 3300044684 Bacteria 8964
330 Ga0466966_0009699 3300044684 Bacteria 6378
331 Ga0466966_0016186 3300044684 Bacteria 4931
332 Ga0466966_0022480 3300044684 Bacteria 4136
333 Ga0466966_0022733 3300044684 Bacteria 4110
334 Ga0466966_0055970 3300044684 Bacteria 2496
335 Ga0466966_0083890 3300044684 Bacteria 1982
336 Ga0466961_0001507 3300044693 Bacteria 14453
337 Ga0466961_0001724 3300044693 Bacteria 13599
338 Ga0466961_0021132 3300044693 Bacteria 4190
339 Ga0466961_0032710 3300044693 Bacteria 3342
340 Ga0466961_0043208 3300044693 Bacteria 2887
341 Ga0466961_0043513 3300044693 Bacteria 2876
342 Ga0466961_0060657 3300044693 Bacteria 2405
343 Ga0466961_0077057 3300044693 Bacteria 2112
344 Ga0466961_0260162 3300044693 Bacteria 1064
345 Ga0466963_0048625 3300044694 Bacteria 2803
346 Ga0466971_0000308 3300044719 Bacteria 18882
347 Ga0466971_0010058 3300044719 Bacteria 4132
348 Ga0466971_0029535 3300044719 Bacteria 2452
349 Ga0466968_0032353 3300044735 Bacteria 2175
350 Ga0466968_0088863 3300044735 Bacteria 1366
351 Ga0466970_0000635 3300044765 Bacteria 17248
352 Ga0466970_0009236 3300044765 Bacteria 4977
353 Ga0466970_0026897 3300044765 Bacteria 3015
354 Ga0466970_0054369 3300044765 Bacteria 2138
355 Ga0466970_0114708 3300044765 Bacteria 1473
356 Ga0466970_0170712 3300044765 Bacteria 1205
357 Ga0466957_0029701 3300044842 Bacteria 3261
358 Ga0466957_0335017 3300044842 Bacteria 1024
359 Ga0466960_0000667 3300044901 Bacteria 11931
360 Ga0466960_0005489 3300044901 Bacteria 5028
361 Ga0466960_0005654 3300044901 Bacteria 4961
362 Ga0466959_0001924 3300045049 Bacteria 13062
363 Ga0466959_0022340 3300045049 Bacteria 4676
364 Ga0466959_0028567 3300045049 Bacteria 4135
365 Ga0466959_0047829 3300045049 Bacteria 3145
366 Ga0466959_0115249 3300045049 Bacteria 1914
367 Ga0466959_0158779 3300045049 Bacteria 1590
368 Ga0466959_0218072 3300045049 Bacteria 1324
369 Ga0466958_0009839 3300045836 Bacteria 5336
370 Ga0466958_0041077 3300045836 Bacteria 2781
371 Ga0466958_0111951 3300045836 Bacteria 1704
372 Ga0466958_0308863 3300045836 Bacteria 1016
373 Ga0466967_0017950 3300045976 Bacteria 5639
374 Ga0466967_0301368 3300045976 Bacteria 1542
375 Ga0495592_0002276 3300046454 Bacteria 13536
376 Ga0495592_0045059 3300046454 Bacteria 3292
377 Ga0495592_0097708 3300046454 Bacteria 2097
378 Ga0495592_0133773 3300046454 Bacteria 1731
379 Ga0495603_0010543 3300046455 Bacteria 5598
380 Ga0495603_0021643 3300046455 Bacteria 3894
381 Ga0495590_0016035 3300046457 Bacteria 2710
382 Ga0495629_0000626 3300046459 Bacteria 28709
383 Ga0495629_0014032 3300046459 Bacteria 5773
384 Ga0495629_0061340 3300046459 Bacteria 2628
385 Ga0495638_0079450 3300046460 Bacteria 1994
386 Ga0495651_0001198 3300046462 Bacteria 20050
387 Ga0495651_0001254 3300046462 Bacteria 19647
388 Ga0495651_0003257 3300046462 Bacteria 12459
389 Ga0495651_0029755 3300046462 Bacteria 4258
390 Ga0495651_0031692 3300046462 Bacteria 4121
391 Ga0495651_0033826 3300046462 Bacteria 3986
392 Ga0495651_0053181 3300046462 Bacteria 3119
393 Ga0495580_0047232 3300046472 Bacteria 3052
394 Ga0495582_0049263 3300046473 Bacteria 2320
395 Ga0495605_0034529 3300046474 Bacteria 2560
396 Ga0495639_0026750 3300046475 Bacteria 2551
397 Ga0495662_0001387 3300046476 Bacteria 12007
398 Ga0495662_0003692 3300046476 Bacteria 7721
399 Ga0495662_0003828 3300046476 Bacteria 7586
400 Ga0495662_0173284 3300046476 Bacteria 1063
401 Ga0495664_0000225 3300046477 Bacteria 26888
402 Ga0495664_0007836 3300046477 Bacteria 5944
403 Ga0495584_0031304 3300046491 Bacteria 2693
404 Ga0495585_0019430 3300046492 Bacteria 3917
405 Ga0495585_0031771 3300046492 Bacteria 2996
406 Ga0495594_0000666 3300046499 Bacteria 17683
407 Ga0495594_0034005 3300046499 Bacteria 2772
408 Ga0495594_0045402 3300046499 Bacteria 2411
409 Ga0495594_0098811 3300046499 Bacteria 1641
410 Ga0495596_0071119 3300046500 Bacteria 1351
411 Ga0495607_0036881 3300046501 Bacteria 2942
412 Ga0495607_0113750 3300046501 Bacteria 1431
413 Ga0495583_0063735 3300046506 Bacteria 1637
414 Ga0495606_0001231 3300046507 Bacteria 35820
415 Ga0495606_0003545 3300046507 Bacteria 16479
416 Ga0495608_0186169 3300046511 Bacteria 1312
417 Ga0495618_0006585 3300046514 Bacteria 7046
418 Ga0495618_0190766 3300046514 Bacteria 1299
419 Ga0495628_0008046 3300046516 Bacteria 9076
420 Ga0495628_0012572 3300046516 Bacteria 7133
421 Ga0495628_0019754 3300046516 Bacteria 5565
422 Ga0495628_0049010 3300046516 Bacteria 3346
423 Ga0495630_0035055 3300046517 Bacteria 3750
424 Ga0495630_0104908 3300046517 Bacteria 2139
425 Ga0495631_0010398 3300046518 Bacteria 4605
426 Ga0495632_0072667 3300046519 Bacteria 1650
427 Ga0495643_0001005 3300046522 Bacteria 28801
428 Ga0495643_0002935 3300046522 Bacteria 12918
429 Ga0495648_0033077 3300046524 Bacteria 3383
430 Ga0495666_0006788 3300046526 Bacteria 5750
431 Ga0495652_0001571 3300046529 Bacteria 24996
432 Ga0495652_0001890 3300046529 Bacteria 22269
433 Ga0495652_0009656 3300046529 Bacteria 8759
434 Ga0495652_0042397 3300046529 Bacteria 3924
435 Ga0495652_0204773 3300046529 Bacteria 1494
436 Ga0495665_0002200 3300046531 Bacteria 10556
437 Ga0495640_0020815 3300046533 Bacteria 4820
438 Ga0495640_0048674 3300046533 Bacteria 2928
439 Ga0495640_0056304 3300046533 Bacteria 2686
440 Ga0495586_0027310 3300046535 Bacteria 3054
441 Ga0495586_0151419 3300046535 Bacteria 1305
442 Ga0495587_0006654 3300046536 Bacteria 7526
443 Ga0495597_0020741 3300046542 Bacteria 3058
444 Ga0495645_0010711 3300046543 Bacteria 6439
445 Ga0495645_0012052 3300046543 Bacteria 6093
446 Ga0495645_0020844 3300046543 Bacteria 4736
447 Ga0495645_0052068 3300046543 Bacteria 2979
448 Ga0495645_0069544 3300046543 Bacteria 2541
449 Ga0495645_0254828 3300046543 Bacteria 1165
450 Ga0495622_0002951 3300046557 Bacteria 8106
451 Ga0495622_0021833 3300046557 Bacteria 2982
452 Ga0495622_0071851 3300046557 Bacteria 1597
453 Ga0495622_0101370 3300046557 Bacteria 1319
454 Ga0495622_0122949 3300046557 Bacteria 1184
455 Ga0495667_0169543 3300046559 Bacteria 1403
456 Ga0495656_0037051 3300046615 Bacteria 2012
457 Ga0495668_0000326 3300046616 Bacteria 65274
458 Ga0495668_0000537 3300046616 Bacteria 47191
459 Ga0495668_0029493 3300046616 Bacteria 3099
460 Ga0495634_0097224 3300046642 Bacteria 1906
461 Ga0495634_0107028 3300046642 Bacteria 1801
462 Ga0495634_0108108 3300046642 Bacteria 1790
463 Ga0495611_0059195 3300046648 Bacteria 1738
464 Ga0495611_0099992 3300046648 Bacteria 1346
465 Ga0495625_0000770 3300046660 Bacteria 44596
466 Ga0495625_0070625 3300046660 Bacteria 2452
467 Ga0495625_0080494 3300046660 Bacteria 2269
468 Ga0495635_0002503 3300046663 Bacteria 12553
469 Ga0495635_0008627 3300046663 Bacteria 7118
470 Ga0495635_0130323 3300046663 Bacteria 1714
471 Ga0495635_0167526 3300046663 Bacteria 1494
472 Ga0495661_0012847 3300046665 Bacteria 5646
473 Ga0495588_0008717 3300046674 Bacteria 4660
474 Ga0495588_0016895 3300046674 Bacteria 3534
475 Ga0495657_0006945 3300046675 Bacteria 8789
476 Ga0495657_0015799 3300046675 Bacteria 5513
477 Ga0495657_0023538 3300046675 Bacteria 4398
478 Ga0495599_0158290 3300046678 Bacteria 1400
479 Ga0495623_0006089 3300046679 Bacteria 7848
480 Ga0495623_0095528 3300046679 Bacteria 1817
481 Ga0495646_0000371 3300046680 Bacteria 23327
482 Ga0495646_0084850 3300046680 Bacteria 1838
483 Ga0495646_0098165 3300046680 Bacteria 1682
484 Ga0495613_0001859 3300046689 Bacteria 16059
485 Ga0495613_0080950 3300046689 Bacteria 2360
486 Ga0495613_0089386 3300046689 Bacteria 2231
487 Ga0495613_0155554 3300046689 Bacteria 1629
488 Ga0495613_0208631 3300046689 Bacteria 1374
489 Ga0495670_0022512 3300046691 Bacteria 3111
490 Ga0495649_0086137 3300046694 Bacteria 1677
491 Ga0495649_0135954 3300046694 Bacteria 1295
492 Ga0495589_0032224 3300046794 Bacteria 2635
493 Ga0495589_0091936 3300046794 Bacteria 1473
494 Ga0495589_0110718 3300046794 Bacteria 1325
495 Ga0495600_0008866 3300046809 Bacteria 6197
496 Ga0495600_0017817 3300046809 Bacteria 4520
497 Ga0495600_0034963 3300046809 Bacteria 3262
498 Ga0495600_0047332 3300046809 Bacteria 2805
499 Ga0495600_0109113 3300046809 Bacteria 1802
500 Ga0495600_0182187 3300046809 Bacteria 1353
501 Ga0495660_0098336 3300046810 Bacteria 1509
502 Ga0495660_0106479 3300046810 Bacteria 1436
503 Ga0495581_0006333 3300047315 Bacteria 6866
504 Ga0495581_0056132 3300047315 Bacteria 2273
505 Ga0495581_0113725 3300047315 Bacteria 1574
506 Ga0495604_0000502 3300047317 Bacteria 34488
507 Ga0495604_0003240 3300047317 Bacteria 13008
508 Ga0495604_0035125 3300047317 Bacteria 3961
509 Ga0495604_0120447 3300047317 Bacteria 1900
510 Ga0495636_0000810 3300047318 Bacteria 11514
511 Ga0495636_0008279 3300047318 Bacteria 4105
512 Ga0495636_0125129 3300047318 Bacteria 1140
513 Ga0495674_0019544 3300047319 Bacteria 6285
514 Ga0495672_0074703 3300047320 Bacteria 1908
515 Ga0495676_0004654 3300047321 Bacteria 12569
516 Ga0495676_0007142 3300047321 Bacteria 10249
517 Ga0495676_0035431 3300047321 Bacteria 4173
518 Ga0495676_0064778 3300047321 Bacteria 2840
519 Ga0495676_0140495 3300047321 Bacteria 1731
520 Ga0495680_0003794 3300047322 Bacteria 14681
521 Ga0495680_0056712 3300047322 Bacteria 3032
522 Ga0495683_0034166 3300047323 Bacteria 2587
523 Ga0495683_0059580 3300047323 Bacteria 1894
524 Ga0495687_002905 3300047443 Bacteria 13052
525 Ga0495687_003222 3300047443 Bacteria 12074
526 Ga0495687_009056 3300047443 Bacteria 5610
527 Ga0495675_0021539 3300047444 Bacteria 4105
528 Ga0495675_0106594 3300047444 Bacteria 1751
529 Ga0495675_0140921 3300047444 Bacteria 1494
530 Ga0495675_0154443 3300047444 Bacteria 1416
531 Ga0495677_0036933 3300047445 Bacteria 1784
532 Ga0495685_000242 3300047447 Bacteria 18816
533 Ga0495685_007723 3300047447 Bacteria 3558
534 Ga0495685_008162 3300047447 Bacteria 3470
535 Ga0495685_033926 3300047447 Bacteria 1754
536 Ga0495681_0005889 3300047470 Bacteria 8138
537 Ga0495686_0087210 3300047472 Bacteria 1898
538 Ga0495593_0008889 3300047673 Bacteria 5829
539 Ga0495593_0033683 3300047673 Bacteria 2789
540 Ga0495602_0016780 3300048088 Bacteria 7353
541 Ga0495602_0083550 3300048088 Bacteria 2675
542 Ga0495602_0107030 3300048088 Bacteria 2280
543 Ga0495614_0026105 3300048089 Bacteria 2517
544 Ga0495626_0000046 3300048091 Bacteria 162660
545 Ga0495626_0000137 3300048091 Bacteria 92873
546 Ga0495626_0012892 3300048091 Bacteria 4361
547 Ga0496105_0335878 3300048908 Bacteria 1209
548 Ga0496105_0341285 3300048908 Bacteria 1198
549 Ga0496106_0034861 3300048909 Bacteria 3761
550 Ga0496108_0000015 3300048911 Bacteria 243282
551 Ga0496108_0050673 3300048911 Bacteria 3476
552 Ga0496108_0097207 3300048911 Bacteria 2509
553 Ga0496109_0022352 3300048912 Bacteria 5601
554 Ga0496110_0299449 3300048913 Bacteria 1465
555 Ga0496111_0001649 3300048914 Bacteria 12957
556 Ga0496112_0067940 3300048915 Bacteria 3519
557 Ga0496114_0010822 3300048917 Bacteria 7263
558 Ga0496114_0110597 3300048917 Bacteria 2354
559 Ga0496117_0000196 3300048920 Bacteria 119243
560 Ga0496118_0076100 3300048921 Bacteria 2389
561 Ga0496119_0060536 3300048922 Bacteria 2266
562 Ga0496119_0115980 3300048922 Bacteria 1479
563 Ga0496125_0049348 3300048928 Bacteria 3498
564 Ga0496126_0054784 3300048929 Bacteria 3610
565 Ga0496126_0057078 3300048929 Bacteria 3527
566 Ga0496126_0060344 3300048929 Bacteria 3411
567 Ga0495678_016992 3300049459 Bacteria 3309
568 Ga0495682_0026202 3300049460 Bacteria 2167
569 Ga0501031_0001193 3300049568 Bacteria 15835
570 Ga0501031_0073104 3300049568 Bacteria 2233
571 Ga0501032_0001375 3300049569 Bacteria 19307
572 Ga0501032_0064028 3300049569 Bacteria 2461
573 Ga0501032_0080971 3300049569 Bacteria 2160
574 Ga0501033_0011940 3300049570 Bacteria 6636
575 Ga0501034_0004272 3300049571 Bacteria 15940
576 Ga0501034_0021972 3300049571 Bacteria 6501
577 Ga0501034_0118142 3300049571 Bacteria 2639
578 Ga0501036_0054086 3300049572 Bacteria 3399
579 Ga0501036_0063142 3300049572 Bacteria 3136
580 Ga0501037_0001086 3300049573 Bacteria 20170
581 Ga0501037_0001575 3300049573 Bacteria 16622
582 Ga0501038_0014929 3300049574 Bacteria 7072
583 Ga0501038_0076202 3300049574 Bacteria 2833
584 Ga0501038_0191266 3300049574 Bacteria 1646
585 Ga0501038_0282487 3300049574 Bacteria 1306
586 Ga0501039_0002353 3300049575 Bacteria 14073
587 Ga0501039_0076474 3300049575 Bacteria 2602
588 Ga0501040_0025318 3300049576 Bacteria 3989
589 Ga0501041_0012595 3300049577 Bacteria 5009
590 Ga0501042_0000296 3300049578 Bacteria 24701
591 Ga0501042_0065215 3300049578 Bacteria 2602
592 Ga0501043_0004901 3300049579 Bacteria 10816
593 Ga0501046_0007535 3300049580 Bacteria 9547
594 Ga0501046_0132302 3300049580 Bacteria 1891
595 Ga0501047_0003044 3300049581 Bacteria 15905
596 Ga0501047_0029479 3300049581 Bacteria 5290
597 Ga0501048_0000513 3300049582 Bacteria 27155
598 Ga0501048_0013876 3300049582 Bacteria 5974
599 Ga0501067_0020963 3300049583 Bacteria 3615
600 Ga0501068_0077821 3300049584 Bacteria 2031
601 Ga0501070_0015332 3300049586 Bacteria 6449
602 Ga0501070_0091682 3300049586 Bacteria 2515
603 Ga0501070_0207527 3300049586 Bacteria 1608
604 Ga0501071_0023537 3300049587 Bacteria 4302
605 Ga0501072_0001837 3300049588 Bacteria 15806
606 Ga0501073_0075093 3300049589 Bacteria 2353
607 Ga0501073_0095404 3300049589 Bacteria 2065
608 Ga0501074_0018140 3300049590 Bacteria 5111
609 Ga0501077_0008026 3300049593 Bacteria 6527
610 Ga0501079_0053821 3300049741 Bacteria 3104
611 Ga0501080_0131575 3300049742 Bacteria 2316
612 Ga0501083_0000059 3300049744 Bacteria 78374
613 Ga0501083_0010196 3300049744 Bacteria 6621
614 Ga0501035_0003230 3300049822 Bacteria 15614
615 Ga0501035_0007647 3300049822 Bacteria 10096
616 Ga0501035_0259169 3300049822 Bacteria 1475
617 Ga0501044_0006899 3300049823 Bacteria 12505
618 Ga0501044_0119640 3300049823 Bacteria 2635
619 Ga0501045_0096748 3300049824 Bacteria 2184
620 nmdc:mga03n38_19253_c1 3300050490 Bacteria 2709
621 nmdc:mga03n38_35023_c1 3300050490 Bacteria 2148
622 nmdc:mga03n38_79540_c1 3300050490 Bacteria 1537
623 nmdc:mga06z11_688_c1 3300050494 Bacteria 12298
624 nmdc:mga05p37_6921_c1 3300050507 Bacteria 13369
625 nmdc:mga09592_346713_c1 3300050508 Bacteria 1285
626 nmdc:mga06r32_694345_c1 3300050510 Bacteria 984
627 Ga0495601_0005136 3300053077 Bacteria 7607
628 Ga0495612_0002515 3300053078 Bacteria 7566
629 Ga0500635_0000073 3300053080 Bacteria 65023
630 Ga0495619_0002746 3300053085 Bacteria 11492
631 Ga0500644_0015782 3300053088 Bacteria 2163
632 Ga0500646_0000134 3300053090 Bacteria 21323
633 Ga0500646_0000964 3300053090 Bacteria 7901
634 Ga0500651_0040400 3300053093 Bacteria 2939
635 Ga0500566_0109140 3300053094 Bacteria 1506
636 Ga0500640_014507 3300053095 Bacteria 3281
637 Ga0500641_0124053 3300053096 Bacteria 1114
638 Ga0500650_0019304 3300053098 Bacteria 2972
639 Ga0500650_0024343 3300053098 Bacteria 2699
640 Ga0500660_039133 3300053100 Bacteria 2424
641 Ga0500553_012772 3300053101 Bacteria 4255
642 Ga0500560_010272 3300053107 Bacteria 2338
643 Ga0500569_003761 3300053109 Bacteria 3135
644 Ga0500594_0026135 3300053118 Bacteria 1502
645 Ga0500652_001575 3300053131 Bacteria 6969
646 Ga0500652_067994 3300053131 Bacteria 1473
647 Ga0500561_0000242 3300053137 Bacteria 9789
648 Ga0500573_0053550 3300053140 Bacteria 2318
649 Ga0500573_0070041 3300053140 Bacteria 2001
650 Ga0500577_0098771 3300053142 Bacteria 1190
651 Ga0500579_072281 3300053143 Bacteria 1983
652 Ga0500588_0012392 3300053146 Bacteria 2113
653 Ga0500588_0017184 3300053146 Bacteria 1884
654 Ga0500616_0000553 3300053153 Bacteria 46504
655 Ga0500624_005662 3300053157 Bacteria 1668
656 Ga0500630_053817 3300053159 Bacteria 1938
657 Ga0500633_0000857 3300053160 Bacteria 5267
658 Ga0500633_0013918 3300053160 Bacteria 2269
659 Ga0501084_0039374 3300054114 Bacteria 3953
660 Ga0501082_0013965 3300060353 Bacteria 6907
661 Ga0501082_0259555 3300060353 Bacteria 1511
662 Ga0466962_0000098 3300061719 Bacteria 35205
663 Ga0466962_0012818 3300061719 Bacteria 4034
664 Ga0466962_0033718 3300061719 Bacteria 2451
665 Ga0466962_0111603 3300061719 Bacteria 1316
666 2895663140 2895660088 Bacteria 3782833
667 2547408736 2547132111 Bacteria 8013147
668 2585300834 2582581312 Bacteria 7308206
669 2585307981 2582581313 Bacteria 10042643
670 2585308176 2582581313 Bacteria 10042643
671 2585319513 2582581314 Bacteria 11452267
672 2616693426 2616644814 Bacteria 11555299
673 2643733108 2643221542 Bacteria 3563959
674 2643759060 2643221548 Bacteria 8053412
675 2643784599 2643221553 Bacteria 3544260
676 2643876793 2643221572 Bacteria 3614809
677 2643877487 2643221572 Bacteria 3614809
678 2644017949 2643221601 Bacteria 7493239
679 2644083928 2643221613 Bacteria 4622396
680 2644094400 2643221616 Bacteria 4066575
681 2644171895 2643221630 Bacteria 3601215
682 2644180763 2643221631 Bacteria 8168043
683 2644199339 2643221635 Bacteria 2632343
684 2644383848 2643221669 Bacteria 3611286
685 2644384542 2643221669 Bacteria 3611286
686 2644441947 2643221678 Bacteria 9540101
687 2644463522 2643221682 Bacteria 6743283
688 2644627623 2643221714 Bacteria 9015452
689 2644630630 2643221714 Bacteria 9015452
690 2644666806 2643221721 Bacteria 4486924
691 2644678221 2643221724 Bacteria 3593515
692 2676485630 2675903059 Bacteria 8644972
693 2676493253 2675903060 Bacteria 10051191
694 2730231238 2728369380 Bacteria 3620317
695 2738697470 2738541272 Bacteria 6848551
696 2739328067 2738543027 Bacteria 6409078
697 2739604547 2739367654 Bacteria 6049412
698 2747954674 2747842429 Bacteria 3914386
699 2753075276 2751185734 Bacteria 8863695
700 2753270823 2751185782 Bacteria 11227053
701 2760303220 2758568522 Bacteria 5953541
702 2785346646 2784746763 Bacteria 9783172
703 2785370693 2784746768 Bacteria 10036182
704 2785374287 2784746768 Bacteria 10036182
705 2808847014 2808606359 Bacteria 9866990
706 2808884940 2808606368 Bacteria 3174172
707 2808900756 2808606372 Bacteria 4649509
708 2808917726 2808606375 Bacteria 9466072
709 2809027718 2808606394 Bacteria 6248540
710 2809225616 2808606447 Bacteria 3572005
711 2812352076 2811994878 Bacteria 5992952
712 2812361332 2811994879 Bacteria 9313447
713 2812477336 2811994917 Bacteria 7761064
714 2816508546 2816332139 Bacteria 9138787
715 2819694374 2818991463 Bacteria 7948711
716 2852635536 2852632344 Bacteria 3463163
717 2852639269 2852635781 Bacteria 8251373
718 2857730915 2857729791 Bacteria 4040535
719 2857731148 2857729791 Bacteria 4040535
720 2862282516 2862281513 Bacteria 9621493
721 2862283824 2862281513 Bacteria 9621493
722 2862388130 2862382967 Bacteria 10317375
723 2862707611 2862705112 Bacteria 6563286
724 2862993407 2862993130 Bacteria 3860849
725 2862995212 2862993130 Bacteria 3860849
726 2863408163 2863404153 Bacteria 9672205
727 2867352873 2867346516 Bacteria 7608576
728 2867435772 2867428634 Bacteria 9590268
729 2868093559 2868088558 Bacteria 7609351
730 2870729365 2870721527 Bacteria 9689237
731 2877684813 2877676314 Bacteria 9512378
732 2884700501 2884693830 Bacteria 11273186
733 2887445747 2887443736 Bacteria 4426037
734 2887479945 2887478801 Bacteria 8972725
735 2895427320 2895427314 Bacteria 13147766
736 2895430680 2895427314 Bacteria 13147766
737 2895450279 2895442618 Bacteria 11027144
738 2895662322 2895660088 Bacteria 3782833
739 2905930624 2905926851 Bacteria 4423176
740 2919445306 2919443155 Bacteria 4072969
741 2919446761 2919443155 Bacteria 4072969
742 2919470104 2919468124 Bacteria 9133025
743 2928122282 2928121344 Bacteria 3972376
744 2928122517 2928121344 Bacteria 3972376
745 2935411640 2935409751 Bacteria 4179611
746 2935411829 2935409751 Bacteria 4179611
747 2935894795 2935890801 Bacteria 4593001
748 2939659505 2939657138 Bacteria 3740283
749 2939659979 2939657138 Bacteria 3740283
750 2939659985 2939657138 Bacteria 3740283
751 2939663578 2939660829 Bacteria 3784848
752 2946006744 2946003308 Bacteria 3857229
753 2946064757 2946064051 Bacteria 8957905
754 2946073123 2946072368 Bacteria 8999607
755 2946079300 2946072368 Bacteria 8999607
756 2947224717 2947224130 Bacteria 9938529
757 2954695664 2954691527 Bacteria 10720516
758 2954710857 2954701450 Bacteria 10834262
759 2954715086 2954711539 Bacteria 10867210
760 2954725028 2954721474 Bacteria 10456478
761 2954736790 2954731030 Bacteria 10243860
762 2954743961 2954740390 Bacteria 10229294
763 2954755638 2954749733 Bacteria 10366972
764 2954762901 2954759201 Bacteria 9358192
765 2964327788 2964326757 Bacteria 3290868
766 2966603981 2966598605 Bacteria 7676064
767 2966925727 2966924647 Bacteria 3268643
768 2974304401 2974302888 Bacteria 4369871
769 2977253055 2977251589 Bacteria 2952848
770 2977264515 2977264416 Bacteria 3750737
771 2990044662 2990044586 Bacteria 6603797
772 2990065738 2990059506 Bacteria 9321252
773 2995467568 2995463766 Bacteria 8577691
774 3006498392 3006493962 Bacteria 8825450
775 8001785409 8001781756 Bacteria 9586736
776 8008489776 8008485437 Bacteria 7198341
777 8008560505 8008558824 Bacteria 10610750
778 8008581298 8008574985 Bacteria 7815457
779 8016256521 8016254467 Bacteria 3797036
780 8025528648 8025524527 Bacteria 7197316
781 8047714759 8047710418 Bacteria 11023148
782 8048413937 8048406513 Bacteria 8936924
783 JGI24739J22299_10013390
784 JGI24739J22299_10018856
785 JGI25406J46586_10003396
786 JGI25406J46586_10020748
787 rootH1_10016398
788 rootL2_10004889
789 rootL2_10106867
790 rootL2_10187667
791 rootH1_10041099
792 rootH1_10061199
793 Ga0006562J51391_1136929
794 Ga0055539_1002865
795 Ga0065714_10003307
796 Ga0070658_10029441
797 Ga0070658_10132103
798 Ga0070683_100343311
799 Ga0070682_100058749
800 Ga0070660_100198461
801 Ga0070668_100000386
802 Ga0070668_100008412
803 Ga0070668_100029140
804 Ga0070667_100531654
805 Ga0070667_100635003
806 Ga0070714_100107991
807 Ga0070714_100194716
808 Ga0070714_100451474
809 Ga0070713_100049127
810 Ga0070713_100117129
811 Ga0070713_100427765
812 Ga0070710_10000347
813 Ga0070711_100242187
814 Ga0070663_100002487
815 Ga0070663_100002529
816 Ga0070681_10132594
817 Ga0070679_100011830
818 Ga0070679_100110853
819 Ga0070684_100087888
820 Ga0068853_100017090
821 Ga0068853_100060366
822 Ga0070665_100046261
823 Ga0070665_100195507
824 Ga0070665_100518515
825 Ga0068855_100006547
826 Ga0068855_100012980
827 Ga0068855_100338767
828 Ga0068854_100096558
829 Ga0068854_100384325
830 Ga0068856_100074324
831 Ga0068856_100134800
832 Ga0068856_100321322
833 Ga0068856_100469775
834 Ga0068852_100044441
835 Ga0068859_100120643
836 Ga0068859_100320127
837 Ga0068859_100346138
838 Ga0068861_100197337
839 Ga0068863_100664981
840 Ga0068858_100175704
841 Ga0068860_100020130
842 Ga0068862_100096266
843 Ga0068862_100117355
844 Ga0081455_10000198
845 Ga0081455_10015011
846 Ga0081539_10000116
847 Ga0081539_10002529
848 Ga0070717_10122055
849 Ga0075363_100017793
850 Ga0075363_100116128
851 Ga0075363_100230939
852 Ga0070712_100121179
853 Ga0075367_10000224
854 Ga0075428_100001094
855 Ga0075430_100003000
856 Ga0075431_100015982
857 Ga0075429_100000494
858 Ga0097620_100120643
859 Ga0097620_100320119
860 Ga0097620_100346170
861 Ga0105240_10020634
862 Ga0105240_10186938
863 Ga0114129_10372288
864 Ga0105243_10113361
865 Ga0105243_10237872
866 Ga0105243_10394335
867 Ga0105241_10000490
868 Ga0105241_10017053
869 Ga0105242_10149434
870 Ga0105248_10706662
871 Ga0105237_10051232
872 Ga0105238_10057219
873 Ga0105238_10240753
874 Ga0105238_10449884
875 Ga0105029_100341
876 Ga0105239_10086406
877 Ga0105239_10432100
878 Ga0105239_10495921
879 Ga0157370_10272139
880 Ga0157370_10280396
881 Ga0157369_10020878
882 Ga0157369_10027187
883 Ga0157369_10029746
884 Ga0157369_10043041
885 Ga0157374_10047880
886 Ga0157378_10034741
887 Ga0163162_10539534
888 Ga0157372_10172262
889 Ga0183367_1003
890 Ga0183367_1004
891 Ga0206354_11401955
892 Ga0206353_10480480
893 Ga0206353_11206199
894 Ga0209563_100586
895 Ga0209677_100513
896 Ga0209233_1031932
897 Ga0209455_1004394
898 Ga0207713_1042807
899 Ga0207692_10001270
900 Ga0207692_10030878
901 Ga0207647_10003321
902 Ga0207647_10019597
903 Ga0207647_10096604
904 Ga0207705_10030365
905 Ga0207705_10258415
906 Ga0207654_10002631
907 Ga0207695_10010930
908 Ga0207695_10054521
909 Ga0207671_10000594
910 Ga0207671_10000886
911 Ga0207693_10001642
912 Ga0207663_10147136
913 Ga0207657_10275951
914 Ga0207649_10031095
915 Ga0207652_10053262
916 Ga0207652_10578466
917 Ga0207694_10005786
918 Ga0207694_10019245
919 Ga0207700_10017247
920 Ga0207700_10046721
921 Ga0207664_10010108
922 Ga0207664_10016938
923 Ga0207664_10061056
924 Ga0207709_10175179
925 Ga0207689_10143456
926 Ga0207667_10133297
927 Ga0207667_10418265
928 Ga0207668_10000190
929 Ga0207668_10000377
930 Ga0207668_10335183
931 Ga0207640_10049087
932 Ga0207658_10107442
933 Ga0207658_10232424
934 Ga0207639_10062019
935 Ga0207639_10197851
936 Ga0207678_10000057
937 Ga0207678_10003078
938 Ga0207678_10009503
939 Ga0207678_10149131
940 Ga0207678_10341324
941 Ga0207702_10346897
942 Ga0207641_10511515
943 Ga0207676_10264424
944 Ga0207674_10033596
945 Ga0207674_10205211
946 Ga0207675_100185237
947 Ga0207698_10075011
948 Ga0268265_10105682
949 Ga0268265_10227924
950 Ga0268264_10045199
951 Ga0268264_10046328
952 Ga0268264_10181849
953 Ga0265337_1001738
954 Ga0265326_10002457
955 Ga0265319_1004500
956 Ga0265334_10000913
957 Ga0265318_10009741
958 Ga0265323_10001725
959 Ga0265336_10001366
960 Ga0307517_10006227
961 Ga0307515_10002799
962 Ga0307515_10004403
963 Ga0307515_10019161
964 Ga0307515_10029984
965 Ga0307515_10037368
966 Ga0307515_10054150
967 Ga0307515_10089723
968 Ga0307515_10109953
969 Ga0307515_10149095
970 Ga0265338_10006593
971 Ga0265338_10135552
972 Ga0265324_10005341
973 Ga0307511_10001462
974 Ga0307511_10053588
975 Ga0307511_10158716
976 Ga0307512_10002105
977 Ga0307512_10004222
978 Ga0307512_10004835
979 Ga0307512_10006577
980 Ga0307512_10032588
981 Ga0307512_10204837
982 Ga0316177_1007692
983 Ga0316176_1054292
984 Ga0314311_1140623
985 Ga0316180_1169781
986 Ga0265320_10007956
987 Ga0265325_10010420
988 Ga0265340_10003865
989 Ga0265339_10071730
990 Ga0307513_10001463
991 Ga0307513_10036257
992 Ga0307513_10043474
993 Ga0307509_10017853
994 Ga0307509_10024530
995 Ga0307509_10029137
996 Ga0307509_10051308
997 Ga0307509_10182643
998 Ga0307408_100089169
999 Ga0307408_100116272
1000 Ga0307508_10000746
1001 Ga0307508_10067173
1002 Ga0307508_10108473
1003 Ga0307514_10215513
1004 Ga0265314_10012450
1005 Ga0265342_10007950
1006 Ga0307516_10000177
1007 Ga0307516_10000894
1008 Ga0307516_10014914
1009 Ga0307516_10015544
1010 Ga0307516_10019656
1011 Ga0307516_10020601
1012 Ga0307516_10024519
1013 Ga0307516_10084527
1014 Ga0307516_10157400
1015 Ga0307516_10191573
1016 Ga0307405_10005419
1017 Ga0307405_10022393
1018 Ga0307413_10001707
1019 Ga0307413_10046803
1020 Ga0307518_10096566
1021 Ga0307410_10210276
1022 Ga0307410_10468596
1023 Ga0307406_10000115
1024 Ga0307406_10000119
1025 Ga0307406_10097764
1026 Ga0307406_10114537
1027 Ga0307407_10008833
1028 Ga0307407_10017144
1029 Ga0307412_10009796
1030 Ga0307412_10014019
1031 Ga0307412_10038248
1032 Ga0307412_10187559
1033 Ga0307409_100000181
1034 Ga0307409_100052591
1035 Ga0307409_100764783
1036 Ga0307416_100039664
1037 Ga0307416_100059910
1038 Ga0307414_10006971
1039 Ga0307414_10008517
1040 Ga0307411_10031162
1041 Ga0307411_10274438
1042 Ga0307411_10485742
1043 Ga0307415_100000148
1044 Ga0307415_100028775
1045 Ga0307415_100086027
1046 Ga0307415_100089198
1047 Ga0307415_100136665
1048 Ga0307507_10000016
1049 Ga0307507_10022239
1050 Ga0307507_10043043
1051 Ga0307507_10058272
1052 Ga0307507_10138680
1053 Ga0307510_10097614
1054 Ga0307510_10155598
1055 Ga0307510_10236896
1056 Ga0373950_0018230
1057 Ga0373951_0000300
1058 Ga0373955_0287960
1059 Ga0373942_0000443
1060 Ga0373935_0001950
1061 Ga0373925_0000237
1062 Ga0395899_0000833
1063 Ga0395899_0002077
1064 Ga0395900_0177717
1065 Ga0395898_0116450
1066 Ga0395901_0273843
1067 Ga0439436_0001148
1068 Ga0439436_0008662
1069 Ga0439439_0004980
1070 Ga0451793_1147289
1071 Ga0451798_0658012
1072 Ga0451802_1239871
1073 Ga0451833_0184157
1074 Ga0451833_0615816
1075 Ga0451853_0437132
1076 Ga0451853_1338476
1077 Ga0439431_0024570
1078 Ga0439433_0003978
1079 Ga0439449_0000771
1080 Ga0439449_0008913
1081 Ga0439449_0083501
1082 Ga0439457_000064
1083 Ga0439457_004083
1084 Ga0439457_005509
1085 Ga0439457_016910
1086 Ga0450890_011050
1087 Ga0450899_000219
1088 Ga0450899_002676
1089 Ga0450903_003756
1090 Ga0450906_000627
1091 Ga0439458_0037620
1092 Ga0450908_001411
1093 Ga0466969_0013971
1094 Ga0466969_0016209
1095 Ga0466969_0016800
1096 Ga0466969_0040940
1097 Ga0466969_0056891
1098 Ga0466969_0082872
1099 Ga0466969_0142197
1100 Ga0466972_0004270
1101 Ga0466972_0006665
1102 Ga0466972_0010681
1103 Ga0466972_0014568
1104 Ga0466972_0025925
1105 Ga0466972_0030850
1106 Ga0466972_0042953
1107 Ga0466965_0000006
1108 Ga0466965_0005771
1109 Ga0466965_0008284
1110 Ga0466965_0010777
1111 Ga0466966_0004721
1112 Ga0466966_0009699
1113 Ga0466966_0016186
1114 Ga0466966_0022480
1115 Ga0466966_0022733
1116 Ga0466966_0055970
1117 Ga0466966_0083890
1118 Ga0466961_0001507
1119 Ga0466961_0001724
1120 Ga0466961_0021132
1121 Ga0466961_0032710
1122 Ga0466961_0043208
1123 Ga0466961_0043513
1124 Ga0466961_0060657
1125 Ga0466961_0077057
1126 Ga0466961_0260162
1127 Ga0466963_0048625
1128 Ga0466971_0000308
1129 Ga0466971_0010058
1130 Ga0466971_0029535
1131 Ga0466968_0032353
1132 Ga0466968_0088863
1133 Ga0466970_0000635
1134 Ga0466970_0009236
1135 Ga0466970_0026897
1136 Ga0466970_0054369
1137 Ga0466970_0114708
1138 Ga0466970_0170712
1139 Ga0466957_0029701
1140 Ga0466957_0335017
1141 Ga0466960_0000667
1142 Ga0466960_0005489
1143 Ga0466960_0005654
1144 Ga0466959_0001924
1145 Ga0466959_0022340
1146 Ga0466959_0028567
1147 Ga0466959_0047829
1148 Ga0466959_0115249
1149 Ga0466959_0158779
1150 Ga0466959_0218072
1151 Ga0466958_0009839
1152 Ga0466958_0041077
1153 Ga0466958_0111951
1154 Ga0466958_0308863
1155 Ga0466967_0017950
1156 Ga0466967_0301368
1157 Ga0495592_0002276
1158 Ga0495592_0045059
1159 Ga0495592_0097708
1160 Ga0495592_0133773
1161 Ga0495603_0010543
1162 Ga0495603_0021643
1163 Ga0495590_0016035
1164 Ga0495629_0000626
1165 Ga0495629_0014032
1166 Ga0495629_0061340
1167 Ga0495638_0079450
1168 Ga0495651_0001198
1169 Ga0495651_0001254
1170 Ga0495651_0003257
1171 Ga0495651_0029755
1172 Ga0495651_0031692
1173 Ga0495651_0033826
1174 Ga0495651_0053181
1175 Ga0495580_0047232
1176 Ga0495582_0049263
1177 Ga0495605_0034529
1178 Ga0495639_0026750
1179 Ga0495662_0001387
1180 Ga0495662_0003692
1181 Ga0495662_0003828
1182 Ga0495662_0173284
1183 Ga0495664_0000225
1184 Ga0495664_0007836
1185 Ga0495584_0031304
1186 Ga0495585_0019430
1187 Ga0495585_0031771
1188 Ga0495594_0000666
1189 Ga0495594_0034005
1190 Ga0495594_0045402
1191 Ga0495594_0098811
1192 Ga0495596_0071119
1193 Ga0495607_0036881
1194 Ga0495607_0113750
1195 Ga0495583_0063735
1196 Ga0495606_0001231
1197 Ga0495606_0003545
1198 Ga0495608_0186169
1199 Ga0495618_0006585
1200 Ga0495618_0190766
1201 Ga0495628_0008046
1202 Ga0495628_0012572
1203 Ga0495628_0019754
1204 Ga0495628_0049010
1205 Ga0495630_0035055
1206 Ga0495630_0104908
1207 Ga0495631_0010398
1208 Ga0495632_0072667
1209 Ga0495643_0001005
1210 Ga0495643_0002935
1211 Ga0495648_0033077
1212 Ga0495666_0006788
1213 Ga0495652_0001571
1214 Ga0495652_0001890
1215 Ga0495652_0009656
1216 Ga0495652_0042397
1217 Ga0495652_0204773
1218 Ga0495665_0002200
1219 Ga0495640_0020815
1220 Ga0495640_0048674
1221 Ga0495640_0056304
1222 Ga0495586_0027310
1223 Ga0495586_0151419
1224 Ga0495587_0006654
1225 Ga0495597_0020741
1226 Ga0495645_0010711
1227 Ga0495645_0012052
1228 Ga0495645_0020844
1229 Ga0495645_0052068
1230 Ga0495645_0069544
1231 Ga0495645_0254828
1232 Ga0495622_0002951
1233 Ga0495622_0021833
1234 Ga0495622_0071851
1235 Ga0495622_0101370
1236 Ga0495622_0122949
1237 Ga0495667_0169543
1238 Ga0495656_0037051
1239 Ga0495668_0000326
1240 Ga0495668_0000537
1241 Ga0495668_0029493
1242 Ga0495634_0097224
1243 Ga0495634_0107028
1244 Ga0495634_0108108
1245 Ga0495611_0059195
1246 Ga0495611_0099992
1247 Ga0495625_0000770
1248 Ga0495625_0070625
1249 Ga0495625_0080494
1250 Ga0495635_0002503
1251 Ga0495635_0008627
1252 Ga0495635_0130323
1253 Ga0495635_0167526
1254 Ga0495661_0012847
1255 Ga0495588_0008717
1256 Ga0495588_0016895
1257 Ga0495657_0006945
1258 Ga0495657_0015799
1259 Ga0495657_0023538
1260 Ga0495599_0158290
1261 Ga0495623_0006089
1262 Ga0495623_0095528
1263 Ga0495646_0000371
1264 Ga0495646_0084850
1265 Ga0495646_0098165
1266 Ga0495613_0001859
1267 Ga0495613_0080950
1268 Ga0495613_0089386
1269 Ga0495613_0155554
1270 Ga0495613_0208631
1271 Ga0495670_0022512
1272 Ga0495649_0086137
1273 Ga0495649_0135954
1274 Ga0495589_0032224
1275 Ga0495589_0091936
1276 Ga0495589_0110718
1277 Ga0495600_0008866
1278 Ga0495600_0017817
1279 Ga0495600_0034963
1280 Ga0495600_0047332
1281 Ga0495600_0109113
1282 Ga0495600_0182187
1283 Ga0495660_0098336
1284 Ga0495660_0106479
1285 Ga0495581_0006333
1286 Ga0495581_0056132
1287 Ga0495581_0113725
1288 Ga0495604_0000502
1289 Ga0495604_0003240
1290 Ga0495604_0035125
1291 Ga0495604_0120447
1292 Ga0495636_0000810
1293 Ga0495636_0008279
1294 Ga0495636_0125129
1295 Ga0495674_0019544
1296 Ga0495672_0074703
1297 Ga0495676_0004654
1298 Ga0495676_0007142
1299 Ga0495676_0035431
1300 Ga0495676_0064778
1301 Ga0495676_0140495
1302 Ga0495680_0003794
1303 Ga0495680_0056712
1304 Ga0495683_0034166
1305 Ga0495683_0059580
1306 Ga0495687_002905
1307 Ga0495687_003222
1308 Ga0495687_009056
1309 Ga0495675_0021539
1310 Ga0495675_0106594
1311 Ga0495675_0140921
1312 Ga0495675_0154443
1313 Ga0495677_0036933
1314 Ga0495685_000242
1315 Ga0495685_007723
1316 Ga0495685_008162
1317 Ga0495685_033926
1318 Ga0495681_0005889
1319 Ga0495686_0087210
1320 Ga0495593_0008889
1321 Ga0495593_0033683
1322 Ga0495602_0016780
1323 Ga0495602_0083550
1324 Ga0495602_0107030
1325 Ga0495614_0026105
1326 Ga0495626_0000046
1327 Ga0495626_0000137
1328 Ga0495626_0012892
1329 Ga0496105_0335878
1330 Ga0496105_0341285
1331 Ga0496106_0034861
1332 Ga0496108_0000015
1333 Ga0496108_0050673
1334 Ga0496108_0097207
1335 Ga0496109_0022352
1336 Ga0496110_0299449
1337 Ga0496111_0001649
1338 Ga0496112_0067940
1339 Ga0496114_0010822
1340 Ga0496114_0110597
1341 Ga0496117_0000196
1342 Ga0496118_0076100
1343 Ga0496119_0060536
1344 Ga0496119_0115980
1345 Ga0496125_0049348
1346 Ga0496126_0054784
1347 Ga0496126_0057078
1348 Ga0496126_0060344
1349 Ga0495678_016992
1350 Ga0495682_0026202
1351 Ga0501031_0001193
1352 Ga0501031_0073104
1353 Ga0501032_0001375
1354 Ga0501032_0064028
1355 Ga0501032_0080971
1356 Ga0501033_0011940
1357 Ga0501034_0004272
1358 Ga0501034_0021972
1359 Ga0501034_0118142
1360 Ga0501036_0054086
1361 Ga0501036_0063142
1362 Ga0501037_0001086
1363 Ga0501037_0001575
1364 Ga0501038_0014929
1365 Ga0501038_0076202
1366 Ga0501038_0191266
1367 Ga0501038_0282487
1368 Ga0501039_0002353
1369 Ga0501039_0076474
1370 Ga0501040_0025318
1371 Ga0501041_0012595
1372 Ga0501042_0000296
1373 Ga0501042_0065215
1374 Ga0501043_0004901
1375 Ga0501046_0007535
1376 Ga0501046_0132302
1377 Ga0501047_0003044
1378 Ga0501047_0029479
1379 Ga0501048_0000513
1380 Ga0501048_0013876
1381 Ga0501067_0020963
1382 Ga0501068_0077821
1383 Ga0501070_0015332
1384 Ga0501070_0091682
1385 Ga0501070_0207527
1386 Ga0501071_0023537
1387 Ga0501072_0001837
1388 Ga0501073_0075093
1389 Ga0501073_0095404
1390 Ga0501074_0018140
1391 Ga0501077_0008026
1392 Ga0501079_0053821
1393 Ga0501080_0131575
1394 Ga0501083_0000059
1395 Ga0501083_0010196
1396 Ga0501035_0003230
1397 Ga0501035_0007647
1398 Ga0501035_0259169
1399 Ga0501044_0006899
1400 Ga0501044_0119640
1401 Ga0501045_0096748
1402 nmdc:mga03n38_19253_c1
1403 nmdc:mga03n38_35023_c1
1404 nmdc:mga03n38_79540_c1
1405 nmdc:mga06z11_688_c1
1406 nmdc:mga05p37_6921_c1
1407 nmdc:mga09592_346713_c1
1408 nmdc:mga06r32_694345_c1
1409 Ga0495601_0005136
1410 Ga0495612_0002515
1411 Ga0500635_0000073
1412 Ga0495619_0002746
1413 Ga0500644_0015782
1414 Ga0500646_0000134
1415 Ga0500646_0000964
1416 Ga0500651_0040400
1417 Ga0500566_0109140
1418 Ga0500640_014507
1419 Ga0500641_0124053
1420 Ga0500650_0019304
1421 Ga0500650_0024343
1422 Ga0500660_039133
1423 Ga0500553_012772
1424 Ga0500560_010272
1425 Ga0500569_003761
1426 Ga0500594_0026135
1427 Ga0500652_001575
1428 Ga0500652_067994
1429 Ga0500561_0000242
1430 Ga0500573_0053550
1431 Ga0500573_0070041
1432 Ga0500577_0098771
1433 Ga0500579_072281
1434 Ga0500588_0012392
1435 Ga0500588_0017184
1436 Ga0500616_0000553
1437 Ga0500624_005662
1438 Ga0500630_053817
1439 Ga0500633_0000857
1440 Ga0500633_0013918
1441 Ga0501084_0039374
1442 Ga0501082_0013965
1443 Ga0501082_0259555
1444 Ga0466962_0000098
1445 Ga0466962_0012818
1446 Ga0466962_0033718
1447 Ga0466962_0111603
1448 2895663140
1449 2547408736
1450 2585300834
1451 2585307981
1452 2585308176
1453 2585319513
1454 2616693426
1455 2643733108
1456 2643759060
1457 2643784599
1458 2643876793
1459 2643877487
1460 2644017949
1461 2644083928
1462 2644094400
1463 2644171895
1464 2644180763
1465 2644199339
1466 2644383848
1467 2644384542
1468 2644441947
1469 2644463522
1470 2644627623
1471 2644630630
1472 2644666806
1473 2644678221
1474 2676485630
1475 2676493253
1476 2730231238
1477 2738697470
1478 2739328067
1479 2739604547
1480 2747954674
1481 2753075276
1482 2753270823
1483 2760303220
1484 2785346646
1485 2785370693
1486 2785374287
1487 2808847014
1488 2808884940
1489 2808900756
1490 2808917726
1491 2809027718
1492 2809225616
1493 2812352076
1494 2812361332
1495 2812477336
1496 2816508546
1497 2819694374
1498 2852635536
1499 2852639269
1500 2857730915
1501 2857731148
1502 2862282516
1503 2862283824
1504 2862388130
1505 2862707611
1506 2862993407
1507 2862995212
1508 2863408163
1509 2867352873
1510 2867435772
1511 2868093559
1512 2870729365
1513 2877684813
1514 2884700501
1515 2887445747
1516 2887479945
1517 2895427320
1518 2895430680
1519 2895450279
1520 2895662322
1521 2905930624
1522 2919445306
1523 2919446761
1524 2919470104
1525 2928122282
1526 2928122517
1527 2935411640
1528 2935411829
1529 2935894795
1530 2939659505
1531 2939659979
1532 2939659985
1533 2939663578
1534 2946006744
1535 2946064757
1536 2946073123
1537 2946079300
1538 2947224717
1539 2954695664
1540 2954710857
1541 2954715086
1542 2954725028
1543 2954736790
1544 2954743961
1545 2954755638
1546 2954762901
1547 2964327788
1548 2966603981
1549 2966925727
1550 2974304401
1551 2977253055
1552 2977264515
1553 2990044662
1554 2990065738
1555 2995467568
1556 3006498392
1557 8001785409
1558 8008489776
1559 8008560505
1560 8008581298
1561 8016256521
1562 8025528648
1563 8047714759
1564 8048413937

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

128

312

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cad-assembly1.cif.gz_B mycobacterium smegmatis sugabc complex 0.8513 22 282
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.8501 22 275
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8428 19 273
3rlf-assembly1.cif.gz_G crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.8317 19 282
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8163 12 271
ID Description Score Start End Superfamily
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9331 19 271 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9284 19 269 1.10.3720.10
af_P9WG01_5_265_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9084 19 271 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8976 19 270 1.10.3720.10
af_P10906_2_274_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8936 19 271 1.10.3720.10
ID Description Score Start End GO Terms
AF-L8EMI2-F1-model_v4 deleted 0.9701 86 280
AF-F3ZK38-F1-model_v4 Putative ABC transporter permease protein 0.9666 35 282 GO:0005886
GO:0055085
AF-A0A6I5CRJ2-F1-model_v4 ABC transporter permease subunit 0.966 76 282 GO:0005886
GO:0055085
AF-A0A3M2JH75-F1-model_v4 Carbohydrate ABC transporter permease 0.9642 21 282 GO:0005886
GO:0055085
AF-A0A4V2XQX3-F1-model_v4 Carbohydrate ABC transporter permease 0.9625 31 279 GO:0005886
GO:0055085

Map