F480643

General Info

Members Datasets Scaffolds Average Seq Length
783 334 1566 68

Family's Representative Sequence

Representative Sequence 3300001990|JGI24737J22298_10015462|JGI24737J22298_100154621
Length 81
Sequence LVHARHIWDKDVLMITGTVKFFNXDKGYGFIAPESGSGDAFVHISAVERAGMTTLNKDQRVSYELETDRRGKTSAVNLQAA

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
117 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
118 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
122 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
185 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
186 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
201 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
202 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
203 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
204 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
212 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
213 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
214 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
215 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
216 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
217 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
218 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
219 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
220 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
221 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
222 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
223 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
224 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
225 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
226 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
227 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
228 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
229 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
230 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
231 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
232 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
233 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
234 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
235 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
238 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
239 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
240 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
241 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
242 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
243 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
244 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
245 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
246 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
247 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
248 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
249 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
250 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
251 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
252 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
253 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
254 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
257 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
258 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
259 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
260 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
268 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
269 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
270 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
271 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
272 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
273 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
276 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
277 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
278 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
279 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
299 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
300 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
301 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
302 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
303 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
304 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
305 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
306 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
307 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
308 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
309 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
310 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
311 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
312 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
313 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
314 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
315 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
316 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
317 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
318 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
319 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
320 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
321 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
322 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
323 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
324 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
325 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
326 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
327 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
328 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
329 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
330 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
331 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
332 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
333 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
334 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.08
Metatranscriptomes 1.92
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.54
Nodule 0.13
Rhizoplane 2.3
Rhizosphere 85.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10015462 3300001990 Bacteria 2471
2 JGI24736J21556_1003022 3300001904 Bacteria 2938
3 JGI24752J21851_1000266 3300001976 Bacteria 7281
4 JGI24752J21851_1006110 3300001976 Bacteria 1573
5 JGI24747J21853_1046519 3300001978 Bacteria 522
6 JGI24740J21852_10040019 3300001979 Bacteria 1424
7 JGI24740J21852_10091332 3300001979 Bacteria 785
8 JGI24740J21852_10115243 3300001979 Bacteria 675
9 JGI24739J22299_10007944 3300001989 Bacteria 3969
10 JGI24739J22299_10009390 3300001989 Bacteria 3644
11 JGI24739J22299_10010059 3300001989 Bacteria 3516
12 JGI24739J22299_10036400 3300001989 Bacteria 1663
13 JGI24739J22299_10052693 3300001989 Bacteria 1308
14 JGI24739J22299_10076252 3300001989 Bacteria 1035
15 JGI24739J22299_10098589 3300001989 Bacteria 883
16 JGI24737J22298_10012233 3300001990 Bacteria 2797
17 JGI24737J22298_10037437 3300001990 Bacteria 1495
18 JGI24737J22298_10048579 3300001990 Bacteria 1291
19 JGI24737J22298_10081153 3300001990 Bacteria 965
20 JGI24743J22301_10105922 3300001991 Bacteria 608
21 JGI24735J21928_10002885 3300002067 Bacteria 5917
22 JGI24735J21928_10012414 3300002067 Bacteria 2692
23 JGI24735J21928_10018234 3300002067 Bacteria 2165
24 JGI24735J21928_10021374 3300002067 Bacteria 1976
25 JGI24735J21928_10034580 3300002067 Bacteria 1489
26 JGI24735J21928_10036131 3300002067 Bacteria 1450
27 JGI24735J21928_10062145 3300002067 Bacteria 1073
28 JGI24735J21928_10098471 3300002067 Bacteria 839
29 JGI24750J21931_1000495 3300002070 Bacteria 6183
30 JGI24750J21931_1003646 3300002070 Bacteria 1850
31 JGI24748J21848_1000085 3300002074 Bacteria 28073
32 JGI24748J21848_1024167 3300002074 Bacteria 739
33 JGI24738J21930_10003443 3300002075 Bacteria 3991
34 JGI24749J21850_1000574 3300002076 Bacteria 5352
35 JGI24749J21850_1002773 3300002076 Bacteria 2456
36 JGI24035J26624_1003865 3300002126 Bacteria 1418
37 JGI24034J26672_10000069 3300002239 Bacteria 27837
38 JGI24034J26672_10031560 3300002239 Bacteria 865
39 JGI24742J22300_10003304 3300002244 Bacteria 2612
40 JGI24751J29686_10000797 3300002459 Bacteria 7367
41 JGI24751J29686_10011534 3300002459 Bacteria 1822
42 JGI24751J29686_10055603 3300002459 Bacteria 816
43 Ga0006778J45830_1070616 3300003162 Bacteria 567
44 JGI25153J46596_10000007 3300003215 Bacteria 377573
45 Ga0006777J48905_1067120 3300003308 Bacteria 505
46 Ga0032354_1014098 3300003693 Bacteria 529
47 Ga0055525_1000086 3300003759 Bacteria 150228
48 Ga0055542_1000353 3300003762 Bacteria 48131
49 Ga0055542_1014558 3300003762 Bacteria 1288
50 Ga0055529_1000377 3300003763 Bacteria 48143
51 Ga0055536_1009345 3300003781 Bacteria 4064
52 Ga0055530_10089249 3300003791 Bacteria 635
53 Ga0055531_10002547 3300003794 Bacteria 12120
54 Ga0065707_10143914 3300005295 Bacteria 1737
55 Ga0065707_10160867 3300005295 Bacteria 1564
56 Ga0065707_10198694 3300005295 Bacteria 1322
57 Ga0065707_10317993 3300005295 Bacteria 972
58 Ga0070658_10002621 3300005327 Bacteria 14984
59 Ga0070658_10525018 3300005327 Bacteria 1024
60 Ga0070658_11274513 3300005327 Bacteria 638
61 Ga0070658_11947157 3300005327 Bacteria 507
62 Ga0070676_10000416 3300005328 Bacteria 20088
63 Ga0070683_101912835 3300005329 Bacteria 570
64 Ga0070690_100001137 3300005330 Bacteria 13688
65 Ga0070670_100000178 3300005331 Bacteria 57676
66 Ga0070670_100000867 3300005331 Bacteria 23777
67 Ga0070670_100115168 3300005331 Bacteria 2318
68 Ga0070670_100784296 3300005331 Bacteria 860
69 Ga0068869_100001367 3300005334 Bacteria 14466
70 Ga0068869_100207918 3300005334 Bacteria 1546
71 Ga0070666_10000547 3300005335 Bacteria 22737
72 Ga0070666_10001181 3300005335 Bacteria 15838
73 Ga0070666_10017146 3300005335 Bacteria 4641
74 Ga0070666_10042146 3300005335 Bacteria 3053
75 Ga0070666_10062119 3300005335 Bacteria 2530
76 Ga0070680_100000824 3300005336 Bacteria 21888
77 Ga0070680_100223225 3300005336 Bacteria 1591
78 Ga0068868_100002349 3300005338 Bacteria 13095
79 Ga0070660_100002444 3300005339 Bacteria 12761
80 Ga0070660_100064482 3300005339 Bacteria 2850
81 Ga0070660_100214103 3300005339 Bacteria 1565
82 Ga0070660_101297022 3300005339 Bacteria 618
83 Ga0070689_100032724 3300005340 Bacteria 3957
84 Ga0070661_100737519 3300005344 Bacteria 805
85 Ga0070661_101521032 3300005344 Bacteria 565
86 Ga0070668_100000006 3300005347 Bacteria 176486
87 Ga0070668_100018392 3300005347 Bacteria 5246
88 Ga0070668_100039166 3300005347 Bacteria 3625
89 Ga0070668_100052169 3300005347 Bacteria 3152
90 Ga0070668_100110967 3300005347 Bacteria 2183
91 Ga0070669_100000013 3300005353 Bacteria 210577
92 Ga0070669_100000119 3300005353 Bacteria 73001
93 Ga0070669_100000958 3300005353 Bacteria 21065
94 Ga0070669_100018299 3300005353 Bacteria 5007
95 Ga0070669_100027700 3300005353 Bacteria 4079
96 Ga0070669_101088590 3300005353 Bacteria 688
97 Ga0070671_100000009 3300005355 Bacteria 206508
98 Ga0070671_100000310 3300005355 Bacteria 33094
99 Ga0070671_100012517 3300005355 Bacteria 6832
100 Ga0070671_100047789 3300005355 Bacteria 3557
101 Ga0070671_100268198 3300005355 Bacteria 1451
102 Ga0070673_100000002 3300005364 Bacteria 225084
103 Ga0070673_101932498 3300005364 Bacteria 560
104 Ga0070688_100000708 3300005365 Bacteria 16427
105 Ga0070659_100064697 3300005366 Bacteria 2895
106 Ga0070659_100258787 3300005366 Bacteria 1444
107 Ga0070659_100304107 3300005366 Bacteria 1331
108 Ga0070659_101289555 3300005366 Bacteria 647
109 Ga0070667_100000003 3300005367 Bacteria 447715
110 Ga0070667_100000322 3300005367 Bacteria 53499
111 Ga0070667_100001187 3300005367 Bacteria 23675
112 Ga0070667_100002032 3300005367 Bacteria 17924
113 Ga0070667_100007537 3300005367 Bacteria 9028
114 Ga0070667_100270147 3300005367 Bacteria 1524
115 Ga0070667_100635550 3300005367 Bacteria 985
116 Ga0070705_100006419 3300005440 Bacteria 5767
117 Ga0070694_100481958 3300005444 Bacteria 984
118 Ga0070663_100635083 3300005455 Bacteria 901
119 Ga0070678_100706137 3300005456 Bacteria 909
120 Ga0070662_100117431 3300005457 Bacteria 2035
121 Ga0070662_100174849 3300005457 Bacteria 1689
122 Ga0070662_101015642 3300005457 Bacteria 710
123 Ga0070662_101607683 3300005457 Bacteria 561
124 Ga0070681_10299263 3300005458 Bacteria 1519
125 Ga0068867_100000012 3300005459 Bacteria 118831
126 Ga0070685_10014208 3300005466 Bacteria 4212
127 Ga0070685_11297936 3300005466 Bacteria 556
128 Ga0070706_100495418 3300005467 Bacteria 1137
129 Ga0070679_100000002 3300005530 Bacteria 312066
130 Ga0070679_100814717 3300005530 Bacteria 877
131 Ga0068853_100179289 3300005539 Bacteria 1921
132 Ga0068853_100208917 3300005539 Bacteria 1779
133 Ga0068853_100687291 3300005539 Bacteria 975
134 Ga0068853_100726148 3300005539 Bacteria 948
135 Ga0068853_101085053 3300005539 Bacteria 772
136 Ga0068853_101982473 3300005539 Bacteria 564
137 Ga0070672_100358753 3300005543 Bacteria 1244
138 Ga0070686_100000181 3300005544 Bacteria 44461
139 Ga0070693_100940005 3300005547 Bacteria 650
140 Ga0070665_100000004 3300005548 Bacteria 785500
141 Ga0070665_100375971 3300005548 Bacteria 1428
142 Ga0068855_100001671 3300005563 Bacteria 27748
143 Ga0068855_100009919 3300005563 Bacteria 11484
144 Ga0068855_100808364 3300005563 Bacteria 996
145 Ga0070664_100083389 3300005564 Bacteria 2757
146 Ga0068857_100077096 3300005577 Bacteria 2973
147 Ga0068857_100095350 3300005577 Bacteria 2665
148 Ga0068857_100116808 3300005577 Bacteria 2400
149 Ga0068857_100127781 3300005577 Bacteria 2291
150 Ga0068857_100153758 3300005577 Bacteria 2085
151 Ga0068857_100287427 3300005577 Bacteria 1513
152 Ga0068857_100373036 3300005577 Bacteria 1324
153 Ga0068857_101306776 3300005577 Bacteria 704
154 Ga0068857_102340343 3300005577 Bacteria 524
155 Ga0068854_100014478 3300005578 Bacteria 5200
156 Ga0068854_100018166 3300005578 Bacteria 4717
157 Ga0068854_100026542 3300005578 Bacteria 3982
158 Ga0068854_100055570 3300005578 Bacteria 2850
159 Ga0068854_100257475 3300005578 Bacteria 1396
160 Ga0068854_100296442 3300005578 Bacteria 1307
161 Ga0068854_100558147 3300005578 Bacteria 972
162 Ga0068854_101214845 3300005578 Bacteria 676
163 Ga0068856_100045341 3300005614 Bacteria 4329
164 Ga0068856_100060059 3300005614 Bacteria 3756
165 Ga0068856_100316171 3300005614 Bacteria 1579
166 Ga0068856_100620865 3300005614 Bacteria 1102
167 Ga0068852_100001276 3300005616 Bacteria 16811
168 Ga0068852_100187094 3300005616 Bacteria 1951
169 Ga0068852_100210428 3300005616 Bacteria 1844
170 Ga0068852_100384086 3300005616 Bacteria 1378
171 Ga0068852_100442281 3300005616 Bacteria 1286
172 Ga0068852_100670318 3300005616 Bacteria 1046
173 Ga0068859_100003101 3300005617 Bacteria 16871
174 Ga0068859_100003140 3300005617 Bacteria 16798
175 Ga0068859_100005086 3300005617 Bacteria 13363
176 Ga0068859_100126303 3300005617 Bacteria 2627
177 Ga0068859_100315109 3300005617 Bacteria 1658
178 Ga0068864_100000183 3300005618 Bacteria 57684
179 Ga0068864_100001051 3300005618 Bacteria 23179
180 Ga0068864_100001150 3300005618 Bacteria 22087
181 Ga0068864_100002014 3300005618 Bacteria 16753
182 Ga0068866_10456153 3300005718 Bacteria 837
183 Ga0068861_100000687 3300005719 Bacteria 20197
184 Ga0068861_100010768 3300005719 Bacteria 6357
185 Ga0068861_100051576 3300005719 Bacteria 3123
186 Ga0068851_10142940 3300005834 Bacteria 1302
187 Ga0068863_100002515 3300005841 Bacteria 18207
188 Ga0068863_100012020 3300005841 Bacteria 8364
189 Ga0068863_100036402 3300005841 Bacteria 4688
190 Ga0068863_100039200 3300005841 Bacteria 4508
191 Ga0068863_100059963 3300005841 Bacteria 3600
192 Ga0068863_101300127 3300005841 Bacteria 734
193 Ga0068863_101560397 3300005841 Bacteria 669
194 Ga0068858_100000920 3300005842 Bacteria 30532
195 Ga0068858_100002212 3300005842 Bacteria 19691
196 Ga0068858_100004181 3300005842 Bacteria 14205
197 Ga0068858_100004950 3300005842 Bacteria 13050
198 Ga0068860_100000068 3300005843 Bacteria 179208
199 Ga0068860_100002805 3300005843 Bacteria 18132
200 Ga0068860_100003455 3300005843 Bacteria 16250
201 Ga0068860_100009225 3300005843 Bacteria 9806
202 Ga0068860_100049782 3300005843 Bacteria 3989
203 Ga0068860_100741843 3300005843 Bacteria 993
204 Ga0068860_101543844 3300005843 Bacteria 686
205 Ga0068860_102651255 3300005843 Bacteria 520
206 Ga0068862_100000006 3300005844 Bacteria 346828
207 Ga0068862_100000160 3300005844 Bacteria 74917
208 Ga0068862_100000894 3300005844 Bacteria 28961
209 Ga0068862_100007026 3300005844 Bacteria 9350
210 Ga0068862_100017369 3300005844 Bacteria 5991
211 Ga0068862_100047193 3300005844 Bacteria 3675
212 Ga0075364_10425274 3300006051 Bacteria 907
213 Ga0075366_10112303 3300006195 Bacteria 1640
214 Ga0075366_10302839 3300006195 Bacteria 978
215 Ga0075366_10747121 3300006195 Bacteria 608
216 Ga0075370_10142822 3300006353 Bacteria 1400
217 Ga0068865_100000004 3300006881 Bacteria 226236
218 Ga0068865_101806364 3300006881 Bacteria 552
219 Ga0097620_100003101 3300006931 Bacteria 16871
220 Ga0097620_100003140 3300006931 Bacteria 16798
221 Ga0097620_100005086 3300006931 Bacteria 13363
222 Ga0097620_100126299 3300006931 Bacteria 2627
223 Ga0097620_100315118 3300006931 Bacteria 1658
224 Ga0079104_1068043 3300006946 Bacteria 753
225 Ga0075435_100728405 3300007076 Bacteria 862
226 Ga0105251_10004083 3300009011 Bacteria 10231
227 Ga0105251_10114818 3300009011 Bacteria 1225
228 Ga0105251_10157131 3300009011 Bacteria 1025
229 Ga0105250_10281365 3300009092 Bacteria 716
230 Ga0105240_10058338 3300009093 Bacteria 4819
231 Ga0105240_10594745 3300009093 Bacteria 1219
232 Ga0105240_11325424 3300009093 Bacteria 759
233 Ga0105245_10004262 3300009098 Bacteria 12680
234 Ga0105247_10002301 3300009101 Bacteria 13054
235 Ga0105247_10003906 3300009101 Bacteria 9623
236 Ga0105247_10074686 3300009101 Bacteria 2127
237 Ga0105247_10900589 3300009101 Bacteria 683
238 Ga0105243_10000146 3300009148 Bacteria 81008
239 Ga0105243_10149830 3300009148 Bacteria 2000
240 Ga0105241_10166380 3300009174 Bacteria 1817
241 Ga0105241_10863534 3300009174 Bacteria 838
242 Ga0105241_11234489 3300009174 Bacteria 709
243 Ga0105242_10000497 3300009176 Bacteria 31053
244 Ga0105248_10000016 3300009177 Bacteria 308151
245 Ga0105248_10003803 3300009177 Bacteria 16733
246 Ga0105248_10030756 3300009177 Bacteria 5997
247 Ga0105248_10046039 3300009177 Bacteria 4890
248 Ga0105248_10046883 3300009177 Bacteria 4846
249 Ga0105248_10047627 3300009177 Bacteria 4808
250 Ga0105248_10056537 3300009177 Bacteria 4402
251 Ga0105248_10306743 3300009177 Bacteria 1788
252 Ga0105248_11444533 3300009177 Bacteria 778
253 Ga0105237_10034455 3300009545 Bacteria 5127
254 Ga0105237_10225531 3300009545 Bacteria 1874
255 Ga0105237_10658202 3300009545 Bacteria 1054
256 Ga0105238_10029748 3300009551 Bacteria 5563
257 Ga0105238_10112959 3300009551 Bacteria 2696
258 Ga0105238_10117478 3300009551 Bacteria 2640
259 Ga0105238_12641540 3300009551 Bacteria 538
260 Ga0105249_10000355 3300009553 Bacteria 45955
261 Ga0105249_10002669 3300009553 Bacteria 15422
262 Ga0105249_10020475 3300009553 Bacteria 5913
263 Ga0105249_10040393 3300009553 Bacteria 4238
264 Ga0105249_10126707 3300009553 Bacteria 2432
265 Ga0105249_10249460 3300009553 Bacteria 1759
266 Ga0105239_10169627 3300010375 Bacteria 2440
267 Ga0105239_10255811 3300010375 Bacteria 1967
268 Ga0105239_10629034 3300010375 Bacteria 1225
269 Ga0105239_10802979 3300010375 Bacteria 1078
270 Ga0105246_10000138 3300011119 Bacteria 33809
271 Ga0157326_1000736 3300012513 Bacteria 3838
272 Ga0157373_11580497 3300013100 Bacteria 502
273 Ga0157371_10000842 3300013102 Bacteria 35113
274 Ga0157371_10019554 3300013102 Bacteria 4991
275 Ga0157371_10487946 3300013102 Bacteria 909
276 Ga0157371_10502727 3300013102 Bacteria 895
277 Ga0157371_10559193 3300013102 Bacteria 848
278 Ga0157370_10030422 3300013104 Bacteria 5290
279 Ga0157370_10204132 3300013104 Bacteria 1833
280 Ga0157370_10800772 3300013104 Bacteria 857
281 Ga0157370_10952631 3300013104 Bacteria 778
282 Ga0157370_11259700 3300013104 Bacteria 667
283 Ga0157369_10135222 3300013105 Bacteria 2610
284 Ga0157369_10917871 3300013105 Bacteria 898
285 Ga0157374_10001104 3300013296 Bacteria 23221
286 Ga0157374_10780796 3300013296 Bacteria 971
287 Ga0157378_10006343 3300013297 Bacteria 10349
288 Ga0157378_10499395 3300013297 Bacteria 1215
289 Ga0163162_10001771 3300013306 Bacteria 20235
290 Ga0163162_10022071 3300013306 Bacteria 6272
291 Ga0163162_10188013 3300013306 Bacteria 2192
292 Ga0163162_10250658 3300013306 Bacteria 1902
293 Ga0157372_10231368 3300013307 Bacteria 2143
294 Ga0157372_10238068 3300013307 Bacteria 2112
295 Ga0157372_10528323 3300013307 Bacteria 1375
296 Ga0157372_10647068 3300013307 Bacteria 1231
297 Ga0157372_12347563 3300013307 Bacteria 612
298 Ga0157375_10000587 3300013308 Bacteria 32327
299 Ga0157375_10536204 3300013308 Bacteria 1333
300 Ga0163163_10047074 3300014325 Bacteria 4238
301 Ga0163163_10161643 3300014325 Bacteria 2285
302 Ga0157380_10000087 3300014326 Bacteria 50956
303 Ga0157380_10017903 3300014326 Bacteria 5253
304 Ga0157380_10188637 3300014326 Bacteria 1818
305 Ga0157380_13483673 3300014326 Bacteria 504
306 Ga0157377_11037338 3300014745 Bacteria 624
307 Ga0157379_10074401 3300014968 Bacteria 3041
308 Ga0157379_10477506 3300014968 Bacteria 1153
309 Ga0157379_11247450 3300014968 Bacteria 716
310 Ga0157376_10000131 3300014969 Bacteria 51790
311 Ga0163161_10002585 3300017792 Bacteria 12911
312 Ga0163161_10620377 3300017792 Bacteria 893
313 Ga0163161_10786492 3300017792 Bacteria 798
314 Ga0207672_1000794 3300025223 Bacteria 3371
315 Ga0209563_100024 3300025230 Bacteria 601155
316 Ga0209646_1008350 3300025246 Bacteria 1667
317 Ga0209026_1012633 3300025250 Bacteria 1464
318 Ga0209148_1000008 3300025254 Bacteria 1504371
319 Ga0209148_1000074 3300025254 Bacteria 314356
320 Ga0209233_1071651 3300025261 Bacteria 639
321 Ga0209455_1000002 3300025272 Bacteria 1505459
322 Ga0209455_1020563 3300025272 Bacteria 1302
323 Ga0207673_1045286 3300025290 Bacteria 620
324 Ga0209676_1000060 3300025292 Bacteria 338238
325 Ga0209676_1000226 3300025292 Bacteria 124004
326 Ga0209758_1000017 3300025297 Bacteria 754393
327 Ga0209050_1003101 3300025298 Bacteria 12745
328 Ga0209050_1102653 3300025298 Bacteria 563
329 Ga0209257_1000392 3300025304 Bacteria 87104
330 Ga0207697_10001743 3300025315 Bacteria 11688
331 Ga0207697_10367646 3300025315 Bacteria 639
332 Ga0207713_1014886 3300025735 Bacteria 4014
333 Ga0207713_1055056 3300025735 Bacteria 1555
334 Ga0207713_1178811 3300025735 Bacteria 664
335 Ga0207642_10270610 3300025899 Bacteria 973
336 Ga0207710_10007517 3300025900 Bacteria 4614
337 Ga0207710_10399660 3300025900 Bacteria 705
338 Ga0207688_10216692 3300025901 Bacteria 1152
339 Ga0207688_11101321 3300025901 Bacteria 501
340 Ga0207680_10000004 3300025903 Bacteria 827324
341 Ga0207680_10000418 3300025903 Bacteria 20249
342 Ga0207680_10033138 3300025903 Bacteria 2944
343 Ga0207680_10099024 3300025903 Bacteria 1870
344 Ga0207680_11080810 3300025903 Bacteria 574
345 Ga0207647_10005831 3300025904 Bacteria 8981
346 Ga0207647_10023553 3300025904 Bacteria 4071
347 Ga0207647_10105475 3300025904 Bacteria 1670
348 Ga0207647_10109834 3300025904 Bacteria 1631
349 Ga0207647_10426139 3300025904 Bacteria 745
350 Ga0207647_10462163 3300025904 Bacteria 711
351 Ga0207647_10774541 3300025904 Bacteria 518
352 Ga0207645_10009635 3300025907 Bacteria 6673
353 Ga0207705_10000084 3300025909 Bacteria 116809
354 Ga0207705_10308546 3300025909 Bacteria 1214
355 Ga0207654_10622447 3300025911 Bacteria 771
356 Ga0207654_10915357 3300025911 Bacteria 636
357 Ga0207707_10752852 3300025912 Bacteria 815
358 Ga0207695_10017127 3300025913 Bacteria 8447
359 Ga0207695_10017716 3300025913 Bacteria 8271
360 Ga0207695_10125643 3300025913 Bacteria 2527
361 Ga0207695_11244698 3300025913 Bacteria 624
362 Ga0207671_10158857 3300025914 Bacteria 1749
363 Ga0207671_10219883 3300025914 Bacteria 1488
364 Ga0207671_11571874 3300025914 Bacteria 506
365 Ga0207660_10003071 3300025917 Bacteria 10911
366 Ga0207660_10287202 3300025917 Bacteria 1307
367 Ga0207657_10004951 3300025919 Bacteria 14018
368 Ga0207657_10074466 3300025919 Bacteria 2867
369 Ga0207657_10218235 3300025919 Bacteria 1529
370 Ga0207649_10025862 3300025920 Bacteria 3428
371 Ga0207649_10124038 3300025920 Bacteria 1745
372 Ga0207652_10000001 3300025921 Bacteria 1006643
373 Ga0207652_10000002 3300025921 Bacteria 878035
374 Ga0207681_10000001 3300025923 Bacteria 1105841
375 Ga0207681_10000008 3300025923 Bacteria 414329
376 Ga0207681_10000704 3300025923 Bacteria 21968
377 Ga0207681_10016779 3300025923 Bacteria 4588
378 Ga0207681_10069647 3300025923 Bacteria 2447
379 Ga0207681_11835153 3300025923 Bacteria 505
380 Ga0207694_10011474 3300025924 Bacteria 6688
381 Ga0207694_10087112 3300025924 Bacteria 2459
382 Ga0207694_10897574 3300025924 Bacteria 749
383 Ga0207694_11302166 3300025924 Bacteria 614
384 Ga0207694_11597144 3300025924 Bacteria 550
385 Ga0207650_10000050 3300025925 Bacteria 169589
386 Ga0207650_10002940 3300025925 Bacteria 11754
387 Ga0207650_10015038 3300025925 Bacteria 5383
388 Ga0207650_10268055 3300025925 Bacteria 1387
389 Ga0207650_10544903 3300025925 Bacteria 972
390 Ga0207687_10039071 3300025927 Bacteria 3247
391 Ga0207644_10000006 3300025931 Bacteria 408793
392 Ga0207644_10000028 3300025931 Bacteria 142921
393 Ga0207644_10000124 3300025931 Bacteria 56579
394 Ga0207644_10000292 3300025931 Bacteria 33037
395 Ga0207644_10001291 3300025931 Bacteria 16119
396 Ga0207644_10127663 3300025931 Bacteria 1943
397 Ga0207690_10126488 3300025932 Bacteria 1864
398 Ga0207690_10520785 3300025932 Bacteria 964
399 Ga0207690_10691990 3300025932 Bacteria 838
400 Ga0207706_10107769 3300025933 Bacteria 2451
401 Ga0207706_10305191 3300025933 Bacteria 1386
402 Ga0207706_10502254 3300025933 Bacteria 1047
403 Ga0207686_10004317 3300025934 Bacteria 7623
404 Ga0207709_10001457 3300025935 Bacteria 16479
405 Ga0207709_10098211 3300025935 Bacteria 1930
406 Ga0207670_10053948 3300025936 Bacteria 2710
407 Ga0207669_11768099 3300025937 Bacteria 528
408 Ga0207704_10000005 3300025938 Bacteria 225353
409 Ga0207704_11783806 3300025938 Bacteria 529
410 Ga0207691_10341864 3300025940 Bacteria 1281
411 Ga0207711_10000022 3300025941 Bacteria 340441
412 Ga0207711_10000662 3300025941 Bacteria 34294
413 Ga0207711_10026087 3300025941 Bacteria 4902
414 Ga0207711_10055697 3300025941 Bacteria 3395
415 Ga0207711_10094318 3300025941 Bacteria 2637
416 Ga0207711_10276754 3300025941 Bacteria 1545
417 Ga0207711_10309852 3300025941 Bacteria 1457
418 Ga0207711_10623807 3300025941 Bacteria 1006
419 Ga0207711_11522888 3300025941 Bacteria 612
420 Ga0207689_10001653 3300025942 Bacteria 21135
421 Ga0207679_10080824 3300025945 Bacteria 2483
422 Ga0207667_10014616 3300025949 Bacteria 8939
423 Ga0207667_10254280 3300025949 Bacteria 1797
424 Ga0207651_10000007 3300025960 Bacteria 225286
425 Ga0207651_11901788 3300025960 Bacteria 535
426 Ga0207712_10000072 3300025961 Bacteria 124006
427 Ga0207712_10017601 3300025961 Bacteria 4645
428 Ga0207712_10021578 3300025961 Bacteria 4229
429 Ga0207712_10072291 3300025961 Bacteria 2483
430 Ga0207712_10108640 3300025961 Bacteria 2076
431 Ga0207668_10000026 3300025972 Bacteria 128309
432 Ga0207668_10000675 3300025972 Bacteria 20963
433 Ga0207668_10003566 3300025972 Bacteria 9144
434 Ga0207668_10056114 3300025972 Bacteria 2742
435 Ga0207668_10095417 3300025972 Bacteria 2195
436 Ga0207640_10012065 3300025981 Bacteria 4912
437 Ga0207640_10012353 3300025981 Bacteria 4860
438 Ga0207640_10074303 3300025981 Bacteria 2300
439 Ga0207640_10081128 3300025981 Bacteria 2217
440 Ga0207640_10443045 3300025981 Bacteria 1068
441 Ga0207640_10526714 3300025981 Bacteria 989
442 Ga0207640_10872620 3300025981 Bacteria 784
443 Ga0207658_10000002 3300025986 Bacteria 1364188
444 Ga0207658_10000608 3300025986 Bacteria 31752
445 Ga0207658_10000967 3300025986 Bacteria 23707
446 Ga0207658_10001977 3300025986 Bacteria 15294
447 Ga0207658_10003917 3300025986 Bacteria 10465
448 Ga0207658_10082023 3300025986 Bacteria 2475
449 Ga0207677_10001155 3300026023 Bacteria 14422
450 Ga0207703_10000849 3300026035 Bacteria 29915
451 Ga0207703_10002381 3300026035 Bacteria 16348
452 Ga0207703_10010115 3300026035 Bacteria 7392
453 Ga0207703_10011114 3300026035 Bacteria 7010
454 Ga0207639_10093564 3300026041 Bacteria 2411
455 Ga0207639_10300634 3300026041 Bacteria 1418
456 Ga0207639_10385948 3300026041 Bacteria 1259
457 Ga0207639_10391395 3300026041 Bacteria 1250
458 Ga0207639_10846840 3300026041 Bacteria 853
459 Ga0207678_10644277 3300026067 Bacteria 931
460 Ga0207678_10802608 3300026067 Bacteria 831
461 Ga0207702_10013739 3300026078 Bacteria 6726
462 Ga0207702_10049546 3300026078 Bacteria 3545
463 Ga0207702_11819071 3300026078 Bacteria 601
464 Ga0207641_10000179 3300026088 Bacteria 88061
465 Ga0207641_10001414 3300026088 Bacteria 23667
466 Ga0207641_10010071 3300026088 Bacteria 7773
467 Ga0207641_10027742 3300026088 Bacteria 4677
468 Ga0207641_10201653 3300026088 Bacteria 1834
469 Ga0207648_10000005 3300026089 Bacteria 225083
470 Ga0207676_10000004 3300026095 Bacteria 725417
471 Ga0207676_10000040 3300026095 Bacteria 167947
472 Ga0207676_10000190 3300026095 Bacteria 53850
473 Ga0207676_10000613 3300026095 Bacteria 29202
474 Ga0207676_10003561 3300026095 Bacteria 11002
475 Ga0207676_10004335 3300026095 Bacteria 10037
476 Ga0207676_11078161 3300026095 Bacteria 793
477 Ga0207676_12624123 3300026095 Bacteria 500
478 Ga0207674_10026868 3300026116 Bacteria 6105
479 Ga0207674_10051090 3300026116 Bacteria 4220
480 Ga0207674_10161760 3300026116 Bacteria 2193
481 Ga0207674_10176484 3300026116 Bacteria 2089
482 Ga0207674_10184225 3300026116 Bacteria 2038
483 Ga0207674_11877723 3300026116 Bacteria 565
484 Ga0207675_100002079 3300026118 Bacteria 19902
485 Ga0207675_100002340 3300026118 Bacteria 18785
486 Ga0207675_100113823 3300026118 Bacteria 2554
487 Ga0207675_100131973 3300026118 Bacteria 2369
488 Ga0207675_100332869 3300026118 Bacteria 1485
489 Ga0207675_100626001 3300026118 Bacteria 1081
490 Ga0207698_10008334 3300026142 Bacteria 6548
491 Ga0207698_10024433 3300026142 Bacteria 4241
492 Ga0207698_10059354 3300026142 Bacteria 2970
493 Ga0207698_11033527 3300026142 Bacteria 833
494 Ga0207698_11179418 3300026142 Bacteria 779
495 Ga0207698_12527130 3300026142 Bacteria 524
496 Ga0209967_1028934 3300027364 Bacteria 827
497 Ga0209982_1057082 3300027552 Bacteria 633
498 Ga0210002_1084160 3300027617 Bacteria 568
499 Ga0209971_1042566 3300027682 Bacteria 1094
500 Ga0209974_10157792 3300027876 Bacteria 822
501 Ga0209974_10227135 3300027876 Bacteria 697
502 Ga0268266_10000009 3300028379 Bacteria 1097737
503 Ga0268266_10264270 3300028379 Bacteria 1595
504 Ga0268266_10437299 3300028379 Bacteria 1242
505 Ga0268265_10000002 3300028380 Bacteria 1035381
506 Ga0268265_10000171 3300028380 Bacteria 77721
507 Ga0268265_10001260 3300028380 Bacteria 21840
508 Ga0268265_10010758 3300028380 Bacteria 6178
509 Ga0268265_10025484 3300028380 Bacteria 4199
510 Ga0268265_10187595 3300028380 Bacteria 1782
511 Ga0268264_10000006 3300028381 Bacteria 827324
512 Ga0268264_10000103 3300028381 Bacteria 222439
513 Ga0268264_10000221 3300028381 Bacteria 111397
514 Ga0268264_10006519 3300028381 Bacteria 9831
515 Ga0268264_10009510 3300028381 Bacteria 8051
516 Ga0307517_10206460 3300028786 Bacteria 1218
517 Ga0316177_1195044 3300030731 Bacteria 2153
518 Ga0307513_10052770 3300031456 Bacteria 4376
519 Ga0307408_100251612 3300031548 Bacteria 1458
520 Ga0307408_100742500 3300031548 Bacteria 886
521 Ga0307408_100825739 3300031548 Bacteria 843
522 Ga0307408_100980730 3300031548 Bacteria 778
523 Ga0307408_101083596 3300031548 Bacteria 742
524 Ga0307405_10064549 3300031731 Bacteria 2328
525 Ga0307405_10113810 3300031731 Bacteria 1838
526 Ga0307405_10345560 3300031731 Bacteria 1145
527 Ga0307405_10533606 3300031731 Bacteria 946
528 Ga0307405_11527357 3300031731 Bacteria 587
529 Ga0307405_11760669 3300031731 Bacteria 550
530 Ga0307405_12080106 3300031731 Bacteria 509
531 Ga0307413_10103574 3300031824 Bacteria 1887
532 Ga0307413_10122485 3300031824 Bacteria 1764
533 Ga0307413_10144419 3300031824 Bacteria 1649
534 Ga0307413_12026844 3300031824 Bacteria 519
535 Ga0307413_12102964 3300031824 Bacteria 510
536 Ga0307410_10017551 3300031852 Bacteria 4302
537 Ga0307410_10034873 3300031852 Bacteria 3263
538 Ga0307410_10112306 3300031852 Bacteria 1973
539 Ga0307406_10077834 3300031901 Bacteria 2195
540 Ga0307406_10202986 3300031901 Bacteria 1461
541 Ga0307406_10839995 3300031901 Bacteria 778
542 Ga0307406_11245948 3300031901 Bacteria 647
543 Ga0307406_12058554 3300031901 Bacteria 511
544 Ga0307407_10039033 3300031903 Bacteria 2637
545 Ga0307407_10068166 3300031903 Bacteria 2106
546 Ga0307412_10012635 3300031911 Bacteria 4928
547 Ga0307412_10014477 3300031911 Bacteria 4652
548 Ga0307412_10023141 3300031911 Bacteria 3819
549 Ga0307412_10027831 3300031911 Bacteria 3530
550 Ga0307412_10041279 3300031911 Bacteria 2989
551 Ga0307412_10134074 3300031911 Bacteria 1804
552 Ga0307412_10238317 3300031911 Bacteria 1405
553 Ga0307412_10279749 3300031911 Bacteria 1309
554 Ga0307412_10346062 3300031911 Bacteria 1192
555 Ga0307412_10591208 3300031911 Bacteria 938
556 Ga0307412_10683218 3300031911 Bacteria 879
557 Ga0307412_11359105 3300031911 Bacteria 641
558 Ga0307409_100104733 3300031995 Bacteria 2357
559 Ga0307409_100121157 3300031995 Bacteria 2215
560 Ga0307409_100188343 3300031995 Bacteria 1834
561 Ga0307416_100081670 3300032002 Bacteria 2734
562 Ga0307416_100276738 3300032002 Bacteria 1652
563 Ga0307416_100606780 3300032002 Bacteria 1175
564 Ga0307416_100926260 3300032002 Bacteria 972
565 Ga0307416_101514025 3300032002 Bacteria 777
566 Ga0307416_103321709 3300032002 Bacteria 538
567 Ga0307414_10000136 3300032004 Bacteria 49913
568 Ga0307414_10002538 3300032004 Bacteria 9589
569 Ga0307414_10013200 3300032004 Bacteria 4911
570 Ga0307414_10164710 3300032004 Bacteria 1765
571 Ga0307414_10234440 3300032004 Bacteria 1515
572 Ga0307414_10391439 3300032004 Bacteria 1204
573 Ga0307414_10536328 3300032004 Bacteria 1041
574 Ga0307414_10887653 3300032004 Bacteria 817
575 Ga0307414_10951832 3300032004 Bacteria 789
576 Ga0307414_11738626 3300032004 Bacteria 582
577 Ga0307414_11990435 3300032004 Bacteria 542
578 Ga0307414_12085014 3300032004 Bacteria 529
579 Ga0307411_10032530 3300032005 Bacteria 3223
580 Ga0307411_10075565 3300032005 Bacteria 2300
581 Ga0307411_10092722 3300032005 Bacteria 2113
582 Ga0307411_10207421 3300032005 Bacteria 1510
583 Ga0307415_100448452 3300032126 Bacteria 1115
584 Ga0307510_10003391 3300033180 Bacteria 18599
585 Ga0307510_10380779 3300033180 Bacteria 856
586 Ga0373948_0169374 3300034817 Bacteria 555
587 Ga0373932_0015327 3300035112 Bacteria 1942
588 Ga0373932_0246634 3300035112 Bacteria 650
589 Ga0373943_0230606 3300035170 Bacteria 1034
590 Ga0373946_0058783 3300035171 Bacteria 1630
591 Ga0373935_0301593 3300035692 Bacteria 1132
592 Ga0373927_0107858 3300035695 Bacteria 1814
593 Ga0373947_0265446 3300035725 Bacteria 1138
594 Ga0395899_0000738 3300037312 Bacteria 32643
595 Ga0395899_0024662 3300037312 Bacteria 4545
596 Ga0395899_0134648 3300037312 Bacteria 1762
597 Ga0395900_0143511 3300037418 Bacteria 2443
598 Ga0395900_1061371 3300037418 Bacteria 728
599 Ga0395900_1464595 3300037418 Bacteria 595
600 Ga0395900_1564069 3300037418 Bacteria 571
601 Ga0395905_0046291 3300037471 Bacteria 4079
602 Ga0395905_0060777 3300037471 Bacteria 3533
603 Ga0395905_0149090 3300037471 Bacteria 2200
604 Ga0395905_0496828 3300037471 Bacteria 1120
605 Ga0395905_0585702 3300037471 Bacteria 1017
606 Ga0395901_0079992 3300038443 Bacteria 3412
607 Ga0395901_0104641 3300038443 Bacteria 2970
608 Ga0395901_0207081 3300038443 Bacteria 2054
609 Ga0395901_0219501 3300038443 Bacteria 1987
610 Ga0395901_1833055 3300038443 Bacteria 555
611 Ga0237819_00702 3300038705 Bacteria 10872
612 Ga0237816_00591 3300039145 Bacteria 3070
613 Ga0451789_0540734 3300041443 Bacteria 649
614 Ga0451789_0943086 3300041443 Bacteria 639
615 Ga0451791_1228639 3300041451 Bacteria 592
616 Ga0451793_0334588 3300041452 Bacteria 589
617 Ga0451801_01071 3300041455 Bacteria 587
618 Ga0451795_0888193 3300041456 Bacteria 574
619 Ga0451802_0602411 3300041460 Bacteria 517
620 Ga0451805_073244 3300041461 Bacteria 638
621 Ga0451804_0674792 3300041463 Bacteria 601
622 Ga0451807_0682885 3300041486 Bacteria 889
623 Ga0451837_0232942 3300041494 Bacteria 781
624 Ga0451837_0932992 3300041494 Bacteria 557
625 Ga0451841_0723032 3300041498 Bacteria 659
626 Ga0451853_3164471 3300041512 Bacteria 682
627 Ga0439448_0002892 3300042005 Bacteria 4705
628 Ga0439432_075293 3300042006 Bacteria 1026
629 Ga0439450_053772 3300042008 Bacteria 962
630 Ga0439454_027297 3300042011 Bacteria 877
631 Ga0439455_0031210 3300042012 Bacteria 1325
632 Ga0439458_0000411 3300042157 Bacteria 10757
633 Ga0439458_0023574 3300042157 Bacteria 1435
634 Ga0451577_0793079 3300042876 Bacteria 856
635 Ga0466963_0764213 3300044694 Bacteria 682
636 Ga0453684_0144988 3300044712 Bacteria 2830
637 Ga0466971_0013453 3300044719 Bacteria 3595
638 Ga0466957_0060779 3300044842 Bacteria 2317
639 Ga0451576_0287511 3300045051 Bacteria 1719
640 Ga0451576_1678546 3300045051 Bacteria 658
641 Ga0466958_0045403 3300045836 Bacteria 2650
642 Ga0466967_0814319 3300045976 Bacteria 927
643 Ga0495592_0433362 3300046454 Bacteria 827
644 Ga0495638_0588644 3300046460 Bacteria 548
645 Ga0495607_0009991 3300046501 Bacteria 6393
646 Ga0495583_0027264 3300046506 Bacteria 2821
647 Ga0495606_0032104 3300046507 Bacteria 3642
648 Ga0495606_0097322 3300046507 Bacteria 1798
649 Ga0495620_0067190 3300046515 Bacteria 1476
650 Ga0495637_0020614 3300046520 Bacteria 3031
651 Ga0495643_0036230 3300046522 Bacteria 2712
652 Ga0495643_0056975 3300046522 Bacteria 2084
653 Ga0495643_0159163 3300046522 Bacteria 1112
654 Ga0495663_0044134 3300046525 Bacteria 1364
655 Ga0495654_0021389 3300046530 Bacteria 3365
656 Ga0495609_0050693 3300046538 Bacteria 1850
657 Ga0495621_0153376 3300046539 Bacteria 907
658 Ga0495597_0096319 3300046542 Bacteria 1251
659 Ga0495633_0164810 3300046558 Bacteria 1022
660 Ga0495668_0000004 3300046616 Bacteria 574236
661 Ga0495668_0018119 3300046616 Bacteria 4072
662 Ga0495668_0027073 3300046616 Bacteria 3249
663 Ga0495668_0058282 3300046616 Bacteria 2131
664 Ga0495625_0008532 3300046660 Bacteria 8729
665 Ga0495625_0042708 3300046660 Bacteria 3292
666 Ga0495625_0284716 3300046660 Bacteria 1062
667 Ga0495635_1093518 3300046663 Bacteria 505
668 Ga0495669_0132247 3300046684 Bacteria 1175
669 Ga0495670_0300947 3300046691 Bacteria 859
670 Ga0495660_0183195 3300046810 Bacteria 1012
671 Ga0495687_004335 3300047443 Bacteria 9654
672 Ga0495677_0119957 3300047445 Bacteria 1002
673 Ga0496100_0721524 3300048903 Bacteria 779
674 Ga0496102_0234565 3300048905 Bacteria 1730
675 Ga0496103_0061206 3300048906 Bacteria 2341
676 Ga0496103_0247355 3300048906 Bacteria 1147
677 Ga0496104_1028999 3300048907 Bacteria 727
678 Ga0496107_0499920 3300048910 Bacteria 902
679 Ga0496113_0184797 3300048916 Bacteria 1653
680 Ga0496113_0756098 3300048916 Bacteria 774
681 Ga0496117_0003839 3300048920 Bacteria 17093
682 Ga0496117_0007266 3300048920 Bacteria 10884
683 Ga0496117_0496874 3300048920 Bacteria 592
684 Ga0496118_0000901 3300048921 Bacteria 46540
685 Ga0496118_0007049 3300048921 Bacteria 12084
686 Ga0496118_0042347 3300048921 Bacteria 3594
687 Ga0496118_0367527 3300048921 Bacteria 760
688 Ga0496118_0395273 3300048921 Bacteria 720
689 Ga0496121_0090548 3300048924 Bacteria 2391
690 Ga0496121_0167769 3300048924 Bacteria 1598
691 Ga0496121_0289737 3300048924 Bacteria 1116
692 Ga0496122_0221186 3300048925 Bacteria 1086
693 Ga0496123_0029600 3300048926 Bacteria 4026
694 Ga0496123_0038218 3300048926 Bacteria 3377
695 Ga0496124_0000192 3300048927 Bacteria 120980
696 Ga0496124_0001412 3300048927 Bacteria 35756
697 Ga0496124_0028878 3300048927 Bacteria 4952
698 Ga0496124_0079741 3300048927 Bacteria 2695
699 Ga0496124_0096167 3300048927 Bacteria 2406
700 Ga0496125_0066180 3300048928 Bacteria 2857
701 Ga0496125_0118299 3300048928 Bacteria 1898
702 Ga0496126_0433319 3300048929 Bacteria 1061
703 Ga0496126_1157881 3300048929 Bacteria 571
704 Ga0495682_0258250 3300049460 Bacteria 616
705 Ga0501293_012339 3300049516 Bacteria 757
706 Ga0501298_032011 3300049521 Bacteria 1036
707 Ga0501300_034092 3300049523 Bacteria 756
708 Ga0501320_012355 3300049536 Bacteria 896
709 Ga0501320_028028 3300049536 Bacteria 688
710 Ga0501321_075558 3300049537 Bacteria 530
711 Ga0501326_14218 3300049542 Bacteria 501
712 Ga0501333_013451 3300049549 Bacteria 606
713 Ga0501334_20069 3300049550 Bacteria 534
714 Ga0501335_039037 3300049551 Bacteria 555
715 Ga0501336_007516 3300049552 Bacteria 828
716 Ga0501337_012984 3300049553 Bacteria 626
717 Ga0501338_09985 3300049554 Bacteria 636
718 Ga0501032_0010668 3300049569 Bacteria 6614
719 Ga0501032_0056543 3300049569 Bacteria 2637
720 Ga0501033_0001724 3300049570 Bacteria 19138
721 Ga0501034_0004606 3300049571 Bacteria 15279
722 Ga0501036_0529121 3300049572 Bacteria 980
723 Ga0501036_0589414 3300049572 Bacteria 923
724 Ga0501036_0997233 3300049572 Bacteria 686
725 Ga0501038_0337306 3300049574 Bacteria 1176
726 Ga0501042_0961576 3300049578 Bacteria 622
727 Ga0501043_0028300 3300049579 Bacteria 4399
728 Ga0501043_0383773 3300049579 Bacteria 1063
729 Ga0501046_1148120 3300049580 Bacteria 535
730 Ga0501047_0000256 3300049581 Bacteria 62551
731 Ga0501047_0026761 3300049581 Bacteria 5552
732 Ga0501047_0215173 3300049581 Bacteria 1778
733 Ga0501047_0642220 3300049581 Bacteria 881
734 Ga0501048_0536426 3300049582 Bacteria 839
735 Ga0501067_0154694 3300049583 Bacteria 1277
736 Ga0501067_0799899 3300049583 Bacteria 531
737 Ga0501069_0702101 3300049585 Bacteria 610
738 Ga0501223_030647 3300049663 Bacteria 1046
739 Ga0501257_000012 3300049686 Bacteria 51962
740 Ga0501080_0632248 3300049742 Bacteria 948
741 Ga0501083_0411979 3300049744 Bacteria 879
742 Ga0501267_003554 3300049764 Bacteria 1424
743 Ga0501278_006800 3300049774 Bacteria 861
744 Ga0501280_001885 3300049776 Bacteria 3666
745 Ga0501044_0027022 3300049823 Bacteria 6072
746 Ga0501044_0383872 3300049823 Bacteria 1319
747 nmdc:mga0k408_49308_c1 3300050493 Bacteria 2437
748 nmdc:mga07m45_117405_c1 3300050496 Bacteria 1535
749 nmdc:mga0rr50_905959_c1 3300050513 Bacteria 752
750 Ga0500643_000166 3300053087 Bacteria 65586
751 Ga0500643_000590 3300053087 Bacteria 25096
752 Ga0500643_001818 3300053087 Bacteria 11669
753 Ga0500644_0317431 3300053088 Bacteria 669
754 Ga0500647_0140807 3300053091 Bacteria 1131
755 Ga0500651_0039143 3300053093 Bacteria 2986
756 Ga0500566_0059490 3300053094 Bacteria 2166
757 Ga0500592_001082 3300053116 Bacteria 4437
758 Ga0500592_007979 3300053116 Bacteria 1679
759 Ga0500592_028852 3300053116 Bacteria 895
760 Ga0500618_000496 3300053125 Bacteria 25243
761 Ga0500618_008655 3300053125 Bacteria 2825
762 Ga0500642_0001609 3300053130 Bacteria 6511
763 Ga0500652_188894 3300053131 Bacteria 841
764 Ga0500655_000399 3300053133 Bacteria 9184
765 Ga0500658_0004128 3300053134 Bacteria 5459
766 Ga0500658_0040535 3300053134 Bacteria 1865
767 Ga0500568_0036013 3300053139 Bacteria 2016
768 Ga0500577_0003903 3300053142 Bacteria 3897
769 Ga0500577_0249368 3300053142 Bacteria 771
770 Ga0500590_004550 3300053148 Bacteria 6558
771 Ga0500604_0042642 3300053151 Bacteria 1376
772 Ga0500622_0004003 3300053156 Bacteria 9497
773 Ga0500627_0000017 3300053158 Bacteria 119507
774 Ga0500627_0006961 3300053158 Bacteria 3897
775 Ga0500627_0015857 3300053158 Bacteria 2925
776 Ga0500627_0184263 3300053158 Bacteria 939
777 Ga0500639_087162 3300053163 Bacteria 1562
778 Ga0500636_0051013 3300053177 Bacteria 2432
779 Ga0500637_0268426 3300053178 Bacteria 945
780 Ga0500570_000052 3300053724 Bacteria 28845
781 Ga0500645_064009 3300053730 Bacteria 1061
782 Ga0501082_0275057 3300060353 Bacteria 1466
783 Ga0466962_0496147 3300061719 Bacteria 617
784 JGI24737J22298_10015462
785 JGI24736J21556_1003022
786 JGI24752J21851_1000266
787 JGI24752J21851_1006110
788 JGI24747J21853_1046519
789 JGI24740J21852_10040019
790 JGI24740J21852_10091332
791 JGI24740J21852_10115243
792 JGI24739J22299_10007944
793 JGI24739J22299_10009390
794 JGI24739J22299_10010059
795 JGI24739J22299_10036400
796 JGI24739J22299_10052693
797 JGI24739J22299_10076252
798 JGI24739J22299_10098589
799 JGI24737J22298_10012233
800 JGI24737J22298_10037437
801 JGI24737J22298_10048579
802 JGI24737J22298_10081153
803 JGI24743J22301_10105922
804 JGI24735J21928_10002885
805 JGI24735J21928_10012414
806 JGI24735J21928_10018234
807 JGI24735J21928_10021374
808 JGI24735J21928_10034580
809 JGI24735J21928_10036131
810 JGI24735J21928_10062145
811 JGI24735J21928_10098471
812 JGI24750J21931_1000495
813 JGI24750J21931_1003646
814 JGI24748J21848_1000085
815 JGI24748J21848_1024167
816 JGI24738J21930_10003443
817 JGI24749J21850_1000574
818 JGI24749J21850_1002773
819 JGI24035J26624_1003865
820 JGI24034J26672_10000069
821 JGI24034J26672_10031560
822 JGI24742J22300_10003304
823 JGI24751J29686_10000797
824 JGI24751J29686_10011534
825 JGI24751J29686_10055603
826 Ga0006778J45830_1070616
827 JGI25153J46596_10000007
828 Ga0006777J48905_1067120
829 Ga0032354_1014098
830 Ga0055525_1000086
831 Ga0055542_1000353
832 Ga0055542_1014558
833 Ga0055529_1000377
834 Ga0055536_1009345
835 Ga0055530_10089249
836 Ga0055531_10002547
837 Ga0065707_10143914
838 Ga0065707_10160867
839 Ga0065707_10198694
840 Ga0065707_10317993
841 Ga0070658_10002621
842 Ga0070658_10525018
843 Ga0070658_11274513
844 Ga0070658_11947157
845 Ga0070676_10000416
846 Ga0070683_101912835
847 Ga0070690_100001137
848 Ga0070670_100000178
849 Ga0070670_100000867
850 Ga0070670_100115168
851 Ga0070670_100784296
852 Ga0068869_100001367
853 Ga0068869_100207918
854 Ga0070666_10000547
855 Ga0070666_10001181
856 Ga0070666_10017146
857 Ga0070666_10042146
858 Ga0070666_10062119
859 Ga0070680_100000824
860 Ga0070680_100223225
861 Ga0068868_100002349
862 Ga0070660_100002444
863 Ga0070660_100064482
864 Ga0070660_100214103
865 Ga0070660_101297022
866 Ga0070689_100032724
867 Ga0070661_100737519
868 Ga0070661_101521032
869 Ga0070668_100000006
870 Ga0070668_100018392
871 Ga0070668_100039166
872 Ga0070668_100052169
873 Ga0070668_100110967
874 Ga0070669_100000013
875 Ga0070669_100000119
876 Ga0070669_100000958
877 Ga0070669_100018299
878 Ga0070669_100027700
879 Ga0070669_101088590
880 Ga0070671_100000009
881 Ga0070671_100000310
882 Ga0070671_100012517
883 Ga0070671_100047789
884 Ga0070671_100268198
885 Ga0070673_100000002
886 Ga0070673_101932498
887 Ga0070688_100000708
888 Ga0070659_100064697
889 Ga0070659_100258787
890 Ga0070659_100304107
891 Ga0070659_101289555
892 Ga0070667_100000003
893 Ga0070667_100000322
894 Ga0070667_100001187
895 Ga0070667_100002032
896 Ga0070667_100007537
897 Ga0070667_100270147
898 Ga0070667_100635550
899 Ga0070705_100006419
900 Ga0070694_100481958
901 Ga0070663_100635083
902 Ga0070678_100706137
903 Ga0070662_100117431
904 Ga0070662_100174849
905 Ga0070662_101015642
906 Ga0070662_101607683
907 Ga0070681_10299263
908 Ga0068867_100000012
909 Ga0070685_10014208
910 Ga0070685_11297936
911 Ga0070706_100495418
912 Ga0070679_100000002
913 Ga0070679_100814717
914 Ga0068853_100179289
915 Ga0068853_100208917
916 Ga0068853_100687291
917 Ga0068853_100726148
918 Ga0068853_101085053
919 Ga0068853_101982473
920 Ga0070672_100358753
921 Ga0070686_100000181
922 Ga0070693_100940005
923 Ga0070665_100000004
924 Ga0070665_100375971
925 Ga0068855_100001671
926 Ga0068855_100009919
927 Ga0068855_100808364
928 Ga0070664_100083389
929 Ga0068857_100077096
930 Ga0068857_100095350
931 Ga0068857_100116808
932 Ga0068857_100127781
933 Ga0068857_100153758
934 Ga0068857_100287427
935 Ga0068857_100373036
936 Ga0068857_101306776
937 Ga0068857_102340343
938 Ga0068854_100014478
939 Ga0068854_100018166
940 Ga0068854_100026542
941 Ga0068854_100055570
942 Ga0068854_100257475
943 Ga0068854_100296442
944 Ga0068854_100558147
945 Ga0068854_101214845
946 Ga0068856_100045341
947 Ga0068856_100060059
948 Ga0068856_100316171
949 Ga0068856_100620865
950 Ga0068852_100001276
951 Ga0068852_100187094
952 Ga0068852_100210428
953 Ga0068852_100384086
954 Ga0068852_100442281
955 Ga0068852_100670318
956 Ga0068859_100003101
957 Ga0068859_100003140
958 Ga0068859_100005086
959 Ga0068859_100126303
960 Ga0068859_100315109
961 Ga0068864_100000183
962 Ga0068864_100001051
963 Ga0068864_100001150
964 Ga0068864_100002014
965 Ga0068866_10456153
966 Ga0068861_100000687
967 Ga0068861_100010768
968 Ga0068861_100051576
969 Ga0068851_10142940
970 Ga0068863_100002515
971 Ga0068863_100012020
972 Ga0068863_100036402
973 Ga0068863_100039200
974 Ga0068863_100059963
975 Ga0068863_101300127
976 Ga0068863_101560397
977 Ga0068858_100000920
978 Ga0068858_100002212
979 Ga0068858_100004181
980 Ga0068858_100004950
981 Ga0068860_100000068
982 Ga0068860_100002805
983 Ga0068860_100003455
984 Ga0068860_100009225
985 Ga0068860_100049782
986 Ga0068860_100741843
987 Ga0068860_101543844
988 Ga0068860_102651255
989 Ga0068862_100000006
990 Ga0068862_100000160
991 Ga0068862_100000894
992 Ga0068862_100007026
993 Ga0068862_100017369
994 Ga0068862_100047193
995 Ga0075364_10425274
996 Ga0075366_10112303
997 Ga0075366_10302839
998 Ga0075366_10747121
999 Ga0075370_10142822
1000 Ga0068865_100000004
1001 Ga0068865_101806364
1002 Ga0097620_100003101
1003 Ga0097620_100003140
1004 Ga0097620_100005086
1005 Ga0097620_100126299
1006 Ga0097620_100315118
1007 Ga0079104_1068043
1008 Ga0075435_100728405
1009 Ga0105251_10004083
1010 Ga0105251_10114818
1011 Ga0105251_10157131
1012 Ga0105250_10281365
1013 Ga0105240_10058338
1014 Ga0105240_10594745
1015 Ga0105240_11325424
1016 Ga0105245_10004262
1017 Ga0105247_10002301
1018 Ga0105247_10003906
1019 Ga0105247_10074686
1020 Ga0105247_10900589
1021 Ga0105243_10000146
1022 Ga0105243_10149830
1023 Ga0105241_10166380
1024 Ga0105241_10863534
1025 Ga0105241_11234489
1026 Ga0105242_10000497
1027 Ga0105248_10000016
1028 Ga0105248_10003803
1029 Ga0105248_10030756
1030 Ga0105248_10046039
1031 Ga0105248_10046883
1032 Ga0105248_10047627
1033 Ga0105248_10056537
1034 Ga0105248_10306743
1035 Ga0105248_11444533
1036 Ga0105237_10034455
1037 Ga0105237_10225531
1038 Ga0105237_10658202
1039 Ga0105238_10029748
1040 Ga0105238_10112959
1041 Ga0105238_10117478
1042 Ga0105238_12641540
1043 Ga0105249_10000355
1044 Ga0105249_10002669
1045 Ga0105249_10020475
1046 Ga0105249_10040393
1047 Ga0105249_10126707
1048 Ga0105249_10249460
1049 Ga0105239_10169627
1050 Ga0105239_10255811
1051 Ga0105239_10629034
1052 Ga0105239_10802979
1053 Ga0105246_10000138
1054 Ga0157326_1000736
1055 Ga0157373_11580497
1056 Ga0157371_10000842
1057 Ga0157371_10019554
1058 Ga0157371_10487946
1059 Ga0157371_10502727
1060 Ga0157371_10559193
1061 Ga0157370_10030422
1062 Ga0157370_10204132
1063 Ga0157370_10800772
1064 Ga0157370_10952631
1065 Ga0157370_11259700
1066 Ga0157369_10135222
1067 Ga0157369_10917871
1068 Ga0157374_10001104
1069 Ga0157374_10780796
1070 Ga0157378_10006343
1071 Ga0157378_10499395
1072 Ga0163162_10001771
1073 Ga0163162_10022071
1074 Ga0163162_10188013
1075 Ga0163162_10250658
1076 Ga0157372_10231368
1077 Ga0157372_10238068
1078 Ga0157372_10528323
1079 Ga0157372_10647068
1080 Ga0157372_12347563
1081 Ga0157375_10000587
1082 Ga0157375_10536204
1083 Ga0163163_10047074
1084 Ga0163163_10161643
1085 Ga0157380_10000087
1086 Ga0157380_10017903
1087 Ga0157380_10188637
1088 Ga0157380_13483673
1089 Ga0157377_11037338
1090 Ga0157379_10074401
1091 Ga0157379_10477506
1092 Ga0157379_11247450
1093 Ga0157376_10000131
1094 Ga0163161_10002585
1095 Ga0163161_10620377
1096 Ga0163161_10786492
1097 Ga0207672_1000794
1098 Ga0209563_100024
1099 Ga0209646_1008350
1100 Ga0209026_1012633
1101 Ga0209148_1000008
1102 Ga0209148_1000074
1103 Ga0209233_1071651
1104 Ga0209455_1000002
1105 Ga0209455_1020563
1106 Ga0207673_1045286
1107 Ga0209676_1000060
1108 Ga0209676_1000226
1109 Ga0209758_1000017
1110 Ga0209050_1003101
1111 Ga0209050_1102653
1112 Ga0209257_1000392
1113 Ga0207697_10001743
1114 Ga0207697_10367646
1115 Ga0207713_1014886
1116 Ga0207713_1055056
1117 Ga0207713_1178811
1118 Ga0207642_10270610
1119 Ga0207710_10007517
1120 Ga0207710_10399660
1121 Ga0207688_10216692
1122 Ga0207688_11101321
1123 Ga0207680_10000004
1124 Ga0207680_10000418
1125 Ga0207680_10033138
1126 Ga0207680_10099024
1127 Ga0207680_11080810
1128 Ga0207647_10005831
1129 Ga0207647_10023553
1130 Ga0207647_10105475
1131 Ga0207647_10109834
1132 Ga0207647_10426139
1133 Ga0207647_10462163
1134 Ga0207647_10774541
1135 Ga0207645_10009635
1136 Ga0207705_10000084
1137 Ga0207705_10308546
1138 Ga0207654_10622447
1139 Ga0207654_10915357
1140 Ga0207707_10752852
1141 Ga0207695_10017127
1142 Ga0207695_10017716
1143 Ga0207695_10125643
1144 Ga0207695_11244698
1145 Ga0207671_10158857
1146 Ga0207671_10219883
1147 Ga0207671_11571874
1148 Ga0207660_10003071
1149 Ga0207660_10287202
1150 Ga0207657_10004951
1151 Ga0207657_10074466
1152 Ga0207657_10218235
1153 Ga0207649_10025862
1154 Ga0207649_10124038
1155 Ga0207652_10000001
1156 Ga0207652_10000002
1157 Ga0207681_10000001
1158 Ga0207681_10000008
1159 Ga0207681_10000704
1160 Ga0207681_10016779
1161 Ga0207681_10069647
1162 Ga0207681_11835153
1163 Ga0207694_10011474
1164 Ga0207694_10087112
1165 Ga0207694_10897574
1166 Ga0207694_11302166
1167 Ga0207694_11597144
1168 Ga0207650_10000050
1169 Ga0207650_10002940
1170 Ga0207650_10015038
1171 Ga0207650_10268055
1172 Ga0207650_10544903
1173 Ga0207687_10039071
1174 Ga0207644_10000006
1175 Ga0207644_10000028
1176 Ga0207644_10000124
1177 Ga0207644_10000292
1178 Ga0207644_10001291
1179 Ga0207644_10127663
1180 Ga0207690_10126488
1181 Ga0207690_10520785
1182 Ga0207690_10691990
1183 Ga0207706_10107769
1184 Ga0207706_10305191
1185 Ga0207706_10502254
1186 Ga0207686_10004317
1187 Ga0207709_10001457
1188 Ga0207709_10098211
1189 Ga0207670_10053948
1190 Ga0207669_11768099
1191 Ga0207704_10000005
1192 Ga0207704_11783806
1193 Ga0207691_10341864
1194 Ga0207711_10000022
1195 Ga0207711_10000662
1196 Ga0207711_10026087
1197 Ga0207711_10055697
1198 Ga0207711_10094318
1199 Ga0207711_10276754
1200 Ga0207711_10309852
1201 Ga0207711_10623807
1202 Ga0207711_11522888
1203 Ga0207689_10001653
1204 Ga0207679_10080824
1205 Ga0207667_10014616
1206 Ga0207667_10254280
1207 Ga0207651_10000007
1208 Ga0207651_11901788
1209 Ga0207712_10000072
1210 Ga0207712_10017601
1211 Ga0207712_10021578
1212 Ga0207712_10072291
1213 Ga0207712_10108640
1214 Ga0207668_10000026
1215 Ga0207668_10000675
1216 Ga0207668_10003566
1217 Ga0207668_10056114
1218 Ga0207668_10095417
1219 Ga0207640_10012065
1220 Ga0207640_10012353
1221 Ga0207640_10074303
1222 Ga0207640_10081128
1223 Ga0207640_10443045
1224 Ga0207640_10526714
1225 Ga0207640_10872620
1226 Ga0207658_10000002
1227 Ga0207658_10000608
1228 Ga0207658_10000967
1229 Ga0207658_10001977
1230 Ga0207658_10003917
1231 Ga0207658_10082023
1232 Ga0207677_10001155
1233 Ga0207703_10000849
1234 Ga0207703_10002381
1235 Ga0207703_10010115
1236 Ga0207703_10011114
1237 Ga0207639_10093564
1238 Ga0207639_10300634
1239 Ga0207639_10385948
1240 Ga0207639_10391395
1241 Ga0207639_10846840
1242 Ga0207678_10644277
1243 Ga0207678_10802608
1244 Ga0207702_10013739
1245 Ga0207702_10049546
1246 Ga0207702_11819071
1247 Ga0207641_10000179
1248 Ga0207641_10001414
1249 Ga0207641_10010071
1250 Ga0207641_10027742
1251 Ga0207641_10201653
1252 Ga0207648_10000005
1253 Ga0207676_10000004
1254 Ga0207676_10000040
1255 Ga0207676_10000190
1256 Ga0207676_10000613
1257 Ga0207676_10003561
1258 Ga0207676_10004335
1259 Ga0207676_11078161
1260 Ga0207676_12624123
1261 Ga0207674_10026868
1262 Ga0207674_10051090
1263 Ga0207674_10161760
1264 Ga0207674_10176484
1265 Ga0207674_10184225
1266 Ga0207674_11877723
1267 Ga0207675_100002079
1268 Ga0207675_100002340
1269 Ga0207675_100113823
1270 Ga0207675_100131973
1271 Ga0207675_100332869
1272 Ga0207675_100626001
1273 Ga0207698_10008334
1274 Ga0207698_10024433
1275 Ga0207698_10059354
1276 Ga0207698_11033527
1277 Ga0207698_11179418
1278 Ga0207698_12527130
1279 Ga0209967_1028934
1280 Ga0209982_1057082
1281 Ga0210002_1084160
1282 Ga0209971_1042566
1283 Ga0209974_10157792
1284 Ga0209974_10227135
1285 Ga0268266_10000009
1286 Ga0268266_10264270
1287 Ga0268266_10437299
1288 Ga0268265_10000002
1289 Ga0268265_10000171
1290 Ga0268265_10001260
1291 Ga0268265_10010758
1292 Ga0268265_10025484
1293 Ga0268265_10187595
1294 Ga0268264_10000006
1295 Ga0268264_10000103
1296 Ga0268264_10000221
1297 Ga0268264_10006519
1298 Ga0268264_10009510
1299 Ga0307517_10206460
1300 Ga0316177_1195044
1301 Ga0307513_10052770
1302 Ga0307408_100251612
1303 Ga0307408_100742500
1304 Ga0307408_100825739
1305 Ga0307408_100980730
1306 Ga0307408_101083596
1307 Ga0307405_10064549
1308 Ga0307405_10113810
1309 Ga0307405_10345560
1310 Ga0307405_10533606
1311 Ga0307405_11527357
1312 Ga0307405_11760669
1313 Ga0307405_12080106
1314 Ga0307413_10103574
1315 Ga0307413_10122485
1316 Ga0307413_10144419
1317 Ga0307413_12026844
1318 Ga0307413_12102964
1319 Ga0307410_10017551
1320 Ga0307410_10034873
1321 Ga0307410_10112306
1322 Ga0307406_10077834
1323 Ga0307406_10202986
1324 Ga0307406_10839995
1325 Ga0307406_11245948
1326 Ga0307406_12058554
1327 Ga0307407_10039033
1328 Ga0307407_10068166
1329 Ga0307412_10012635
1330 Ga0307412_10014477
1331 Ga0307412_10023141
1332 Ga0307412_10027831
1333 Ga0307412_10041279
1334 Ga0307412_10134074
1335 Ga0307412_10238317
1336 Ga0307412_10279749
1337 Ga0307412_10346062
1338 Ga0307412_10591208
1339 Ga0307412_10683218
1340 Ga0307412_11359105
1341 Ga0307409_100104733
1342 Ga0307409_100121157
1343 Ga0307409_100188343
1344 Ga0307416_100081670
1345 Ga0307416_100276738
1346 Ga0307416_100606780
1347 Ga0307416_100926260
1348 Ga0307416_101514025
1349 Ga0307416_103321709
1350 Ga0307414_10000136
1351 Ga0307414_10002538
1352 Ga0307414_10013200
1353 Ga0307414_10164710
1354 Ga0307414_10234440
1355 Ga0307414_10391439
1356 Ga0307414_10536328
1357 Ga0307414_10887653
1358 Ga0307414_10951832
1359 Ga0307414_11738626
1360 Ga0307414_11990435
1361 Ga0307414_12085014
1362 Ga0307411_10032530
1363 Ga0307411_10075565
1364 Ga0307411_10092722
1365 Ga0307411_10207421
1366 Ga0307415_100448452
1367 Ga0307510_10003391
1368 Ga0307510_10380779
1369 Ga0373948_0169374
1370 Ga0373932_0015327
1371 Ga0373932_0246634
1372 Ga0373943_0230606
1373 Ga0373946_0058783
1374 Ga0373935_0301593
1375 Ga0373927_0107858
1376 Ga0373947_0265446
1377 Ga0395899_0000738
1378 Ga0395899_0024662
1379 Ga0395899_0134648
1380 Ga0395900_0143511
1381 Ga0395900_1061371
1382 Ga0395900_1464595
1383 Ga0395900_1564069
1384 Ga0395905_0046291
1385 Ga0395905_0060777
1386 Ga0395905_0149090
1387 Ga0395905_0496828
1388 Ga0395905_0585702
1389 Ga0395901_0079992
1390 Ga0395901_0104641
1391 Ga0395901_0207081
1392 Ga0395901_0219501
1393 Ga0395901_1833055
1394 Ga0237819_00702
1395 Ga0237816_00591
1396 Ga0451789_0540734
1397 Ga0451789_0943086
1398 Ga0451791_1228639
1399 Ga0451793_0334588
1400 Ga0451801_01071
1401 Ga0451795_0888193
1402 Ga0451802_0602411
1403 Ga0451805_073244
1404 Ga0451804_0674792
1405 Ga0451807_0682885
1406 Ga0451837_0232942
1407 Ga0451837_0932992
1408 Ga0451841_0723032
1409 Ga0451853_3164471
1410 Ga0439448_0002892
1411 Ga0439432_075293
1412 Ga0439450_053772
1413 Ga0439454_027297
1414 Ga0439455_0031210
1415 Ga0439458_0000411
1416 Ga0439458_0023574
1417 Ga0451577_0793079
1418 Ga0466963_0764213
1419 Ga0453684_0144988
1420 Ga0466971_0013453
1421 Ga0466957_0060779
1422 Ga0451576_0287511
1423 Ga0451576_1678546
1424 Ga0466958_0045403
1425 Ga0466967_0814319
1426 Ga0495592_0433362
1427 Ga0495638_0588644
1428 Ga0495607_0009991
1429 Ga0495583_0027264
1430 Ga0495606_0032104
1431 Ga0495606_0097322
1432 Ga0495620_0067190
1433 Ga0495637_0020614
1434 Ga0495643_0036230
1435 Ga0495643_0056975
1436 Ga0495643_0159163
1437 Ga0495663_0044134
1438 Ga0495654_0021389
1439 Ga0495609_0050693
1440 Ga0495621_0153376
1441 Ga0495597_0096319
1442 Ga0495633_0164810
1443 Ga0495668_0000004
1444 Ga0495668_0018119
1445 Ga0495668_0027073
1446 Ga0495668_0058282
1447 Ga0495625_0008532
1448 Ga0495625_0042708
1449 Ga0495625_0284716
1450 Ga0495635_1093518
1451 Ga0495669_0132247
1452 Ga0495670_0300947
1453 Ga0495660_0183195
1454 Ga0495687_004335
1455 Ga0495677_0119957
1456 Ga0496100_0721524
1457 Ga0496102_0234565
1458 Ga0496103_0061206
1459 Ga0496103_0247355
1460 Ga0496104_1028999
1461 Ga0496107_0499920
1462 Ga0496113_0184797
1463 Ga0496113_0756098
1464 Ga0496117_0003839
1465 Ga0496117_0007266
1466 Ga0496117_0496874
1467 Ga0496118_0000901
1468 Ga0496118_0007049
1469 Ga0496118_0042347
1470 Ga0496118_0367527
1471 Ga0496118_0395273
1472 Ga0496121_0090548
1473 Ga0496121_0167769
1474 Ga0496121_0289737
1475 Ga0496122_0221186
1476 Ga0496123_0029600
1477 Ga0496123_0038218
1478 Ga0496124_0000192
1479 Ga0496124_0001412
1480 Ga0496124_0028878
1481 Ga0496124_0079741
1482 Ga0496124_0096167
1483 Ga0496125_0066180
1484 Ga0496125_0118299
1485 Ga0496126_0433319
1486 Ga0496126_1157881
1487 Ga0495682_0258250
1488 Ga0501293_012339
1489 Ga0501298_032011
1490 Ga0501300_034092
1491 Ga0501320_012355
1492 Ga0501320_028028
1493 Ga0501321_075558
1494 Ga0501326_14218
1495 Ga0501333_013451
1496 Ga0501334_20069
1497 Ga0501335_039037
1498 Ga0501336_007516
1499 Ga0501337_012984
1500 Ga0501338_09985
1501 Ga0501032_0010668
1502 Ga0501032_0056543
1503 Ga0501033_0001724
1504 Ga0501034_0004606
1505 Ga0501036_0529121
1506 Ga0501036_0589414
1507 Ga0501036_0997233
1508 Ga0501038_0337306
1509 Ga0501042_0961576
1510 Ga0501043_0028300
1511 Ga0501043_0383773
1512 Ga0501046_1148120
1513 Ga0501047_0000256
1514 Ga0501047_0026761
1515 Ga0501047_0215173
1516 Ga0501047_0642220
1517 Ga0501048_0536426
1518 Ga0501067_0154694
1519 Ga0501067_0799899
1520 Ga0501069_0702101
1521 Ga0501223_030647
1522 Ga0501257_000012
1523 Ga0501080_0632248
1524 Ga0501083_0411979
1525 Ga0501267_003554
1526 Ga0501278_006800
1527 Ga0501280_001885
1528 Ga0501044_0027022
1529 Ga0501044_0383872
1530 nmdc:mga0k408_49308_c1
1531 nmdc:mga07m45_117405_c1
1532 nmdc:mga0rr50_905959_c1
1533 Ga0500643_000166
1534 Ga0500643_000590
1535 Ga0500643_001818
1536 Ga0500644_0317431
1537 Ga0500647_0140807
1538 Ga0500651_0039143
1539 Ga0500566_0059490
1540 Ga0500592_001082
1541 Ga0500592_007979
1542 Ga0500592_028852
1543 Ga0500618_000496
1544 Ga0500618_008655
1545 Ga0500642_0001609
1546 Ga0500652_188894
1547 Ga0500655_000399
1548 Ga0500658_0004128
1549 Ga0500658_0040535
1550 Ga0500568_0036013
1551 Ga0500577_0003903
1552 Ga0500577_0249368
1553 Ga0500590_004550
1554 Ga0500604_0042642
1555 Ga0500622_0004003
1556 Ga0500627_0000017
1557 Ga0500627_0006961
1558 Ga0500627_0015857
1559 Ga0500627_0184263
1560 Ga0500639_087162
1561 Ga0500636_0051013
1562 Ga0500637_0268426
1563 Ga0500570_000052
1564 Ga0500645_064009
1565 Ga0501082_0275057
1566 Ga0466962_0496147

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00313

CSD

'Cold-shock' DNA-binding domain

15

81

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mjc-assembly1.cif.gz_A crystal structure of cspa, the major cold shock protein of escherichia coli 0.8883 2 68
3i2z-assembly2.cif.gz_B structure of cold shock protein e from salmonella typhimurium 0.8855 1 68
6kug-assembly1.cif.gz_A crystal structure of ybx1 csd with rna 0.8825 2 67
3a0j-assembly2.cif.gz_B crystal structure of cold shock protein 1 from thermus thermophilus hb8 0.8795 1 65
3pf5-assembly2.cif.gz_B crystal structure of bs-cspb in complex with ru6 0.8794 1 67
ID Description Score Start End Superfamily
af_Q94C69_1_75_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8891 2 66 2.40.50.140
2haxA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8836 1 33 2.40.50.140
af_I1LPN7_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8777 2 67 2.40.50.140
af_P92186_48_133_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8752 2 67 2.40.50.140
2lssA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8703 2 68 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A437GXQ1-F1-model_v4 Cold-shock protein 1.006 1 68 GO:0003676
GO:0005829
AF-A0A2E5BVN1-F1-model_v4 Cold-shock protein 1.006 1 68 GO:0003676
GO:0005829
AF-A0A7X2FUF1-F1-model_v4 Cold-shock protein 1.005 1 68 GO:0003676
GO:0005829
AF-Q2IX68-F1-model_v4 Cold-shock DNA-binding protein family 1.005 1 68 GO:0003677
GO:0005829
AF-A0A1H6FIG3-F1-model_v4 Cold-shock DNA-binding protein family 1.004 1 68 GO:0003677
GO:0005829

Map