F480648

General Info

Members Datasets Scaffolds Average Seq Length
783 238 1566 133

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100091124|Ga0070670_1000911242
Length 152
Sequence MRRRLIVALGILALAACDDGAQQQTNQPTIKVRGTEQNQLHTLNAMNLSIALKHAIYDAGYTCKRITDAGFVAYYQNLDMWAAHCEYDKGASRDWAIFAGPDGSAQVRDCKDIVGTGVPACAITKRPKGSFGNPPSGAEAPSDGAKTDTNLG

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
177 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
178 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
179 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
180 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
183 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
192 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
193 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
194 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
205 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
206 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
207 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
232 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
233 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
237 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 7.02
Rhizosphere 92.46
Stem 0
Stem Tuber 0
Unclassified 6.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100091124 3300005331 Bacteria 2620
2 JGI24741J21665_1012998 3300001915 Bacteria 1419
3 JGI24741J21665_1018528 3300001915 Unclassified 1112
4 JGI24740J21852_10004688 3300001979 Bacteria 5857
5 JGI24740J21852_10008945 3300001979 Bacteria 3955
6 JGI24740J21852_10026117 3300001979 Bacteria 1960
7 JGI24739J22299_10004473 3300001989 Bacteria 5351
8 JGI24739J22299_10014393 3300001989 Bacteria 2878
9 JGI24737J22298_10000655 3300001990 Bacteria 12249
10 JGI24737J22298_10000987 3300001990 Bacteria 10119
11 JGI24737J22298_10056357 3300001990 Bacteria 1187
12 JGI24743J22301_10048885 3300001991 Bacteria 859
13 JGI24735J21928_10057368 3300002067 Unclassified 1121
14 JGI24735J21928_10058798 3300002067 Bacteria 1106
15 JGI24738J21930_10000812 3300002075 Bacteria 8970
16 JGI24738J21930_10070799 3300002075 Bacteria 722
17 Ga0065712_10211573 3300005290 Unclassified 1071
18 Ga0070658_10000269 3300005327 Bacteria 45712
19 Ga0070658_10007111 3300005327 Bacteria 9035
20 Ga0070658_10016356 3300005327 Bacteria 5937
21 Ga0070658_10020842 3300005327 Bacteria 5252
22 Ga0070658_10026585 3300005327 Bacteria 4643
23 Ga0070658_10706906 3300005327 Bacteria 875
24 Ga0070676_10008701 3300005328 Bacteria 5477
25 Ga0070676_10034995 3300005328 Bacteria 2886
26 Ga0070676_10077479 3300005328 Bacteria 2009
27 Ga0070676_10649335 3300005328 Bacteria 766
28 Ga0070683_100001138 3300005329 Bacteria 20116
29 Ga0070683_100007370 3300005329 Bacteria 9295
30 Ga0070683_100361267 3300005329 Bacteria 1383
31 Ga0070683_101090397 3300005329 Bacteria 767
32 Ga0070690_100060826 3300005330 Bacteria 2432
33 Ga0070690_100137193 3300005330 Bacteria 1657
34 Ga0070690_100657645 3300005330 Bacteria 801
35 Ga0070670_100028324 3300005331 Bacteria 4821
36 Ga0070670_100030482 3300005331 Bacteria 4645
37 Ga0070670_100073467 3300005331 Bacteria 2937
38 Ga0070670_100159061 3300005331 Bacteria 1957
39 Ga0070670_100175633 3300005331 Bacteria 1859
40 Ga0070670_100325843 3300005331 Bacteria 1346
41 Ga0070670_100438894 3300005331 Bacteria 1156
42 Ga0070670_101516190 3300005331 Bacteria 616
43 Ga0070670_102008472 3300005331 Unclassified 533
44 Ga0070677_10592280 3300005333 Bacteria 613
45 Ga0068869_100318459 3300005334 Bacteria 1261
46 Ga0068869_100653340 3300005334 Bacteria 893
47 Ga0070666_10000330 3300005335 Bacteria 29917
48 Ga0070666_10007668 3300005335 Bacteria 6663
49 Ga0070666_10032086 3300005335 Bacteria 3469
50 Ga0070666_10193411 3300005335 Unclassified 1430
51 Ga0070666_10208281 3300005335 Bacteria 1376
52 Ga0070680_100007182 3300005336 Bacteria 8490
53 Ga0070680_100217441 3300005336 Bacteria 1612
54 Ga0070682_100230895 3300005337 Bacteria 1322
55 Ga0068868_100024884 3300005338 Bacteria 4546
56 Ga0068868_100147000 3300005338 Bacteria 1939
57 Ga0068868_100157935 3300005338 Bacteria 1871
58 Ga0068868_100207917 3300005338 Bacteria 1634
59 Ga0068868_100454913 3300005338 Bacteria 1114
60 Ga0070660_100000109 3300005339 Bacteria 50964
61 Ga0070660_100000339 3300005339 Bacteria 31090
62 Ga0070660_100003053 3300005339 Bacteria 11523
63 Ga0070660_100015001 3300005339 Bacteria 5588
64 Ga0070660_100107887 3300005339 Bacteria 2213
65 Ga0070660_100582750 3300005339 Bacteria 934
66 Ga0070660_101684040 3300005339 Bacteria 540
67 Ga0070687_100091225 3300005343 Bacteria 1686
68 Ga0070687_100190983 3300005343 Bacteria 1234
69 Ga0070661_100000070 3300005344 Bacteria 82818
70 Ga0070661_100011611 3300005344 Bacteria 6139
71 Ga0070661_100023710 3300005344 Bacteria 4400
72 Ga0070661_100034939 3300005344 Bacteria 3648
73 Ga0070661_100118743 3300005344 Bacteria 1979
74 Ga0070661_100325891 3300005344 Bacteria 1200
75 Ga0070692_10008029 3300005345 Bacteria 4685
76 Ga0070692_10011894 3300005345 Bacteria 4013
77 Ga0070668_100019581 3300005347 Bacteria 5094
78 Ga0070668_100058980 3300005347 Bacteria 2970
79 Ga0070668_100489744 3300005347 Bacteria 1063
80 Ga0070668_100544512 3300005347 Bacteria 1009
81 Ga0070668_101483319 3300005347 Unclassified 620
82 Ga0070669_100140030 3300005353 Bacteria 1864
83 Ga0070669_100185501 3300005353 Bacteria 1630
84 Ga0070669_100256674 3300005353 Bacteria 1393
85 Ga0070669_100269297 3300005353 Bacteria 1361
86 Ga0070669_101285535 3300005353 Bacteria 633
87 Ga0070675_100140457 3300005354 Bacteria 2064
88 Ga0070675_100355003 3300005354 Bacteria 1301
89 Ga0070675_100973275 3300005354 Unclassified 779
90 Ga0070671_100016707 3300005355 Bacteria 5934
91 Ga0070671_100026341 3300005355 Bacteria 4778
92 Ga0070671_100081281 3300005355 Bacteria 2710
93 Ga0070671_100151912 3300005355 Bacteria 1955
94 Ga0070671_100196846 3300005355 Bacteria 1708
95 Ga0070671_100599972 3300005355 Unclassified 951
96 Ga0070671_100717777 3300005355 Bacteria 868
97 Ga0070674_100044481 3300005356 Bacteria 3027
98 Ga0070674_100111426 3300005356 Bacteria 2010
99 Ga0070674_100269077 3300005356 Bacteria 1346
100 Ga0070673_100008589 3300005364 Bacteria 6801
101 Ga0070673_100029719 3300005364 Bacteria 4078
102 Ga0070673_100029963 3300005364 Bacteria 4065
103 Ga0070673_100068180 3300005364 Bacteria 2848
104 Ga0070673_100072882 3300005364 Bacteria 2763
105 Ga0070673_100125407 3300005364 Bacteria 2148
106 Ga0070673_100500918 3300005364 Bacteria 1098
107 Ga0070688_100239974 3300005365 Bacteria 1286
108 Ga0070659_100000312 3300005366 Bacteria 37872
109 Ga0070659_100005147 3300005366 Bacteria 9376
110 Ga0070659_100053970 3300005366 Bacteria 3165
111 Ga0070659_100238704 3300005366 Bacteria 1503
112 Ga0070659_100389646 3300005366 Bacteria 1175
113 Ga0070659_101000084 3300005366 Bacteria 734
114 Ga0070667_100003813 3300005367 Bacteria 12811
115 Ga0070667_100008539 3300005367 Bacteria 8491
116 Ga0070667_100031529 3300005367 Bacteria 4419
117 Ga0070667_100036196 3300005367 Bacteria 4137
118 Ga0070667_100042585 3300005367 Bacteria 3809
119 Ga0070667_100081281 3300005367 Bacteria 2773
120 Ga0070667_100243972 3300005367 Bacteria 1605
121 Ga0070667_100264287 3300005367 Bacteria 1541
122 Ga0070667_100462252 3300005367 Bacteria 1160
123 Ga0070667_100521863 3300005367 Bacteria 1090
124 Ga0070667_101026454 3300005367 Bacteria 770
125 Ga0070714_100304477 3300005435 Bacteria 1487
126 Ga0070694_100025638 3300005444 Bacteria 3814
127 Ga0070663_100006534 3300005455 Bacteria 7022
128 Ga0070663_100008493 3300005455 Bacteria 6320
129 Ga0070663_100222806 3300005455 Bacteria 1481
130 Ga0070663_100314442 3300005455 Bacteria 1257
131 Ga0070663_100388540 3300005455 Unclassified 1138
132 Ga0070663_100817736 3300005455 Bacteria 800
133 Ga0070678_100001567 3300005456 Bacteria 12248
134 Ga0070678_100008774 3300005456 Bacteria 6074
135 Ga0070678_100160172 3300005456 Bacteria 1822
136 Ga0070678_100271767 3300005456 Bacteria 1430
137 Ga0070678_101070560 3300005456 Bacteria 743
138 Ga0070678_101080991 3300005456 Bacteria 740
139 Ga0070662_100000037 3300005457 Bacteria 76596
140 Ga0070662_100009922 3300005457 Bacteria 6239
141 Ga0070662_100031671 3300005457 Bacteria 3713
142 Ga0070662_100318556 3300005457 Bacteria 1268
143 Ga0070662_100805208 3300005457 Unclassified 799
144 Ga0070681_10020408 3300005458 Bacteria 6641
145 Ga0070681_10063111 3300005458 Bacteria 3677
146 Ga0068867_100020121 3300005459 Bacteria 4756
147 Ga0068867_100093557 3300005459 Bacteria 2285
148 Ga0068867_100185971 3300005459 Bacteria 1654
149 Ga0068867_100830755 3300005459 Unclassified 826
150 Ga0070685_10057207 3300005466 Bacteria 2269
151 Ga0070679_100015769 3300005530 Bacteria 7269
152 Ga0070679_100211998 3300005530 Bacteria 1900
153 Ga0070679_101042618 3300005530 Bacteria 762
154 Ga0070684_100007613 3300005535 Bacteria 8441
155 Ga0068853_100000309 3300005539 Bacteria 34282
156 Ga0068853_100100007 3300005539 Bacteria 2563
157 Ga0068853_101073267 3300005539 Unclassified 776
158 Ga0068853_101579720 3300005539 Bacteria 635
159 Ga0070672_100009584 3300005543 Bacteria 6681
160 Ga0070672_100009843 3300005543 Bacteria 6608
161 Ga0070672_100169136 3300005543 Bacteria 1817
162 Ga0070672_100169185 3300005543 Bacteria 1816
163 Ga0070686_100063234 3300005544 Bacteria 2397
164 Ga0070686_100359814 3300005544 Bacteria 1096
165 Ga0070695_100520689 3300005545 Bacteria 923
166 Ga0070696_100137209 3300005546 Bacteria 1784
167 Ga0070696_100804678 3300005546 Bacteria 774
168 Ga0070693_100003397 3300005547 Bacteria 7412
169 Ga0070693_100120838 3300005547 Bacteria 1624
170 Ga0070665_100002925 3300005548 Bacteria 18444
171 Ga0070665_100049719 3300005548 Bacteria 4207
172 Ga0070665_100095470 3300005548 Bacteria 2978
173 Ga0070665_100105865 3300005548 Bacteria 2815
174 Ga0070665_100124803 3300005548 Bacteria 2576
175 Ga0070665_100159377 3300005548 Bacteria 2258
176 Ga0070704_101078266 3300005549 Unclassified 729
177 Ga0068855_100000247 3300005563 Bacteria 68071
178 Ga0068855_100024916 3300005563 Bacteria 7158
179 Ga0068855_100037585 3300005563 Bacteria 5757
180 Ga0068855_100070606 3300005563 Bacteria 4063
181 Ga0068855_100082525 3300005563 Bacteria 3725
182 Ga0068855_100764707 3300005563 Bacteria 1029
183 Ga0068855_101203595 3300005563 Bacteria 788
184 Ga0068855_101283533 3300005563 Unclassified 758
185 Ga0070664_100000077 3300005564 Bacteria 62053
186 Ga0070664_100003026 3300005564 Bacteria 13593
187 Ga0070664_100129822 3300005564 Bacteria 2213
188 Ga0070664_100158916 3300005564 Bacteria 1998
189 Ga0068857_100020826 3300005577 Bacteria 5769
190 Ga0068857_100022877 3300005577 Bacteria 5498
191 Ga0068857_100252035 3300005577 Bacteria 1619
192 Ga0068857_101034718 3300005577 Unclassified 791
193 Ga0068854_100111101 3300005578 Bacteria 2068
194 Ga0068854_100170997 3300005578 Bacteria 1691
195 Ga0068854_100503140 3300005578 Bacteria 1021
196 Ga0068856_100000444 3300005614 Bacteria 45674
197 Ga0068856_100014742 3300005614 Bacteria 7544
198 Ga0068856_100063582 3300005614 Bacteria 3646
199 Ga0068856_100153077 3300005614 Bacteria 2315
200 Ga0070702_100231833 3300005615 Bacteria 1241
201 Ga0068852_100000350 3300005616 Bacteria 31032
202 Ga0068852_100032451 3300005616 Bacteria 4324
203 Ga0068852_100282041 3300005616 Bacteria 1602
204 Ga0068852_100688902 3300005616 Bacteria 1031
205 Ga0068859_100002392 3300005617 Bacteria 19100
206 Ga0068859_100037850 3300005617 Bacteria 4841
207 Ga0068859_100157169 3300005617 Bacteria 2351
208 Ga0068859_100257758 3300005617 Bacteria 1835
209 Ga0068859_101533935 3300005617 Unclassified 735
210 Ga0068864_100001110 3300005618 Bacteria 22495
211 Ga0068864_100002819 3300005618 Bacteria 14343
212 Ga0068864_100022361 3300005618 Bacteria 5302
213 Ga0068864_100040637 3300005618 Bacteria 3978
214 Ga0068864_100510382 3300005618 Bacteria 1158
215 Ga0068866_10005188 3300005718 Bacteria 5368
216 Ga0068866_10067216 3300005718 Bacteria 1881
217 Ga0068861_100397804 3300005719 Bacteria 1222
218 Ga0068851_10006475 3300005834 Bacteria 5347
219 Ga0068851_10018054 3300005834 Bacteria 3396
220 Ga0068870_10049839 3300005840 Bacteria 2210
221 Ga0068863_100001056 3300005841 Bacteria 27521
222 Ga0068863_100022022 3300005841 Bacteria 6083
223 Ga0068863_100064125 3300005841 Bacteria 3474
224 Ga0068863_100079639 3300005841 Bacteria 3102
225 Ga0068863_100588306 3300005841 Bacteria 1101
226 Ga0068858_100002753 3300005842 Bacteria 17665
227 Ga0068858_100003145 3300005842 Bacteria 16530
228 Ga0068858_100020528 3300005842 Bacteria 6174
229 Ga0068858_100055846 3300005842 Bacteria 3650
230 Ga0068858_100115005 3300005842 Bacteria 2514
231 Ga0068858_100864297 3300005842 Bacteria 884
232 Ga0068860_100002768 3300005843 Bacteria 18241
233 Ga0068860_100022372 3300005843 Bacteria 6116
234 Ga0068860_100160812 3300005843 Bacteria 2165
235 Ga0068860_100599134 3300005843 Bacteria 1107
236 Ga0068860_100739500 3300005843 Bacteria 995
237 Ga0068860_100850854 3300005843 Unclassified 927
238 Ga0068862_100016753 3300005844 Bacteria 6101
239 Ga0068862_100101524 3300005844 Bacteria 2517
240 Ga0068862_100186233 3300005844 Bacteria 1865
241 Ga0068862_100209588 3300005844 Bacteria 1760
242 Ga0068862_100333344 3300005844 Bacteria 1403
243 Ga0070717_10307576 3300006028 Bacteria 1410
244 Ga0075362_10040870 3300006177 Bacteria 2043
245 Ga0097621_100011209 3300006237 Bacteria 6600
246 Ga0097621_100013030 3300006237 Bacteria 6181
247 Ga0097621_100073298 3300006237 Bacteria 2834
248 Ga0097621_100079858 3300006237 Bacteria 2720
249 Ga0097621_100386946 3300006237 Bacteria 1250
250 Ga0097621_100769015 3300006237 Bacteria 891
251 Ga0068871_100005666 3300006358 Bacteria 8763
252 Ga0068871_100149842 3300006358 Bacteria 1988
253 Ga0068865_100001424 3300006881 Bacteria 13953
254 Ga0068865_100555539 3300006881 Bacteria 965
255 Ga0097620_100002392 3300006931 Bacteria 19100
256 Ga0097620_100037851 3300006931 Bacteria 4841
257 Ga0097620_100157174 3300006931 Bacteria 2351
258 Ga0097620_100257750 3300006931 Bacteria 1835
259 Ga0097620_101534009 3300006931 Unclassified 735
260 Ga0105250_10020270 3300009092 Bacteria 2689
261 Ga0105240_10122528 3300009093 Bacteria 3129
262 Ga0111539_10687239 3300009094 Bacteria 1191
263 Ga0105245_10019331 3300009098 Bacteria 5963
264 Ga0105247_10136598 3300009101 Bacteria 1602
265 Ga0105247_11578015 3300009101 Bacteria 538
266 Ga0105243_10425369 3300009148 Bacteria 1240
267 Ga0105243_10678028 3300009148 Bacteria 1002
268 Ga0105241_10035146 3300009174 Bacteria 3769
269 Ga0105241_12136009 3300009174 Unclassified 554
270 Ga0105242_10002410 3300009176 Bacteria 14697
271 Ga0105248_10000719 3300009177 Bacteria 37511
272 Ga0105248_10001320 3300009177 Bacteria 27621
273 Ga0105248_10034268 3300009177 Bacteria 5676
274 Ga0105248_10034516 3300009177 Bacteria 5657
275 Ga0105248_10044563 3300009177 Bacteria 4975
276 Ga0105248_10197736 3300009177 Bacteria 2265
277 Ga0105248_10444894 3300009177 Bacteria 1460
278 Ga0105248_10610712 3300009177 Bacteria 1230
279 Ga0105248_10760313 3300009177 Bacteria 1094
280 Ga0105237_10099852 3300009545 Bacteria 2893
281 Ga0105238_10105363 3300009551 Bacteria 2801
282 Ga0105238_10238785 3300009551 Bacteria 1795
283 Ga0105238_10284737 3300009551 Bacteria 1634
284 Ga0105238_10923203 3300009551 Bacteria 892
285 Ga0105249_10026474 3300009553 Bacteria 5226
286 Ga0105249_10026708 3300009553 Bacteria 5205
287 Ga0105249_10297614 3300009553 Bacteria 1617
288 Ga0105249_10763485 3300009553 Bacteria 1029
289 Ga0105239_10042112 3300010375 Bacteria 5004
290 Ga0105239_10497957 3300010375 Bacteria 1385
291 Ga0105246_10686742 3300011119 Unclassified 895
292 Ga0157373_10093973 3300013100 Bacteria 2111
293 Ga0157373_10104195 3300013100 Bacteria 1995
294 Ga0157373_10239812 3300013100 Bacteria 1281
295 Ga0157373_10699714 3300013100 Bacteria 743
296 Ga0157371_10000624 3300013102 Bacteria 42051
297 Ga0157371_10009369 3300013102 Bacteria 7713
298 Ga0157371_10060886 3300013102 Bacteria 2676
299 Ga0157371_10079776 3300013102 Bacteria 2318
300 Ga0157371_10195695 3300013102 Bacteria 1448
301 Ga0157371_10209660 3300013102 Bacteria 1398
302 Ga0157370_10015768 3300013104 Bacteria 7669
303 Ga0157370_10350312 3300013104 Bacteria 1361
304 Ga0157369_10004619 3300013105 Bacteria 16188
305 Ga0157369_10063577 3300013105 Bacteria 3975
306 Ga0157369_10083232 3300013105 Bacteria 3423
307 Ga0157369_10301563 3300013105 Bacteria 1666
308 Ga0157369_10743491 3300013105 Bacteria 1009
309 Ga0157374_10002253 3300013296 Bacteria 16246
310 Ga0157374_10034433 3300013296 Bacteria 4626
311 Ga0157374_10101337 3300013296 Bacteria 2761
312 Ga0157374_10116923 3300013296 Bacteria 2570
313 Ga0157374_10437965 3300013296 Bacteria 1307
314 Ga0157378_10182112 3300013297 Bacteria 1977
315 Ga0157378_11842491 3300013297 Bacteria 653
316 Ga0163162_10021265 3300013306 Bacteria 6386
317 Ga0163162_10088341 3300013306 Bacteria 3179
318 Ga0163162_10154261 3300013306 Bacteria 2416
319 Ga0163162_10460752 3300013306 Bacteria 1403
320 Ga0157372_10143435 3300013307 Bacteria 2754
321 Ga0157372_10506493 3300013307 Bacteria 1408
322 Ga0157372_10571284 3300013307 Bacteria 1318
323 Ga0157372_11304519 3300013307 Bacteria 838
324 Ga0157372_12392102 3300013307 Bacteria 607
325 Ga0157375_10004680 3300013308 Bacteria 11902
326 Ga0157375_10377954 3300013308 Bacteria 1583
327 Ga0157375_11198341 3300013308 Bacteria 891
328 Ga0163163_10000123 3300014325 Bacteria 82366
329 Ga0163163_10002706 3300014325 Bacteria 14968
330 Ga0163163_10006151 3300014325 Bacteria 10461
331 Ga0163163_10093474 3300014325 Bacteria 3024
332 Ga0157377_10156987 3300014745 Bacteria 1411
333 Ga0157377_10764551 3300014745 Unclassified 708
334 Ga0157379_10003612 3300014968 Bacteria 13127
335 Ga0157379_10013809 3300014968 Bacteria 7078
336 Ga0157379_10028415 3300014968 Bacteria 4974
337 Ga0157379_10148042 3300014968 Bacteria 2118
338 Ga0157379_10271188 3300014968 Bacteria 1543
339 Ga0157379_11834004 3300014968 Unclassified 596
340 Ga0157376_10003882 3300014969 Bacteria 10338
341 Ga0163161_10140702 3300017792 Bacteria 1827
342 Ga0206355_1223371 3300020076 Bacteria 1228
343 Ga0206353_10745816 3300020082 Bacteria 1192
344 Ga0213876_10807115 3300021384 Unclassified 500
345 Ga0207697_10020248 3300025315 Bacteria 2725
346 Ga0207656_10051647 3300025321 Bacteria 1778
347 Ga0207656_10088655 3300025321 Bacteria 1401
348 Ga0207696_1014589 3300025711 Bacteria 2689
349 Ga0207682_10222412 3300025893 Bacteria 873
350 Ga0207642_10103059 3300025899 Bacteria 1437
351 Ga0207642_10193347 3300025899 Unclassified 1118
352 Ga0207688_10011556 3300025901 Bacteria 4804
353 Ga0207688_10174628 3300025901 Bacteria 1279
354 Ga0207688_10197216 3300025901 Bacteria 1206
355 Ga0207680_10033482 3300025903 Bacteria 2931
356 Ga0207680_10249074 3300025903 Bacteria 1227
357 Ga0207680_10250498 3300025903 Bacteria 1223
358 Ga0207680_10434187 3300025903 Bacteria 931
359 Ga0207680_10471134 3300025903 Bacteria 893
360 Ga0207647_10007743 3300025904 Bacteria 7735
361 Ga0207647_10014655 3300025904 Bacteria 5401
362 Ga0207647_10021670 3300025904 Bacteria 4285
363 Ga0207647_10104745 3300025904 Bacteria 1676
364 Ga0207647_10162018 3300025904 Bacteria 1304
365 Ga0207647_10166710 3300025904 Bacteria 1284
366 Ga0207699_11048191 3300025906 Unclassified 603
367 Ga0207645_10008669 3300025907 Bacteria 7084
368 Ga0207645_10060475 3300025907 Bacteria 2419
369 Ga0207645_10187521 3300025907 Bacteria 1358
370 Ga0207645_10417150 3300025907 Bacteria 904
371 Ga0207643_10025687 3300025908 Bacteria 3257
372 Ga0207705_10000082 3300025909 Bacteria 118194
373 Ga0207705_10000086 3300025909 Bacteria 116132
374 Ga0207705_10000493 3300025909 Bacteria 33656
375 Ga0207705_10005027 3300025909 Bacteria 9920
376 Ga0207705_10026022 3300025909 Bacteria 4175
377 Ga0207705_10039003 3300025909 Bacteria 3403
378 Ga0207705_10052448 3300025909 Bacteria 2936
379 Ga0207705_10101837 3300025909 Bacteria 2113
380 Ga0207654_10031984 3300025911 Bacteria 2902
381 Ga0207654_10118589 3300025911 Bacteria 1658
382 Ga0207654_10875007 3300025911 Bacteria 651
383 Ga0207707_10025551 3300025912 Bacteria 5167
384 Ga0207707_10087292 3300025912 Bacteria 2726
385 Ga0207707_10343098 3300025912 Bacteria 1288
386 Ga0207695_10736975 3300025913 Bacteria 866
387 Ga0207693_10471338 3300025915 Bacteria 981
388 Ga0207693_10654058 3300025915 Unclassified 816
389 Ga0207660_10000770 3300025917 Bacteria 21320
390 Ga0207660_10019326 3300025917 Bacteria 4552
391 Ga0207662_10014872 3300025918 Bacteria 4372
392 Ga0207662_10866349 3300025918 Bacteria 639
393 Ga0207657_10000360 3300025919 Bacteria 48193
394 Ga0207657_10001020 3300025919 Bacteria 29724
395 Ga0207657_10001678 3300025919 Bacteria 23887
396 Ga0207657_10002261 3300025919 Bacteria 20877
397 Ga0207657_10011262 3300025919 Bacteria 8886
398 Ga0207657_10022343 3300025919 Bacteria 5922
399 Ga0207657_10023065 3300025919 Bacteria 5804
400 Ga0207657_10026681 3300025919 Bacteria 5302
401 Ga0207657_10140861 3300025919 Bacteria 1970
402 Ga0207657_10524623 3300025919 Unclassified 927
403 Ga0207649_10000420 3300025920 Bacteria 31171
404 Ga0207649_10018705 3300025920 Bacteria 3946
405 Ga0207649_10029155 3300025920 Bacteria 3257
406 Ga0207649_10128035 3300025920 Unclassified 1721
407 Ga0207649_10308980 3300025920 Bacteria 1158
408 Ga0207652_10000034 3300025921 Bacteria 138571
409 Ga0207652_10028676 3300025921 Bacteria 4647
410 Ga0207652_10268136 3300025921 Bacteria 1540
411 Ga0207681_10026545 3300025923 Bacteria 3736
412 Ga0207681_10032261 3300025923 Bacteria 3428
413 Ga0207681_11442421 3300025923 Bacteria 577
414 Ga0207694_10123657 3300025924 Bacteria 2068
415 Ga0207694_10174361 3300025924 Bacteria 1742
416 Ga0207694_10425874 3300025924 Bacteria 1106
417 Ga0207650_10017046 3300025925 Bacteria 5084
418 Ga0207650_10032900 3300025925 Bacteria 3753
419 Ga0207650_10093483 3300025925 Bacteria 2302
420 Ga0207650_10110147 3300025925 Bacteria 2130
421 Ga0207650_10112624 3300025925 Bacteria 2108
422 Ga0207650_10278944 3300025925 Bacteria 1360
423 Ga0207650_10457245 3300025925 Bacteria 1063
424 Ga0207650_10460092 3300025925 Unclassified 1060
425 Ga0207659_10083897 3300025926 Bacteria 2363
426 Ga0207659_10157715 3300025926 Bacteria 1779
427 Ga0207659_10434818 3300025926 Bacteria 1103
428 Ga0207687_10414331 3300025927 Bacteria 1111
429 Ga0207664_10854551 3300025929 Bacteria 818
430 Ga0207644_10006312 3300025931 Bacteria 7718
431 Ga0207644_10025723 3300025931 Bacteria 4048
432 Ga0207644_10031105 3300025931 Bacteria 3717
433 Ga0207644_10036457 3300025931 Bacteria 3453
434 Ga0207644_10043002 3300025931 Bacteria 3204
435 Ga0207644_10486112 3300025931 Bacteria 1017
436 Ga0207644_11198259 3300025931 Bacteria 638
437 Ga0207690_10000413 3300025932 Bacteria 27940
438 Ga0207690_10042985 3300025932 Bacteria 2972
439 Ga0207690_10053007 3300025932 Bacteria 2720
440 Ga0207690_10099389 3300025932 Bacteria 2074
441 Ga0207690_10120973 3300025932 Bacteria 1902
442 Ga0207690_10140316 3300025932 Bacteria 1780
443 Ga0207690_10471756 3300025932 Unclassified 1012
444 Ga0207690_10588261 3300025932 Bacteria 907
445 Ga0207690_10711457 3300025932 Bacteria 826
446 Ga0207706_10000192 3300025933 Bacteria 68319
447 Ga0207706_10006865 3300025933 Bacteria 10524
448 Ga0207706_10007819 3300025933 Bacteria 9867
449 Ga0207706_10016257 3300025933 Bacteria 6721
450 Ga0207706_10020249 3300025933 Bacteria 5979
451 Ga0207706_10132255 3300025933 Bacteria 2194
452 Ga0207706_10317391 3300025933 Bacteria 1356
453 Ga0207706_11214764 3300025933 Bacteria 626
454 Ga0207686_10228229 3300025934 Bacteria 1348
455 Ga0207709_10334038 3300025935 Bacteria 1138
456 Ga0207709_10373253 3300025935 Bacteria 1083
457 Ga0207709_10664277 3300025935 Bacteria 831
458 Ga0207669_10290219 3300025937 Bacteria 1238
459 Ga0207669_10954660 3300025937 Bacteria 719
460 Ga0207704_10342826 3300025938 Bacteria 1160
461 Ga0207691_10013134 3300025940 Bacteria 7928
462 Ga0207691_10014251 3300025940 Bacteria 7584
463 Ga0207691_10026469 3300025940 Bacteria 5441
464 Ga0207691_10062014 3300025940 Bacteria 3394
465 Ga0207691_10081216 3300025940 Bacteria 2914
466 Ga0207711_10000869 3300025941 Bacteria 29230
467 Ga0207711_10002038 3300025941 Bacteria 18270
468 Ga0207711_10006956 3300025941 Bacteria 9493
469 Ga0207711_10047302 3300025941 Bacteria 3677
470 Ga0207711_10080903 3300025941 Bacteria 2838
471 Ga0207711_10186107 3300025941 Bacteria 1890
472 Ga0207711_10647918 3300025941 Bacteria 985
473 Ga0207689_10024225 3300025942 Bacteria 5092
474 Ga0207689_10033527 3300025942 Bacteria 4267
475 Ga0207661_10002726 3300025944 Bacteria 12149
476 Ga0207661_10028875 3300025944 Bacteria 4252
477 Ga0207679_10000347 3300025945 Bacteria 33719
478 Ga0207679_10001488 3300025945 Bacteria 14672
479 Ga0207679_10025135 3300025945 Bacteria 4092
480 Ga0207679_10031355 3300025945 Bacteria 3720
481 Ga0207679_10051489 3300025945 Bacteria 3014
482 Ga0207679_10426486 3300025945 Bacteria 1171
483 Ga0207667_10000114 3300025949 Bacteria 128923
484 Ga0207667_10000850 3300025949 Bacteria 39399
485 Ga0207667_10069541 3300025949 Bacteria 3664
486 Ga0207667_10094516 3300025949 Bacteria 3086
487 Ga0207667_10095578 3300025949 Bacteria 3068
488 Ga0207667_10364114 3300025949 Bacteria 1474
489 Ga0207667_10475191 3300025949 Bacteria 1269
490 Ga0207651_10008035 3300025960 Bacteria 5661
491 Ga0207651_10009471 3300025960 Bacteria 5337
492 Ga0207651_10282048 3300025960 Bacteria 1373
493 Ga0207712_10003235 3300025961 Bacteria 10349
494 Ga0207712_10058889 3300025961 Bacteria 2716
495 Ga0207668_10000072 3300025972 Bacteria 77023
496 Ga0207668_10033122 3300025972 Bacteria 3421
497 Ga0207668_10160863 3300025972 Bacteria 1749
498 Ga0207668_10648170 3300025972 Bacteria 924
499 Ga0207640_10014591 3300025981 Bacteria 4527
500 Ga0207640_10141564 3300025981 Bacteria 1754
501 Ga0207640_10457633 3300025981 Bacteria 1053
502 Ga0207640_10553422 3300025981 Bacteria 967
503 Ga0207658_10009361 3300025986 Bacteria 6645
504 Ga0207658_10015372 3300025986 Bacteria 5251
505 Ga0207658_10021906 3300025986 Bacteria 4442
506 Ga0207658_10022216 3300025986 Bacteria 4415
507 Ga0207658_10026119 3300025986 Bacteria 4092
508 Ga0207658_10096138 3300025986 Bacteria 2309
509 Ga0207658_10107463 3300025986 Bacteria 2199
510 Ga0207658_10177607 3300025986 Bacteria 1759
511 Ga0207658_10188689 3300025986 Bacteria 1711
512 Ga0207658_10453870 3300025986 Bacteria 1135
513 Ga0207658_10785992 3300025986 Bacteria 863
514 Ga0207677_10066798 3300026023 Bacteria 2516
515 Ga0207677_10071281 3300026023 Bacteria 2452
516 Ga0207677_10277365 3300026023 Bacteria 1374
517 Ga0207677_10300752 3300026023 Bacteria 1325
518 Ga0207703_10004152 3300026035 Bacteria 11945
519 Ga0207703_10014313 3300026035 Bacteria 6188
520 Ga0207703_10027296 3300026035 Bacteria 4496
521 Ga0207703_10042738 3300026035 Bacteria 3636
522 Ga0207703_10142454 3300026035 Bacteria 2082
523 Ga0207703_11892354 3300026035 Bacteria 573
524 Ga0207639_10000524 3300026041 Bacteria 26513
525 Ga0207639_10029804 3300026041 Bacteria 3999
526 Ga0207639_10318103 3300026041 Bacteria 1381
527 Ga0207639_10334654 3300026041 Bacteria 1348
528 Ga0207639_10381418 3300026041 Bacteria 1266
529 Ga0207678_10004938 3300026067 Bacteria 11979
530 Ga0207678_10010668 3300026067 Bacteria 8071
531 Ga0207678_10011128 3300026067 Bacteria 7904
532 Ga0207678_10051977 3300026067 Bacteria 3536
533 Ga0207678_10876423 3300026067 Bacteria 793
534 Ga0207678_11207644 3300026067 Bacteria 670
535 Ga0207702_10001885 3300026078 Bacteria 20524
536 Ga0207702_10022362 3300026078 Bacteria 5242
537 Ga0207702_10054149 3300026078 Bacteria 3399
538 Ga0207702_10211184 3300026078 Bacteria 1804
539 Ga0207702_10368541 3300026078 Bacteria 1378
540 Ga0207641_10001513 3300026088 Bacteria 22775
541 Ga0207641_10064867 3300026088 Bacteria 3122
542 Ga0207641_10112062 3300026088 Bacteria 2420
543 Ga0207641_10540375 3300026088 Bacteria 1135
544 Ga0207648_10002300 3300026089 Bacteria 20648
545 Ga0207648_10020517 3300026089 Bacteria 5950
546 Ga0207648_10118017 3300026089 Bacteria 2331
547 Ga0207648_10303784 3300026089 Bacteria 1431
548 Ga0207648_10831389 3300026089 Unclassified 861
549 Ga0207676_10006150 3300026095 Bacteria 8475
550 Ga0207676_10006185 3300026095 Bacteria 8457
551 Ga0207676_10014327 3300026095 Bacteria 5703
552 Ga0207674_10008897 3300026116 Bacteria 11545
553 Ga0207674_10028194 3300026116 Bacteria 5930
554 Ga0207674_10040219 3300026116 Bacteria 4845
555 Ga0207674_10058545 3300026116 Bacteria 3902
556 Ga0207674_10194371 3300026116 Bacteria 1979
557 Ga0207674_10986198 3300026116 Bacteria 811
558 Ga0207674_11311970 3300026116 Bacteria 693
559 Ga0207675_100504457 3300026118 Bacteria 1205
560 Ga0207683_10001629 3300026121 Bacteria 20121
561 Ga0207683_10002763 3300026121 Bacteria 15335
562 Ga0207683_10004970 3300026121 Bacteria 11437
563 Ga0207683_10055134 3300026121 Bacteria 3486
564 Ga0207683_10195399 3300026121 Bacteria 1838
565 Ga0207698_10000542 3300026142 Bacteria 21912
566 Ga0207698_10006707 3300026142 Bacteria 7194
567 Ga0207698_10077733 3300026142 Bacteria 2662
568 Ga0207698_10123193 3300026142 Bacteria 2199
569 Ga0207698_10392822 3300026142 Bacteria 1323
570 Ga0207698_10692656 3300026142 Bacteria 1013
571 Ga0207698_11073888 3300026142 Bacteria 817
572 Ga0207698_11222284 3300026142 Bacteria 765
573 Ga0268266_10003812 3300028379 Bacteria 14751
574 Ga0268266_10010764 3300028379 Bacteria 7970
575 Ga0268266_10061473 3300028379 Bacteria 3240
576 Ga0268266_10137169 3300028379 Bacteria 2192
577 Ga0268266_10204869 3300028379 Bacteria 1807
578 Ga0268265_10002655 3300028380 Bacteria 13268
579 Ga0268265_10003724 3300028380 Bacteria 10841
580 Ga0268265_10064979 3300028380 Bacteria 2813
581 Ga0268265_10182703 3300028380 Bacteria 1803
582 Ga0268265_10228207 3300028380 Bacteria 1634
583 Ga0268265_10326296 3300028380 Bacteria 1392
584 Ga0268264_10005781 3300028381 Bacteria 10486
585 Ga0268264_10006884 3300028381 Bacteria 9541
586 Ga0268264_10148778 3300028381 Bacteria 2097
587 Ga0268264_10308887 3300028381 Bacteria 1491
588 Ga0268264_10429415 3300028381 Bacteria 1276
589 Ga0268264_10488669 3300028381 Bacteria 1199
590 Ga0268264_10537805 3300028381 Bacteria 1144
591 Ga0268264_10637035 3300028381 Bacteria 1054
592 Ga0268264_10747498 3300028381 Bacteria 974
593 Ga0268264_10812687 3300028381 Unclassified 934
594 Ga0307513_10504345 3300031456 Bacteria 927
595 Ga0307405_10082142 3300031731 Bacteria 2108
596 Ga0307405_10162711 3300031731 Bacteria 1583
597 Ga0307405_10370384 3300031731 Bacteria 1112
598 Ga0307413_10002467 3300031824 Bacteria 7526
599 Ga0307413_10010593 3300031824 Bacteria 4484
600 Ga0307410_10011969 3300031852 Bacteria 4989
601 Ga0307410_10227112 3300031852 Bacteria 1439
602 Ga0307410_10246541 3300031852 Bacteria 1387
603 Ga0307406_10181586 3300031901 Bacteria 1532
604 Ga0307406_10782456 3300031901 Unclassified 804
605 Ga0307407_10099736 3300031903 Bacteria 1800
606 Ga0307407_10109914 3300031903 Bacteria 1728
607 Ga0307407_10140567 3300031903 Bacteria 1557
608 Ga0307407_11464884 3300031903 Unclassified 539
609 Ga0307409_100021681 3300031995 Bacteria 4410
610 Ga0307409_100230612 3300031995 Bacteria 1678
611 Ga0307409_100568805 3300031995 Bacteria 1115
612 Ga0307416_100608895 3300032002 Bacteria 1173
613 Ga0307416_100631338 3300032002 Unclassified 1154
614 Ga0307416_100968210 3300032002 Unclassified 953
615 Ga0307416_101433404 3300032002 Bacteria 796
616 Ga0307414_10009564 3300032004 Bacteria 5578
617 Ga0307414_10792635 3300032004 Bacteria 864
618 Ga0307411_10000475 3300032005 Bacteria 13954
619 Ga0307411_10003128 3300032005 Bacteria 7586
620 Ga0307411_11363681 3300032005 Unclassified 648
621 Ga0307415_100129072 3300032126 Bacteria 1910
622 Ga0307415_100141369 3300032126 Bacteria 1839
623 Ga0307415_100575332 3300032126 Bacteria 998
624 Ga0307415_101534432 3300032126 Bacteria 638
625 Ga0373928_0014329 3300035084 Bacteria 1602
626 Ga0373949_0303835 3300035090 Unclassified 507
627 Ga0373952_0069710 3300035092 Bacteria 877
628 Ga0373932_0128468 3300035112 Bacteria 852
629 Ga0373939_0042642 3300035114 Bacteria 1373
630 Ga0373946_0563239 3300035171 Unclassified 589
631 Ga0373942_0095134 3300035207 Bacteria 903
632 Ga0373961_0055104 3300035241 Bacteria 1190
633 Ga0373931_0015417 3300035691 Bacteria 3748
634 Ga0373931_0087294 3300035691 Bacteria 1732
635 Ga0373935_0009711 3300035692 Bacteria 5761
636 Ga0395899_0026489 3300037312 Bacteria 4375
637 Ga0395899_0059381 3300037312 Bacteria 2819
638 Ga0395899_0078830 3300037312 Bacteria 2400
639 Ga0395899_0239317 3300037312 Bacteria 1250
640 Ga0395899_0395108 3300037312 Bacteria 916
641 Ga0395899_0996460 3300037312 Unclassified 505
642 Ga0395900_0003085 3300037418 Bacteria 18103
643 Ga0395900_0013504 3300037418 Bacteria 8346
644 Ga0395900_0015910 3300037418 Bacteria 7663
645 Ga0395900_0016429 3300037418 Bacteria 7547
646 Ga0395900_0028185 3300037418 Bacteria 5752
647 Ga0395900_0089079 3300037418 Bacteria 3172
648 Ga0395900_0097007 3300037418 Bacteria 3029
649 Ga0395900_0203772 3300037418 Bacteria 2000
650 Ga0395900_0479947 3300037418 Bacteria 1196
651 Ga0395900_0546808 3300037418 Bacteria 1103
652 Ga0395900_0609207 3300037418 Bacteria 1032
653 Ga0395898_0010465 3300037466 Bacteria 9695
654 Ga0395898_0064367 3300037466 Bacteria 3556
655 Ga0395898_0094728 3300037466 Bacteria 2869
656 Ga0395898_0108973 3300037466 Bacteria 2655
657 Ga0395898_0329791 3300037466 Bacteria 1455
658 Ga0395898_0352082 3300037466 Bacteria 1404
659 Ga0395898_0822954 3300037466 Bacteria 868
660 Ga0395905_0000104 3300037471 Bacteria 141965
661 Ga0395905_0001031 3300037471 Bacteria 35482
662 Ga0395905_0028195 3300037471 Bacteria 5292
663 Ga0395905_0079844 3300037471 Bacteria 3066
664 Ga0395905_0139090 3300037471 Bacteria 2284
665 Ga0395905_0370642 3300037471 Bacteria 1325
666 Ga0395905_0380799 3300037471 Bacteria 1305
667 Ga0395905_0564245 3300037471 Bacteria 1040
668 Ga0395905_0738714 3300037471 Bacteria 886
669 Ga0395905_1037366 3300037471 Unclassified 723
670 Ga0395901_0001126 3300038443 Bacteria 28379
671 Ga0395901_0044992 3300038443 Bacteria 4579
672 Ga0395901_0165413 3300038443 Bacteria 2323
673 Ga0395901_0170171 3300038443 Bacteria 2286
674 Ga0395901_0247381 3300038443 Bacteria 1858
675 Ga0395901_0525600 3300038443 Bacteria 1201
676 Ga0395901_1974721 3300038443 Bacteria 530
677 Ga0439449_0095892 3300042007 Bacteria 1096
678 Ga0439458_0060151 3300042157 Bacteria 947
679 Ga0439464_0000350 3300042439 Bacteria 8930
680 Ga0466969_0084983 3300044656 Bacteria 1505
681 Ga0466969_0174412 3300044656 Bacteria 985
682 Ga0466966_0075412 3300044684 Bacteria 2107
683 Ga0466966_0151438 3300044684 Bacteria 1414
684 Ga0466961_0048228 3300044693 Bacteria 2722
685 Ga0466963_0023693 3300044694 Bacteria 3901
686 Ga0466963_0058368 3300044694 Bacteria 2573
687 Ga0466971_0025392 3300044719 Bacteria 2646
688 Ga0466957_0005582 3300044842 Bacteria 7066
689 Ga0466957_0009431 3300044842 Bacteria 5573
690 Ga0466960_0297462 3300044901 Unclassified 909
691 Ga0466959_0026160 3300045049 Bacteria 4326
692 Ga0466959_0176653 3300045049 Bacteria 1495
693 Ga0466958_0032434 3300045836 Bacteria 3108
694 Ga0466958_0104886 3300045836 Bacteria 1761
695 Ga0466958_0468886 3300045836 Bacteria 816
696 Ga0466967_0020997 3300045976 Bacteria 5290
697 Ga0466967_0027514 3300045976 Bacteria 4732
698 Ga0466967_0038382 3300045976 Bacteria 4107
699 Ga0466967_0047665 3300045976 Bacteria 3736
700 Ga0466967_0067578 3300045976 Bacteria 3188
701 Ga0466967_0071901 3300045976 Bacteria 3098
702 Ga0466967_0343418 3300045976 Bacteria 1444
703 Ga0466967_1456446 3300045976 Bacteria 682
704 Ga0495585_0120095 3300046492 Bacteria 1391
705 Ga0495616_0134238 3300046513 Bacteria 1132
706 Ga0495643_0393389 3300046522 Unclassified 613
707 Ga0495642_0376421 3300046528 Bacteria 625
708 Ga0495668_0050557 3300046616 Bacteria 2303
709 Ga0495668_0578034 3300046616 Bacteria 620
710 Ga0495669_0027869 3300046684 Bacteria 2471
711 Ga0495669_0101523 3300046684 Bacteria 1336
712 Ga0495669_0136343 3300046684 Bacteria 1157
713 Ga0495669_0313169 3300046684 Unclassified 757
714 Ga0495677_0047340 3300047445 Bacteria 1579
715 Ga0495677_0243229 3300047445 Bacteria 703
716 Ga0496100_0006995 3300048903 Bacteria 6188
717 Ga0496100_0165871 3300048903 Bacteria 1587
718 Ga0496100_0944117 3300048903 Bacteria 678
719 Ga0496101_0088049 3300048904 Bacteria 2306
720 Ga0496101_0118283 3300048904 Bacteria 2001
721 Ga0496101_0124376 3300048904 Bacteria 1953
722 Ga0496101_0189895 3300048904 Bacteria 1585
723 Ga0496101_1447997 3300048904 Bacteria 535
724 Ga0496102_0141200 3300048905 Bacteria 2258
725 Ga0496102_0144054 3300048905 Bacteria 2235
726 Ga0496103_0044232 3300048906 Bacteria 2743
727 Ga0496104_0215519 3300048907 Bacteria 1831
728 Ga0496104_0242889 3300048907 Bacteria 1713
729 Ga0496104_0391196 3300048907 Bacteria 1302
730 Ga0496105_0096247 3300048908 Bacteria 2445
731 Ga0496105_0233726 3300048908 Bacteria 1493
732 Ga0496105_0282734 3300048908 Bacteria 1337
733 Ga0496106_0033452 3300048909 Bacteria 3836
734 Ga0496106_0047950 3300048909 Bacteria 3216
735 Ga0496106_0111285 3300048909 Bacteria 2132
736 Ga0496107_0008263 3300048910 Bacteria 7203
737 Ga0496107_0025841 3300048910 Bacteria 4160
738 Ga0496107_0046907 3300048910 Bacteria 3110
739 Ga0496107_0144468 3300048910 Bacteria 1759
740 Ga0496107_0170668 3300048910 Bacteria 1614
741 Ga0496107_0510113 3300048910 Bacteria 892
742 Ga0496108_0009895 3300048911 Bacteria 7727
743 Ga0496108_0038691 3300048911 Bacteria 3974
744 Ga0496108_0040243 3300048911 Bacteria 3895
745 Ga0496108_0148879 3300048911 Bacteria 2019
746 Ga0496109_0119558 3300048912 Bacteria 2453
747 Ga0496109_0145862 3300048912 Bacteria 2214
748 Ga0496109_0202462 3300048912 Bacteria 1866
749 Ga0496109_0725456 3300048912 Bacteria 932
750 Ga0496110_0047002 3300048913 Bacteria 3777
751 Ga0496110_0091427 3300048913 Bacteria 2722
752 Ga0496110_0212783 3300048913 Bacteria 1757
753 Ga0496110_0315668 3300048913 Bacteria 1423
754 Ga0496110_1294800 3300048913 Bacteria 638
755 Ga0496111_0007276 3300048914 Bacteria 7244
756 Ga0496111_0140569 3300048914 Bacteria 1789
757 Ga0496111_0148522 3300048914 Bacteria 1738
758 Ga0496112_0057299 3300048915 Bacteria 3836
759 Ga0496112_0058934 3300048915 Bacteria 3782
760 Ga0496112_0109240 3300048915 Bacteria 2736
761 Ga0496112_0117027 3300048915 Bacteria 2635
762 Ga0496112_0172125 3300048915 Bacteria 2130
763 Ga0496112_1012585 3300048915 Bacteria 750
764 Ga0496113_0012024 3300048916 Bacteria 5804
765 Ga0496113_0073323 3300048916 Bacteria 2608
766 Ga0496113_0098386 3300048916 Bacteria 2264
767 Ga0496113_0184825 3300048916 Bacteria 1653
768 Ga0496113_1077842 3300048916 Archaea 631
769 Ga0496114_0030533 3300048917 Bacteria 4434
770 Ga0496115_0144384 3300048918 Bacteria 1964
771 Ga0501067_0035435 3300049583 Bacteria 2771
772 Ga0501069_0120442 3300049585 Bacteria 1499
773 Ga0501070_0067070 3300049586 Bacteria 2972
774 Ga0501070_0860643 3300049586 Bacteria 709
775 Ga0501071_0093261 3300049587 Bacteria 2214
776 Ga0501230_076047 3300049667 Unclassified 697
777 Ga0501268_026444 3300049765 Unclassified 1026
778 Ga0501270_009736 3300049767 Unclassified 1249
779 nmdc:mga08y16_533163_c1 3300050511 Bacteria 1189
780 nmdc:mga0n895_544974_c1 3300050512 Unclassified 1166
781 Ga0500658_0000036 3300053134 Bacteria 85304
782 Ga0587073_0086711 3300059492 Bacteria 788
783 Ga0587071_022250 3300060344 Bacteria 1169
784 Ga0070670_100091124
785 JGI24741J21665_1012998
786 JGI24741J21665_1018528
787 JGI24740J21852_10004688
788 JGI24740J21852_10008945
789 JGI24740J21852_10026117
790 JGI24739J22299_10004473
791 JGI24739J22299_10014393
792 JGI24737J22298_10000655
793 JGI24737J22298_10000987
794 JGI24737J22298_10056357
795 JGI24743J22301_10048885
796 JGI24735J21928_10057368
797 JGI24735J21928_10058798
798 JGI24738J21930_10000812
799 JGI24738J21930_10070799
800 Ga0065712_10211573
801 Ga0070658_10000269
802 Ga0070658_10007111
803 Ga0070658_10016356
804 Ga0070658_10020842
805 Ga0070658_10026585
806 Ga0070658_10706906
807 Ga0070676_10008701
808 Ga0070676_10034995
809 Ga0070676_10077479
810 Ga0070676_10649335
811 Ga0070683_100001138
812 Ga0070683_100007370
813 Ga0070683_100361267
814 Ga0070683_101090397
815 Ga0070690_100060826
816 Ga0070690_100137193
817 Ga0070690_100657645
818 Ga0070670_100028324
819 Ga0070670_100030482
820 Ga0070670_100073467
821 Ga0070670_100159061
822 Ga0070670_100175633
823 Ga0070670_100325843
824 Ga0070670_100438894
825 Ga0070670_101516190
826 Ga0070670_102008472
827 Ga0070677_10592280
828 Ga0068869_100318459
829 Ga0068869_100653340
830 Ga0070666_10000330
831 Ga0070666_10007668
832 Ga0070666_10032086
833 Ga0070666_10193411
834 Ga0070666_10208281
835 Ga0070680_100007182
836 Ga0070680_100217441
837 Ga0070682_100230895
838 Ga0068868_100024884
839 Ga0068868_100147000
840 Ga0068868_100157935
841 Ga0068868_100207917
842 Ga0068868_100454913
843 Ga0070660_100000109
844 Ga0070660_100000339
845 Ga0070660_100003053
846 Ga0070660_100015001
847 Ga0070660_100107887
848 Ga0070660_100582750
849 Ga0070660_101684040
850 Ga0070687_100091225
851 Ga0070687_100190983
852 Ga0070661_100000070
853 Ga0070661_100011611
854 Ga0070661_100023710
855 Ga0070661_100034939
856 Ga0070661_100118743
857 Ga0070661_100325891
858 Ga0070692_10008029
859 Ga0070692_10011894
860 Ga0070668_100019581
861 Ga0070668_100058980
862 Ga0070668_100489744
863 Ga0070668_100544512
864 Ga0070668_101483319
865 Ga0070669_100140030
866 Ga0070669_100185501
867 Ga0070669_100256674
868 Ga0070669_100269297
869 Ga0070669_101285535
870 Ga0070675_100140457
871 Ga0070675_100355003
872 Ga0070675_100973275
873 Ga0070671_100016707
874 Ga0070671_100026341
875 Ga0070671_100081281
876 Ga0070671_100151912
877 Ga0070671_100196846
878 Ga0070671_100599972
879 Ga0070671_100717777
880 Ga0070674_100044481
881 Ga0070674_100111426
882 Ga0070674_100269077
883 Ga0070673_100008589
884 Ga0070673_100029719
885 Ga0070673_100029963
886 Ga0070673_100068180
887 Ga0070673_100072882
888 Ga0070673_100125407
889 Ga0070673_100500918
890 Ga0070688_100239974
891 Ga0070659_100000312
892 Ga0070659_100005147
893 Ga0070659_100053970
894 Ga0070659_100238704
895 Ga0070659_100389646
896 Ga0070659_101000084
897 Ga0070667_100003813
898 Ga0070667_100008539
899 Ga0070667_100031529
900 Ga0070667_100036196
901 Ga0070667_100042585
902 Ga0070667_100081281
903 Ga0070667_100243972
904 Ga0070667_100264287
905 Ga0070667_100462252
906 Ga0070667_100521863
907 Ga0070667_101026454
908 Ga0070714_100304477
909 Ga0070694_100025638
910 Ga0070663_100006534
911 Ga0070663_100008493
912 Ga0070663_100222806
913 Ga0070663_100314442
914 Ga0070663_100388540
915 Ga0070663_100817736
916 Ga0070678_100001567
917 Ga0070678_100008774
918 Ga0070678_100160172
919 Ga0070678_100271767
920 Ga0070678_101070560
921 Ga0070678_101080991
922 Ga0070662_100000037
923 Ga0070662_100009922
924 Ga0070662_100031671
925 Ga0070662_100318556
926 Ga0070662_100805208
927 Ga0070681_10020408
928 Ga0070681_10063111
929 Ga0068867_100020121
930 Ga0068867_100093557
931 Ga0068867_100185971
932 Ga0068867_100830755
933 Ga0070685_10057207
934 Ga0070679_100015769
935 Ga0070679_100211998
936 Ga0070679_101042618
937 Ga0070684_100007613
938 Ga0068853_100000309
939 Ga0068853_100100007
940 Ga0068853_101073267
941 Ga0068853_101579720
942 Ga0070672_100009584
943 Ga0070672_100009843
944 Ga0070672_100169136
945 Ga0070672_100169185
946 Ga0070686_100063234
947 Ga0070686_100359814
948 Ga0070695_100520689
949 Ga0070696_100137209
950 Ga0070696_100804678
951 Ga0070693_100003397
952 Ga0070693_100120838
953 Ga0070665_100002925
954 Ga0070665_100049719
955 Ga0070665_100095470
956 Ga0070665_100105865
957 Ga0070665_100124803
958 Ga0070665_100159377
959 Ga0070704_101078266
960 Ga0068855_100000247
961 Ga0068855_100024916
962 Ga0068855_100037585
963 Ga0068855_100070606
964 Ga0068855_100082525
965 Ga0068855_100764707
966 Ga0068855_101203595
967 Ga0068855_101283533
968 Ga0070664_100000077
969 Ga0070664_100003026
970 Ga0070664_100129822
971 Ga0070664_100158916
972 Ga0068857_100020826
973 Ga0068857_100022877
974 Ga0068857_100252035
975 Ga0068857_101034718
976 Ga0068854_100111101
977 Ga0068854_100170997
978 Ga0068854_100503140
979 Ga0068856_100000444
980 Ga0068856_100014742
981 Ga0068856_100063582
982 Ga0068856_100153077
983 Ga0070702_100231833
984 Ga0068852_100000350
985 Ga0068852_100032451
986 Ga0068852_100282041
987 Ga0068852_100688902
988 Ga0068859_100002392
989 Ga0068859_100037850
990 Ga0068859_100157169
991 Ga0068859_100257758
992 Ga0068859_101533935
993 Ga0068864_100001110
994 Ga0068864_100002819
995 Ga0068864_100022361
996 Ga0068864_100040637
997 Ga0068864_100510382
998 Ga0068866_10005188
999 Ga0068866_10067216
1000 Ga0068861_100397804
1001 Ga0068851_10006475
1002 Ga0068851_10018054
1003 Ga0068870_10049839
1004 Ga0068863_100001056
1005 Ga0068863_100022022
1006 Ga0068863_100064125
1007 Ga0068863_100079639
1008 Ga0068863_100588306
1009 Ga0068858_100002753
1010 Ga0068858_100003145
1011 Ga0068858_100020528
1012 Ga0068858_100055846
1013 Ga0068858_100115005
1014 Ga0068858_100864297
1015 Ga0068860_100002768
1016 Ga0068860_100022372
1017 Ga0068860_100160812
1018 Ga0068860_100599134
1019 Ga0068860_100739500
1020 Ga0068860_100850854
1021 Ga0068862_100016753
1022 Ga0068862_100101524
1023 Ga0068862_100186233
1024 Ga0068862_100209588
1025 Ga0068862_100333344
1026 Ga0070717_10307576
1027 Ga0075362_10040870
1028 Ga0097621_100011209
1029 Ga0097621_100013030
1030 Ga0097621_100073298
1031 Ga0097621_100079858
1032 Ga0097621_100386946
1033 Ga0097621_100769015
1034 Ga0068871_100005666
1035 Ga0068871_100149842
1036 Ga0068865_100001424
1037 Ga0068865_100555539
1038 Ga0097620_100002392
1039 Ga0097620_100037851
1040 Ga0097620_100157174
1041 Ga0097620_100257750
1042 Ga0097620_101534009
1043 Ga0105250_10020270
1044 Ga0105240_10122528
1045 Ga0111539_10687239
1046 Ga0105245_10019331
1047 Ga0105247_10136598
1048 Ga0105247_11578015
1049 Ga0105243_10425369
1050 Ga0105243_10678028
1051 Ga0105241_10035146
1052 Ga0105241_12136009
1053 Ga0105242_10002410
1054 Ga0105248_10000719
1055 Ga0105248_10001320
1056 Ga0105248_10034268
1057 Ga0105248_10034516
1058 Ga0105248_10044563
1059 Ga0105248_10197736
1060 Ga0105248_10444894
1061 Ga0105248_10610712
1062 Ga0105248_10760313
1063 Ga0105237_10099852
1064 Ga0105238_10105363
1065 Ga0105238_10238785
1066 Ga0105238_10284737
1067 Ga0105238_10923203
1068 Ga0105249_10026474
1069 Ga0105249_10026708
1070 Ga0105249_10297614
1071 Ga0105249_10763485
1072 Ga0105239_10042112
1073 Ga0105239_10497957
1074 Ga0105246_10686742
1075 Ga0157373_10093973
1076 Ga0157373_10104195
1077 Ga0157373_10239812
1078 Ga0157373_10699714
1079 Ga0157371_10000624
1080 Ga0157371_10009369
1081 Ga0157371_10060886
1082 Ga0157371_10079776
1083 Ga0157371_10195695
1084 Ga0157371_10209660
1085 Ga0157370_10015768
1086 Ga0157370_10350312
1087 Ga0157369_10004619
1088 Ga0157369_10063577
1089 Ga0157369_10083232
1090 Ga0157369_10301563
1091 Ga0157369_10743491
1092 Ga0157374_10002253
1093 Ga0157374_10034433
1094 Ga0157374_10101337
1095 Ga0157374_10116923
1096 Ga0157374_10437965
1097 Ga0157378_10182112
1098 Ga0157378_11842491
1099 Ga0163162_10021265
1100 Ga0163162_10088341
1101 Ga0163162_10154261
1102 Ga0163162_10460752
1103 Ga0157372_10143435
1104 Ga0157372_10506493
1105 Ga0157372_10571284
1106 Ga0157372_11304519
1107 Ga0157372_12392102
1108 Ga0157375_10004680
1109 Ga0157375_10377954
1110 Ga0157375_11198341
1111 Ga0163163_10000123
1112 Ga0163163_10002706
1113 Ga0163163_10006151
1114 Ga0163163_10093474
1115 Ga0157377_10156987
1116 Ga0157377_10764551
1117 Ga0157379_10003612
1118 Ga0157379_10013809
1119 Ga0157379_10028415
1120 Ga0157379_10148042
1121 Ga0157379_10271188
1122 Ga0157379_11834004
1123 Ga0157376_10003882
1124 Ga0163161_10140702
1125 Ga0206355_1223371
1126 Ga0206353_10745816
1127 Ga0213876_10807115
1128 Ga0207697_10020248
1129 Ga0207656_10051647
1130 Ga0207656_10088655
1131 Ga0207696_1014589
1132 Ga0207682_10222412
1133 Ga0207642_10103059
1134 Ga0207642_10193347
1135 Ga0207688_10011556
1136 Ga0207688_10174628
1137 Ga0207688_10197216
1138 Ga0207680_10033482
1139 Ga0207680_10249074
1140 Ga0207680_10250498
1141 Ga0207680_10434187
1142 Ga0207680_10471134
1143 Ga0207647_10007743
1144 Ga0207647_10014655
1145 Ga0207647_10021670
1146 Ga0207647_10104745
1147 Ga0207647_10162018
1148 Ga0207647_10166710
1149 Ga0207699_11048191
1150 Ga0207645_10008669
1151 Ga0207645_10060475
1152 Ga0207645_10187521
1153 Ga0207645_10417150
1154 Ga0207643_10025687
1155 Ga0207705_10000082
1156 Ga0207705_10000086
1157 Ga0207705_10000493
1158 Ga0207705_10005027
1159 Ga0207705_10026022
1160 Ga0207705_10039003
1161 Ga0207705_10052448
1162 Ga0207705_10101837
1163 Ga0207654_10031984
1164 Ga0207654_10118589
1165 Ga0207654_10875007
1166 Ga0207707_10025551
1167 Ga0207707_10087292
1168 Ga0207707_10343098
1169 Ga0207695_10736975
1170 Ga0207693_10471338
1171 Ga0207693_10654058
1172 Ga0207660_10000770
1173 Ga0207660_10019326
1174 Ga0207662_10014872
1175 Ga0207662_10866349
1176 Ga0207657_10000360
1177 Ga0207657_10001020
1178 Ga0207657_10001678
1179 Ga0207657_10002261
1180 Ga0207657_10011262
1181 Ga0207657_10022343
1182 Ga0207657_10023065
1183 Ga0207657_10026681
1184 Ga0207657_10140861
1185 Ga0207657_10524623
1186 Ga0207649_10000420
1187 Ga0207649_10018705
1188 Ga0207649_10029155
1189 Ga0207649_10128035
1190 Ga0207649_10308980
1191 Ga0207652_10000034
1192 Ga0207652_10028676
1193 Ga0207652_10268136
1194 Ga0207681_10026545
1195 Ga0207681_10032261
1196 Ga0207681_11442421
1197 Ga0207694_10123657
1198 Ga0207694_10174361
1199 Ga0207694_10425874
1200 Ga0207650_10017046
1201 Ga0207650_10032900
1202 Ga0207650_10093483
1203 Ga0207650_10110147
1204 Ga0207650_10112624
1205 Ga0207650_10278944
1206 Ga0207650_10457245
1207 Ga0207650_10460092
1208 Ga0207659_10083897
1209 Ga0207659_10157715
1210 Ga0207659_10434818
1211 Ga0207687_10414331
1212 Ga0207664_10854551
1213 Ga0207644_10006312
1214 Ga0207644_10025723
1215 Ga0207644_10031105
1216 Ga0207644_10036457
1217 Ga0207644_10043002
1218 Ga0207644_10486112
1219 Ga0207644_11198259
1220 Ga0207690_10000413
1221 Ga0207690_10042985
1222 Ga0207690_10053007
1223 Ga0207690_10099389
1224 Ga0207690_10120973
1225 Ga0207690_10140316
1226 Ga0207690_10471756
1227 Ga0207690_10588261
1228 Ga0207690_10711457
1229 Ga0207706_10000192
1230 Ga0207706_10006865
1231 Ga0207706_10007819
1232 Ga0207706_10016257
1233 Ga0207706_10020249
1234 Ga0207706_10132255
1235 Ga0207706_10317391
1236 Ga0207706_11214764
1237 Ga0207686_10228229
1238 Ga0207709_10334038
1239 Ga0207709_10373253
1240 Ga0207709_10664277
1241 Ga0207669_10290219
1242 Ga0207669_10954660
1243 Ga0207704_10342826
1244 Ga0207691_10013134
1245 Ga0207691_10014251
1246 Ga0207691_10026469
1247 Ga0207691_10062014
1248 Ga0207691_10081216
1249 Ga0207711_10000869
1250 Ga0207711_10002038
1251 Ga0207711_10006956
1252 Ga0207711_10047302
1253 Ga0207711_10080903
1254 Ga0207711_10186107
1255 Ga0207711_10647918
1256 Ga0207689_10024225
1257 Ga0207689_10033527
1258 Ga0207661_10002726
1259 Ga0207661_10028875
1260 Ga0207679_10000347
1261 Ga0207679_10001488
1262 Ga0207679_10025135
1263 Ga0207679_10031355
1264 Ga0207679_10051489
1265 Ga0207679_10426486
1266 Ga0207667_10000114
1267 Ga0207667_10000850
1268 Ga0207667_10069541
1269 Ga0207667_10094516
1270 Ga0207667_10095578
1271 Ga0207667_10364114
1272 Ga0207667_10475191
1273 Ga0207651_10008035
1274 Ga0207651_10009471
1275 Ga0207651_10282048
1276 Ga0207712_10003235
1277 Ga0207712_10058889
1278 Ga0207668_10000072
1279 Ga0207668_10033122
1280 Ga0207668_10160863
1281 Ga0207668_10648170
1282 Ga0207640_10014591
1283 Ga0207640_10141564
1284 Ga0207640_10457633
1285 Ga0207640_10553422
1286 Ga0207658_10009361
1287 Ga0207658_10015372
1288 Ga0207658_10021906
1289 Ga0207658_10022216
1290 Ga0207658_10026119
1291 Ga0207658_10096138
1292 Ga0207658_10107463
1293 Ga0207658_10177607
1294 Ga0207658_10188689
1295 Ga0207658_10453870
1296 Ga0207658_10785992
1297 Ga0207677_10066798
1298 Ga0207677_10071281
1299 Ga0207677_10277365
1300 Ga0207677_10300752
1301 Ga0207703_10004152
1302 Ga0207703_10014313
1303 Ga0207703_10027296
1304 Ga0207703_10042738
1305 Ga0207703_10142454
1306 Ga0207703_11892354
1307 Ga0207639_10000524
1308 Ga0207639_10029804
1309 Ga0207639_10318103
1310 Ga0207639_10334654
1311 Ga0207639_10381418
1312 Ga0207678_10004938
1313 Ga0207678_10010668
1314 Ga0207678_10011128
1315 Ga0207678_10051977
1316 Ga0207678_10876423
1317 Ga0207678_11207644
1318 Ga0207702_10001885
1319 Ga0207702_10022362
1320 Ga0207702_10054149
1321 Ga0207702_10211184
1322 Ga0207702_10368541
1323 Ga0207641_10001513
1324 Ga0207641_10064867
1325 Ga0207641_10112062
1326 Ga0207641_10540375
1327 Ga0207648_10002300
1328 Ga0207648_10020517
1329 Ga0207648_10118017
1330 Ga0207648_10303784
1331 Ga0207648_10831389
1332 Ga0207676_10006150
1333 Ga0207676_10006185
1334 Ga0207676_10014327
1335 Ga0207674_10008897
1336 Ga0207674_10028194
1337 Ga0207674_10040219
1338 Ga0207674_10058545
1339 Ga0207674_10194371
1340 Ga0207674_10986198
1341 Ga0207674_11311970
1342 Ga0207675_100504457
1343 Ga0207683_10001629
1344 Ga0207683_10002763
1345 Ga0207683_10004970
1346 Ga0207683_10055134
1347 Ga0207683_10195399
1348 Ga0207698_10000542
1349 Ga0207698_10006707
1350 Ga0207698_10077733
1351 Ga0207698_10123193
1352 Ga0207698_10392822
1353 Ga0207698_10692656
1354 Ga0207698_11073888
1355 Ga0207698_11222284
1356 Ga0268266_10003812
1357 Ga0268266_10010764
1358 Ga0268266_10061473
1359 Ga0268266_10137169
1360 Ga0268266_10204869
1361 Ga0268265_10002655
1362 Ga0268265_10003724
1363 Ga0268265_10064979
1364 Ga0268265_10182703
1365 Ga0268265_10228207
1366 Ga0268265_10326296
1367 Ga0268264_10005781
1368 Ga0268264_10006884
1369 Ga0268264_10148778
1370 Ga0268264_10308887
1371 Ga0268264_10429415
1372 Ga0268264_10488669
1373 Ga0268264_10537805
1374 Ga0268264_10637035
1375 Ga0268264_10747498
1376 Ga0268264_10812687
1377 Ga0307513_10504345
1378 Ga0307405_10082142
1379 Ga0307405_10162711
1380 Ga0307405_10370384
1381 Ga0307413_10002467
1382 Ga0307413_10010593
1383 Ga0307410_10011969
1384 Ga0307410_10227112
1385 Ga0307410_10246541
1386 Ga0307406_10181586
1387 Ga0307406_10782456
1388 Ga0307407_10099736
1389 Ga0307407_10109914
1390 Ga0307407_10140567
1391 Ga0307407_11464884
1392 Ga0307409_100021681
1393 Ga0307409_100230612
1394 Ga0307409_100568805
1395 Ga0307416_100608895
1396 Ga0307416_100631338
1397 Ga0307416_100968210
1398 Ga0307416_101433404
1399 Ga0307414_10009564
1400 Ga0307414_10792635
1401 Ga0307411_10000475
1402 Ga0307411_10003128
1403 Ga0307411_11363681
1404 Ga0307415_100129072
1405 Ga0307415_100141369
1406 Ga0307415_100575332
1407 Ga0307415_101534432
1408 Ga0373928_0014329
1409 Ga0373949_0303835
1410 Ga0373952_0069710
1411 Ga0373932_0128468
1412 Ga0373939_0042642
1413 Ga0373946_0563239
1414 Ga0373942_0095134
1415 Ga0373961_0055104
1416 Ga0373931_0015417
1417 Ga0373931_0087294
1418 Ga0373935_0009711
1419 Ga0395899_0026489
1420 Ga0395899_0059381
1421 Ga0395899_0078830
1422 Ga0395899_0239317
1423 Ga0395899_0395108
1424 Ga0395899_0996460
1425 Ga0395900_0003085
1426 Ga0395900_0013504
1427 Ga0395900_0015910
1428 Ga0395900_0016429
1429 Ga0395900_0028185
1430 Ga0395900_0089079
1431 Ga0395900_0097007
1432 Ga0395900_0203772
1433 Ga0395900_0479947
1434 Ga0395900_0546808
1435 Ga0395900_0609207
1436 Ga0395898_0010465
1437 Ga0395898_0064367
1438 Ga0395898_0094728
1439 Ga0395898_0108973
1440 Ga0395898_0329791
1441 Ga0395898_0352082
1442 Ga0395898_0822954
1443 Ga0395905_0000104
1444 Ga0395905_0001031
1445 Ga0395905_0028195
1446 Ga0395905_0079844
1447 Ga0395905_0139090
1448 Ga0395905_0370642
1449 Ga0395905_0380799
1450 Ga0395905_0564245
1451 Ga0395905_0738714
1452 Ga0395905_1037366
1453 Ga0395901_0001126
1454 Ga0395901_0044992
1455 Ga0395901_0165413
1456 Ga0395901_0170171
1457 Ga0395901_0247381
1458 Ga0395901_0525600
1459 Ga0395901_1974721
1460 Ga0439449_0095892
1461 Ga0439458_0060151
1462 Ga0439464_0000350
1463 Ga0466969_0084983
1464 Ga0466969_0174412
1465 Ga0466966_0075412
1466 Ga0466966_0151438
1467 Ga0466961_0048228
1468 Ga0466963_0023693
1469 Ga0466963_0058368
1470 Ga0466971_0025392
1471 Ga0466957_0005582
1472 Ga0466957_0009431
1473 Ga0466960_0297462
1474 Ga0466959_0026160
1475 Ga0466959_0176653
1476 Ga0466958_0032434
1477 Ga0466958_0104886
1478 Ga0466958_0468886
1479 Ga0466967_0020997
1480 Ga0466967_0027514
1481 Ga0466967_0038382
1482 Ga0466967_0047665
1483 Ga0466967_0067578
1484 Ga0466967_0071901
1485 Ga0466967_0343418
1486 Ga0466967_1456446
1487 Ga0495585_0120095
1488 Ga0495616_0134238
1489 Ga0495643_0393389
1490 Ga0495642_0376421
1491 Ga0495668_0050557
1492 Ga0495668_0578034
1493 Ga0495669_0027869
1494 Ga0495669_0101523
1495 Ga0495669_0136343
1496 Ga0495669_0313169
1497 Ga0495677_0047340
1498 Ga0495677_0243229
1499 Ga0496100_0006995
1500 Ga0496100_0165871
1501 Ga0496100_0944117
1502 Ga0496101_0088049
1503 Ga0496101_0118283
1504 Ga0496101_0124376
1505 Ga0496101_0189895
1506 Ga0496101_1447997
1507 Ga0496102_0141200
1508 Ga0496102_0144054
1509 Ga0496103_0044232
1510 Ga0496104_0215519
1511 Ga0496104_0242889
1512 Ga0496104_0391196
1513 Ga0496105_0096247
1514 Ga0496105_0233726
1515 Ga0496105_0282734
1516 Ga0496106_0033452
1517 Ga0496106_0047950
1518 Ga0496106_0111285
1519 Ga0496107_0008263
1520 Ga0496107_0025841
1521 Ga0496107_0046907
1522 Ga0496107_0144468
1523 Ga0496107_0170668
1524 Ga0496107_0510113
1525 Ga0496108_0009895
1526 Ga0496108_0038691
1527 Ga0496108_0040243
1528 Ga0496108_0148879
1529 Ga0496109_0119558
1530 Ga0496109_0145862
1531 Ga0496109_0202462
1532 Ga0496109_0725456
1533 Ga0496110_0047002
1534 Ga0496110_0091427
1535 Ga0496110_0212783
1536 Ga0496110_0315668
1537 Ga0496110_1294800
1538 Ga0496111_0007276
1539 Ga0496111_0140569
1540 Ga0496111_0148522
1541 Ga0496112_0057299
1542 Ga0496112_0058934
1543 Ga0496112_0109240
1544 Ga0496112_0117027
1545 Ga0496112_0172125
1546 Ga0496112_1012585
1547 Ga0496113_0012024
1548 Ga0496113_0073323
1549 Ga0496113_0098386
1550 Ga0496113_0184825
1551 Ga0496113_1077842
1552 Ga0496114_0030533
1553 Ga0496115_0144384
1554 Ga0501067_0035435
1555 Ga0501069_0120442
1556 Ga0501070_0067070
1557 Ga0501070_0860643
1558 Ga0501071_0093261
1559 Ga0501230_076047
1560 Ga0501268_026444
1561 Ga0501270_009736
1562 nmdc:mga08y16_533163_c1
1563 nmdc:mga0n895_544974_c1
1564 Ga0500658_0000036
1565 Ga0587073_0086711
1566 Ga0587071_022250

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vhz-assembly1.cif.gz_B crystal structure of adp compounds hydrolase 0.8626 67 99
5c8l-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.8312 67 100
5c7q-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.8283 67 100
5i8u-assembly2.cif.gz_A crystal structure of the rv1700 (mt adprase) e142q mutant 0.8204 67 101
1xjv-assembly1.cif.gz_A crystal structure of human pot1 bound to telomeric single-stranded dna (ttagggttag) 0.796 67 101
ID Description Score Start End Superfamily
5c8lB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8303 67 100 3.90.79.10
5i8uB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8072 67 101 3.90.79.10
af_Q0D7W8_61_281_2.120.10.60 Mainly Beta;6 Propeller;Neuraminidase;Tricorn protease N-terminal domain 0.8065 64 110 2.120.10.60
af_A0A0R0JA37_7_107_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7984 67 99 2.40.50.140
af_A0A0R0EKE2_8_109_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7926 67 99 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7V0RK78-F1-model_v4 Uncharacterized protein 0.8865 67 109
AF-A0A2H6IWU2-F1-model_v4 Uncharacterized protein 0.8767 67 109
AF-A0A5A8CHI9-F1-model_v4 Uncharacterized protein 0.873 67 110 GO:0016567
AF-A0A2A5F1X9-F1-model_v4 Uncharacterized protein 0.8409 69 110
AF-A0A225E0T6-F1-model_v4 Uncharacterized protein 0.8321 70 116 GO:0016020

Map