F480655
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 783 | 323 | 783 | 279 |
Family's Representative Sequence
| Representative Sequence | 3300007788|Ga0099795_10015030|Ga0099795_100150302 |
| Length | 327 |
| Sequence | MISSPIVAARLAGSAHGNYRDSQFDMALSAGGPFRRYYRKERSMVDIRRMGPQIGVEVTGVDVKTLDDAGFAPIYQAWLDCNILVVRDQQLEIKDFLRYSRRFGPVIPHPSKSTRHPEIPEITMLGINKFDADGKINNAIYRRGAEGWHTDGAYNQAPFKATQLYALAIPSRGGDTLFANGYAAYDALPERLKRRLDGVKGAFAYGGRRGGSQLLDKEDQDWKPVFHPIIRTHPETGRKSLYFDPGKIVYIVGADQKESDALIAELKGYMIQPDAEYRHKWRKGDIVIWDNRCSYHKAAGDYPPEEDRIHWRVSINDYGVEALAAAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 85 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 114 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 115 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 195 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 201 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 202 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 203 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 204 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 209 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 213 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 214 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 217 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 218 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 219 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 222 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 223 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 224 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 225 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 226 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 227 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 228 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 229 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 230 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 231 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 232 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 233 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 234 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 235 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 236 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 237 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 238 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 239 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 240 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 241 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 242 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 272 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 273 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 274 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 277 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 278 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 279 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 280 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 281 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.87 |
| Metatranscriptomes | 0.13 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.92 |
| Rhizosphere | 94.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10005914 | 3300003203 | Bacteria | 5661 |
| 2 | Ga0070658_10051305 | 3300005327 | Bacteria | 3344 |
| 3 | Ga0070676_10064433 | 3300005328 | Bacteria | 2185 |
| 4 | Ga0070690_100010677 | 3300005330 | Bacteria | 5352 |
| 5 | Ga0070690_100275106 | 3300005330 | Unclassified | 1199 |
| 6 | Ga0070690_100459037 | 3300005330 | Bacteria | 946 |
| 7 | Ga0070670_100004356 | 3300005331 | Bacteria | 11843 |
| 8 | Ga0070670_100062981 | 3300005331 | Bacteria | 3183 |
| 9 | Ga0070677_10010018 | 3300005333 | Bacteria | 3228 |
| 10 | Ga0068869_100001903 | 3300005334 | Bacteria | 12551 |
| 11 | Ga0068869_100466183 | 3300005334 | Bacteria | 1049 |
| 12 | Ga0070666_10058323 | 3300005335 | Bacteria | 2610 |
| 13 | Ga0070666_10099455 | 3300005335 | Bacteria | 2003 |
| 14 | Ga0070666_10225728 | 3300005335 | Unclassified | 1322 |
| 15 | Ga0070666_10373623 | 3300005335 | Bacteria | 1023 |
| 16 | Ga0070680_100002663 | 3300005336 | Bacteria | 13234 |
| 17 | Ga0070682_100005961 | 3300005337 | Bacteria | 6822 |
| 18 | Ga0068868_100051865 | 3300005338 | Bacteria | 3229 |
| 19 | Ga0068868_100332802 | 3300005338 | Bacteria | 1296 |
| 20 | Ga0070660_100000640 | 3300005339 | Bacteria | 23213 |
| 21 | Ga0070689_100011348 | 3300005340 | Bacteria | 6380 |
| 22 | Ga0070689_100267039 | 3300005340 | Bacteria | 1415 |
| 23 | Ga0070692_10048151 | 3300005345 | Bacteria | 2207 |
| 24 | Ga0070668_100018225 | 3300005347 | Bacteria | 5267 |
| 25 | Ga0070669_100020459 | 3300005353 | Bacteria | 4726 |
| 26 | Ga0070669_100042300 | 3300005353 | Bacteria | 3315 |
| 27 | Ga0070669_100059128 | 3300005353 | Bacteria | 2814 |
| 28 | Ga0070669_100155477 | 3300005353 | Bacteria | 1773 |
| 29 | Ga0070669_100291805 | 3300005353 | Bacteria | 1309 |
| 30 | Ga0070675_100032040 | 3300005354 | Bacteria | 4252 |
| 31 | Ga0070675_100075714 | 3300005354 | Bacteria | 2798 |
| 32 | Ga0070671_100098960 | 3300005355 | Bacteria | 2446 |
| 33 | Ga0070674_100043915 | 3300005356 | Bacteria | 3043 |
| 34 | Ga0070674_100125540 | 3300005356 | Bacteria | 1905 |
| 35 | Ga0070673_100084444 | 3300005364 | Bacteria | 2582 |
| 36 | Ga0070673_100097873 | 3300005364 | Bacteria | 2410 |
| 37 | Ga0070688_100026974 | 3300005365 | Bacteria | 3418 |
| 38 | Ga0070659_100004266 | 3300005366 | Bacteria | 10205 |
| 39 | Ga0070667_100337323 | 3300005367 | Bacteria | 1363 |
| 40 | Ga0070667_100372727 | 3300005367 | Bacteria | 1295 |
| 41 | Ga0070709_10257894 | 3300005434 | Bacteria | 1258 |
| 42 | Ga0070714_100032868 | 3300005435 | Bacteria | 4333 |
| 43 | Ga0070714_100089109 | 3300005435 | Bacteria | 2700 |
| 44 | Ga0070714_100413839 | 3300005435 | Unclassified | 1276 |
| 45 | Ga0070713_100019223 | 3300005436 | Bacteria | 5210 |
| 46 | Ga0070713_100055242 | 3300005436 | Bacteria | 3299 |
| 47 | Ga0070713_100089786 | 3300005436 | Bacteria | 2640 |
| 48 | Ga0070713_100398598 | 3300005436 | Bacteria | 1285 |
| 49 | Ga0070710_10024515 | 3300005437 | Bacteria | 3183 |
| 50 | Ga0070710_10272451 | 3300005437 | Bacteria | 1095 |
| 51 | Ga0070701_10016634 | 3300005438 | Bacteria | 3424 |
| 52 | Ga0070701_10026266 | 3300005438 | Bacteria | 2838 |
| 53 | Ga0070705_100001700 | 3300005440 | Bacteria | 11474 |
| 54 | Ga0070705_100082834 | 3300005440 | Bacteria | 1975 |
| 55 | Ga0070694_100002292 | 3300005444 | Bacteria | 11323 |
| 56 | Ga0070694_100045828 | 3300005444 | Bacteria | 2932 |
| 57 | Ga0070694_100104772 | 3300005444 | Bacteria | 2006 |
| 58 | Ga0070694_100164966 | 3300005444 | Bacteria | 1628 |
| 59 | Ga0070708_100004836 | 3300005445 | Bacteria | 10627 |
| 60 | Ga0070708_100042642 | 3300005445 | Bacteria | 3984 |
| 61 | Ga0070708_100043416 | 3300005445 | Bacteria | 3950 |
| 62 | Ga0070708_100108359 | 3300005445 | Bacteria | 2551 |
| 63 | Ga0070708_100117321 | 3300005445 | Bacteria | 2451 |
| 64 | Ga0070663_100007247 | 3300005455 | Bacteria | 6740 |
| 65 | Ga0070678_100073447 | 3300005456 | Bacteria | 2567 |
| 66 | Ga0070662_100002555 | 3300005457 | Bacteria | 11205 |
| 67 | Ga0070662_100020262 | 3300005457 | Bacteria | 4526 |
| 68 | Ga0070681_10038418 | 3300005458 | Bacteria | 4799 |
| 69 | Ga0070681_10170393 | 3300005458 | Bacteria | 2099 |
| 70 | Ga0070681_10341027 | 3300005458 | Bacteria | 1408 |
| 71 | Ga0068867_100013214 | 3300005459 | Bacteria | 5848 |
| 72 | Ga0068867_100133964 | 3300005459 | Bacteria | 1929 |
| 73 | Ga0070685_10134825 | 3300005466 | Bacteria | 1548 |
| 74 | Ga0070706_100028326 | 3300005467 | Bacteria | 5157 |
| 75 | Ga0070706_100035276 | 3300005467 | Bacteria | 4620 |
| 76 | Ga0070706_100405927 | 3300005467 | Bacteria | 1268 |
| 77 | Ga0070706_100497470 | 3300005467 | Bacteria | 1134 |
| 78 | Ga0070707_100018737 | 3300005468 | Bacteria | 6516 |
| 79 | Ga0070707_100029238 | 3300005468 | Bacteria | 5247 |
| 80 | Ga0070707_100031685 | 3300005468 | Bacteria | 5037 |
| 81 | Ga0070707_100033692 | 3300005468 | Bacteria | 4884 |
| 82 | Ga0070707_100228442 | 3300005468 | Bacteria | 1812 |
| 83 | Ga0070707_100396853 | 3300005468 | Bacteria | 1339 |
| 84 | Ga0070698_100002771 | 3300005471 | Bacteria | 19277 |
| 85 | Ga0070698_100010750 | 3300005471 | Bacteria | 9740 |
| 86 | Ga0070698_100066274 | 3300005471 | Bacteria | 3635 |
| 87 | Ga0070698_100319063 | 3300005471 | Bacteria | 1484 |
| 88 | Ga0070699_100001298 | 3300005518 | Bacteria | 23074 |
| 89 | Ga0070699_100005810 | 3300005518 | Bacteria | 10793 |
| 90 | Ga0070699_100079176 | 3300005518 | Bacteria | 2862 |
| 91 | Ga0070699_100086970 | 3300005518 | Bacteria | 2728 |
| 92 | Ga0070699_100087282 | 3300005518 | Bacteria | 2723 |
| 93 | Ga0070699_100196457 | 3300005518 | Bacteria | 1793 |
| 94 | Ga0070699_100222187 | 3300005518 | Bacteria | 1683 |
| 95 | Ga0070699_100308771 | 3300005518 | Bacteria | 1420 |
| 96 | Ga0070699_100523005 | 3300005518 | Bacteria | 1079 |
| 97 | Ga0070679_100002921 | 3300005530 | Bacteria | 15546 |
| 98 | Ga0070679_100201853 | 3300005530 | Bacteria | 1954 |
| 99 | Ga0070679_100281326 | 3300005530 | Bacteria | 1616 |
| 100 | Ga0070684_100139178 | 3300005535 | Bacteria | 2194 |
| 101 | Ga0070697_100044718 | 3300005536 | Bacteria | 3587 |
| 102 | Ga0070697_100074319 | 3300005536 | Bacteria | 2792 |
| 103 | Ga0070697_100091218 | 3300005536 | Bacteria | 2519 |
| 104 | Ga0070697_100131637 | 3300005536 | Bacteria | 2098 |
| 105 | Ga0068853_100023398 | 3300005539 | Bacteria | 5171 |
| 106 | Ga0070672_100014156 | 3300005543 | Bacteria | 5645 |
| 107 | Ga0070672_100077635 | 3300005543 | Bacteria | 2656 |
| 108 | Ga0070686_100118364 | 3300005544 | Bacteria | 1815 |
| 109 | Ga0070695_100005791 | 3300005545 | Bacteria | 7283 |
| 110 | Ga0070695_100008322 | 3300005545 | Bacteria | 6154 |
| 111 | Ga0070695_100114809 | 3300005545 | Bacteria | 1834 |
| 112 | Ga0070695_100157100 | 3300005545 | Bacteria | 1593 |
| 113 | Ga0070695_100215593 | 3300005545 | Bacteria | 1380 |
| 114 | Ga0070696_100002170 | 3300005546 | Bacteria | 12930 |
| 115 | Ga0070696_100036674 | 3300005546 | Bacteria | 3381 |
| 116 | Ga0070696_100598705 | 3300005546 | Bacteria | 888 |
| 117 | Ga0070693_100000283 | 3300005547 | Bacteria | 23822 |
| 118 | Ga0070693_100428098 | 3300005547 | Bacteria | 924 |
| 119 | Ga0070665_100509302 | 3300005548 | Unclassified | 1215 |
| 120 | Ga0070704_100193532 | 3300005549 | Bacteria | 1636 |
| 121 | Ga0070704_100203833 | 3300005549 | Bacteria | 1598 |
| 122 | Ga0070704_100231572 | 3300005549 | Bacteria | 1507 |
| 123 | Ga0070704_100291594 | 3300005549 | Bacteria | 1356 |
| 124 | Ga0068855_100008748 | 3300005563 | Bacteria | 12241 |
| 125 | Ga0068857_100539293 | 3300005577 | Bacteria | 1098 |
| 126 | Ga0068854_100000849 | 3300005578 | Bacteria | 18284 |
| 127 | Ga0068856_100015440 | 3300005614 | Bacteria | 7380 |
| 128 | Ga0068856_100155490 | 3300005614 | Bacteria | 2297 |
| 129 | Ga0068856_100369559 | 3300005614 | Unclassified | 1453 |
| 130 | Ga0070702_100077461 | 3300005615 | Bacteria | 1982 |
| 131 | Ga0070702_100227410 | 3300005615 | Bacteria | 1251 |
| 132 | Ga0068859_100015115 | 3300005617 | Bacteria | 7746 |
| 133 | Ga0068859_100528360 | 3300005617 | Bacteria | 1274 |
| 134 | Ga0068859_100578593 | 3300005617 | Bacteria | 1217 |
| 135 | Ga0068864_100029363 | 3300005618 | Bacteria | 4656 |
| 136 | Ga0068864_100077990 | 3300005618 | Bacteria | 2898 |
| 137 | Ga0068864_100140213 | 3300005618 | Bacteria | 2180 |
| 138 | Ga0068866_10011868 | 3300005718 | Bacteria | 3784 |
| 139 | Ga0068861_100008733 | 3300005719 | Bacteria | 6974 |
| 140 | Ga0068861_100044905 | 3300005719 | Bacteria | 3325 |
| 141 | Ga0068861_100049093 | 3300005719 | Bacteria | 3193 |
| 142 | Ga0068861_100310977 | 3300005719 | Bacteria | 1369 |
| 143 | Ga0068870_10002446 | 3300005840 | Bacteria | 7732 |
| 144 | Ga0068863_100023209 | 3300005841 | Bacteria | 5928 |
| 145 | Ga0068863_100082178 | 3300005841 | Bacteria | 3053 |
| 146 | Ga0068863_100225933 | 3300005841 | Bacteria | 1804 |
| 147 | Ga0068863_100386266 | 3300005841 | Bacteria | 1367 |
| 148 | Ga0068858_100040117 | 3300005842 | Bacteria | 4341 |
| 149 | Ga0068858_100124714 | 3300005842 | Bacteria | 2410 |
| 150 | Ga0068860_100058243 | 3300005843 | Bacteria | 3672 |
| 151 | Ga0068860_100472076 | 3300005843 | Bacteria | 1249 |
| 152 | Ga0068860_100599264 | 3300005843 | Bacteria | 1107 |
| 153 | Ga0068862_100002414 | 3300005844 | Bacteria | 16590 |
| 154 | Ga0068862_100013361 | 3300005844 | Bacteria | 6793 |
| 155 | Ga0068862_100017892 | 3300005844 | Bacteria | 5901 |
| 156 | Ga0068862_100146488 | 3300005844 | Bacteria | 2099 |
| 157 | Ga0068862_100505706 | 3300005844 | Unclassified | 1147 |
| 158 | Ga0081455_10003829 | 3300005937 | Bacteria | 17162 |
| 159 | Ga0081540_1002103 | 3300005983 | Bacteria | 16583 |
| 160 | Ga0081539_10000044 | 3300005985 | Bacteria | 284021 |
| 161 | Ga0070717_10001390 | 3300006028 | Bacteria | 16670 |
| 162 | Ga0070717_10055316 | 3300006028 | Bacteria | 3273 |
| 163 | Ga0070717_10063058 | 3300006028 | Unclassified | 3075 |
| 164 | Ga0070712_100060180 | 3300006175 | Bacteria | 2677 |
| 165 | Ga0070712_100374553 | 3300006175 | Bacteria | 1170 |
| 166 | Ga0097621_100136507 | 3300006237 | Bacteria | 2092 |
| 167 | Ga0097621_100306701 | 3300006237 | Bacteria | 1403 |
| 168 | Ga0097621_100674383 | 3300006237 | Unclassified | 950 |
| 169 | Ga0068871_100317860 | 3300006358 | Bacteria | 1370 |
| 170 | Ga0075428_100010575 | 3300006844 | Bacteria | 10256 |
| 171 | Ga0075428_100013472 | 3300006844 | Bacteria | 9100 |
| 172 | Ga0075428_100025119 | 3300006844 | Bacteria | 6591 |
| 173 | Ga0075428_100046058 | 3300006844 | Bacteria | 4792 |
| 174 | Ga0075428_100055445 | 3300006844 | Bacteria | 4342 |
| 175 | Ga0075428_100308038 | 3300006844 | Unclassified | 1702 |
| 176 | Ga0075428_100526758 | 3300006844 | Bacteria | 1264 |
| 177 | Ga0075430_100000577 | 3300006846 | Bacteria | 27863 |
| 178 | Ga0075430_100000658 | 3300006846 | Bacteria | 26387 |
| 179 | Ga0075430_100036582 | 3300006846 | Bacteria | 4162 |
| 180 | Ga0075431_100000635 | 3300006847 | Bacteria | 29710 |
| 181 | Ga0075431_100000847 | 3300006847 | Bacteria | 26809 |
| 182 | Ga0075431_100005898 | 3300006847 | Bacteria | 12117 |
| 183 | Ga0075431_100007172 | 3300006847 | Bacteria | 11083 |
| 184 | Ga0075431_100117031 | 3300006847 | Bacteria | 2750 |
| 185 | Ga0075431_100117969 | 3300006847 | Bacteria | 2738 |
| 186 | Ga0075431_100158834 | 3300006847 | Bacteria | 2325 |
| 187 | Ga0075431_100441051 | 3300006847 | Bacteria | 1299 |
| 188 | Ga0075433_10001836 | 3300006852 | Bacteria | 15941 |
| 189 | Ga0075433_10005357 | 3300006852 | Bacteria | 10074 |
| 190 | Ga0075433_10009282 | 3300006852 | Bacteria | 7865 |
| 191 | Ga0075433_10009564 | 3300006852 | Bacteria | 7752 |
| 192 | Ga0075433_10016703 | 3300006852 | Bacteria | 6059 |
| 193 | Ga0075433_10018680 | 3300006852 | Bacteria | 5765 |
| 194 | Ga0075433_10081243 | 3300006852 | Bacteria | 2857 |
| 195 | Ga0075433_10092314 | 3300006852 | Bacteria | 2678 |
| 196 | Ga0075433_10267092 | 3300006852 | Bacteria | 1516 |
| 197 | Ga0075434_100010082 | 3300006871 | Bacteria | 8848 |
| 198 | Ga0075434_100014963 | 3300006871 | Bacteria | 7425 |
| 199 | Ga0075434_100017262 | 3300006871 | Bacteria | 6950 |
| 200 | Ga0075434_100055043 | 3300006871 | Bacteria | 3953 |
| 201 | Ga0075434_100300616 | 3300006871 | Bacteria | 1625 |
| 202 | Ga0075434_100306757 | 3300006871 | Bacteria | 1607 |
| 203 | Ga0075434_100567100 | 3300006871 | Bacteria | 1155 |
| 204 | Ga0075434_100731558 | 3300006871 | Bacteria | 1006 |
| 205 | Ga0075429_100000237 | 3300006880 | Bacteria | 37841 |
| 206 | Ga0075429_100000485 | 3300006880 | Bacteria | 29758 |
| 207 | Ga0075429_100003182 | 3300006880 | Bacteria | 13956 |
| 208 | Ga0075429_100013779 | 3300006880 | Bacteria | 7011 |
| 209 | Ga0075429_100029625 | 3300006880 | Bacteria | 4753 |
| 210 | Ga0075429_100060882 | 3300006880 | Bacteria | 3288 |
| 211 | Ga0075429_100288484 | 3300006880 | Bacteria | 1437 |
| 212 | Ga0075429_100289998 | 3300006880 | Bacteria | 1433 |
| 213 | Ga0075429_100338754 | 3300006880 | Unclassified | 1316 |
| 214 | Ga0068865_100208964 | 3300006881 | Bacteria | 1520 |
| 215 | Ga0075436_100001548 | 3300006914 | Bacteria | 15705 |
| 216 | Ga0075436_100020521 | 3300006914 | Bacteria | 4534 |
| 217 | Ga0075436_100023406 | 3300006914 | Bacteria | 4243 |
| 218 | Ga0075436_100039002 | 3300006914 | Bacteria | 3277 |
| 219 | Ga0075436_100061038 | 3300006914 | Bacteria | 2604 |
| 220 | Ga0075436_100107640 | 3300006914 | Bacteria | 1945 |
| 221 | Ga0097620_100015115 | 3300006931 | Bacteria | 7746 |
| 222 | Ga0097620_100528340 | 3300006931 | Bacteria | 1274 |
| 223 | Ga0097620_100578589 | 3300006931 | Bacteria | 1217 |
| 224 | Ga0075435_100010992 | 3300007076 | Bacteria | 6637 |
| 225 | Ga0075435_100013882 | 3300007076 | Bacteria | 6007 |
| 226 | Ga0075435_100016614 | 3300007076 | Bacteria | 5551 |
| 227 | Ga0075435_100057953 | 3300007076 | Bacteria | 3135 |
| 228 | Ga0075435_100182920 | 3300007076 | Bacteria | 1772 |
| 229 | Ga0099794_10003220 | 3300007265 | Bacteria | 6192 |
| 230 | Ga0099795_10015030 | 3300007788 | Bacteria | 2414 |
| 231 | Ga0099795_10061093 | 3300007788 | Bacteria | 1398 |
| 232 | Ga0111539_10000139 | 3300009094 | Bacteria | 82909 |
| 233 | Ga0111539_10003777 | 3300009094 | Bacteria | 19927 |
| 234 | Ga0111539_10005684 | 3300009094 | Bacteria | 16136 |
| 235 | Ga0111539_10027347 | 3300009094 | Bacteria | 6966 |
| 236 | Ga0111539_10029747 | 3300009094 | Bacteria | 6649 |
| 237 | Ga0111539_10043841 | 3300009094 | Bacteria | 5362 |
| 238 | Ga0111539_10054232 | 3300009094 | Bacteria | 4770 |
| 239 | Ga0111539_10137181 | 3300009094 | Bacteria | 2865 |
| 240 | Ga0111539_10152633 | 3300009094 | Bacteria | 2703 |
| 241 | Ga0111539_10801890 | 3300009094 | Bacteria | 1096 |
| 242 | Ga0105245_10109569 | 3300009098 | Bacteria | 2566 |
| 243 | Ga0105245_10272929 | 3300009098 | Unclassified | 1650 |
| 244 | Ga0105247_10114373 | 3300009101 | Bacteria | 1741 |
| 245 | Ga0114129_10000149 | 3300009147 | Bacteria | 73883 |
| 246 | Ga0114129_10000562 | 3300009147 | Bacteria | 45605 |
| 247 | Ga0114129_10009090 | 3300009147 | Bacteria | 14159 |
| 248 | Ga0114129_10041323 | 3300009147 | Bacteria | 6499 |
| 249 | Ga0114129_10049654 | 3300009147 | Bacteria | 5894 |
| 250 | Ga0114129_10053694 | 3300009147 | Bacteria | 5652 |
| 251 | Ga0114129_10057600 | 3300009147 | Bacteria | 5437 |
| 252 | Ga0114129_10072996 | 3300009147 | Bacteria | 4782 |
| 253 | Ga0114129_10128949 | 3300009147 | Bacteria | 3476 |
| 254 | Ga0114129_10136000 | 3300009147 | Bacteria | 3372 |
| 255 | Ga0114129_10329703 | 3300009147 | Bacteria | 2027 |
| 256 | Ga0114129_10572313 | 3300009147 | Bacteria | 1467 |
| 257 | Ga0114129_11196120 | 3300009147 | Bacteria | 947 |
| 258 | Ga0105243_10015145 | 3300009148 | Bacteria | 5835 |
| 259 | Ga0105243_10017154 | 3300009148 | Bacteria | 5476 |
| 260 | Ga0105243_10050781 | 3300009148 | Bacteria | 3278 |
| 261 | Ga0105243_10428915 | 3300009148 | Bacteria | 1235 |
| 262 | Ga0105243_10451637 | 3300009148 | Bacteria | 1206 |
| 263 | Ga0105241_10010553 | 3300009174 | Bacteria | 6777 |
| 264 | Ga0105241_10028648 | 3300009174 | Bacteria | 4150 |
| 265 | Ga0105242_10132260 | 3300009176 | Bacteria | 2155 |
| 266 | Ga0105248_10057324 | 3300009177 | Bacteria | 4372 |
| 267 | Ga0105248_10068601 | 3300009177 | Bacteria | 3981 |
| 268 | Ga0105248_10442636 | 3300009177 | Bacteria | 1464 |
| 269 | Ga0105248_10478469 | 3300009177 | Bacteria | 1404 |
| 270 | Ga0105249_10132999 | 3300009553 | Bacteria | 2377 |
| 271 | Ga0105249_10261224 | 3300009553 | Bacteria | 1721 |
| 272 | Ga0099796_10056947 | 3300010159 | Bacteria | 1374 |
| 273 | Ga0105239_10032525 | 3300010375 | Bacteria | 5730 |
| 274 | Ga0105239_10772432 | 3300010375 | Unclassified | 1100 |
| 275 | Ga0105246_10056054 | 3300011119 | Bacteria | 2722 |
| 276 | Ga0105246_10145320 | 3300011119 | Bacteria | 1789 |
| 277 | Ga0157373_10000457 | 3300013100 | Bacteria | 32330 |
| 278 | Ga0157370_10312303 | 3300013104 | Unclassified | 1450 |
| 279 | Ga0157369_10005377 | 3300013105 | Bacteria | 14912 |
| 280 | Ga0157369_10092406 | 3300013105 | Bacteria | 3229 |
| 281 | Ga0157374_10053226 | 3300013296 | Bacteria | 3773 |
| 282 | Ga0157378_10069886 | 3300013297 | Bacteria | 3151 |
| 283 | Ga0157378_10094574 | 3300013297 | Bacteria | 2721 |
| 284 | Ga0157378_10467386 | 3300013297 | Bacteria | 1255 |
| 285 | Ga0163162_10070826 | 3300013306 | Bacteria | 3538 |
| 286 | Ga0163162_10134585 | 3300013306 | Bacteria | 2582 |
| 287 | Ga0163162_10603647 | 3300013306 | Bacteria | 1223 |
| 288 | Ga0157372_10024219 | 3300013307 | Bacteria | 6589 |
| 289 | Ga0157372_10523849 | 3300013307 | Bacteria | 1382 |
| 290 | Ga0157375_10014050 | 3300013308 | Bacteria | 7142 |
| 291 | Ga0163163_10184372 | 3300014325 | Bacteria | 2135 |
| 292 | Ga0157380_10036806 | 3300014326 | Bacteria | 3789 |
| 293 | Ga0157380_10079992 | 3300014326 | Bacteria | 2670 |
| 294 | Ga0182008_10046829 | 3300014497 | Bacteria | 2149 |
| 295 | Ga0157377_10045882 | 3300014745 | Bacteria | 2442 |
| 296 | Ga0157379_10220429 | 3300014968 | Bacteria | 1719 |
| 297 | Ga0157379_10534292 | 3300014968 | Bacteria | 1090 |
| 298 | Ga0157376_10029306 | 3300014969 | Bacteria | 4384 |
| 299 | Ga0163161_10014586 | 3300017792 | Bacteria | 5470 |
| 300 | Ga0163161_10191900 | 3300017792 | Bacteria | 1571 |
| 301 | Ga0163161_10591729 | 3300017792 | Unclassified | 914 |
| 302 | Ga0213876_10002708 | 3300021384 | Bacteria | 10324 |
| 303 | Ga0213875_10000152 | 3300021388 | Bacteria | 73219 |
| 304 | Ga0213875_10007069 | 3300021388 | Bacteria | 5835 |
| 305 | Ga0213875_10071533 | 3300021388 | Bacteria | 1619 |
| 306 | Ga0213875_10118933 | 3300021388 | Bacteria | 1234 |
| 307 | Ga0224712_10062806 | 3300022467 | Unclassified | 1485 |
| 308 | Ga0207666_1015518 | 3300025271 | Bacteria | 1085 |
| 309 | Ga0207653_10012207 | 3300025885 | Bacteria | 2683 |
| 310 | Ga0207682_10014559 | 3300025893 | Bacteria | 3065 |
| 311 | Ga0207692_10104611 | 3300025898 | Bacteria | 1560 |
| 312 | Ga0207692_10203210 | 3300025898 | Bacteria | 1166 |
| 313 | Ga0207642_10024383 | 3300025899 | Bacteria | 2431 |
| 314 | Ga0207642_10096462 | 3300025899 | Unclassified | 1474 |
| 315 | Ga0207688_10005957 | 3300025901 | Bacteria | 6635 |
| 316 | Ga0207680_10012243 | 3300025903 | Bacteria | 4365 |
| 317 | Ga0207680_10058046 | 3300025903 | Bacteria | 2344 |
| 318 | Ga0207680_10312813 | 3300025903 | Bacteria | 1097 |
| 319 | Ga0207699_10008581 | 3300025906 | Bacteria | 5050 |
| 320 | Ga0207699_10033054 | 3300025906 | Bacteria | 2920 |
| 321 | Ga0207645_10006681 | 3300025907 | Bacteria | 8238 |
| 322 | Ga0207645_10107017 | 3300025907 | Unclassified | 1808 |
| 323 | Ga0207643_10001151 | 3300025908 | Bacteria | 15691 |
| 324 | Ga0207643_10060259 | 3300025908 | Bacteria | 2167 |
| 325 | Ga0207684_10000673 | 3300025910 | Bacteria | 40594 |
| 326 | Ga0207684_10008211 | 3300025910 | Bacteria | 9296 |
| 327 | Ga0207684_10015297 | 3300025910 | Bacteria | 6607 |
| 328 | Ga0207684_10016306 | 3300025910 | Bacteria | 6379 |
| 329 | Ga0207684_10020113 | 3300025910 | Bacteria | 5702 |
| 330 | Ga0207684_10030055 | 3300025910 | Bacteria | 4626 |
| 331 | Ga0207684_10046446 | 3300025910 | Bacteria | 3684 |
| 332 | Ga0207684_10338360 | 3300025910 | Bacteria | 1296 |
| 333 | Ga0207684_10464587 | 3300025910 | Bacteria | 1086 |
| 334 | Ga0207654_10026695 | 3300025911 | Bacteria | 3130 |
| 335 | Ga0207707_10000158 | 3300025912 | Bacteria | 71112 |
| 336 | Ga0207707_10231471 | 3300025912 | Bacteria | 1608 |
| 337 | Ga0207693_10014075 | 3300025915 | Bacteria | 6440 |
| 338 | Ga0207693_10028525 | 3300025915 | Bacteria | 4410 |
| 339 | Ga0207693_10046200 | 3300025915 | Bacteria | 3420 |
| 340 | Ga0207693_10107006 | 3300025915 | Bacteria | 2194 |
| 341 | Ga0207663_10106012 | 3300025916 | Bacteria | 1898 |
| 342 | Ga0207660_10000220 | 3300025917 | Bacteria | 36783 |
| 343 | Ga0207660_10062257 | 3300025917 | Bacteria | 2688 |
| 344 | Ga0207649_10058290 | 3300025920 | Bacteria | 2417 |
| 345 | Ga0207649_10083580 | 3300025920 | Bacteria | 2073 |
| 346 | Ga0207652_10000290 | 3300025921 | Bacteria | 52056 |
| 347 | Ga0207652_10052275 | 3300025921 | Bacteria | 3506 |
| 348 | Ga0207646_10001668 | 3300025922 | Bacteria | 27110 |
| 349 | Ga0207646_10023356 | 3300025922 | Bacteria | 5681 |
| 350 | Ga0207646_10024791 | 3300025922 | Bacteria | 5490 |
| 351 | Ga0207646_10062141 | 3300025922 | Bacteria | 3334 |
| 352 | Ga0207681_10079999 | 3300025923 | Bacteria | 2304 |
| 353 | Ga0207681_10167084 | 3300025923 | Bacteria | 1664 |
| 354 | Ga0207681_10215655 | 3300025923 | Unclassified | 1482 |
| 355 | Ga0207650_10020548 | 3300025925 | Bacteria | 4658 |
| 356 | Ga0207650_10026018 | 3300025925 | Bacteria | 4171 |
| 357 | Ga0207650_10092028 | 3300025925 | Bacteria | 2319 |
| 358 | Ga0207650_10137943 | 3300025925 | Bacteria | 1915 |
| 359 | Ga0207650_10291318 | 3300025925 | Unclassified | 1331 |
| 360 | Ga0207659_10011144 | 3300025926 | Bacteria | 5673 |
| 361 | Ga0207659_10049794 | 3300025926 | Bacteria | 2973 |
| 362 | Ga0207659_10392435 | 3300025926 | Unclassified | 1159 |
| 363 | Ga0207659_10409742 | 3300025926 | Bacteria | 1135 |
| 364 | Ga0207687_10016642 | 3300025927 | Bacteria | 4831 |
| 365 | Ga0207687_10201853 | 3300025927 | Bacteria | 1555 |
| 366 | Ga0207700_10029038 | 3300025928 | Bacteria | 3898 |
| 367 | Ga0207700_10032949 | 3300025928 | Bacteria | 3702 |
| 368 | Ga0207700_10063618 | 3300025928 | Bacteria | 2807 |
| 369 | Ga0207700_10144112 | 3300025928 | Bacteria | 1961 |
| 370 | Ga0207700_10168225 | 3300025928 | Bacteria | 1826 |
| 371 | Ga0207700_10320485 | 3300025928 | Bacteria | 1343 |
| 372 | Ga0207700_10436578 | 3300025928 | Bacteria | 1152 |
| 373 | Ga0207664_10012103 | 3300025929 | Bacteria | 6161 |
| 374 | Ga0207664_10062701 | 3300025929 | Bacteria | 2969 |
| 375 | Ga0207664_10192368 | 3300025929 | Unclassified | 1757 |
| 376 | Ga0207664_10273051 | 3300025929 | Bacteria | 1481 |
| 377 | Ga0207644_10041322 | 3300025931 | Bacteria | 3262 |
| 378 | Ga0207644_10071757 | 3300025931 | Bacteria | 2534 |
| 379 | Ga0207644_10072039 | 3300025931 | Bacteria | 2529 |
| 380 | Ga0207644_10220117 | 3300025931 | Bacteria | 1504 |
| 381 | Ga0207690_10001918 | 3300025932 | Bacteria | 12764 |
| 382 | Ga0207706_10008340 | 3300025933 | Bacteria | 9554 |
| 383 | Ga0207706_10013948 | 3300025933 | Bacteria | 7286 |
| 384 | Ga0207706_10068268 | 3300025933 | Bacteria | 3129 |
| 385 | Ga0207706_10395187 | 3300025933 | Unclassified | 1199 |
| 386 | Ga0207686_10146121 | 3300025934 | Bacteria | 1640 |
| 387 | Ga0207709_10047835 | 3300025935 | Bacteria | 2603 |
| 388 | Ga0207709_10063266 | 3300025935 | Bacteria | 2319 |
| 389 | Ga0207670_10003369 | 3300025936 | Bacteria | 8480 |
| 390 | Ga0207670_10271095 | 3300025936 | Bacteria | 1319 |
| 391 | Ga0207670_10338045 | 3300025936 | Bacteria | 1189 |
| 392 | Ga0207669_10069448 | 3300025937 | Bacteria | 2204 |
| 393 | Ga0207669_10089703 | 3300025937 | Bacteria | 1997 |
| 394 | Ga0207704_10049398 | 3300025938 | Bacteria | 2530 |
| 395 | Ga0207704_10433227 | 3300025938 | Bacteria | 1045 |
| 396 | Ga0207665_10056133 | 3300025939 | Bacteria | 2658 |
| 397 | Ga0207665_10085816 | 3300025939 | Bacteria | 2173 |
| 398 | Ga0207691_10013162 | 3300025940 | Bacteria | 7921 |
| 399 | Ga0207691_10018115 | 3300025940 | Bacteria | 6669 |
| 400 | Ga0207691_10035866 | 3300025940 | Bacteria | 4599 |
| 401 | Ga0207691_10067145 | 3300025940 | Bacteria | 3243 |
| 402 | Ga0207691_10195337 | 3300025940 | Bacteria | 1763 |
| 403 | Ga0207711_10058850 | 3300025941 | Bacteria | 3308 |
| 404 | Ga0207711_10104303 | 3300025941 | Bacteria | 2512 |
| 405 | Ga0207711_10232008 | 3300025941 | Unclassified | 1690 |
| 406 | Ga0207689_10000277 | 3300025942 | Bacteria | 46512 |
| 407 | Ga0207689_10002119 | 3300025942 | Bacteria | 18663 |
| 408 | Ga0207689_10041899 | 3300025942 | Bacteria | 3788 |
| 409 | Ga0207689_10181365 | 3300025942 | Bacteria | 1736 |
| 410 | Ga0207661_10293128 | 3300025944 | Bacteria | 1457 |
| 411 | Ga0207679_10000820 | 3300025945 | Bacteria | 20002 |
| 412 | Ga0207667_10001638 | 3300025949 | Bacteria | 28188 |
| 413 | Ga0207667_10408278 | 3300025949 | Unclassified | 1383 |
| 414 | Ga0207651_10186842 | 3300025960 | Bacteria | 1649 |
| 415 | Ga0207712_10066434 | 3300025961 | Bacteria | 2578 |
| 416 | Ga0207712_10261095 | 3300025961 | Bacteria | 1405 |
| 417 | Ga0207712_10463820 | 3300025961 | Unclassified | 1077 |
| 418 | Ga0207668_10146646 | 3300025972 | Bacteria | 1822 |
| 419 | Ga0207640_10029885 | 3300025981 | Bacteria | 3350 |
| 420 | Ga0207658_10391434 | 3300025986 | Bacteria | 1219 |
| 421 | Ga0207677_10070093 | 3300026023 | Bacteria | 2469 |
| 422 | Ga0207677_10590118 | 3300026023 | Bacteria | 974 |
| 423 | Ga0207703_10017809 | 3300026035 | Bacteria | 5548 |
| 424 | Ga0207703_10310108 | 3300026035 | Bacteria | 1442 |
| 425 | Ga0207639_10028956 | 3300026041 | Bacteria | 4050 |
| 426 | Ga0207678_10031501 | 3300026067 | Bacteria | 4626 |
| 427 | Ga0207708_10027298 | 3300026075 | Bacteria | 4322 |
| 428 | Ga0207708_10152174 | 3300026075 | Bacteria | 1822 |
| 429 | Ga0207702_10048474 | 3300026078 | Bacteria | 3583 |
| 430 | Ga0207702_10306424 | 3300026078 | Unclassified | 1509 |
| 431 | Ga0207641_10026717 | 3300026088 | Bacteria | 4765 |
| 432 | Ga0207641_10080626 | 3300026088 | Bacteria | 2824 |
| 433 | Ga0207641_10430836 | 3300026088 | Bacteria | 1271 |
| 434 | Ga0207648_10009469 | 3300026089 | Bacteria | 9327 |
| 435 | Ga0207648_10018035 | 3300026089 | Bacteria | 6396 |
| 436 | Ga0207648_10095107 | 3300026089 | Bacteria | 2605 |
| 437 | Ga0207648_10097994 | 3300026089 | Bacteria | 2566 |
| 438 | Ga0207676_10004198 | 3300026095 | Bacteria | 10182 |
| 439 | Ga0207676_10039226 | 3300026095 | Bacteria | 3621 |
| 440 | Ga0207676_10076687 | 3300026095 | Bacteria | 2702 |
| 441 | Ga0207676_10227075 | 3300026095 | Bacteria | 1666 |
| 442 | Ga0207674_10022090 | 3300026116 | Bacteria | 6839 |
| 443 | Ga0207675_100057233 | 3300026118 | Bacteria | 3637 |
| 444 | Ga0207675_100070214 | 3300026118 | Bacteria | 3274 |
| 445 | Ga0207683_10078100 | 3300026121 | Bacteria | 2933 |
| 446 | Ga0207683_10179420 | 3300026121 | Bacteria | 1920 |
| 447 | Ga0207683_10423726 | 3300026121 | Bacteria | 1226 |
| 448 | Ga0207698_10448515 | 3300026142 | Bacteria | 1245 |
| 449 | Ga0207698_10706598 | 3300026142 | Unclassified | 1003 |
| 450 | Ga0209996_1000437 | 3300027395 | Bacteria | 5020 |
| 451 | Ga0209984_1010499 | 3300027424 | Bacteria | 1189 |
| 452 | Ga0210000_1009653 | 3300027462 | Bacteria | 1422 |
| 453 | Ga0209995_1003242 | 3300027471 | Bacteria | 2589 |
| 454 | Ga0209179_1013621 | 3300027512 | Bacteria | 1480 |
| 455 | Ga0209968_1000769 | 3300027526 | Bacteria | 4947 |
| 456 | Ga0209999_1000908 | 3300027543 | Bacteria | 4969 |
| 457 | Ga0209982_1001961 | 3300027552 | Bacteria | 2851 |
| 458 | Ga0209970_1000737 | 3300027614 | Bacteria | 5667 |
| 459 | Ga0210002_1024207 | 3300027617 | Bacteria | 990 |
| 460 | Ga0209983_1000271 | 3300027665 | Bacteria | 10774 |
| 461 | Ga0209588_1004919 | 3300027671 | Bacteria | 3799 |
| 462 | Ga0209971_1000036 | 3300027682 | Bacteria | 46401 |
| 463 | Ga0209966_1000021 | 3300027695 | Bacteria | 68287 |
| 464 | Ga0209998_10000002 | 3300027717 | Bacteria | 126355 |
| 465 | Ga0209998_10023228 | 3300027717 | Bacteria | 1340 |
| 466 | Ga0209974_10002471 | 3300027876 | Bacteria | 6691 |
| 467 | Ga0207428_10000027 | 3300027907 | Bacteria | 250186 |
| 468 | Ga0207428_10000239 | 3300027907 | Bacteria | 75249 |
| 469 | Ga0207428_10005083 | 3300027907 | Bacteria | 12354 |
| 470 | Ga0207428_10023392 | 3300027907 | Bacteria | 5196 |
| 471 | Ga0207428_10042288 | 3300027907 | Bacteria | 3684 |
| 472 | Ga0207428_10238954 | 3300027907 | Bacteria | 1358 |
| 473 | Ga0207428_10435746 | 3300027907 | Bacteria | 957 |
| 474 | Ga0268265_10008105 | 3300028380 | Bacteria | 7100 |
| 475 | Ga0268265_10012301 | 3300028380 | Bacteria | 5799 |
| 476 | Ga0268265_10191618 | 3300028380 | Bacteria | 1766 |
| 477 | Ga0268265_10535433 | 3300028380 | Bacteria | 1109 |
| 478 | Ga0268264_10140736 | 3300028381 | Bacteria | 2151 |
| 479 | Ga0268264_10575601 | 3300028381 | Bacteria | 1107 |
| 480 | Ga0265337_1024465 | 3300028556 | Bacteria | 1848 |
| 481 | Ga0265318_10003548 | 3300028577 | Bacteria | 7818 |
| 482 | Ga0265338_10076275 | 3300028800 | Unclassified | 2840 |
| 483 | Ga0265332_10011096 | 3300031238 | Bacteria | 4004 |
| 484 | Ga0265329_10006071 | 3300031242 | Bacteria | 4823 |
| 485 | Ga0265313_10106204 | 3300031595 | Bacteria | 1240 |
| 486 | Ga0265314_10003180 | 3300031711 | Bacteria | 16087 |
| 487 | Ga0307410_10272828 | 3300031852 | Bacteria | 1324 |
| 488 | Ga0307406_10241253 | 3300031901 | Bacteria | 1356 |
| 489 | Ga0307416_100009526 | 3300032002 | Bacteria | 6364 |
| 490 | Ga0307416_100479814 | 3300032002 | Bacteria | 1303 |
| 491 | Ga0373930_0039796 | 3300034816 | Bacteria | 998 |
| 492 | Ga0373948_0018883 | 3300034817 | Bacteria | 1299 |
| 493 | Ga0373928_0013191 | 3300035084 | Bacteria | 1657 |
| 494 | Ga0373951_0014935 | 3300035091 | Bacteria | 1747 |
| 495 | Ga0373932_0017703 | 3300035112 | Bacteria | 1833 |
| 496 | Ga0373932_0031834 | 3300035112 | Bacteria | 1472 |
| 497 | Ga0373939_0006538 | 3300035114 | Bacteria | 2811 |
| 498 | Ga0373960_0005718 | 3300035121 | Bacteria | 2890 |
| 499 | Ga0373943_0104521 | 3300035170 | Unclassified | 1486 |
| 500 | Ga0373943_0274091 | 3300035170 | Unclassified | 952 |
| 501 | Ga0373955_0002628 | 3300035172 | Bacteria | 7862 |
| 502 | Ga0373955_0027841 | 3300035172 | Bacteria | 2926 |
| 503 | Ga0373955_0048691 | 3300035172 | Bacteria | 2299 |
| 504 | Ga0373962_0076125 | 3300035242 | Bacteria | 1011 |
| 505 | Ga0373924_0015082 | 3300035410 | Bacteria | 2930 |
| 506 | Ga0373931_0030071 | 3300035691 | Bacteria | 2794 |
| 507 | Ga0373931_0038481 | 3300035691 | Bacteria | 2502 |
| 508 | Ga0373931_0075287 | 3300035691 | Bacteria | 1851 |
| 509 | Ga0373935_0042106 | 3300035692 | Bacteria | 2871 |
| 510 | Ga0373935_0358332 | 3300035692 | Bacteria | 1041 |
| 511 | Ga0373927_0088486 | 3300035695 | Bacteria | 2011 |
| 512 | Ga0373927_0146852 | 3300035695 | Unclassified | 1544 |
| 513 | Ga0373933_0007224 | 3300035724 | Bacteria | 6055 |
| 514 | Ga0373933_0183498 | 3300035724 | Bacteria | 1335 |
| 515 | Ga0373947_0156203 | 3300035725 | Bacteria | 1472 |
| 516 | Ga0373937_0014749 | 3300036401 | Bacteria | 6899 |
| 517 | Ga0373937_0023034 | 3300036401 | Bacteria | 5602 |
| 518 | Ga0373937_0032893 | 3300036401 | Bacteria | 4705 |
| 519 | Ga0373937_0370545 | 3300036401 | Unclassified | 1358 |
| 520 | Ga0373937_0384630 | 3300036401 | Bacteria | 1331 |
| 521 | Ga0373925_0113004 | 3300037068 | Unclassified | 2100 |
| 522 | Ga0373925_0148541 | 3300037068 | Bacteria | 1838 |
| 523 | Ga0395899_0009538 | 3300037312 | Bacteria | 7451 |
| 524 | Ga0395900_0013526 | 3300037418 | Bacteria | 8337 |
| 525 | Ga0436364_0210276 | 3300037853 | Bacteria | 2932 |
| 526 | Ga0436364_0660746 | 3300037853 | Bacteria | 1179 |
| 527 | Ga0436364_0675117 | 3300037853 | Bacteria | 1030 |
| 528 | Ga0436364_0793378 | 3300037853 | Bacteria | 2614 |
| 529 | Ga0436364_0883536 | 3300037853 | Bacteria | 58970 |
| 530 | Ga0436364_1013423 | 3300037853 | Bacteria | 35685 |
| 531 | Ga0436364_1072565 | 3300037853 | Bacteria | 7836 |
| 532 | Ga0436364_1226760 | 3300037853 | Bacteria | 13597 |
| 533 | Ga0436364_1524375 | 3300037853 | Bacteria | 1972 |
| 534 | Ga0395901_0003070 | 3300038443 | Bacteria | 16818 |
| 535 | Ga0436365_0036618 | 3300039437 | Bacteria | 5006 |
| 536 | Ga0436365_0158096 | 3300039437 | Bacteria | 1160 |
| 537 | Ga0436365_0469579 | 3300039437 | Bacteria | 37854 |
| 538 | Ga0436365_1088548 | 3300039437 | Unclassified | 1167 |
| 539 | Ga0436365_1156765 | 3300039437 | Bacteria | 3298 |
| 540 | Ga0436365_1692579 | 3300039437 | Bacteria | 13333 |
| 541 | Ga0436360_0063921 | 3300039438 | Bacteria | 1202 |
| 542 | Ga0436360_0301600 | 3300039438 | Bacteria | 1610 |
| 543 | Ga0436360_0416464 | 3300039438 | Bacteria | 1769 |
| 544 | Ga0436361_0156140 | 3300039447 | Bacteria | 2919 |
| 545 | Ga0436363_0127255 | 3300039450 | Bacteria | 2417 |
| 546 | Ga0436363_0290638 | 3300039450 | Bacteria | 1761 |
| 547 | Ga0436363_0845692 | 3300039450 | Bacteria | 2767 |
| 548 | Ga0436363_1076056 | 3300039450 | Unclassified | 1979 |
| 549 | Ga0436362_0329835 | 3300039453 | Bacteria | 1487 |
| 550 | Ga0436362_0672745 | 3300039453 | Unclassified | 1270 |
| 551 | Ga0439441_013384 | 3300042001 | Bacteria | 1422 |
| 552 | Ga0439448_0004515 | 3300042005 | Bacteria | 3930 |
| 553 | Ga0439455_0038172 | 3300042012 | Bacteria | 1221 |
| 554 | Ga0439463_018975 | 3300042016 | Bacteria | 1713 |
| 555 | Ga0439464_0000383 | 3300042439 | Bacteria | 8673 |
| 556 | Ga0439460_0003649 | 3300042461 | Bacteria | 3730 |
| 557 | Ga0451577_0004128 | 3300042876 | Bacteria | 15564 |
| 558 | Ga0451577_0011112 | 3300042876 | Bacteria | 8543 |
| 559 | Ga0451577_0129375 | 3300042876 | Bacteria | 2264 |
| 560 | Ga0451577_0250281 | 3300042876 | Bacteria | 1604 |
| 561 | Ga0453683_0022559 | 3300044673 | Bacteria | 4016 |
| 562 | Ga0453683_0086763 | 3300044673 | Bacteria | 1961 |
| 563 | Ga0453683_0135533 | 3300044673 | Bacteria | 1553 |
| 564 | Ga0453683_0214742 | 3300044673 | Bacteria | 1222 |
| 565 | Ga0466963_0076198 | 3300044694 | Bacteria | 2265 |
| 566 | Ga0453684_0079456 | 3300044712 | Bacteria | 4100 |
| 567 | Ga0453684_0114765 | 3300044712 | Bacteria | 3265 |
| 568 | Ga0451576_0029646 | 3300045051 | Bacteria | 5853 |
| 569 | Ga0451576_0051373 | 3300045051 | Bacteria | 4322 |
| 570 | Ga0451576_0073845 | 3300045051 | Bacteria | 3549 |
| 571 | Ga0451576_0330317 | 3300045051 | Bacteria | 1596 |
| 572 | Ga0466967_0480637 | 3300045976 | Bacteria | 1217 |
| 573 | Ga0495592_0052033 | 3300046454 | Unclassified | 3042 |
| 574 | Ga0495592_0133588 | 3300046454 | Bacteria | 1733 |
| 575 | Ga0495651_0020223 | 3300046462 | Bacteria | 5166 |
| 576 | Ga0495651_0042141 | 3300046462 | Bacteria | 3545 |
| 577 | Ga0495653_0256922 | 3300046463 | Unclassified | 1157 |
| 578 | Ga0495580_0002075 | 3300046472 | Bacteria | 17590 |
| 579 | Ga0495662_0037066 | 3300046476 | Bacteria | 2355 |
| 580 | Ga0495664_0005183 | 3300046477 | Bacteria | 7152 |
| 581 | Ga0495608_0028486 | 3300046511 | Bacteria | 3796 |
| 582 | Ga0495608_0116991 | 3300046511 | Unclassified | 1710 |
| 583 | Ga0495618_0024655 | 3300046514 | Bacteria | 3727 |
| 584 | Ga0495628_0162829 | 3300046516 | Bacteria | 1695 |
| 585 | Ga0495642_0016547 | 3300046528 | Bacteria | 2876 |
| 586 | Ga0495652_0171837 | 3300046529 | Bacteria | 1672 |
| 587 | Ga0495640_0103390 | 3300046533 | Bacteria | 1868 |
| 588 | Ga0495586_0048986 | 3300046535 | Bacteria | 2284 |
| 589 | Ga0495587_0028607 | 3300046536 | Bacteria | 3388 |
| 590 | Ga0495598_0007052 | 3300046537 | Bacteria | 2561 |
| 591 | Ga0495645_0001188 | 3300046543 | Bacteria | 17779 |
| 592 | Ga0495667_0010033 | 3300046559 | Bacteria | 6415 |
| 593 | Ga0495667_0165579 | 3300046559 | Bacteria | 1421 |
| 594 | Ga0495656_0021249 | 3300046615 | Bacteria | 2525 |
| 595 | Ga0495599_0021975 | 3300046678 | Bacteria | 3981 |
| 596 | Ga0495646_0009838 | 3300046680 | Bacteria | 6076 |
| 597 | Ga0495658_0094420 | 3300046683 | Bacteria | 1776 |
| 598 | Ga0495600_0049089 | 3300046809 | Bacteria | 2753 |
| 599 | Ga0495581_0188545 | 3300047315 | Unclassified | 1206 |
| 600 | Ga0495604_0069906 | 3300047317 | Bacteria | 2660 |
| 601 | Ga0495604_0265967 | 3300047317 | Bacteria | 1164 |
| 602 | Ga0495636_0055524 | 3300047318 | Unclassified | 1666 |
| 603 | Ga0495674_0153319 | 3300047319 | Bacteria | 1931 |
| 604 | Ga0495680_0016744 | 3300047322 | Bacteria | 6286 |
| 605 | Ga0495680_0030134 | 3300047322 | Bacteria | 4434 |
| 606 | Ga0495675_0001602 | 3300047444 | Bacteria | 13605 |
| 607 | Ga0495602_0000230 | 3300048088 | Bacteria | 52313 |
| 608 | Ga0495602_0032285 | 3300048088 | Unclassified | 4932 |
| 609 | Ga0496102_0026723 | 3300048905 | Bacteria | 5151 |
| 610 | Ga0496102_0104125 | 3300048905 | Bacteria | 2639 |
| 611 | Ga0496103_0231975 | 3300048906 | Bacteria | 1187 |
| 612 | Ga0496105_0540347 | 3300048908 | Unclassified | 911 |
| 613 | Ga0496108_0169510 | 3300048911 | Unclassified | 1889 |
| 614 | Ga0496108_0357350 | 3300048911 | Bacteria | 1275 |
| 615 | Ga0496109_0414803 | 3300048912 | Unclassified | 1272 |
| 616 | Ga0496109_0473779 | 3300048912 | Bacteria | 1182 |
| 617 | Ga0496110_0041884 | 3300048913 | Bacteria | 3997 |
| 618 | Ga0496110_0102006 | 3300048913 | Bacteria | 2573 |
| 619 | Ga0496110_0448626 | 3300048913 | Bacteria | 1176 |
| 620 | Ga0496112_0122769 | 3300048915 | Bacteria | 2568 |
| 621 | Ga0496113_0122374 | 3300048916 | Bacteria | 2035 |
| 622 | Ga0496114_0005334 | 3300048917 | Bacteria | 10049 |
| 623 | Ga0496114_0305120 | 3300048917 | Bacteria | 1406 |
| 624 | Ga0496126_0155996 | 3300048929 | Bacteria | 1954 |
| 625 | Ga0501031_0105071 | 3300049568 | Bacteria | 1843 |
| 626 | Ga0501032_0310903 | 3300049569 | Unclassified | 1018 |
| 627 | Ga0501033_0037843 | 3300049570 | Bacteria | 3610 |
| 628 | Ga0501033_0178748 | 3300049570 | Bacteria | 1522 |
| 629 | Ga0501034_0163724 | 3300049571 | Bacteria | 2194 |
| 630 | Ga0501036_0033040 | 3300049572 | Bacteria | 4375 |
| 631 | Ga0501036_0137253 | 3300049572 | Bacteria | 2064 |
| 632 | Ga0501036_0219365 | 3300049572 | Bacteria | 1597 |
| 633 | Ga0501037_0037983 | 3300049573 | Bacteria | 3550 |
| 634 | Ga0501039_0018005 | 3300049575 | Bacteria | 5419 |
| 635 | Ga0501039_0242598 | 3300049575 | Bacteria | 1417 |
| 636 | Ga0501039_0266981 | 3300049575 | Bacteria | 1345 |
| 637 | Ga0501040_0007257 | 3300049576 | Bacteria | 7182 |
| 638 | Ga0501040_0010980 | 3300049576 | Bacteria | 5921 |
| 639 | Ga0501041_0004421 | 3300049577 | Bacteria | 8130 |
| 640 | Ga0501041_0030887 | 3300049577 | Bacteria | 3233 |
| 641 | Ga0501041_0172113 | 3300049577 | Bacteria | 1355 |
| 642 | Ga0501042_0003463 | 3300049578 | Bacteria | 9908 |
| 643 | Ga0501042_0120251 | 3300049578 | Bacteria | 1891 |
| 644 | Ga0501042_0130631 | 3300049578 | Bacteria | 1810 |
| 645 | Ga0501042_0210040 | 3300049578 | Bacteria | 1404 |
| 646 | Ga0501043_0049422 | 3300049579 | Bacteria | 3306 |
| 647 | Ga0501043_0081308 | 3300049579 | Bacteria | 2546 |
| 648 | Ga0501046_0000240 | 3300049580 | Bacteria | 56302 |
| 649 | Ga0501047_0046156 | 3300049581 | Bacteria | 4211 |
| 650 | Ga0501048_0018933 | 3300049582 | Bacteria | 5060 |
| 651 | Ga0501048_0286847 | 3300049582 | Bacteria | 1171 |
| 652 | Ga0501070_0451272 | 3300049586 | Unclassified | 1037 |
| 653 | Ga0501071_0071454 | 3300049587 | Bacteria | 2530 |
| 654 | Ga0501072_0039460 | 3300049588 | Bacteria | 3707 |
| 655 | Ga0501072_0042515 | 3300049588 | Bacteria | 3569 |
| 656 | Ga0501072_0110664 | 3300049588 | Bacteria | 2186 |
| 657 | Ga0501072_0177125 | 3300049588 | Bacteria | 1701 |
| 658 | Ga0501072_0328160 | 3300049588 | Bacteria | 1216 |
| 659 | Ga0501073_0175977 | 3300049589 | Bacteria | 1481 |
| 660 | Ga0501074_0010370 | 3300049590 | Bacteria | 6761 |
| 661 | Ga0501075_0011788 | 3300049591 | Bacteria | 6198 |
| 662 | Ga0501075_0124539 | 3300049591 | Unclassified | 1962 |
| 663 | Ga0501075_0145704 | 3300049591 | Bacteria | 1805 |
| 664 | Ga0501075_0146669 | 3300049591 | Bacteria | 1798 |
| 665 | Ga0501075_0257981 | 3300049591 | Bacteria | 1328 |
| 666 | Ga0501075_0277999 | 3300049591 | Bacteria | 1276 |
| 667 | Ga0501076_0002469 | 3300049592 | Bacteria | 12699 |
| 668 | Ga0501076_0006954 | 3300049592 | Bacteria | 8223 |
| 669 | Ga0501076_0048596 | 3300049592 | Bacteria | 3353 |
| 670 | Ga0501077_0012786 | 3300049593 | Bacteria | 5260 |
| 671 | Ga0501077_0019306 | 3300049593 | Bacteria | 4311 |
| 672 | Ga0501079_0005268 | 3300049741 | Bacteria | 9617 |
| 673 | Ga0501079_0005994 | 3300049741 | Bacteria | 9101 |
| 674 | Ga0501079_0027102 | 3300049741 | Bacteria | 4392 |
| 675 | Ga0501079_0075611 | 3300049741 | Bacteria | 2605 |
| 676 | Ga0501079_0078174 | 3300049741 | Bacteria | 2559 |
| 677 | Ga0501079_0500457 | 3300049741 | Bacteria | 955 |
| 678 | Ga0501080_0015063 | 3300049742 | Bacteria | 7126 |
| 679 | Ga0501080_0024101 | 3300049742 | Bacteria | 5641 |
| 680 | Ga0501080_0628070 | 3300049742 | Bacteria | 952 |
| 681 | Ga0501081_0002066 | 3300049743 | Bacteria | 12521 |
| 682 | Ga0501081_0002648 | 3300049743 | Bacteria | 11319 |
| 683 | Ga0501081_0056081 | 3300049743 | Bacteria | 2722 |
| 684 | Ga0501081_0118454 | 3300049743 | Bacteria | 1884 |
| 685 | Ga0501083_0141644 | 3300049744 | Bacteria | 1575 |
| 686 | Ga0501045_0003643 | 3300049824 | Bacteria | 10592 |
| 687 | Ga0501045_0057687 | 3300049824 | Bacteria | 2842 |
| 688 | nmdc:mga05p37_1308_c1 | 3300050507 | Bacteria | 28963 |
| 689 | nmdc:mga05p37_13403_c1 | 3300050507 | Bacteria | 9825 |
| 690 | nmdc:mga05p37_216892_c1 | 3300050507 | Bacteria | 2311 |
| 691 | nmdc:mga05p37_221896_c1 | 3300050507 | Bacteria | 2281 |
| 692 | nmdc:mga05p37_2288_c1 | 3300050507 | Bacteria | 22334 |
| 693 | nmdc:mga05p37_292966_c1 | 3300050507 | Bacteria | 1937 |
| 694 | nmdc:mga05p37_50288_c1 | 3300050507 | Bacteria | 5126 |
| 695 | nmdc:mga05p37_72351_c1 | 3300050507 | Bacteria | 4242 |
| 696 | nmdc:mga05p37_78184_c1 | 3300050507 | Bacteria | 4074 |
| 697 | nmdc:mga05p37_88888_c1 | 3300050507 | Bacteria | 3808 |
| 698 | nmdc:mga09592_134194_c1 | 3300050508 | Bacteria | 2132 |
| 699 | nmdc:mga09592_1983_c1 | 3300050508 | Bacteria | 16505 |
| 700 | nmdc:mga09592_27471_c1 | 3300050508 | Bacteria | 4722 |
| 701 | nmdc:mga09592_3499_c1 | 3300050508 | Bacteria | 12676 |
| 702 | nmdc:mga09592_376374_c1 | 3300050508 | Bacteria | 1228 |
| 703 | nmdc:mga09592_45322_c1 | 3300050508 | Bacteria | 3704 |
| 704 | nmdc:mga09592_471988_c1 | 3300050508 | Bacteria | 1082 |
| 705 | nmdc:mga09592_49664_c1 | 3300050508 | Bacteria | 3537 |
| 706 | nmdc:mga09592_9421_c1 | 3300050508 | Bacteria | 7933 |
| 707 | nmdc:mga09592_991_c1 | 3300050508 | Bacteria | 22493 |
| 708 | nmdc:mga0qj67_141_c1 | 3300050509 | Bacteria | 48622 |
| 709 | nmdc:mga0qj67_29813_c1 | 3300050509 | Bacteria | 4240 |
| 710 | nmdc:mga0qj67_6609_c1 | 3300050509 | Bacteria | 8519 |
| 711 | nmdc:mga06r32_11284_c1 | 3300050510 | Bacteria | 8048 |
| 712 | nmdc:mga06r32_1408_c1 | 3300050510 | Bacteria | 21711 |
| 713 | nmdc:mga06r32_18996_c1 | 3300050510 | Bacteria | 6302 |
| 714 | nmdc:mga06r32_226169_c1 | 3300050510 | Bacteria | 1859 |
| 715 | nmdc:mga06r32_238933_c1 | 3300050510 | Bacteria | 1804 |
| 716 | nmdc:mga06r32_257012_c1 | 3300050510 | Bacteria | 1735 |
| 717 | nmdc:mga06r32_268_c1 | 3300050510 | Bacteria | 43133 |
| 718 | nmdc:mga06r32_47927_c1 | 3300050510 | Bacteria | 4084 |
| 719 | nmdc:mga06r32_573765_c1 | 3300050510 | Unclassified | 1101 |
| 720 | nmdc:mga08y16_194012_c1 | 3300050511 | Bacteria | 2106 |
| 721 | nmdc:mga08y16_21560_c1 | 3300050511 | Bacteria | 6803 |
| 722 | nmdc:mga08y16_40638_c1 | 3300050511 | Bacteria | 4873 |
| 723 | nmdc:mga08y16_54366_c1 | 3300050511 | Bacteria | 4184 |
| 724 | nmdc:mga08y16_5571_c1 | 3300050511 | Bacteria | 13190 |
| 725 | nmdc:mga08y16_558676_c1 | 3300050511 | Bacteria | 1158 |
| 726 | nmdc:mga08y16_7748_c1 | 3300050511 | Bacteria | 11248 |
| 727 | nmdc:mga08y16_7784_c1 | 3300050511 | Bacteria | 11223 |
| 728 | nmdc:mga0n895_117104_c1 | 3300050512 | Bacteria | 2683 |
| 729 | nmdc:mga0n895_148729_c1 | 3300050512 | Bacteria | 2371 |
| 730 | nmdc:mga0n895_21898_c1 | 3300050512 | Bacteria | 5986 |
| 731 | nmdc:mga0n895_251457_c1 | 3300050512 | Bacteria | 1794 |
| 732 | nmdc:mga0n895_285413_c1 | 3300050512 | Bacteria | 1674 |
| 733 | nmdc:mga0n895_3955_c1 | 3300050512 | Bacteria | 12046 |
| 734 | nmdc:mga0n895_415170_c1 | 3300050512 | Bacteria | 1361 |
| 735 | nmdc:mga0n895_4479_c1 | 3300050512 | Bacteria | 11481 |
| 736 | nmdc:mga0n895_52283_c1 | 3300050512 | Bacteria | 4010 |
| 737 | nmdc:mga0n895_826_c1 | 3300050512 | Bacteria | 22185 |
| 738 | nmdc:mga0rr50_103708_c1 | 3300050513 | Bacteria | 2239 |
| 739 | nmdc:mga0rr50_11081_c1 | 3300050513 | Bacteria | 5751 |
| 740 | nmdc:mga0rr50_18674_c1 | 3300050513 | Bacteria | 4663 |
| 741 | nmdc:mga0rr50_21882_c1 | 3300050513 | Bacteria | 4376 |
| 742 | nmdc:mga0rr50_309872_c1 | 3300050513 | Bacteria | 1322 |
| 743 | nmdc:mga0rr50_37300_c1 | 3300050513 | Bacteria | 3507 |
| 744 | nmdc:mga0rr50_506534_c1 | 3300050513 | Bacteria | 1027 |
| 745 | nmdc:mga0rr50_6133_c1 | 3300050513 | Bacteria | 7276 |
| 746 | nmdc:mga0rr50_82534_c1 | 3300050513 | Bacteria | 2483 |
| 747 | nmdc:mga08x19_212600_c1 | 3300050514 | Bacteria | 1328 |
| 748 | nmdc:mga08x19_26225_c1 | 3300050514 | Bacteria | 3635 |
| 749 | nmdc:mga08x19_2837_c1 | 3300050514 | Bacteria | 10452 |
| 750 | nmdc:mga08x19_42291_c1 | 3300050514 | Bacteria | 2904 |
| 751 | nmdc:mga08x19_4910_c1 | 3300050514 | Bacteria | 7899 |
| 752 | nmdc:mga08x19_69414_c1 | 3300050514 | Bacteria | 2295 |
| 753 | nmdc:mga0a205_104897_c1 | 3300050515 | Bacteria | 2725 |
| 754 | nmdc:mga0a205_12814_c1 | 3300050515 | Bacteria | 7776 |
| 755 | nmdc:mga0a205_13391_c1 | 3300050515 | Bacteria | 7636 |
| 756 | nmdc:mga0a205_149018_c1 | 3300050515 | Bacteria | 2240 |
| 757 | nmdc:mga0a205_25809_c1 | 3300050515 | Bacteria | 5599 |
| 758 | nmdc:mga0a205_26719_c1 | 3300050515 | Bacteria | 5508 |
| 759 | nmdc:mga0a205_295091_c1 | 3300050515 | Bacteria | 1495 |
| 760 | nmdc:mga0a205_3041_c2 | 3300050515 | Bacteria | 3932 |
| 761 | nmdc:mga0a205_33777_c1 | 3300050515 | Bacteria | 4906 |
| 762 | nmdc:mga0a205_5169_c1 | 3300050515 | Bacteria | 11734 |
| 763 | nmdc:mga0a205_99302_c1 | 3300050515 | Bacteria | 2809 |
| 764 | Ga0495601_0001753 | 3300053077 | Bacteria | 12008 |
| 765 | Ga0495601_0171110 | 3300053077 | Bacteria | 1420 |
| 766 | Ga0495612_0002063 | 3300053078 | Bacteria | 8272 |
| 767 | Ga0495612_0112150 | 3300053078 | Unclassified | 1168 |
| 768 | Ga0495595_0108173 | 3300053084 | Unclassified | 1346 |
| 769 | Ga0495619_0237310 | 3300053085 | Bacteria | 1263 |
| 770 | Ga0501084_0011701 | 3300054114 | Bacteria | 7263 |
| 771 | Ga0501084_0013355 | 3300054114 | Bacteria | 6795 |
| 772 | Ga0501084_0070061 | 3300054114 | Bacteria | 2936 |
| 773 | Ga0501084_0109146 | 3300054114 | Bacteria | 2325 |
| 774 | Ga0501084_0190645 | 3300054114 | Bacteria | 1729 |
| 775 | Ga0501084_0352855 | 3300054114 | Bacteria | 1242 |
| 776 | Ga0501082_0000691 | 3300060353 | Bacteria | 29759 |
| 777 | Ga0501082_0002744 | 3300060353 | Bacteria | 15383 |
| 778 | Ga0501082_0009737 | 3300060353 | Bacteria | 8279 |
| 779 | Ga0501082_0088907 | 3300060353 | Bacteria | 2666 |
| 780 | Ga0501082_0261744 | 3300060353 | Bacteria | 1505 |
| 781 | Ga0530510_0002570 | 3300061734 | Bacteria | 12468 |
| 782 | Ga0530510_0017719 | 3300061734 | Bacteria | 5047 |
| 783 | Ga0530510_0374154 | 3300061734 | Bacteria | 1072 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048911 | Ga0496108_0357350 | Ga0496108_0357350_578_1252 | 222 |
| 2 | 3300027717 | Ga0209998_10023228 | Ga0209998_100232282 | 232 |
| 3 | 3300050508 | nmdc:mga09592_471988_c1 | nmdc:mga09592_471988_c1_65_916 | 257 |
| 4 | 3300037853 | Ga0436364_1524375 | Ga0436364_1524375_881_1726 | 258 |
| 5 | 3300044673 | Ga0453683_0135533 | Ga0453683_0135533_418_1272 | 259 |
| 6 | 3300042876 | Ga0451577_0250281 | Ga0451577_0250281_54_902 | 263 |
| 7 | 3300005545 | Ga0070695_100114809 | Ga0070695_1001148092 | 264 |
| 8 | 3300025917 | Ga0207660_10062257 | Ga0207660_100622572 | 264 |
| 9 | 3300028577 | Ga0265318_10003548 | Ga0265318_100035487 | 264 |
| 10 | 3300031238 | Ga0265332_10011096 | Ga0265332_100110963 | 264 |
| 11 | 3300031242 | Ga0265329_10006071 | Ga0265329_100060714 | 264 |
| 12 | 3300031595 | Ga0265313_10106204 | Ga0265313_101062041 | 264 |
| 13 | 3300031711 | Ga0265314_10003180 | Ga0265314_1000318014 | 264 |
| 14 | 3300035691 | Ga0373931_0038481 | Ga0373931_0038481_1551_2399 | 264 |
| 15 | 3300048905 | Ga0496102_0026723 | Ga0496102_0026723_1151_1999 | 264 |
| 16 | 3300006846 | Ga0075430_100036582 | Ga0075430_1000365824 | 266 |
| 17 | 3300006847 | Ga0075431_100158834 | Ga0075431_1001588342 | 266 |
| 18 | 3300009094 | Ga0111539_10003777 | Ga0111539_1000377717 | 266 |
| 19 | 3300027907 | Ga0207428_10000027 | Ga0207428_10000027121 | 266 |
| 20 | 3300035112 | Ga0373932_0017703 | Ga0373932_0017703_775_1626 | 266 |
| 21 | 3300035114 | Ga0373939_0006538 | Ga0373939_0006538_1154_2005 | 266 |
| 22 | 3300050509 | nmdc:mga0qj67_29813_c1 | nmdc:mga0qj67_29813_c1_3062_3913 | 266 |
| 23 | 3300050510 | nmdc:mga06r32_257012_c1 | nmdc:mga06r32_257012_c1_200_1051 | 266 |
| 24 | 3300050511 | nmdc:mga08y16_21560_c1 | nmdc:mga08y16_21560_c1_5084_5935 | 266 |
| 25 | 3300013104 | Ga0157370_10312303 | Ga0157370_103123032 | 269 |
| 26 | 3300025915 | Ga0207693_10046200 | Ga0207693_100462002 | 269 |
| 27 | 3300035170 | Ga0373943_0274091 | Ga0373943_0274091_102_935 | 269 |
| 28 | 3300035172 | Ga0373955_0002628 | Ga0373955_0002628_319_1152 | 269 |
| 29 | 3300035695 | Ga0373927_0146852 | Ga0373927_0146852_228_1061 | 269 |
| 30 | 3300035725 | Ga0373947_0156203 | Ga0373947_0156203_459_1292 | 269 |
| 31 | 3300036401 | Ga0373937_0370545 | Ga0373937_0370545_355_1188 | 269 |
| 32 | 3300037068 | Ga0373925_0148541 | Ga0373925_0148541_50_883 | 269 |
| 33 | 3300037853 | Ga0436364_0210276 | Ga0436364_0210276_37_873 | 269 |
| 34 | 3300046463 | Ga0495653_0256922 | Ga0495653_0256922_88_921 | 269 |
| 35 | 3300039450 | Ga0436363_1076056 | Ga0436363_1076056_1008_1844 | 272 |
| 36 | 3300045051 | Ga0451576_0330317 | Ga0451576_0330317_21_860 | 272 |
| 37 | 3300005327 | Ga0070658_10051305 | Ga0070658_100513053 | 273 |
| 38 | 3300005328 | Ga0070676_10064433 | Ga0070676_100644333 | 273 |
| 39 | 3300005330 | Ga0070690_100010677 | Ga0070690_1000106776 | 273 |
| 40 | 3300005331 | Ga0070670_100062981 | Ga0070670_1000629811 | 273 |
| 41 | 3300005333 | Ga0070677_10010018 | Ga0070677_100100184 | 273 |
| 42 | 3300005335 | Ga0070666_10058323 | Ga0070666_100583231 | 273 |
| 43 | 3300005335 | Ga0070666_10225728 | Ga0070666_102257281 | 273 |
| 44 | 3300005335 | Ga0070666_10373623 | Ga0070666_103736232 | 273 |
| 45 | 3300005338 | Ga0068868_100332802 | Ga0068868_1003328021 | 273 |
| 46 | 3300005340 | Ga0070689_100267039 | Ga0070689_1002670391 | 273 |
| 47 | 3300005347 | Ga0070668_100018225 | Ga0070668_1000182253 | 273 |
| 48 | 3300005353 | Ga0070669_100020459 | Ga0070669_1000204596 | 273 |
| 49 | 3300005354 | Ga0070675_100032040 | Ga0070675_1000320402 | 273 |
| 50 | 3300005355 | Ga0070671_100098960 | Ga0070671_1000989603 | 273 |
| 51 | 3300005356 | Ga0070674_100043915 | Ga0070674_1000439154 | 273 |
| 52 | 3300005364 | Ga0070673_100084444 | Ga0070673_1000844442 | 273 |
| 53 | 3300005365 | Ga0070688_100026974 | Ga0070688_1000269745 | 273 |
| 54 | 3300005367 | Ga0070667_100337323 | Ga0070667_1003373232 | 273 |
| 55 | 3300005367 | Ga0070667_100372727 | Ga0070667_1003727272 | 273 |
| 56 | 3300005438 | Ga0070701_10016634 | Ga0070701_100166345 | 273 |
| 57 | 3300005444 | Ga0070694_100164966 | Ga0070694_1001649662 | 273 |
| 58 | 3300005457 | Ga0070662_100020262 | Ga0070662_1000202622 | 273 |
| 59 | 3300005458 | Ga0070681_10038418 | Ga0070681_100384184 | 273 |
| 60 | 3300005530 | Ga0070679_100281326 | Ga0070679_1002813262 | 273 |
| 61 | 3300005543 | Ga0070672_100077635 | Ga0070672_1000776353 | 273 |
| 62 | 3300005545 | Ga0070695_100215593 | Ga0070695_1002155931 | 273 |
| 63 | 3300005617 | Ga0068859_100578593 | Ga0068859_1005785932 | 273 |
| 64 | 3300005618 | Ga0068864_100029363 | Ga0068864_1000293632 | 273 |
| 65 | 3300005718 | Ga0068866_10011868 | Ga0068866_100118682 | 273 |
| 66 | 3300005719 | Ga0068861_100008733 | Ga0068861_1000087333 | 273 |
| 67 | 3300005840 | Ga0068870_10002446 | Ga0068870_100024467 | 273 |
| 68 | 3300005841 | Ga0068863_100225933 | Ga0068863_1002259332 | 273 |
| 69 | 3300005841 | Ga0068863_100386266 | Ga0068863_1003862661 | 273 |
| 70 | 3300005842 | Ga0068858_100124714 | Ga0068858_1001247143 | 273 |
| 71 | 3300005843 | Ga0068860_100058243 | Ga0068860_1000582433 | 273 |
| 72 | 3300005843 | Ga0068860_100472076 | Ga0068860_1004720762 | 273 |
| 73 | 3300005844 | Ga0068862_100017892 | Ga0068862_1000178925 | 273 |
| 74 | 3300006237 | Ga0097621_100136507 | Ga0097621_1001365072 | 273 |
| 75 | 3300006237 | Ga0097621_100306701 | Ga0097621_1003067012 | 273 |
| 76 | 3300006881 | Ga0068865_100208964 | Ga0068865_1002089642 | 273 |
| 77 | 3300006931 | Ga0097620_100578589 | Ga0097620_1005785892 | 273 |
| 78 | 3300009094 | Ga0111539_10054232 | Ga0111539_100542325 | 273 |
| 79 | 3300009098 | Ga0105245_10272929 | Ga0105245_102729292 | 273 |
| 80 | 3300009101 | Ga0105247_10114373 | Ga0105247_101143732 | 273 |
| 81 | 3300009148 | Ga0105243_10015145 | Ga0105243_100151457 | 273 |
| 82 | 3300009176 | Ga0105242_10132260 | Ga0105242_101322601 | 273 |
| 83 | 3300009177 | Ga0105248_10057324 | Ga0105248_100573241 | 273 |
| 84 | 3300009553 | Ga0105249_10132999 | Ga0105249_101329992 | 273 |
| 85 | 3300011119 | Ga0105246_10145320 | Ga0105246_101453202 | 273 |
| 86 | 3300013296 | Ga0157374_10053226 | Ga0157374_100532262 | 273 |
| 87 | 3300013297 | Ga0157378_10467386 | Ga0157378_104673862 | 273 |
| 88 | 3300013306 | Ga0163162_10134585 | Ga0163162_101345851 | 273 |
| 89 | 3300013308 | Ga0157375_10014050 | Ga0157375_100140502 | 273 |
| 90 | 3300014325 | Ga0163163_10184372 | Ga0163163_101843723 | 273 |
| 91 | 3300014326 | Ga0157380_10036806 | Ga0157380_100368065 | 273 |
| 92 | 3300014745 | Ga0157377_10045882 | Ga0157377_100458821 | 273 |
| 93 | 3300014968 | Ga0157379_10220429 | Ga0157379_102204292 | 273 |
| 94 | 3300014969 | Ga0157376_10029306 | Ga0157376_100293062 | 273 |
| 95 | 3300017792 | Ga0163161_10014586 | Ga0163161_100145864 | 273 |
| 96 | 3300017792 | Ga0163161_10591729 | Ga0163161_105917291 | 273 |
| 97 | 3300025271 | Ga0207666_1015518 | Ga0207666_10155182 | 273 |
| 98 | 3300025893 | Ga0207682_10014559 | Ga0207682_100145591 | 273 |
| 99 | 3300025899 | Ga0207642_10024383 | Ga0207642_100243831 | 273 |
| 100 | 3300025899 | Ga0207642_10096462 | Ga0207642_100964621 | 273 |
| 101 | 3300025901 | Ga0207688_10005957 | Ga0207688_100059578 | 273 |
| 102 | 3300025903 | Ga0207680_10012243 | Ga0207680_100122434 | 273 |
| 103 | 3300025908 | Ga0207643_10060259 | Ga0207643_100602591 | 273 |
| 104 | 3300025920 | Ga0207649_10083580 | Ga0207649_100835802 | 273 |
| 105 | 3300025925 | Ga0207650_10026018 | Ga0207650_100260181 | 273 |
| 106 | 3300025925 | Ga0207650_10092028 | Ga0207650_100920283 | 273 |
| 107 | 3300025925 | Ga0207650_10137943 | Ga0207650_101379431 | 273 |
| 108 | 3300025925 | Ga0207650_10291318 | Ga0207650_102913181 | 273 |
| 109 | 3300025926 | Ga0207659_10011144 | Ga0207659_100111443 | 273 |
| 110 | 3300025926 | Ga0207659_10392435 | Ga0207659_103924352 | 273 |
| 111 | 3300025926 | Ga0207659_10409742 | Ga0207659_104097422 | 273 |
| 112 | 3300025927 | Ga0207687_10016642 | Ga0207687_100166423 | 273 |
| 113 | 3300025931 | Ga0207644_10072039 | Ga0207644_100720393 | 273 |
| 114 | 3300025931 | Ga0207644_10220117 | Ga0207644_102201172 | 273 |
| 115 | 3300025933 | Ga0207706_10013948 | Ga0207706_100139486 | 273 |
| 116 | 3300025933 | Ga0207706_10395187 | Ga0207706_103951872 | 273 |
| 117 | 3300025935 | Ga0207709_10047835 | Ga0207709_100478353 | 273 |
| 118 | 3300025936 | Ga0207670_10271095 | Ga0207670_102710952 | 273 |
| 119 | 3300025937 | Ga0207669_10069448 | Ga0207669_100694483 | 273 |
| 120 | 3300025938 | Ga0207704_10049398 | Ga0207704_100493981 | 273 |
| 121 | 3300025940 | Ga0207691_10018115 | Ga0207691_100181157 | 273 |
| 122 | 3300025940 | Ga0207691_10067145 | Ga0207691_100671455 | 273 |
| 123 | 3300025940 | Ga0207691_10195337 | Ga0207691_101953372 | 273 |
| 124 | 3300025941 | Ga0207711_10058850 | Ga0207711_100588501 | 273 |
| 125 | 3300025941 | Ga0207711_10104303 | Ga0207711_101043033 | 273 |
| 126 | 3300025942 | Ga0207689_10041899 | Ga0207689_100418993 | 273 |
| 127 | 3300025961 | Ga0207712_10066434 | Ga0207712_100664342 | 273 |
| 128 | 3300025986 | Ga0207658_10391434 | Ga0207658_103914342 | 273 |
| 129 | 3300026023 | Ga0207677_10070093 | Ga0207677_100700932 | 273 |
| 130 | 3300026023 | Ga0207677_10590118 | Ga0207677_105901182 | 273 |
| 131 | 3300026035 | Ga0207703_10310108 | Ga0207703_103101081 | 273 |
| 132 | 3300026075 | Ga0207708_10027298 | Ga0207708_100272981 | 273 |
| 133 | 3300026088 | Ga0207641_10026717 | Ga0207641_100267172 | 273 |
| 134 | 3300026088 | Ga0207641_10430836 | Ga0207641_104308361 | 273 |
| 135 | 3300026089 | Ga0207648_10018035 | Ga0207648_100180351 | 273 |
| 136 | 3300026095 | Ga0207676_10004198 | Ga0207676_100041989 | 273 |
| 137 | 3300026095 | Ga0207676_10076687 | Ga0207676_100766871 | 273 |
| 138 | 3300026095 | Ga0207676_10227075 | Ga0207676_102270752 | 273 |
| 139 | 3300026118 | Ga0207675_100057233 | Ga0207675_1000572332 | 273 |
| 140 | 3300026121 | Ga0207683_10078100 | Ga0207683_100781001 | 273 |
| 141 | 3300026121 | Ga0207683_10423726 | Ga0207683_104237261 | 273 |
| 142 | 3300026142 | Ga0207698_10448515 | Ga0207698_104485152 | 273 |
| 143 | 3300027907 | Ga0207428_10435746 | Ga0207428_104357461 | 273 |
| 144 | 3300028380 | Ga0268265_10535433 | Ga0268265_105354332 | 273 |
| 145 | 3300028381 | Ga0268264_10140736 | Ga0268264_101407361 | 273 |
| 146 | 3300028381 | Ga0268264_10575601 | Ga0268264_105756011 | 273 |
| 147 | 3300039453 | Ga0436362_0672745 | Ga0436362_0672745_184_1032 | 273 |
| 148 | 3300046528 | Ga0495642_0016547 | Ga0495642_0016547_587_1420 | 273 |
| 149 | 3300046537 | Ga0495598_0007052 | Ga0495598_0007052_367_1200 | 273 |
| 150 | 3300046683 | Ga0495658_0094420 | Ga0495658_0094420_527_1360 | 273 |
| 151 | 3300048912 | Ga0496109_0414803 | Ga0496109_0414803_367_1197 | 273 |
| 152 | 3300048913 | Ga0496110_0041884 | Ga0496110_0041884_2794_3624 | 273 |
| 153 | 3300048913 | Ga0496110_0448626 | Ga0496110_0448626_287_1108 | 273 |
| 154 | 3300048917 | Ga0496114_0305120 | Ga0496114_0305120_347_1180 | 273 |
| 155 | 3300050511 | nmdc:mga08y16_558676_c1 | nmdc:mga08y16_558676_c1_77_910 | 273 |
| 156 | 3300005354 | Ga0070675_100075714 | Ga0070675_1000757142 | 274 |
| 157 | 3300005434 | Ga0070709_10257894 | Ga0070709_102578941 | 274 |
| 158 | 3300005435 | Ga0070714_100032868 | Ga0070714_1000328682 | 274 |
| 159 | 3300005435 | Ga0070714_100413839 | Ga0070714_1004138391 | 274 |
| 160 | 3300005444 | Ga0070694_100104772 | Ga0070694_1001047722 | 274 |
| 161 | 3300005445 | Ga0070708_100042642 | Ga0070708_1000426423 | 274 |
| 162 | 3300005467 | Ga0070706_100405927 | Ga0070706_1004059272 | 274 |
| 163 | 3300005468 | Ga0070707_100029238 | Ga0070707_1000292384 | 274 |
| 164 | 3300005518 | Ga0070699_100005810 | Ga0070699_1000058108 | 274 |
| 165 | 3300005536 | Ga0070697_100091218 | Ga0070697_1000912184 | 274 |
| 166 | 3300005545 | Ga0070695_100005791 | Ga0070695_1000057916 | 274 |
| 167 | 3300005545 | Ga0070695_100157100 | Ga0070695_1001571002 | 274 |
| 168 | 3300005546 | Ga0070696_100036674 | Ga0070696_1000366742 | 274 |
| 169 | 3300005546 | Ga0070696_100598705 | Ga0070696_1005987051 | 274 |
| 170 | 3300005549 | Ga0070704_100231572 | Ga0070704_1002315722 | 274 |
| 171 | 3300005614 | Ga0068856_100155490 | Ga0068856_1001554902 | 274 |
| 172 | 3300005615 | Ga0070702_100077461 | Ga0070702_1000774612 | 274 |
| 173 | 3300005615 | Ga0070702_100227410 | Ga0070702_1002274102 | 274 |
| 174 | 3300005617 | Ga0068859_100528360 | Ga0068859_1005283601 | 274 |
| 175 | 3300005618 | Ga0068864_100140213 | Ga0068864_1001402133 | 274 |
| 176 | 3300005844 | Ga0068862_100013361 | Ga0068862_1000133614 | 274 |
| 177 | 3300005844 | Ga0068862_100146488 | Ga0068862_1001464883 | 274 |
| 178 | 3300005937 | Ga0081455_10003829 | Ga0081455_1000382911 | 274 |
| 179 | 3300006028 | Ga0070717_10055316 | Ga0070717_100553163 | 274 |
| 180 | 3300006844 | Ga0075428_100526758 | Ga0075428_1005267582 | 274 |
| 181 | 3300006880 | Ga0075429_100289998 | Ga0075429_1002899982 | 274 |
| 182 | 3300006931 | Ga0097620_100528340 | Ga0097620_1005283402 | 274 |
| 183 | 3300007076 | Ga0075435_100057953 | Ga0075435_1000579533 | 274 |
| 184 | 3300009098 | Ga0105245_10109569 | Ga0105245_101095692 | 274 |
| 185 | 3300009147 | Ga0114129_10329703 | Ga0114129_103297032 | 274 |
| 186 | 3300009148 | Ga0105243_10017154 | Ga0105243_100171545 | 274 |
| 187 | 3300009553 | Ga0105249_10261224 | Ga0105249_102612242 | 274 |
| 188 | 3300013306 | Ga0163162_10603647 | Ga0163162_106036472 | 274 |
| 189 | 3300013307 | Ga0157372_10523849 | Ga0157372_105238492 | 274 |
| 190 | 3300025907 | Ga0207645_10107017 | Ga0207645_101070172 | 274 |
| 191 | 3300025910 | Ga0207684_10000673 | Ga0207684_100006736 | 274 |
| 192 | 3300025922 | Ga0207646_10001668 | Ga0207646_1000166828 | 274 |
| 193 | 3300025922 | Ga0207646_10024791 | Ga0207646_100247914 | 274 |
| 194 | 3300025927 | Ga0207687_10201853 | Ga0207687_102018532 | 274 |
| 195 | 3300025928 | Ga0207700_10029038 | Ga0207700_100290385 | 274 |
| 196 | 3300025928 | Ga0207700_10144112 | Ga0207700_101441122 | 274 |
| 197 | 3300025928 | Ga0207700_10168225 | Ga0207700_101682252 | 274 |
| 198 | 3300025929 | Ga0207664_10012103 | Ga0207664_100121035 | 274 |
| 199 | 3300025929 | Ga0207664_10192368 | Ga0207664_101923682 | 274 |
| 200 | 3300025931 | Ga0207644_10071757 | Ga0207644_100717572 | 274 |
| 201 | 3300025934 | Ga0207686_10146121 | Ga0207686_101461212 | 274 |
| 202 | 3300025935 | Ga0207709_10063266 | Ga0207709_100632662 | 274 |
| 203 | 3300025939 | Ga0207665_10085816 | Ga0207665_100858163 | 274 |
| 204 | 3300025942 | Ga0207689_10002119 | Ga0207689_1000211914 | 274 |
| 205 | 3300025949 | Ga0207667_10408278 | Ga0207667_104082782 | 274 |
| 206 | 3300025961 | Ga0207712_10261095 | Ga0207712_102610952 | 274 |
| 207 | 3300026075 | Ga0207708_10152174 | Ga0207708_101521742 | 274 |
| 208 | 3300026078 | Ga0207702_10048474 | Ga0207702_100484742 | 274 |
| 209 | 3300026089 | Ga0207648_10097994 | Ga0207648_100979944 | 274 |
| 210 | 3300027395 | Ga0209996_1000437 | Ga0209996_10004375 | 274 |
| 211 | 3300027424 | Ga0209984_1010499 | Ga0209984_10104991 | 274 |
| 212 | 3300027462 | Ga0210000_1009653 | Ga0210000_10096532 | 274 |
| 213 | 3300027471 | Ga0209995_1003242 | Ga0209995_10032422 | 274 |
| 214 | 3300027526 | Ga0209968_1000769 | Ga0209968_10007695 | 274 |
| 215 | 3300027543 | Ga0209999_1000908 | Ga0209999_10009082 | 274 |
| 216 | 3300027552 | Ga0209982_1001961 | Ga0209982_10019612 | 274 |
| 217 | 3300027614 | Ga0209970_1000737 | Ga0209970_10007374 | 274 |
| 218 | 3300027617 | Ga0210002_1024207 | Ga0210002_10242071 | 274 |
| 219 | 3300027665 | Ga0209983_1000271 | Ga0209983_10002714 | 274 |
| 220 | 3300027682 | Ga0209971_1000036 | Ga0209971_100003645 | 274 |
| 221 | 3300027695 | Ga0209966_1000021 | Ga0209966_100002144 | 274 |
| 222 | 3300027717 | Ga0209998_10000002 | Ga0209998_1000000276 | 274 |
| 223 | 3300027876 | Ga0209974_10002471 | Ga0209974_100024712 | 274 |
| 224 | 3300028380 | Ga0268265_10008105 | Ga0268265_100081052 | 274 |
| 225 | 3300035691 | Ga0373931_0075287 | Ga0373931_0075287_19_873 | 274 |
| 226 | 3300035695 | Ga0373927_0088486 | Ga0373927_0088486_244_1098 | 274 |
| 227 | 3300037853 | Ga0436364_0675117 | Ga0436364_0675117_55_954 | 274 |
| 228 | 3300039437 | Ga0436365_1156765 | Ga0436365_1156765_2030_2881 | 274 |
| 229 | 3300039450 | Ga0436363_0290638 | Ga0436363_0290638_734_1585 | 274 |
| 230 | 3300042012 | Ga0439455_0038172 | Ga0439455_0038172_172_1002 | 274 |
| 231 | 3300042016 | Ga0439463_018975 | Ga0439463_018975_755_1582 | 274 |
| 232 | 3300042439 | Ga0439464_0000383 | Ga0439464_0000383_2740_3567 | 274 |
| 233 | 3300042461 | Ga0439460_0003649 | Ga0439460_0003649_2431_3258 | 274 |
| 234 | 3300042876 | Ga0451577_0129375 | Ga0451577_0129375_405_1232 | 274 |
| 235 | 3300045051 | Ga0451576_0073845 | Ga0451576_0073845_906_1733 | 274 |
| 236 | 3300048908 | Ga0496105_0540347 | Ga0496105_0540347_28_879 | 274 |
| 237 | 3300048912 | Ga0496109_0473779 | Ga0496109_0473779_217_1068 | 274 |
| 238 | 3300048913 | Ga0496110_0102006 | Ga0496110_0102006_1264_2118 | 274 |
| 239 | 3300048916 | Ga0496113_0122374 | Ga0496113_0122374_172_1026 | 274 |
| 240 | 3300048917 | Ga0496114_0005334 | Ga0496114_0005334_7533_8384 | 274 |
| 241 | 3300049568 | Ga0501031_0105071 | Ga0501031_0105071_434_1261 | 274 |
| 242 | 3300049569 | Ga0501032_0310903 | Ga0501032_0310903_50_898 | 274 |
| 243 | 3300049571 | Ga0501034_0163724 | Ga0501034_0163724_510_1355 | 274 |
| 244 | 3300049572 | Ga0501036_0137253 | Ga0501036_0137253_1172_1999 | 274 |
| 245 | 3300049573 | Ga0501037_0037983 | Ga0501037_0037983_1061_1888 | 274 |
| 246 | 3300049575 | Ga0501039_0018005 | Ga0501039_0018005_3380_4207 | 274 |
| 247 | 3300049575 | Ga0501039_0242598 | Ga0501039_0242598_480_1310 | 274 |
| 248 | 3300049576 | Ga0501040_0010980 | Ga0501040_0010980_741_1568 | 274 |
| 249 | 3300049577 | Ga0501041_0030887 | Ga0501041_0030887_1016_1843 | 274 |
| 250 | 3300049578 | Ga0501042_0003463 | Ga0501042_0003463_8456_9283 | 274 |
| 251 | 3300049578 | Ga0501042_0130631 | Ga0501042_0130631_502_1347 | 274 |
| 252 | 3300049578 | Ga0501042_0210040 | Ga0501042_0210040_458_1285 | 274 |
| 253 | 3300049579 | Ga0501043_0049422 | Ga0501043_0049422_1753_2580 | 274 |
| 254 | 3300049580 | Ga0501046_0000240 | Ga0501046_0000240_20029_20856 | 274 |
| 255 | 3300049581 | Ga0501047_0046156 | Ga0501047_0046156_2766_3593 | 274 |
| 256 | 3300049582 | Ga0501048_0018933 | Ga0501048_0018933_4092_4919 | 274 |
| 257 | 3300049587 | Ga0501071_0071454 | Ga0501071_0071454_425_1270 | 274 |
| 258 | 3300049588 | Ga0501072_0039460 | Ga0501072_0039460_2089_2934 | 274 |
| 259 | 3300049588 | Ga0501072_0110664 | Ga0501072_0110664_1150_1977 | 274 |
| 260 | 3300049590 | Ga0501074_0010370 | Ga0501074_0010370_1494_2321 | 274 |
| 261 | 3300049591 | Ga0501075_0257981 | Ga0501075_0257981_73_900 | 274 |
| 262 | 3300049592 | Ga0501076_0006954 | Ga0501076_0006954_692_1519 | 274 |
| 263 | 3300049592 | Ga0501076_0048596 | Ga0501076_0048596_2098_2943 | 274 |
| 264 | 3300049593 | Ga0501077_0019306 | Ga0501077_0019306_2510_3337 | 274 |
| 265 | 3300049741 | Ga0501079_0005994 | Ga0501079_0005994_1378_2205 | 274 |
| 266 | 3300049741 | Ga0501079_0075611 | Ga0501079_0075611_1064_1909 | 274 |
| 267 | 3300049741 | Ga0501079_0078174 | Ga0501079_0078174_477_1307 | 274 |
| 268 | 3300049742 | Ga0501080_0024101 | Ga0501080_0024101_670_1497 | 274 |
| 269 | 3300049743 | Ga0501081_0002066 | Ga0501081_0002066_252_1079 | 274 |
| 270 | 3300049743 | Ga0501081_0118454 | Ga0501081_0118454_521_1348 | 274 |
| 271 | 3300049824 | Ga0501045_0003643 | Ga0501045_0003643_4630_5457 | 274 |
| 272 | 3300049824 | Ga0501045_0057687 | Ga0501045_0057687_882_1727 | 274 |
| 273 | 3300050512 | nmdc:mga0n895_148729_c1 | nmdc:mga0n895_148729_c1_1383_2228 | 274 |
| 274 | 3300050513 | nmdc:mga0rr50_103708_c1 | nmdc:mga0rr50_103708_c1_499_1344 | 274 |
| 275 | 3300054114 | Ga0501084_0011701 | Ga0501084_0011701_6201_7028 | 274 |
| 276 | 3300054114 | Ga0501084_0352855 | Ga0501084_0352855_96_941 | 274 |
| 277 | 3300060353 | Ga0501082_0002744 | Ga0501082_0002744_13742_14569 | 274 |
| 278 | 3300061734 | Ga0530510_0017719 | Ga0530510_0017719_318_1145 | 274 |
| 279 | 3300061734 | Ga0530510_0374154 | Ga0530510_0374154_192_1037 | 274 |
| 280 | 3300003203 | JGI25406J46586_10005914 | JGI25406J46586_100059146 | 275 |
| 281 | 3300005330 | Ga0070690_100275106 | Ga0070690_1002751062 | 275 |
| 282 | 3300005330 | Ga0070690_100459037 | Ga0070690_1004590371 | 275 |
| 283 | 3300005331 | Ga0070670_100004356 | Ga0070670_1000043563 | 275 |
| 284 | 3300005334 | Ga0068869_100001903 | Ga0068869_1000019038 | 275 |
| 285 | 3300005334 | Ga0068869_100466183 | Ga0068869_1004661831 | 275 |
| 286 | 3300005335 | Ga0070666_10099455 | Ga0070666_100994552 | 275 |
| 287 | 3300005336 | Ga0070680_100002663 | Ga0070680_1000026637 | 275 |
| 288 | 3300005337 | Ga0070682_100005961 | Ga0070682_1000059613 | 275 |
| 289 | 3300005338 | Ga0068868_100051865 | Ga0068868_1000518653 | 275 |
| 290 | 3300005339 | Ga0070660_100000640 | Ga0070660_1000006407 | 275 |
| 291 | 3300005340 | Ga0070689_100011348 | Ga0070689_1000113482 | 275 |
| 292 | 3300005345 | Ga0070692_10048151 | Ga0070692_100481512 | 275 |
| 293 | 3300005353 | Ga0070669_100042300 | Ga0070669_1000423003 | 275 |
| 294 | 3300005353 | Ga0070669_100059128 | Ga0070669_1000591282 | 275 |
| 295 | 3300005353 | Ga0070669_100155477 | Ga0070669_1001554772 | 275 |
| 296 | 3300005353 | Ga0070669_100291805 | Ga0070669_1002918052 | 275 |
| 297 | 3300005356 | Ga0070674_100125540 | Ga0070674_1001255402 | 275 |
| 298 | 3300005364 | Ga0070673_100097873 | Ga0070673_1000978732 | 275 |
| 299 | 3300005366 | Ga0070659_100004266 | Ga0070659_1000042663 | 275 |
| 300 | 3300005435 | Ga0070714_100089109 | Ga0070714_1000891092 | 275 |
| 301 | 3300005436 | Ga0070713_100019223 | Ga0070713_1000192233 | 275 |
| 302 | 3300005436 | Ga0070713_100055242 | Ga0070713_1000552422 | 275 |
| 303 | 3300005436 | Ga0070713_100089786 | Ga0070713_1000897863 | 275 |
| 304 | 3300005436 | Ga0070713_100398598 | Ga0070713_1003985981 | 275 |
| 305 | 3300005437 | Ga0070710_10024515 | Ga0070710_100245152 | 275 |
| 306 | 3300005437 | Ga0070710_10272451 | Ga0070710_102724512 | 275 |
| 307 | 3300005438 | Ga0070701_10026266 | Ga0070701_100262662 | 275 |
| 308 | 3300005440 | Ga0070705_100001700 | Ga0070705_1000017004 | 275 |
| 309 | 3300005440 | Ga0070705_100082834 | Ga0070705_1000828342 | 275 |
| 310 | 3300005444 | Ga0070694_100002292 | Ga0070694_1000022927 | 275 |
| 311 | 3300005444 | Ga0070694_100045828 | Ga0070694_1000458281 | 275 |
| 312 | 3300005445 | Ga0070708_100004836 | Ga0070708_1000048362 | 275 |
| 313 | 3300005445 | Ga0070708_100043416 | Ga0070708_1000434165 | 275 |
| 314 | 3300005445 | Ga0070708_100108359 | Ga0070708_1001083592 | 275 |
| 315 | 3300005445 | Ga0070708_100117321 | Ga0070708_1001173212 | 275 |
| 316 | 3300005455 | Ga0070663_100007247 | Ga0070663_1000072475 | 275 |
| 317 | 3300005456 | Ga0070678_100073447 | Ga0070678_1000734473 | 275 |
| 318 | 3300005457 | Ga0070662_100002555 | Ga0070662_1000025558 | 275 |
| 319 | 3300005458 | Ga0070681_10170393 | Ga0070681_101703932 | 275 |
| 320 | 3300005458 | Ga0070681_10341027 | Ga0070681_103410272 | 275 |
| 321 | 3300005459 | Ga0068867_100013214 | Ga0068867_1000132144 | 275 |
| 322 | 3300005459 | Ga0068867_100133964 | Ga0068867_1001339643 | 275 |
| 323 | 3300005466 | Ga0070685_10134825 | Ga0070685_101348251 | 275 |
| 324 | 3300005467 | Ga0070706_100028326 | Ga0070706_1000283262 | 275 |
| 325 | 3300005467 | Ga0070706_100035276 | Ga0070706_1000352762 | 275 |
| 326 | 3300005467 | Ga0070706_100497470 | Ga0070706_1004974702 | 275 |
| 327 | 3300005468 | Ga0070707_100018737 | Ga0070707_1000187374 | 275 |
| 328 | 3300005468 | Ga0070707_100031685 | Ga0070707_1000316854 | 275 |
| 329 | 3300005468 | Ga0070707_100033692 | Ga0070707_1000336925 | 275 |
| 330 | 3300005468 | Ga0070707_100228442 | Ga0070707_1002284422 | 275 |
| 331 | 3300005468 | Ga0070707_100396853 | Ga0070707_1003968532 | 275 |
| 332 | 3300005471 | Ga0070698_100002771 | Ga0070698_10000277116 | 275 |
| 333 | 3300005471 | Ga0070698_100010750 | Ga0070698_1000107504 | 275 |
| 334 | 3300005471 | Ga0070698_100066274 | Ga0070698_1000662743 | 275 |
| 335 | 3300005471 | Ga0070698_100319063 | Ga0070698_1003190632 | 275 |
| 336 | 3300005518 | Ga0070699_100001298 | Ga0070699_1000012986 | 275 |
| 337 | 3300005518 | Ga0070699_100079176 | Ga0070699_1000791762 | 275 |
| 338 | 3300005518 | Ga0070699_100086970 | Ga0070699_1000869704 | 275 |
| 339 | 3300005518 | Ga0070699_100087282 | Ga0070699_1000872822 | 275 |
| 340 | 3300005518 | Ga0070699_100196457 | Ga0070699_1001964572 | 275 |
| 341 | 3300005518 | Ga0070699_100222187 | Ga0070699_1002221872 | 275 |
| 342 | 3300005518 | Ga0070699_100308771 | Ga0070699_1003087711 | 275 |
| 343 | 3300005518 | Ga0070699_100523005 | Ga0070699_1005230051 | 275 |
| 344 | 3300005530 | Ga0070679_100002921 | Ga0070679_1000029217 | 275 |
| 345 | 3300005530 | Ga0070679_100201853 | Ga0070679_1002018532 | 275 |
| 346 | 3300005535 | Ga0070684_100139178 | Ga0070684_1001391783 | 275 |
| 347 | 3300005536 | Ga0070697_100044718 | Ga0070697_1000447184 | 275 |
| 348 | 3300005536 | Ga0070697_100074319 | Ga0070697_1000743192 | 275 |
| 349 | 3300005536 | Ga0070697_100131637 | Ga0070697_1001316372 | 275 |
| 350 | 3300005539 | Ga0068853_100023398 | Ga0068853_1000233983 | 275 |
| 351 | 3300005543 | Ga0070672_100014156 | Ga0070672_1000141565 | 275 |
| 352 | 3300005544 | Ga0070686_100118364 | Ga0070686_1001183642 | 275 |
| 353 | 3300005545 | Ga0070695_100008322 | Ga0070695_1000083222 | 275 |
| 354 | 3300005546 | Ga0070696_100002170 | Ga0070696_1000021705 | 275 |
| 355 | 3300005547 | Ga0070693_100000283 | Ga0070693_10000028316 | 275 |
| 356 | 3300005547 | Ga0070693_100428098 | Ga0070693_1004280981 | 275 |
| 357 | 3300005548 | Ga0070665_100509302 | Ga0070665_1005093021 | 275 |
| 358 | 3300005549 | Ga0070704_100193532 | Ga0070704_1001935322 | 275 |
| 359 | 3300005549 | Ga0070704_100203833 | Ga0070704_1002038332 | 275 |
| 360 | 3300005549 | Ga0070704_100291594 | Ga0070704_1002915942 | 275 |
| 361 | 3300005563 | Ga0068855_100008748 | Ga0068855_1000087485 | 275 |
| 362 | 3300005577 | Ga0068857_100539293 | Ga0068857_1005392931 | 275 |
| 363 | 3300005578 | Ga0068854_100000849 | Ga0068854_10000084913 | 275 |
| 364 | 3300005614 | Ga0068856_100015440 | Ga0068856_1000154405 | 275 |
| 365 | 3300005614 | Ga0068856_100369559 | Ga0068856_1003695592 | 275 |
| 366 | 3300005617 | Ga0068859_100015115 | Ga0068859_1000151156 | 275 |
| 367 | 3300005618 | Ga0068864_100077990 | Ga0068864_1000779902 | 275 |
| 368 | 3300005719 | Ga0068861_100044905 | Ga0068861_1000449052 | 275 |
| 369 | 3300005719 | Ga0068861_100049093 | Ga0068861_1000490934 | 275 |
| 370 | 3300005719 | Ga0068861_100310977 | Ga0068861_1003109773 | 275 |
| 371 | 3300005841 | Ga0068863_100023209 | Ga0068863_1000232093 | 275 |
| 372 | 3300005841 | Ga0068863_100082178 | Ga0068863_1000821782 | 275 |
| 373 | 3300005842 | Ga0068858_100040117 | Ga0068858_1000401172 | 275 |
| 374 | 3300005843 | Ga0068860_100599264 | Ga0068860_1005992642 | 275 |
| 375 | 3300005844 | Ga0068862_100002414 | Ga0068862_1000024145 | 275 |
| 376 | 3300005844 | Ga0068862_100505706 | Ga0068862_1005057062 | 275 |
| 377 | 3300005983 | Ga0081540_1002103 | Ga0081540_100210312 | 275 |
| 378 | 3300005985 | Ga0081539_10000044 | Ga0081539_10000044205 | 275 |
| 379 | 3300006028 | Ga0070717_10001390 | Ga0070717_100013903 | 275 |
| 380 | 3300006028 | Ga0070717_10063058 | Ga0070717_100630583 | 275 |
| 381 | 3300006175 | Ga0070712_100060180 | Ga0070712_1000601803 | 275 |
| 382 | 3300006175 | Ga0070712_100374553 | Ga0070712_1003745532 | 275 |
| 383 | 3300006237 | Ga0097621_100674383 | Ga0097621_1006743832 | 275 |
| 384 | 3300006358 | Ga0068871_100317860 | Ga0068871_1003178601 | 275 |
| 385 | 3300006844 | Ga0075428_100010575 | Ga0075428_1000105754 | 275 |
| 386 | 3300006844 | Ga0075428_100013472 | Ga0075428_1000134721 | 275 |
| 387 | 3300006844 | Ga0075428_100025119 | Ga0075428_1000251194 | 275 |
| 388 | 3300006844 | Ga0075428_100046058 | Ga0075428_1000460583 | 275 |
| 389 | 3300006844 | Ga0075428_100055445 | Ga0075428_1000554454 | 275 |
| 390 | 3300006844 | Ga0075428_100308038 | Ga0075428_1003080382 | 275 |
| 391 | 3300006846 | Ga0075430_100000577 | Ga0075430_10000057725 | 275 |
| 392 | 3300006846 | Ga0075430_100000658 | Ga0075430_1000006584 | 275 |
| 393 | 3300006847 | Ga0075431_100000635 | Ga0075431_10000063513 | 275 |
| 394 | 3300006847 | Ga0075431_100000847 | Ga0075431_10000084711 | 275 |
| 395 | 3300006847 | Ga0075431_100005898 | Ga0075431_1000058982 | 275 |
| 396 | 3300006847 | Ga0075431_100007172 | Ga0075431_10000717210 | 275 |
| 397 | 3300006847 | Ga0075431_100117031 | Ga0075431_1001170313 | 275 |
| 398 | 3300006847 | Ga0075431_100117969 | Ga0075431_1001179694 | 275 |
| 399 | 3300006847 | Ga0075431_100441051 | Ga0075431_1004410512 | 275 |
| 400 | 3300006852 | Ga0075433_10001836 | Ga0075433_100018368 | 275 |
| 401 | 3300006852 | Ga0075433_10005357 | Ga0075433_100053575 | 275 |
| 402 | 3300006852 | Ga0075433_10009282 | Ga0075433_100092827 | 275 |
| 403 | 3300006852 | Ga0075433_10009564 | Ga0075433_100095647 | 275 |
| 404 | 3300006852 | Ga0075433_10016703 | Ga0075433_100167033 | 275 |
| 405 | 3300006852 | Ga0075433_10018680 | Ga0075433_100186801 | 275 |
| 406 | 3300006852 | Ga0075433_10081243 | Ga0075433_100812433 | 275 |
| 407 | 3300006852 | Ga0075433_10092314 | Ga0075433_100923144 | 275 |
| 408 | 3300006852 | Ga0075433_10267092 | Ga0075433_102670922 | 275 |
| 409 | 3300006871 | Ga0075434_100010082 | Ga0075434_10001008210 | 275 |
| 410 | 3300006871 | Ga0075434_100014963 | Ga0075434_1000149637 | 275 |
| 411 | 3300006871 | Ga0075434_100017262 | Ga0075434_1000172626 | 275 |
| 412 | 3300006871 | Ga0075434_100055043 | Ga0075434_1000550432 | 275 |
| 413 | 3300006871 | Ga0075434_100300616 | Ga0075434_1003006162 | 275 |
| 414 | 3300006871 | Ga0075434_100306757 | Ga0075434_1003067571 | 275 |
| 415 | 3300006871 | Ga0075434_100567100 | Ga0075434_1005671002 | 275 |
| 416 | 3300006871 | Ga0075434_100731558 | Ga0075434_1007315581 | 275 |
| 417 | 3300006880 | Ga0075429_100000237 | Ga0075429_10000023736 | 275 |
| 418 | 3300006880 | Ga0075429_100000485 | Ga0075429_10000048523 | 275 |
| 419 | 3300006880 | Ga0075429_100003182 | Ga0075429_1000031824 | 275 |
| 420 | 3300006880 | Ga0075429_100013779 | Ga0075429_1000137795 | 275 |
| 421 | 3300006880 | Ga0075429_100029625 | Ga0075429_1000296254 | 275 |
| 422 | 3300006880 | Ga0075429_100060882 | Ga0075429_1000608823 | 275 |
| 423 | 3300006880 | Ga0075429_100288484 | Ga0075429_1002884842 | 275 |
| 424 | 3300006880 | Ga0075429_100338754 | Ga0075429_1003387542 | 275 |
| 425 | 3300006914 | Ga0075436_100001548 | Ga0075436_1000015482 | 275 |
| 426 | 3300006914 | Ga0075436_100020521 | Ga0075436_1000205214 | 275 |
| 427 | 3300006914 | Ga0075436_100023406 | Ga0075436_1000234064 | 275 |
| 428 | 3300006914 | Ga0075436_100039002 | Ga0075436_1000390022 | 275 |
| 429 | 3300006914 | Ga0075436_100061038 | Ga0075436_1000610384 | 275 |
| 430 | 3300006914 | Ga0075436_100107640 | Ga0075436_1001076402 | 275 |
| 431 | 3300006931 | Ga0097620_100015115 | Ga0097620_1000151152 | 275 |
| 432 | 3300007076 | Ga0075435_100010992 | Ga0075435_1000109926 | 275 |
| 433 | 3300007076 | Ga0075435_100013882 | Ga0075435_1000138822 | 275 |
| 434 | 3300007076 | Ga0075435_100016614 | Ga0075435_1000166145 | 275 |
| 435 | 3300007076 | Ga0075435_100182920 | Ga0075435_1001829202 | 275 |
| 436 | 3300007265 | Ga0099794_10003220 | Ga0099794_100032203 | 275 |
| 437 | 3300007788 | Ga0099795_10015030 | Ga0099795_100150302 | 275 |
| 438 | 3300007788 | Ga0099795_10061093 | Ga0099795_100610932 | 275 |
| 439 | 3300009094 | Ga0111539_10000139 | Ga0111539_1000013960 | 275 |
| 440 | 3300009094 | Ga0111539_10005684 | Ga0111539_100056847 | 275 |
| 441 | 3300009094 | Ga0111539_10027347 | Ga0111539_100273474 | 275 |
| 442 | 3300009094 | Ga0111539_10029747 | Ga0111539_100297475 | 275 |
| 443 | 3300009094 | Ga0111539_10043841 | Ga0111539_100438414 | 275 |
| 444 | 3300009094 | Ga0111539_10137181 | Ga0111539_101371815 | 275 |
| 445 | 3300009094 | Ga0111539_10152633 | Ga0111539_101526332 | 275 |
| 446 | 3300009094 | Ga0111539_10801890 | Ga0111539_108018901 | 275 |
| 447 | 3300009147 | Ga0114129_10000149 | Ga0114129_1000014956 | 275 |
| 448 | 3300009147 | Ga0114129_10000562 | Ga0114129_1000056235 | 275 |
| 449 | 3300009147 | Ga0114129_10009090 | Ga0114129_100090905 | 275 |
| 450 | 3300009147 | Ga0114129_10041323 | Ga0114129_100413235 | 275 |
| 451 | 3300009147 | Ga0114129_10049654 | Ga0114129_100496546 | 275 |
| 452 | 3300009147 | Ga0114129_10053694 | Ga0114129_100536947 | 275 |
| 453 | 3300009147 | Ga0114129_10057600 | Ga0114129_100576005 | 275 |
| 454 | 3300009147 | Ga0114129_10072996 | Ga0114129_100729962 | 275 |
| 455 | 3300009147 | Ga0114129_10128949 | Ga0114129_101289493 | 275 |
| 456 | 3300009147 | Ga0114129_10136000 | Ga0114129_101360003 | 275 |
| 457 | 3300009147 | Ga0114129_10572313 | Ga0114129_105723132 | 275 |
| 458 | 3300009147 | Ga0114129_11196120 | Ga0114129_111961201 | 275 |
| 459 | 3300009148 | Ga0105243_10050781 | Ga0105243_100507814 | 275 |
| 460 | 3300009148 | Ga0105243_10428915 | Ga0105243_104289152 | 275 |
| 461 | 3300009148 | Ga0105243_10451637 | Ga0105243_104516372 | 275 |
| 462 | 3300009174 | Ga0105241_10010553 | Ga0105241_100105534 | 275 |
| 463 | 3300009174 | Ga0105241_10028648 | Ga0105241_100286485 | 275 |
| 464 | 3300009177 | Ga0105248_10068601 | Ga0105248_100686014 | 275 |
| 465 | 3300009177 | Ga0105248_10442636 | Ga0105248_104426362 | 275 |
| 466 | 3300009177 | Ga0105248_10478469 | Ga0105248_104784691 | 275 |
| 467 | 3300010159 | Ga0099796_10056947 | Ga0099796_100569471 | 275 |
| 468 | 3300010375 | Ga0105239_10032525 | Ga0105239_100325251 | 275 |
| 469 | 3300010375 | Ga0105239_10772432 | Ga0105239_107724321 | 275 |
| 470 | 3300011119 | Ga0105246_10056054 | Ga0105246_100560542 | 275 |
| 471 | 3300013100 | Ga0157373_10000457 | Ga0157373_100004578 | 275 |
| 472 | 3300013105 | Ga0157369_10005377 | Ga0157369_100053775 | 275 |
| 473 | 3300013105 | Ga0157369_10092406 | Ga0157369_100924061 | 275 |
| 474 | 3300013297 | Ga0157378_10069886 | Ga0157378_100698863 | 275 |
| 475 | 3300013297 | Ga0157378_10094574 | Ga0157378_100945743 | 275 |
| 476 | 3300013306 | Ga0163162_10070826 | Ga0163162_100708263 | 275 |
| 477 | 3300013307 | Ga0157372_10024219 | Ga0157372_100242193 | 275 |
| 478 | 3300014326 | Ga0157380_10079992 | Ga0157380_100799923 | 275 |
| 479 | 3300014497 | Ga0182008_10046829 | Ga0182008_100468292 | 275 |
| 480 | 3300014968 | Ga0157379_10534292 | Ga0157379_105342922 | 275 |
| 481 | 3300017792 | Ga0163161_10191900 | Ga0163161_101919002 | 275 |
| 482 | 3300021384 | Ga0213876_10002708 | Ga0213876_100027087 | 275 |
| 483 | 3300021388 | Ga0213875_10000152 | Ga0213875_1000015253 | 275 |
| 484 | 3300021388 | Ga0213875_10007069 | Ga0213875_100070692 | 275 |
| 485 | 3300021388 | Ga0213875_10071533 | Ga0213875_100715332 | 275 |
| 486 | 3300021388 | Ga0213875_10118933 | Ga0213875_101189331 | 275 |
| 487 | 3300022467 | Ga0224712_10062806 | Ga0224712_100628061 | 275 |
| 488 | 3300025885 | Ga0207653_10012207 | Ga0207653_100122072 | 275 |
| 489 | 3300025898 | Ga0207692_10104611 | Ga0207692_101046111 | 275 |
| 490 | 3300025898 | Ga0207692_10203210 | Ga0207692_102032102 | 275 |
| 491 | 3300025903 | Ga0207680_10058046 | Ga0207680_100580462 | 275 |
| 492 | 3300025903 | Ga0207680_10312813 | Ga0207680_103128131 | 275 |
| 493 | 3300025906 | Ga0207699_10008581 | Ga0207699_100085814 | 275 |
| 494 | 3300025906 | Ga0207699_10033054 | Ga0207699_100330543 | 275 |
| 495 | 3300025907 | Ga0207645_10006681 | Ga0207645_100066814 | 275 |
| 496 | 3300025908 | Ga0207643_10001151 | Ga0207643_100011519 | 275 |
| 497 | 3300025910 | Ga0207684_10008211 | Ga0207684_1000821111 | 275 |
| 498 | 3300025910 | Ga0207684_10015297 | Ga0207684_100152973 | 275 |
| 499 | 3300025910 | Ga0207684_10016306 | Ga0207684_100163065 | 275 |
| 500 | 3300025910 | Ga0207684_10020113 | Ga0207684_100201136 | 275 |
| 501 | 3300025910 | Ga0207684_10030055 | Ga0207684_100300554 | 275 |
| 502 | 3300025910 | Ga0207684_10046446 | Ga0207684_100464462 | 275 |
| 503 | 3300025910 | Ga0207684_10338360 | Ga0207684_103383602 | 275 |
| 504 | 3300025910 | Ga0207684_10464587 | Ga0207684_104645871 | 275 |
| 505 | 3300025911 | Ga0207654_10026695 | Ga0207654_100266954 | 275 |
| 506 | 3300025912 | Ga0207707_10000158 | Ga0207707_1000015822 | 275 |
| 507 | 3300025912 | Ga0207707_10231471 | Ga0207707_102314711 | 275 |
| 508 | 3300025915 | Ga0207693_10014075 | Ga0207693_100140757 | 275 |
| 509 | 3300025915 | Ga0207693_10028525 | Ga0207693_100285254 | 275 |
| 510 | 3300025915 | Ga0207693_10107006 | Ga0207693_101070062 | 275 |
| 511 | 3300025916 | Ga0207663_10106012 | Ga0207663_101060122 | 275 |
| 512 | 3300025917 | Ga0207660_10000220 | Ga0207660_1000022030 | 275 |
| 513 | 3300025920 | Ga0207649_10058290 | Ga0207649_100582902 | 275 |
| 514 | 3300025921 | Ga0207652_10000290 | Ga0207652_1000029030 | 275 |
| 515 | 3300025921 | Ga0207652_10052275 | Ga0207652_100522752 | 275 |
| 516 | 3300025922 | Ga0207646_10023356 | Ga0207646_100233566 | 275 |
| 517 | 3300025922 | Ga0207646_10062141 | Ga0207646_100621412 | 275 |
| 518 | 3300025923 | Ga0207681_10079999 | Ga0207681_100799993 | 275 |
| 519 | 3300025923 | Ga0207681_10167084 | Ga0207681_101670842 | 275 |
| 520 | 3300025923 | Ga0207681_10215655 | Ga0207681_102156552 | 275 |
| 521 | 3300025925 | Ga0207650_10020548 | Ga0207650_100205483 | 275 |
| 522 | 3300025926 | Ga0207659_10049794 | Ga0207659_100497941 | 275 |
| 523 | 3300025928 | Ga0207700_10032949 | Ga0207700_100329493 | 275 |
| 524 | 3300025928 | Ga0207700_10063618 | Ga0207700_100636183 | 275 |
| 525 | 3300025928 | Ga0207700_10320485 | Ga0207700_103204852 | 275 |
| 526 | 3300025928 | Ga0207700_10436578 | Ga0207700_104365781 | 275 |
| 527 | 3300025929 | Ga0207664_10062701 | Ga0207664_100627013 | 275 |
| 528 | 3300025929 | Ga0207664_10273051 | Ga0207664_102730511 | 275 |
| 529 | 3300025931 | Ga0207644_10041322 | Ga0207644_100413222 | 275 |
| 530 | 3300025932 | Ga0207690_10001918 | Ga0207690_100019185 | 275 |
| 531 | 3300025933 | Ga0207706_10008340 | Ga0207706_100083404 | 275 |
| 532 | 3300025933 | Ga0207706_10068268 | Ga0207706_100682682 | 275 |
| 533 | 3300025936 | Ga0207670_10003369 | Ga0207670_100033695 | 275 |
| 534 | 3300025936 | Ga0207670_10338045 | Ga0207670_103380451 | 275 |
| 535 | 3300025937 | Ga0207669_10089703 | Ga0207669_100897032 | 275 |
| 536 | 3300025938 | Ga0207704_10433227 | Ga0207704_104332271 | 275 |
| 537 | 3300025939 | Ga0207665_10056133 | Ga0207665_100561332 | 275 |
| 538 | 3300025940 | Ga0207691_10013162 | Ga0207691_100131626 | 275 |
| 539 | 3300025940 | Ga0207691_10035866 | Ga0207691_100358663 | 275 |
| 540 | 3300025941 | Ga0207711_10232008 | Ga0207711_102320082 | 275 |
| 541 | 3300025942 | Ga0207689_10000277 | Ga0207689_1000027739 | 275 |
| 542 | 3300025942 | Ga0207689_10181365 | Ga0207689_101813651 | 275 |
| 543 | 3300025944 | Ga0207661_10293128 | Ga0207661_102931282 | 275 |
| 544 | 3300025945 | Ga0207679_10000820 | Ga0207679_1000082016 | 275 |
| 545 | 3300025949 | Ga0207667_10001638 | Ga0207667_100016389 | 275 |
| 546 | 3300025960 | Ga0207651_10186842 | Ga0207651_101868422 | 275 |
| 547 | 3300025961 | Ga0207712_10463820 | Ga0207712_104638202 | 275 |
| 548 | 3300025972 | Ga0207668_10146646 | Ga0207668_101466462 | 275 |
| 549 | 3300025981 | Ga0207640_10029885 | Ga0207640_100298854 | 275 |
| 550 | 3300026035 | Ga0207703_10017809 | Ga0207703_100178092 | 275 |
| 551 | 3300026041 | Ga0207639_10028956 | Ga0207639_100289562 | 275 |
| 552 | 3300026067 | Ga0207678_10031501 | Ga0207678_100315012 | 275 |
| 553 | 3300026078 | Ga0207702_10306424 | Ga0207702_103064242 | 275 |
| 554 | 3300026088 | Ga0207641_10080626 | Ga0207641_100806262 | 275 |
| 555 | 3300026089 | Ga0207648_10009469 | Ga0207648_100094696 | 275 |
| 556 | 3300026089 | Ga0207648_10095107 | Ga0207648_100951074 | 275 |
| 557 | 3300026095 | Ga0207676_10039226 | Ga0207676_100392265 | 275 |
| 558 | 3300026116 | Ga0207674_10022090 | Ga0207674_100220903 | 275 |
| 559 | 3300026118 | Ga0207675_100070214 | Ga0207675_1000702144 | 275 |
| 560 | 3300026121 | Ga0207683_10179420 | Ga0207683_101794202 | 275 |
| 561 | 3300026142 | Ga0207698_10706598 | Ga0207698_107065981 | 275 |
| 562 | 3300027512 | Ga0209179_1013621 | Ga0209179_10136212 | 275 |
| 563 | 3300027671 | Ga0209588_1004919 | Ga0209588_10049194 | 275 |
| 564 | 3300027907 | Ga0207428_10000239 | Ga0207428_1000023957 | 275 |
| 565 | 3300027907 | Ga0207428_10005083 | Ga0207428_100050836 | 275 |
| 566 | 3300027907 | Ga0207428_10023392 | Ga0207428_100233922 | 275 |
| 567 | 3300027907 | Ga0207428_10042288 | Ga0207428_100422883 | 275 |
| 568 | 3300027907 | Ga0207428_10238954 | Ga0207428_102389542 | 275 |
| 569 | 3300028380 | Ga0268265_10012301 | Ga0268265_100123012 | 275 |
| 570 | 3300028380 | Ga0268265_10191618 | Ga0268265_101916182 | 275 |
| 571 | 3300028556 | Ga0265337_1024465 | Ga0265337_10244651 | 275 |
| 572 | 3300028800 | Ga0265338_10076275 | Ga0265338_100762752 | 275 |
| 573 | 3300031852 | Ga0307410_10272828 | Ga0307410_102728282 | 275 |
| 574 | 3300031901 | Ga0307406_10241253 | Ga0307406_102412532 | 275 |
| 575 | 3300032002 | Ga0307416_100009526 | Ga0307416_1000095262 | 275 |
| 576 | 3300032002 | Ga0307416_100479814 | Ga0307416_1004798141 | 275 |
| 577 | 3300034816 | Ga0373930_0039796 | Ga0373930_0039796_73_906 | 275 |
| 578 | 3300034817 | Ga0373948_0018883 | Ga0373948_0018883_194_1036 | 275 |
| 579 | 3300035084 | Ga0373928_0013191 | Ga0373928_0013191_391_1233 | 275 |
| 580 | 3300035091 | Ga0373951_0014935 | Ga0373951_0014935_605_1447 | 275 |
| 581 | 3300035112 | Ga0373932_0031834 | Ga0373932_0031834_474_1310 | 275 |
| 582 | 3300035121 | Ga0373960_0005718 | Ga0373960_0005718_1842_2684 | 275 |
| 583 | 3300035170 | Ga0373943_0104521 | Ga0373943_0104521_122_973 | 275 |
| 584 | 3300035172 | Ga0373955_0027841 | Ga0373955_0027841_2016_2867 | 275 |
| 585 | 3300035172 | Ga0373955_0048691 | Ga0373955_0048691_347_1198 | 275 |
| 586 | 3300035242 | Ga0373962_0076125 | Ga0373962_0076125_90_926 | 275 |
| 587 | 3300035410 | Ga0373924_0015082 | Ga0373924_0015082_1330_2181 | 275 |
| 588 | 3300035691 | Ga0373931_0030071 | Ga0373931_0030071_947_1789 | 275 |
| 589 | 3300035692 | Ga0373935_0042106 | Ga0373935_0042106_1571_2422 | 275 |
| 590 | 3300035692 | Ga0373935_0358332 | Ga0373935_0358332_50_904 | 275 |
| 591 | 3300035724 | Ga0373933_0007224 | Ga0373933_0007224_2741_3592 | 275 |
| 592 | 3300035724 | Ga0373933_0183498 | Ga0373933_0183498_277_1134 | 275 |
| 593 | 3300036401 | Ga0373937_0014749 | Ga0373937_0014749_2356_3213 | 275 |
| 594 | 3300036401 | Ga0373937_0023034 | Ga0373937_0023034_438_1289 | 275 |
| 595 | 3300036401 | Ga0373937_0032893 | Ga0373937_0032893_423_1274 | 275 |
| 596 | 3300036401 | Ga0373937_0384630 | Ga0373937_0384630_320_1174 | 275 |
| 597 | 3300037068 | Ga0373925_0113004 | Ga0373925_0113004_247_1098 | 275 |
| 598 | 3300037312 | Ga0395899_0009538 | Ga0395899_0009538_1659_2489 | 275 |
| 599 | 3300037418 | Ga0395900_0013526 | Ga0395900_0013526_6875_7705 | 275 |
| 600 | 3300037853 | Ga0436364_0660746 | Ga0436364_0660746_164_1003 | 275 |
| 601 | 3300037853 | Ga0436364_0793378 | Ga0436364_0793378_1038_1958 | 275 |
| 602 | 3300037853 | Ga0436364_0883536 | Ga0436364_0883536_53672_54526 | 275 |
| 603 | 3300037853 | Ga0436364_1013423 | Ga0436364_1013423_28258_29115 | 275 |
| 604 | 3300037853 | Ga0436364_1072565 | Ga0436364_1072565_5352_6209 | 275 |
| 605 | 3300037853 | Ga0436364_1226760 | Ga0436364_1226760_9473_10303 | 275 |
| 606 | 3300038443 | Ga0395901_0003070 | Ga0395901_0003070_5007_5837 | 275 |
| 607 | 3300039437 | Ga0436365_0036618 | Ga0436365_0036618_2731_3588 | 275 |
| 608 | 3300039437 | Ga0436365_0158096 | Ga0436365_0158096_76_909 | 275 |
| 609 | 3300039437 | Ga0436365_0469579 | Ga0436365_0469579_3559_4434 | 275 |
| 610 | 3300039437 | Ga0436365_1088548 | Ga0436365_1088548_257_1096 | 275 |
| 611 | 3300039437 | Ga0436365_1692579 | Ga0436365_1692579_3259_4089 | 275 |
| 612 | 3300039438 | Ga0436360_0063921 | Ga0436360_0063921_26_883 | 275 |
| 613 | 3300039438 | Ga0436360_0301600 | Ga0436360_0301600_735_1589 | 275 |
| 614 | 3300039438 | Ga0436360_0416464 | Ga0436360_0416464_709_1545 | 275 |
| 615 | 3300039447 | Ga0436361_0156140 | Ga0436361_0156140_23_853 | 275 |
| 616 | 3300039450 | Ga0436363_0127255 | Ga0436363_0127255_1259_2116 | 275 |
| 617 | 3300039450 | Ga0436363_0845692 | Ga0436363_0845692_1772_2626 | 275 |
| 618 | 3300039453 | Ga0436362_0329835 | Ga0436362_0329835_128_964 | 275 |
| 619 | 3300042001 | Ga0439441_013384 | Ga0439441_013384_261_1100 | 275 |
| 620 | 3300042005 | Ga0439448_0004515 | Ga0439448_0004515_1849_2691 | 275 |
| 621 | 3300042876 | Ga0451577_0004128 | Ga0451577_0004128_14405_15247 | 275 |
| 622 | 3300042876 | Ga0451577_0011112 | Ga0451577_0011112_4914_5744 | 275 |
| 623 | 3300044673 | Ga0453683_0022559 | Ga0453683_0022559_1642_2472 | 275 |
| 624 | 3300044673 | Ga0453683_0086763 | Ga0453683_0086763_139_993 | 275 |
| 625 | 3300044673 | Ga0453683_0214742 | Ga0453683_0214742_92_925 | 275 |
| 626 | 3300044694 | Ga0466963_0076198 | Ga0466963_0076198_329_1186 | 275 |
| 627 | 3300044712 | Ga0453684_0079456 | Ga0453684_0079456_2676_3506 | 275 |
| 628 | 3300044712 | Ga0453684_0114765 | Ga0453684_0114765_1178_2020 | 275 |
| 629 | 3300045051 | Ga0451576_0029646 | Ga0451576_0029646_3254_4084 | 275 |
| 630 | 3300045051 | Ga0451576_0051373 | Ga0451576_0051373_1502_2332 | 275 |
| 631 | 3300045976 | Ga0466967_0480637 | Ga0466967_0480637_182_1051 | 275 |
| 632 | 3300046454 | Ga0495592_0052033 | Ga0495592_0052033_195_1046 | 275 |
| 633 | 3300046454 | Ga0495592_0133588 | Ga0495592_0133588_373_1224 | 275 |
| 634 | 3300046462 | Ga0495651_0020223 | Ga0495651_0020223_48_899 | 275 |
| 635 | 3300046462 | Ga0495651_0042141 | Ga0495651_0042141_2005_2856 | 275 |
| 636 | 3300046472 | Ga0495580_0002075 | Ga0495580_0002075_7955_8791 | 275 |
| 637 | 3300046476 | Ga0495662_0037066 | Ga0495662_0037066_882_1736 | 275 |
| 638 | 3300046477 | Ga0495664_0005183 | Ga0495664_0005183_847_1698 | 275 |
| 639 | 3300046511 | Ga0495608_0028486 | Ga0495608_0028486_2159_3010 | 275 |
| 640 | 3300046511 | Ga0495608_0116991 | Ga0495608_0116991_73_924 | 275 |
| 641 | 3300046514 | Ga0495618_0024655 | Ga0495618_0024655_1338_2189 | 275 |
| 642 | 3300046516 | Ga0495628_0162829 | Ga0495628_0162829_583_1437 | 275 |
| 643 | 3300046529 | Ga0495652_0171837 | Ga0495652_0171837_345_1196 | 275 |
| 644 | 3300046533 | Ga0495640_0103390 | Ga0495640_0103390_50_901 | 275 |
| 645 | 3300046535 | Ga0495586_0048986 | Ga0495586_0048986_337_1191 | 275 |
| 646 | 3300046536 | Ga0495587_0028607 | Ga0495587_0028607_2158_3009 | 275 |
| 647 | 3300046543 | Ga0495645_0001188 | Ga0495645_0001188_15578_16429 | 275 |
| 648 | 3300046559 | Ga0495667_0010033 | Ga0495667_0010033_2093_2944 | 275 |
| 649 | 3300046559 | Ga0495667_0165579 | Ga0495667_0165579_357_1211 | 275 |
| 650 | 3300046615 | Ga0495656_0021249 | Ga0495656_0021249_447_1280 | 275 |
| 651 | 3300046678 | Ga0495599_0021975 | Ga0495599_0021975_1443_2294 | 275 |
| 652 | 3300046680 | Ga0495646_0009838 | Ga0495646_0009838_2927_3778 | 275 |
| 653 | 3300046809 | Ga0495600_0049089 | Ga0495600_0049089_269_1120 | 275 |
| 654 | 3300047315 | Ga0495581_0188545 | Ga0495581_0188545_311_1162 | 275 |
| 655 | 3300047317 | Ga0495604_0069906 | Ga0495604_0069906_1382_2233 | 275 |
| 656 | 3300047317 | Ga0495604_0265967 | Ga0495604_0265967_226_1077 | 275 |
| 657 | 3300047318 | Ga0495636_0055524 | Ga0495636_0055524_135_971 | 275 |
| 658 | 3300047319 | Ga0495674_0153319 | Ga0495674_0153319_274_1125 | 275 |
| 659 | 3300047322 | Ga0495680_0016744 | Ga0495680_0016744_3736_4590 | 275 |
| 660 | 3300047322 | Ga0495680_0030134 | Ga0495680_0030134_1664_2515 | 275 |
| 661 | 3300047444 | Ga0495675_0001602 | Ga0495675_0001602_1385_2236 | 275 |
| 662 | 3300048088 | Ga0495602_0000230 | Ga0495602_0000230_423_1274 | 275 |
| 663 | 3300048088 | Ga0495602_0032285 | Ga0495602_0032285_4064_4915 | 275 |
| 664 | 3300048905 | Ga0496102_0104125 | Ga0496102_0104125_1214_2056 | 275 |
| 665 | 3300048906 | Ga0496103_0231975 | Ga0496103_0231975_280_1122 | 275 |
| 666 | 3300048911 | Ga0496108_0169510 | Ga0496108_0169510_1018_1860 | 275 |
| 667 | 3300048915 | Ga0496112_0122769 | Ga0496112_0122769_175_1017 | 275 |
| 668 | 3300048929 | Ga0496126_0155996 | Ga0496126_0155996_335_1174 | 275 |
| 669 | 3300049570 | Ga0501033_0037843 | Ga0501033_0037843_2448_3281 | 275 |
| 670 | 3300049570 | Ga0501033_0178748 | Ga0501033_0178748_405_1235 | 275 |
| 671 | 3300049572 | Ga0501036_0033040 | Ga0501036_0033040_2244_3077 | 275 |
| 672 | 3300049572 | Ga0501036_0219365 | Ga0501036_0219365_318_1148 | 275 |
| 673 | 3300049575 | Ga0501039_0266981 | Ga0501039_0266981_113_946 | 275 |
| 674 | 3300049576 | Ga0501040_0007257 | Ga0501040_0007257_2843_3679 | 275 |
| 675 | 3300049577 | Ga0501041_0004421 | Ga0501041_0004421_4352_5185 | 275 |
| 676 | 3300049577 | Ga0501041_0172113 | Ga0501041_0172113_11_859 | 275 |
| 677 | 3300049578 | Ga0501042_0120251 | Ga0501042_0120251_220_1053 | 275 |
| 678 | 3300049579 | Ga0501043_0081308 | Ga0501043_0081308_1184_2035 | 275 |
| 679 | 3300049582 | Ga0501048_0286847 | Ga0501048_0286847_251_1081 | 275 |
| 680 | 3300049586 | Ga0501070_0451272 | Ga0501070_0451272_139_999 | 275 |
| 681 | 3300049588 | Ga0501072_0042515 | Ga0501072_0042515_571_1404 | 275 |
| 682 | 3300049588 | Ga0501072_0177125 | Ga0501072_0177125_109_939 | 275 |
| 683 | 3300049588 | Ga0501072_0328160 | Ga0501072_0328160_47_898 | 275 |
| 684 | 3300049589 | Ga0501073_0175977 | Ga0501073_0175977_411_1259 | 275 |
| 685 | 3300049591 | Ga0501075_0011788 | Ga0501075_0011788_269_1102 | 275 |
| 686 | 3300049591 | Ga0501075_0124539 | Ga0501075_0124539_847_1698 | 275 |
| 687 | 3300049591 | Ga0501075_0145704 | Ga0501075_0145704_903_1736 | 275 |
| 688 | 3300049591 | Ga0501075_0146669 | Ga0501075_0146669_712_1542 | 275 |
| 689 | 3300049591 | Ga0501075_0277999 | Ga0501075_0277999_172_1008 | 275 |
| 690 | 3300049592 | Ga0501076_0002469 | Ga0501076_0002469_2683_3516 | 275 |
| 691 | 3300049593 | Ga0501077_0012786 | Ga0501077_0012786_817_1647 | 275 |
| 692 | 3300049741 | Ga0501079_0005268 | Ga0501079_0005268_1606_2436 | 275 |
| 693 | 3300049741 | Ga0501079_0027102 | Ga0501079_0027102_1634_2467 | 275 |
| 694 | 3300049741 | Ga0501079_0500457 | Ga0501079_0500457_35_871 | 275 |
| 695 | 3300049742 | Ga0501080_0015063 | Ga0501080_0015063_3329_4159 | 275 |
| 696 | 3300049742 | Ga0501080_0628070 | Ga0501080_0628070_42_926 | 275 |
| 697 | 3300049743 | Ga0501081_0002648 | Ga0501081_0002648_5242_6072 | 275 |
| 698 | 3300049743 | Ga0501081_0056081 | Ga0501081_0056081_233_1066 | 275 |
| 699 | 3300049744 | Ga0501083_0141644 | Ga0501083_0141644_721_1554 | 275 |
| 700 | 3300050507 | nmdc:mga05p37_1308_c1 | nmdc:mga05p37_1308_c1_3588_4418 | 275 |
| 701 | 3300050507 | nmdc:mga05p37_13403_c1 | nmdc:mga05p37_13403_c1_2844_3692 | 275 |
| 702 | 3300050507 | nmdc:mga05p37_216892_c1 | nmdc:mga05p37_216892_c1_409_1239 | 275 |
| 703 | 3300050507 | nmdc:mga05p37_221896_c1 | nmdc:mga05p37_221896_c1_1367_2197 | 275 |
| 704 | 3300050507 | nmdc:mga05p37_2288_c1 | nmdc:mga05p37_2288_c1_9614_10444 | 275 |
| 705 | 3300050507 | nmdc:mga05p37_292966_c1 | nmdc:mga05p37_292966_c1_357_1208 | 275 |
| 706 | 3300050507 | nmdc:mga05p37_50288_c1 | nmdc:mga05p37_50288_c1_1567_2403 | 275 |
| 707 | 3300050507 | nmdc:mga05p37_72351_c1 | nmdc:mga05p37_72351_c1_1646_2488 | 275 |
| 708 | 3300050507 | nmdc:mga05p37_78184_c1 | nmdc:mga05p37_78184_c1_2442_3275 | 275 |
| 709 | 3300050507 | nmdc:mga05p37_88888_c1 | nmdc:mga05p37_88888_c1_1772_2602 | 275 |
| 710 | 3300050508 | nmdc:mga09592_134194_c1 | nmdc:mga09592_134194_c1_907_1737 | 275 |
| 711 | 3300050508 | nmdc:mga09592_1983_c1 | nmdc:mga09592_1983_c1_4634_5464 | 275 |
| 712 | 3300050508 | nmdc:mga09592_27471_c1 | nmdc:mga09592_27471_c1_2141_3031 | 275 |
| 713 | 3300050508 | nmdc:mga09592_3499_c1 | nmdc:mga09592_3499_c1_2586_3416 | 275 |
| 714 | 3300050508 | nmdc:mga09592_376374_c1 | nmdc:mga09592_376374_c1_361_1188 | 275 |
| 715 | 3300050508 | nmdc:mga09592_45322_c1 | nmdc:mga09592_45322_c1_1504_2352 | 275 |
| 716 | 3300050508 | nmdc:mga09592_49664_c1 | nmdc:mga09592_49664_c1_618_1445 | 275 |
| 717 | 3300050508 | nmdc:mga09592_9421_c1 | nmdc:mga09592_9421_c1_3242_4075 | 275 |
| 718 | 3300050508 | nmdc:mga09592_991_c1 | nmdc:mga09592_991_c1_14840_15691 | 275 |
| 719 | 3300050509 | nmdc:mga0qj67_141_c1 | nmdc:mga0qj67_141_c1_22711_23541 | 275 |
| 720 | 3300050509 | nmdc:mga0qj67_6609_c1 | nmdc:mga0qj67_6609_c1_6381_7229 | 275 |
| 721 | 3300050510 | nmdc:mga06r32_11284_c1 | nmdc:mga06r32_11284_c1_5508_6338 | 275 |
| 722 | 3300050510 | nmdc:mga06r32_1408_c1 | nmdc:mga06r32_1408_c1_16291_17121 | 275 |
| 723 | 3300050510 | nmdc:mga06r32_18996_c1 | nmdc:mga06r32_18996_c1_4969_5817 | 275 |
| 724 | 3300050510 | nmdc:mga06r32_226169_c1 | nmdc:mga06r32_226169_c1_725_1591 | 275 |
| 725 | 3300050510 | nmdc:mga06r32_238933_c1 | nmdc:mga06r32_238933_c1_688_1599 | 275 |
| 726 | 3300050510 | nmdc:mga06r32_268_c1 | nmdc:mga06r32_268_c1_24532_25362 | 275 |
| 727 | 3300050510 | nmdc:mga06r32_47927_c1 | nmdc:mga06r32_47927_c1_3211_4059 | 275 |
| 728 | 3300050510 | nmdc:mga06r32_573765_c1 | nmdc:mga06r32_573765_c1_178_1005 | 275 |
| 729 | 3300050511 | nmdc:mga08y16_194012_c1 | nmdc:mga08y16_194012_c1_69_899 | 275 |
| 730 | 3300050511 | nmdc:mga08y16_40638_c1 | nmdc:mga08y16_40638_c1_1838_2677 | 275 |
| 731 | 3300050511 | nmdc:mga08y16_54366_c1 | nmdc:mga08y16_54366_c1_1538_2380 | 275 |
| 732 | 3300050511 | nmdc:mga08y16_5571_c1 | nmdc:mga08y16_5571_c1_9091_9924 | 275 |
| 733 | 3300050511 | nmdc:mga08y16_7748_c1 | nmdc:mga08y16_7748_c1_8332_9165 | 275 |
| 734 | 3300050511 | nmdc:mga08y16_7784_c1 | nmdc:mga08y16_7784_c1_4914_5744 | 275 |
| 735 | 3300050512 | nmdc:mga0n895_117104_c1 | nmdc:mga0n895_117104_c1_1714_2568 | 275 |
| 736 | 3300050512 | nmdc:mga0n895_21898_c1 | nmdc:mga0n895_21898_c1_180_1010 | 275 |
| 737 | 3300050512 | nmdc:mga0n895_251457_c1 | nmdc:mga0n895_251457_c1_207_1061 | 275 |
| 738 | 3300050512 | nmdc:mga0n895_285413_c1 | nmdc:mga0n895_285413_c1_357_1208 | 275 |
| 739 | 3300050512 | nmdc:mga0n895_3955_c1 | nmdc:mga0n895_3955_c1_7938_8768 | 275 |
| 740 | 3300050512 | nmdc:mga0n895_415170_c1 | nmdc:mga0n895_415170_c1_143_988 | 275 |
| 741 | 3300050512 | nmdc:mga0n895_4479_c1 | nmdc:mga0n895_4479_c1_2534_3370 | 275 |
| 742 | 3300050512 | nmdc:mga0n895_52283_c1 | nmdc:mga0n895_52283_c1_496_1326 | 275 |
| 743 | 3300050512 | nmdc:mga0n895_826_c1 | nmdc:mga0n895_826_c1_20984_21820 | 275 |
| 744 | 3300050513 | nmdc:mga0rr50_11081_c1 | nmdc:mga0rr50_11081_c1_4258_5109 | 275 |
| 745 | 3300050513 | nmdc:mga0rr50_18674_c1 | nmdc:mga0rr50_18674_c1_37_891 | 275 |
| 746 | 3300050513 | nmdc:mga0rr50_21882_c1 | nmdc:mga0rr50_21882_c1_2071_3018 | 275 |
| 747 | 3300050513 | nmdc:mga0rr50_309872_c1 | nmdc:mga0rr50_309872_c1_37_867 | 275 |
| 748 | 3300050513 | nmdc:mga0rr50_37300_c1 | nmdc:mga0rr50_37300_c1_1981_2811 | 275 |
| 749 | 3300050513 | nmdc:mga0rr50_506534_c1 | nmdc:mga0rr50_506534_c1_45_890 | 275 |
| 750 | 3300050513 | nmdc:mga0rr50_6133_c1 | nmdc:mga0rr50_6133_c1_6184_7020 | 275 |
| 751 | 3300050513 | nmdc:mga0rr50_82534_c1 | nmdc:mga0rr50_82534_c1_1560_2390 | 275 |
| 752 | 3300050514 | nmdc:mga08x19_212600_c1 | nmdc:mga08x19_212600_c1_291_1121 | 275 |
| 753 | 3300050514 | nmdc:mga08x19_26225_c1 | nmdc:mga08x19_26225_c1_2255_3109 | 275 |
| 754 | 3300050514 | nmdc:mga08x19_2837_c1 | nmdc:mga08x19_2837_c1_7417_8364 | 275 |
| 755 | 3300050514 | nmdc:mga08x19_42291_c1 | nmdc:mga08x19_42291_c1_1542_2384 | 275 |
| 756 | 3300050514 | nmdc:mga08x19_4910_c1 | nmdc:mga08x19_4910_c1_4530_5366 | 275 |
| 757 | 3300050514 | nmdc:mga08x19_69414_c1 | nmdc:mga08x19_69414_c1_83_913 | 275 |
| 758 | 3300050515 | nmdc:mga0a205_104897_c1 | nmdc:mga0a205_104897_c1_1459_2313 | 275 |
| 759 | 3300050515 | nmdc:mga0a205_12814_c1 | nmdc:mga0a205_12814_c1_4276_5106 | 275 |
| 760 | 3300050515 | nmdc:mga0a205_13391_c1 | nmdc:mga0a205_13391_c1_4832_5668 | 275 |
| 761 | 3300050515 | nmdc:mga0a205_149018_c1 | nmdc:mga0a205_149018_c1_266_1096 | 275 |
| 762 | 3300050515 | nmdc:mga0a205_25809_c1 | nmdc:mga0a205_25809_c1_4274_5104 | 275 |
| 763 | 3300050515 | nmdc:mga0a205_26719_c1 | nmdc:mga0a205_26719_c1_885_1727 | 275 |
| 764 | 3300050515 | nmdc:mga0a205_295091_c1 | nmdc:mga0a205_295091_c1_77_907 | 275 |
| 765 | 3300050515 | nmdc:mga0a205_3041_c2 | nmdc:mga0a205_3041_c2_1065_1895 | 275 |
| 766 | 3300050515 | nmdc:mga0a205_33777_c1 | nmdc:mga0a205_33777_c1_2682_3533 | 275 |
| 767 | 3300050515 | nmdc:mga0a205_5169_c1 | nmdc:mga0a205_5169_c1_3155_4102 | 275 |
| 768 | 3300050515 | nmdc:mga0a205_99302_c1 | nmdc:mga0a205_99302_c1_470_1297 | 275 |
| 769 | 3300053077 | Ga0495601_0001753 | Ga0495601_0001753_906_1757 | 275 |
| 770 | 3300053077 | Ga0495601_0171110 | Ga0495601_0171110_27_878 | 275 |
| 771 | 3300053078 | Ga0495612_0002063 | Ga0495612_0002063_2166_3017 | 275 |
| 772 | 3300053078 | Ga0495612_0112150 | Ga0495612_0112150_274_1125 | 275 |
| 773 | 3300053084 | Ga0495595_0108173 | Ga0495595_0108173_184_1035 | 275 |
| 774 | 3300053085 | Ga0495619_0237310 | Ga0495619_0237310_252_1106 | 275 |
| 775 | 3300054114 | Ga0501084_0013355 | Ga0501084_0013355_1128_1958 | 275 |
| 776 | 3300054114 | Ga0501084_0070061 | Ga0501084_0070061_1419_2252 | 275 |
| 777 | 3300054114 | Ga0501084_0109146 | Ga0501084_0109146_455_1306 | 275 |
| 778 | 3300054114 | Ga0501084_0190645 | Ga0501084_0190645_694_1527 | 275 |
| 779 | 3300060353 | Ga0501082_0000691 | Ga0501082_0000691_1995_2828 | 275 |
| 780 | 3300060353 | Ga0501082_0009737 | Ga0501082_0009737_3338_4168 | 275 |
| 781 | 3300060353 | Ga0501082_0088907 | Ga0501082_0088907_881_1714 | 275 |
| 782 | 3300060353 | Ga0501082_0261744 | Ga0501082_0261744_291_1142 | 275 |
| 783 | 3300061734 | Ga0530510_0002570 | Ga0530510_0002570_287_1120 | 275 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6d3j-assembly1.cif.gz_A | ft_t dioxygenase holoenzyme | 0.9486 | 2 | 272 |
| 7qtf-assembly1.cif.gz_B | crystal structure of the fe(ii)/alpha-ketoglutarate dependent dioxygenase plao1 in complex with sodium succinate | 0.94 | 2 | 272 |
| 7qtf-assembly1.cif.gz_A | crystal structure of the fe(ii)/alpha-ketoglutarate dependent dioxygenase plao1 in complex with sodium succinate | 0.9383 | 3 | 272 |
| 1oij-assembly4.cif.gz_D | crystal structure of the alkylsulfatase atsk, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with alphaketoglutarate | 0.9369 | 1 | 275 |
| 7qtg-assembly1.cif.gz_B-2 | crystal structure of the fe(ii)/alpha-ketoglutarate dependent dioxygenase plao1 | 0.935 | 3 | 272 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5hsxA00 | Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like | 0.9155 | 1 | 275 | 3.60.130.10 |
| 1vz4D00 | Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like | 0.9074 | 1 | 275 | 3.60.130.10 |
| 5j92B00 | Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like | 0.897 | 1 | 272 | 3.60.130.10 |
| 6d0oA00 | Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like | 0.8906 | 2 | 275 | 3.60.130.10 |
| 1gqwB00 | Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like | 0.8882 | 1 | 272 | 3.60.130.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257PAL0-F1-model_v4 | TauD/TfdA-like domain-containing protein | 0.9802 | 1 | 274 |
GO:0000908
GO:0005737 GO:0006790 |
| AF-A0A257PAL0-F1-model_v4 | TauD/TfdA-like domain-containing protein | 0.9731 | 1 | 274 |
GO:0000908
GO:0005737 GO:0006790 |
| AF-A0A6J6HQC8-F1-model_v4 | Unannotated protein | 0.942 | 1 | 272 |
GO:0005737
GO:0016706 |
| AF-A0A6A7KRT8-F1-model_v4 | TauD/TfdA family dioxygenase | 0.9364 | 1 | 275 |
GO:0000908
GO:0005737 GO:0006790 |
| AF-A0A537Z8W6-F1-model_v4 | Taurine dioxygenase | 0.9347 | 1 | 274 |
GO:0005737
GO:0016706 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar