F480655

General Info

Members Datasets Scaffolds Average Seq Length
783 323 783 279

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10015030|Ga0099795_100150302
Length 327
Sequence MISSPIVAARLAGSAHGNYRDSQFDMALSAGGPFRRYYRKERSMVDIRRMGPQIGVEVTGVDVKTLDDAGFAPIYQAWLDCNILVVRDQQLEIKDFLRYSRRFGPVIPHPSKSTRHPEIPEITMLGINKFDADGKINNAIYRRGAEGWHTDGAYNQAPFKATQLYALAIPSRGGDTLFANGYAAYDALPERLKRRLDGVKGAFAYGGRRGGSQLLDKEDQDWKPVFHPIIRTHPETGRKSLYFDPGKIVYIVGADQKESDALIAELKGYMIQPDAEYRHKWRKGDIVIWDNRCSYHKAAGDYPPEEDRIHWRVSINDYGVEALAAAE

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
194 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
195 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
196 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
197 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
198 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
199 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
204 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
205 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
206 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
207 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
208 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
209 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
210 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
213 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
218 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
227 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
228 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
229 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
230 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
231 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
232 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
233 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
234 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
235 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
236 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
237 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
243 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
244 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
245 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
246 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
249 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
250 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
251 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
252 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
253 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
256 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
257 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
258 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
259 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
260 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
261 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
262 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
265 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
266 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
267 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
268 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
269 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
270 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
281 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
296 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
297 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
298 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
299 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
300 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
301 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
302 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
303 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
306 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
307 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
308 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
309 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
310 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
311 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
312 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
313 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
314 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
315 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
316 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
317 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
318 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
319 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
320 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
321 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
322 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
323 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.92
Rhizosphere 94.89
Stem 0
Stem Tuber 0
Unclassified 3.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10005914 3300003203 Bacteria 5661
2 Ga0070658_10051305 3300005327 Bacteria 3344
3 Ga0070676_10064433 3300005328 Bacteria 2185
4 Ga0070690_100010677 3300005330 Bacteria 5352
5 Ga0070690_100275106 3300005330 Unclassified 1199
6 Ga0070690_100459037 3300005330 Bacteria 946
7 Ga0070670_100004356 3300005331 Bacteria 11843
8 Ga0070670_100062981 3300005331 Bacteria 3183
9 Ga0070677_10010018 3300005333 Bacteria 3228
10 Ga0068869_100001903 3300005334 Bacteria 12551
11 Ga0068869_100466183 3300005334 Bacteria 1049
12 Ga0070666_10058323 3300005335 Bacteria 2610
13 Ga0070666_10099455 3300005335 Bacteria 2003
14 Ga0070666_10225728 3300005335 Unclassified 1322
15 Ga0070666_10373623 3300005335 Bacteria 1023
16 Ga0070680_100002663 3300005336 Bacteria 13234
17 Ga0070682_100005961 3300005337 Bacteria 6822
18 Ga0068868_100051865 3300005338 Bacteria 3229
19 Ga0068868_100332802 3300005338 Bacteria 1296
20 Ga0070660_100000640 3300005339 Bacteria 23213
21 Ga0070689_100011348 3300005340 Bacteria 6380
22 Ga0070689_100267039 3300005340 Bacteria 1415
23 Ga0070692_10048151 3300005345 Bacteria 2207
24 Ga0070668_100018225 3300005347 Bacteria 5267
25 Ga0070669_100020459 3300005353 Bacteria 4726
26 Ga0070669_100042300 3300005353 Bacteria 3315
27 Ga0070669_100059128 3300005353 Bacteria 2814
28 Ga0070669_100155477 3300005353 Bacteria 1773
29 Ga0070669_100291805 3300005353 Bacteria 1309
30 Ga0070675_100032040 3300005354 Bacteria 4252
31 Ga0070675_100075714 3300005354 Bacteria 2798
32 Ga0070671_100098960 3300005355 Bacteria 2446
33 Ga0070674_100043915 3300005356 Bacteria 3043
34 Ga0070674_100125540 3300005356 Bacteria 1905
35 Ga0070673_100084444 3300005364 Bacteria 2582
36 Ga0070673_100097873 3300005364 Bacteria 2410
37 Ga0070688_100026974 3300005365 Bacteria 3418
38 Ga0070659_100004266 3300005366 Bacteria 10205
39 Ga0070667_100337323 3300005367 Bacteria 1363
40 Ga0070667_100372727 3300005367 Bacteria 1295
41 Ga0070709_10257894 3300005434 Bacteria 1258
42 Ga0070714_100032868 3300005435 Bacteria 4333
43 Ga0070714_100089109 3300005435 Bacteria 2700
44 Ga0070714_100413839 3300005435 Unclassified 1276
45 Ga0070713_100019223 3300005436 Bacteria 5210
46 Ga0070713_100055242 3300005436 Bacteria 3299
47 Ga0070713_100089786 3300005436 Bacteria 2640
48 Ga0070713_100398598 3300005436 Bacteria 1285
49 Ga0070710_10024515 3300005437 Bacteria 3183
50 Ga0070710_10272451 3300005437 Bacteria 1095
51 Ga0070701_10016634 3300005438 Bacteria 3424
52 Ga0070701_10026266 3300005438 Bacteria 2838
53 Ga0070705_100001700 3300005440 Bacteria 11474
54 Ga0070705_100082834 3300005440 Bacteria 1975
55 Ga0070694_100002292 3300005444 Bacteria 11323
56 Ga0070694_100045828 3300005444 Bacteria 2932
57 Ga0070694_100104772 3300005444 Bacteria 2006
58 Ga0070694_100164966 3300005444 Bacteria 1628
59 Ga0070708_100004836 3300005445 Bacteria 10627
60 Ga0070708_100042642 3300005445 Bacteria 3984
61 Ga0070708_100043416 3300005445 Bacteria 3950
62 Ga0070708_100108359 3300005445 Bacteria 2551
63 Ga0070708_100117321 3300005445 Bacteria 2451
64 Ga0070663_100007247 3300005455 Bacteria 6740
65 Ga0070678_100073447 3300005456 Bacteria 2567
66 Ga0070662_100002555 3300005457 Bacteria 11205
67 Ga0070662_100020262 3300005457 Bacteria 4526
68 Ga0070681_10038418 3300005458 Bacteria 4799
69 Ga0070681_10170393 3300005458 Bacteria 2099
70 Ga0070681_10341027 3300005458 Bacteria 1408
71 Ga0068867_100013214 3300005459 Bacteria 5848
72 Ga0068867_100133964 3300005459 Bacteria 1929
73 Ga0070685_10134825 3300005466 Bacteria 1548
74 Ga0070706_100028326 3300005467 Bacteria 5157
75 Ga0070706_100035276 3300005467 Bacteria 4620
76 Ga0070706_100405927 3300005467 Bacteria 1268
77 Ga0070706_100497470 3300005467 Bacteria 1134
78 Ga0070707_100018737 3300005468 Bacteria 6516
79 Ga0070707_100029238 3300005468 Bacteria 5247
80 Ga0070707_100031685 3300005468 Bacteria 5037
81 Ga0070707_100033692 3300005468 Bacteria 4884
82 Ga0070707_100228442 3300005468 Bacteria 1812
83 Ga0070707_100396853 3300005468 Bacteria 1339
84 Ga0070698_100002771 3300005471 Bacteria 19277
85 Ga0070698_100010750 3300005471 Bacteria 9740
86 Ga0070698_100066274 3300005471 Bacteria 3635
87 Ga0070698_100319063 3300005471 Bacteria 1484
88 Ga0070699_100001298 3300005518 Bacteria 23074
89 Ga0070699_100005810 3300005518 Bacteria 10793
90 Ga0070699_100079176 3300005518 Bacteria 2862
91 Ga0070699_100086970 3300005518 Bacteria 2728
92 Ga0070699_100087282 3300005518 Bacteria 2723
93 Ga0070699_100196457 3300005518 Bacteria 1793
94 Ga0070699_100222187 3300005518 Bacteria 1683
95 Ga0070699_100308771 3300005518 Bacteria 1420
96 Ga0070699_100523005 3300005518 Bacteria 1079
97 Ga0070679_100002921 3300005530 Bacteria 15546
98 Ga0070679_100201853 3300005530 Bacteria 1954
99 Ga0070679_100281326 3300005530 Bacteria 1616
100 Ga0070684_100139178 3300005535 Bacteria 2194
101 Ga0070697_100044718 3300005536 Bacteria 3587
102 Ga0070697_100074319 3300005536 Bacteria 2792
103 Ga0070697_100091218 3300005536 Bacteria 2519
104 Ga0070697_100131637 3300005536 Bacteria 2098
105 Ga0068853_100023398 3300005539 Bacteria 5171
106 Ga0070672_100014156 3300005543 Bacteria 5645
107 Ga0070672_100077635 3300005543 Bacteria 2656
108 Ga0070686_100118364 3300005544 Bacteria 1815
109 Ga0070695_100005791 3300005545 Bacteria 7283
110 Ga0070695_100008322 3300005545 Bacteria 6154
111 Ga0070695_100114809 3300005545 Bacteria 1834
112 Ga0070695_100157100 3300005545 Bacteria 1593
113 Ga0070695_100215593 3300005545 Bacteria 1380
114 Ga0070696_100002170 3300005546 Bacteria 12930
115 Ga0070696_100036674 3300005546 Bacteria 3381
116 Ga0070696_100598705 3300005546 Bacteria 888
117 Ga0070693_100000283 3300005547 Bacteria 23822
118 Ga0070693_100428098 3300005547 Bacteria 924
119 Ga0070665_100509302 3300005548 Unclassified 1215
120 Ga0070704_100193532 3300005549 Bacteria 1636
121 Ga0070704_100203833 3300005549 Bacteria 1598
122 Ga0070704_100231572 3300005549 Bacteria 1507
123 Ga0070704_100291594 3300005549 Bacteria 1356
124 Ga0068855_100008748 3300005563 Bacteria 12241
125 Ga0068857_100539293 3300005577 Bacteria 1098
126 Ga0068854_100000849 3300005578 Bacteria 18284
127 Ga0068856_100015440 3300005614 Bacteria 7380
128 Ga0068856_100155490 3300005614 Bacteria 2297
129 Ga0068856_100369559 3300005614 Unclassified 1453
130 Ga0070702_100077461 3300005615 Bacteria 1982
131 Ga0070702_100227410 3300005615 Bacteria 1251
132 Ga0068859_100015115 3300005617 Bacteria 7746
133 Ga0068859_100528360 3300005617 Bacteria 1274
134 Ga0068859_100578593 3300005617 Bacteria 1217
135 Ga0068864_100029363 3300005618 Bacteria 4656
136 Ga0068864_100077990 3300005618 Bacteria 2898
137 Ga0068864_100140213 3300005618 Bacteria 2180
138 Ga0068866_10011868 3300005718 Bacteria 3784
139 Ga0068861_100008733 3300005719 Bacteria 6974
140 Ga0068861_100044905 3300005719 Bacteria 3325
141 Ga0068861_100049093 3300005719 Bacteria 3193
142 Ga0068861_100310977 3300005719 Bacteria 1369
143 Ga0068870_10002446 3300005840 Bacteria 7732
144 Ga0068863_100023209 3300005841 Bacteria 5928
145 Ga0068863_100082178 3300005841 Bacteria 3053
146 Ga0068863_100225933 3300005841 Bacteria 1804
147 Ga0068863_100386266 3300005841 Bacteria 1367
148 Ga0068858_100040117 3300005842 Bacteria 4341
149 Ga0068858_100124714 3300005842 Bacteria 2410
150 Ga0068860_100058243 3300005843 Bacteria 3672
151 Ga0068860_100472076 3300005843 Bacteria 1249
152 Ga0068860_100599264 3300005843 Bacteria 1107
153 Ga0068862_100002414 3300005844 Bacteria 16590
154 Ga0068862_100013361 3300005844 Bacteria 6793
155 Ga0068862_100017892 3300005844 Bacteria 5901
156 Ga0068862_100146488 3300005844 Bacteria 2099
157 Ga0068862_100505706 3300005844 Unclassified 1147
158 Ga0081455_10003829 3300005937 Bacteria 17162
159 Ga0081540_1002103 3300005983 Bacteria 16583
160 Ga0081539_10000044 3300005985 Bacteria 284021
161 Ga0070717_10001390 3300006028 Bacteria 16670
162 Ga0070717_10055316 3300006028 Bacteria 3273
163 Ga0070717_10063058 3300006028 Unclassified 3075
164 Ga0070712_100060180 3300006175 Bacteria 2677
165 Ga0070712_100374553 3300006175 Bacteria 1170
166 Ga0097621_100136507 3300006237 Bacteria 2092
167 Ga0097621_100306701 3300006237 Bacteria 1403
168 Ga0097621_100674383 3300006237 Unclassified 950
169 Ga0068871_100317860 3300006358 Bacteria 1370
170 Ga0075428_100010575 3300006844 Bacteria 10256
171 Ga0075428_100013472 3300006844 Bacteria 9100
172 Ga0075428_100025119 3300006844 Bacteria 6591
173 Ga0075428_100046058 3300006844 Bacteria 4792
174 Ga0075428_100055445 3300006844 Bacteria 4342
175 Ga0075428_100308038 3300006844 Unclassified 1702
176 Ga0075428_100526758 3300006844 Bacteria 1264
177 Ga0075430_100000577 3300006846 Bacteria 27863
178 Ga0075430_100000658 3300006846 Bacteria 26387
179 Ga0075430_100036582 3300006846 Bacteria 4162
180 Ga0075431_100000635 3300006847 Bacteria 29710
181 Ga0075431_100000847 3300006847 Bacteria 26809
182 Ga0075431_100005898 3300006847 Bacteria 12117
183 Ga0075431_100007172 3300006847 Bacteria 11083
184 Ga0075431_100117031 3300006847 Bacteria 2750
185 Ga0075431_100117969 3300006847 Bacteria 2738
186 Ga0075431_100158834 3300006847 Bacteria 2325
187 Ga0075431_100441051 3300006847 Bacteria 1299
188 Ga0075433_10001836 3300006852 Bacteria 15941
189 Ga0075433_10005357 3300006852 Bacteria 10074
190 Ga0075433_10009282 3300006852 Bacteria 7865
191 Ga0075433_10009564 3300006852 Bacteria 7752
192 Ga0075433_10016703 3300006852 Bacteria 6059
193 Ga0075433_10018680 3300006852 Bacteria 5765
194 Ga0075433_10081243 3300006852 Bacteria 2857
195 Ga0075433_10092314 3300006852 Bacteria 2678
196 Ga0075433_10267092 3300006852 Bacteria 1516
197 Ga0075434_100010082 3300006871 Bacteria 8848
198 Ga0075434_100014963 3300006871 Bacteria 7425
199 Ga0075434_100017262 3300006871 Bacteria 6950
200 Ga0075434_100055043 3300006871 Bacteria 3953
201 Ga0075434_100300616 3300006871 Bacteria 1625
202 Ga0075434_100306757 3300006871 Bacteria 1607
203 Ga0075434_100567100 3300006871 Bacteria 1155
204 Ga0075434_100731558 3300006871 Bacteria 1006
205 Ga0075429_100000237 3300006880 Bacteria 37841
206 Ga0075429_100000485 3300006880 Bacteria 29758
207 Ga0075429_100003182 3300006880 Bacteria 13956
208 Ga0075429_100013779 3300006880 Bacteria 7011
209 Ga0075429_100029625 3300006880 Bacteria 4753
210 Ga0075429_100060882 3300006880 Bacteria 3288
211 Ga0075429_100288484 3300006880 Bacteria 1437
212 Ga0075429_100289998 3300006880 Bacteria 1433
213 Ga0075429_100338754 3300006880 Unclassified 1316
214 Ga0068865_100208964 3300006881 Bacteria 1520
215 Ga0075436_100001548 3300006914 Bacteria 15705
216 Ga0075436_100020521 3300006914 Bacteria 4534
217 Ga0075436_100023406 3300006914 Bacteria 4243
218 Ga0075436_100039002 3300006914 Bacteria 3277
219 Ga0075436_100061038 3300006914 Bacteria 2604
220 Ga0075436_100107640 3300006914 Bacteria 1945
221 Ga0097620_100015115 3300006931 Bacteria 7746
222 Ga0097620_100528340 3300006931 Bacteria 1274
223 Ga0097620_100578589 3300006931 Bacteria 1217
224 Ga0075435_100010992 3300007076 Bacteria 6637
225 Ga0075435_100013882 3300007076 Bacteria 6007
226 Ga0075435_100016614 3300007076 Bacteria 5551
227 Ga0075435_100057953 3300007076 Bacteria 3135
228 Ga0075435_100182920 3300007076 Bacteria 1772
229 Ga0099794_10003220 3300007265 Bacteria 6192
230 Ga0099795_10015030 3300007788 Bacteria 2414
231 Ga0099795_10061093 3300007788 Bacteria 1398
232 Ga0111539_10000139 3300009094 Bacteria 82909
233 Ga0111539_10003777 3300009094 Bacteria 19927
234 Ga0111539_10005684 3300009094 Bacteria 16136
235 Ga0111539_10027347 3300009094 Bacteria 6966
236 Ga0111539_10029747 3300009094 Bacteria 6649
237 Ga0111539_10043841 3300009094 Bacteria 5362
238 Ga0111539_10054232 3300009094 Bacteria 4770
239 Ga0111539_10137181 3300009094 Bacteria 2865
240 Ga0111539_10152633 3300009094 Bacteria 2703
241 Ga0111539_10801890 3300009094 Bacteria 1096
242 Ga0105245_10109569 3300009098 Bacteria 2566
243 Ga0105245_10272929 3300009098 Unclassified 1650
244 Ga0105247_10114373 3300009101 Bacteria 1741
245 Ga0114129_10000149 3300009147 Bacteria 73883
246 Ga0114129_10000562 3300009147 Bacteria 45605
247 Ga0114129_10009090 3300009147 Bacteria 14159
248 Ga0114129_10041323 3300009147 Bacteria 6499
249 Ga0114129_10049654 3300009147 Bacteria 5894
250 Ga0114129_10053694 3300009147 Bacteria 5652
251 Ga0114129_10057600 3300009147 Bacteria 5437
252 Ga0114129_10072996 3300009147 Bacteria 4782
253 Ga0114129_10128949 3300009147 Bacteria 3476
254 Ga0114129_10136000 3300009147 Bacteria 3372
255 Ga0114129_10329703 3300009147 Bacteria 2027
256 Ga0114129_10572313 3300009147 Bacteria 1467
257 Ga0114129_11196120 3300009147 Bacteria 947
258 Ga0105243_10015145 3300009148 Bacteria 5835
259 Ga0105243_10017154 3300009148 Bacteria 5476
260 Ga0105243_10050781 3300009148 Bacteria 3278
261 Ga0105243_10428915 3300009148 Bacteria 1235
262 Ga0105243_10451637 3300009148 Bacteria 1206
263 Ga0105241_10010553 3300009174 Bacteria 6777
264 Ga0105241_10028648 3300009174 Bacteria 4150
265 Ga0105242_10132260 3300009176 Bacteria 2155
266 Ga0105248_10057324 3300009177 Bacteria 4372
267 Ga0105248_10068601 3300009177 Bacteria 3981
268 Ga0105248_10442636 3300009177 Bacteria 1464
269 Ga0105248_10478469 3300009177 Bacteria 1404
270 Ga0105249_10132999 3300009553 Bacteria 2377
271 Ga0105249_10261224 3300009553 Bacteria 1721
272 Ga0099796_10056947 3300010159 Bacteria 1374
273 Ga0105239_10032525 3300010375 Bacteria 5730
274 Ga0105239_10772432 3300010375 Unclassified 1100
275 Ga0105246_10056054 3300011119 Bacteria 2722
276 Ga0105246_10145320 3300011119 Bacteria 1789
277 Ga0157373_10000457 3300013100 Bacteria 32330
278 Ga0157370_10312303 3300013104 Unclassified 1450
279 Ga0157369_10005377 3300013105 Bacteria 14912
280 Ga0157369_10092406 3300013105 Bacteria 3229
281 Ga0157374_10053226 3300013296 Bacteria 3773
282 Ga0157378_10069886 3300013297 Bacteria 3151
283 Ga0157378_10094574 3300013297 Bacteria 2721
284 Ga0157378_10467386 3300013297 Bacteria 1255
285 Ga0163162_10070826 3300013306 Bacteria 3538
286 Ga0163162_10134585 3300013306 Bacteria 2582
287 Ga0163162_10603647 3300013306 Bacteria 1223
288 Ga0157372_10024219 3300013307 Bacteria 6589
289 Ga0157372_10523849 3300013307 Bacteria 1382
290 Ga0157375_10014050 3300013308 Bacteria 7142
291 Ga0163163_10184372 3300014325 Bacteria 2135
292 Ga0157380_10036806 3300014326 Bacteria 3789
293 Ga0157380_10079992 3300014326 Bacteria 2670
294 Ga0182008_10046829 3300014497 Bacteria 2149
295 Ga0157377_10045882 3300014745 Bacteria 2442
296 Ga0157379_10220429 3300014968 Bacteria 1719
297 Ga0157379_10534292 3300014968 Bacteria 1090
298 Ga0157376_10029306 3300014969 Bacteria 4384
299 Ga0163161_10014586 3300017792 Bacteria 5470
300 Ga0163161_10191900 3300017792 Bacteria 1571
301 Ga0163161_10591729 3300017792 Unclassified 914
302 Ga0213876_10002708 3300021384 Bacteria 10324
303 Ga0213875_10000152 3300021388 Bacteria 73219
304 Ga0213875_10007069 3300021388 Bacteria 5835
305 Ga0213875_10071533 3300021388 Bacteria 1619
306 Ga0213875_10118933 3300021388 Bacteria 1234
307 Ga0224712_10062806 3300022467 Unclassified 1485
308 Ga0207666_1015518 3300025271 Bacteria 1085
309 Ga0207653_10012207 3300025885 Bacteria 2683
310 Ga0207682_10014559 3300025893 Bacteria 3065
311 Ga0207692_10104611 3300025898 Bacteria 1560
312 Ga0207692_10203210 3300025898 Bacteria 1166
313 Ga0207642_10024383 3300025899 Bacteria 2431
314 Ga0207642_10096462 3300025899 Unclassified 1474
315 Ga0207688_10005957 3300025901 Bacteria 6635
316 Ga0207680_10012243 3300025903 Bacteria 4365
317 Ga0207680_10058046 3300025903 Bacteria 2344
318 Ga0207680_10312813 3300025903 Bacteria 1097
319 Ga0207699_10008581 3300025906 Bacteria 5050
320 Ga0207699_10033054 3300025906 Bacteria 2920
321 Ga0207645_10006681 3300025907 Bacteria 8238
322 Ga0207645_10107017 3300025907 Unclassified 1808
323 Ga0207643_10001151 3300025908 Bacteria 15691
324 Ga0207643_10060259 3300025908 Bacteria 2167
325 Ga0207684_10000673 3300025910 Bacteria 40594
326 Ga0207684_10008211 3300025910 Bacteria 9296
327 Ga0207684_10015297 3300025910 Bacteria 6607
328 Ga0207684_10016306 3300025910 Bacteria 6379
329 Ga0207684_10020113 3300025910 Bacteria 5702
330 Ga0207684_10030055 3300025910 Bacteria 4626
331 Ga0207684_10046446 3300025910 Bacteria 3684
332 Ga0207684_10338360 3300025910 Bacteria 1296
333 Ga0207684_10464587 3300025910 Bacteria 1086
334 Ga0207654_10026695 3300025911 Bacteria 3130
335 Ga0207707_10000158 3300025912 Bacteria 71112
336 Ga0207707_10231471 3300025912 Bacteria 1608
337 Ga0207693_10014075 3300025915 Bacteria 6440
338 Ga0207693_10028525 3300025915 Bacteria 4410
339 Ga0207693_10046200 3300025915 Bacteria 3420
340 Ga0207693_10107006 3300025915 Bacteria 2194
341 Ga0207663_10106012 3300025916 Bacteria 1898
342 Ga0207660_10000220 3300025917 Bacteria 36783
343 Ga0207660_10062257 3300025917 Bacteria 2688
344 Ga0207649_10058290 3300025920 Bacteria 2417
345 Ga0207649_10083580 3300025920 Bacteria 2073
346 Ga0207652_10000290 3300025921 Bacteria 52056
347 Ga0207652_10052275 3300025921 Bacteria 3506
348 Ga0207646_10001668 3300025922 Bacteria 27110
349 Ga0207646_10023356 3300025922 Bacteria 5681
350 Ga0207646_10024791 3300025922 Bacteria 5490
351 Ga0207646_10062141 3300025922 Bacteria 3334
352 Ga0207681_10079999 3300025923 Bacteria 2304
353 Ga0207681_10167084 3300025923 Bacteria 1664
354 Ga0207681_10215655 3300025923 Unclassified 1482
355 Ga0207650_10020548 3300025925 Bacteria 4658
356 Ga0207650_10026018 3300025925 Bacteria 4171
357 Ga0207650_10092028 3300025925 Bacteria 2319
358 Ga0207650_10137943 3300025925 Bacteria 1915
359 Ga0207650_10291318 3300025925 Unclassified 1331
360 Ga0207659_10011144 3300025926 Bacteria 5673
361 Ga0207659_10049794 3300025926 Bacteria 2973
362 Ga0207659_10392435 3300025926 Unclassified 1159
363 Ga0207659_10409742 3300025926 Bacteria 1135
364 Ga0207687_10016642 3300025927 Bacteria 4831
365 Ga0207687_10201853 3300025927 Bacteria 1555
366 Ga0207700_10029038 3300025928 Bacteria 3898
367 Ga0207700_10032949 3300025928 Bacteria 3702
368 Ga0207700_10063618 3300025928 Bacteria 2807
369 Ga0207700_10144112 3300025928 Bacteria 1961
370 Ga0207700_10168225 3300025928 Bacteria 1826
371 Ga0207700_10320485 3300025928 Bacteria 1343
372 Ga0207700_10436578 3300025928 Bacteria 1152
373 Ga0207664_10012103 3300025929 Bacteria 6161
374 Ga0207664_10062701 3300025929 Bacteria 2969
375 Ga0207664_10192368 3300025929 Unclassified 1757
376 Ga0207664_10273051 3300025929 Bacteria 1481
377 Ga0207644_10041322 3300025931 Bacteria 3262
378 Ga0207644_10071757 3300025931 Bacteria 2534
379 Ga0207644_10072039 3300025931 Bacteria 2529
380 Ga0207644_10220117 3300025931 Bacteria 1504
381 Ga0207690_10001918 3300025932 Bacteria 12764
382 Ga0207706_10008340 3300025933 Bacteria 9554
383 Ga0207706_10013948 3300025933 Bacteria 7286
384 Ga0207706_10068268 3300025933 Bacteria 3129
385 Ga0207706_10395187 3300025933 Unclassified 1199
386 Ga0207686_10146121 3300025934 Bacteria 1640
387 Ga0207709_10047835 3300025935 Bacteria 2603
388 Ga0207709_10063266 3300025935 Bacteria 2319
389 Ga0207670_10003369 3300025936 Bacteria 8480
390 Ga0207670_10271095 3300025936 Bacteria 1319
391 Ga0207670_10338045 3300025936 Bacteria 1189
392 Ga0207669_10069448 3300025937 Bacteria 2204
393 Ga0207669_10089703 3300025937 Bacteria 1997
394 Ga0207704_10049398 3300025938 Bacteria 2530
395 Ga0207704_10433227 3300025938 Bacteria 1045
396 Ga0207665_10056133 3300025939 Bacteria 2658
397 Ga0207665_10085816 3300025939 Bacteria 2173
398 Ga0207691_10013162 3300025940 Bacteria 7921
399 Ga0207691_10018115 3300025940 Bacteria 6669
400 Ga0207691_10035866 3300025940 Bacteria 4599
401 Ga0207691_10067145 3300025940 Bacteria 3243
402 Ga0207691_10195337 3300025940 Bacteria 1763
403 Ga0207711_10058850 3300025941 Bacteria 3308
404 Ga0207711_10104303 3300025941 Bacteria 2512
405 Ga0207711_10232008 3300025941 Unclassified 1690
406 Ga0207689_10000277 3300025942 Bacteria 46512
407 Ga0207689_10002119 3300025942 Bacteria 18663
408 Ga0207689_10041899 3300025942 Bacteria 3788
409 Ga0207689_10181365 3300025942 Bacteria 1736
410 Ga0207661_10293128 3300025944 Bacteria 1457
411 Ga0207679_10000820 3300025945 Bacteria 20002
412 Ga0207667_10001638 3300025949 Bacteria 28188
413 Ga0207667_10408278 3300025949 Unclassified 1383
414 Ga0207651_10186842 3300025960 Bacteria 1649
415 Ga0207712_10066434 3300025961 Bacteria 2578
416 Ga0207712_10261095 3300025961 Bacteria 1405
417 Ga0207712_10463820 3300025961 Unclassified 1077
418 Ga0207668_10146646 3300025972 Bacteria 1822
419 Ga0207640_10029885 3300025981 Bacteria 3350
420 Ga0207658_10391434 3300025986 Bacteria 1219
421 Ga0207677_10070093 3300026023 Bacteria 2469
422 Ga0207677_10590118 3300026023 Bacteria 974
423 Ga0207703_10017809 3300026035 Bacteria 5548
424 Ga0207703_10310108 3300026035 Bacteria 1442
425 Ga0207639_10028956 3300026041 Bacteria 4050
426 Ga0207678_10031501 3300026067 Bacteria 4626
427 Ga0207708_10027298 3300026075 Bacteria 4322
428 Ga0207708_10152174 3300026075 Bacteria 1822
429 Ga0207702_10048474 3300026078 Bacteria 3583
430 Ga0207702_10306424 3300026078 Unclassified 1509
431 Ga0207641_10026717 3300026088 Bacteria 4765
432 Ga0207641_10080626 3300026088 Bacteria 2824
433 Ga0207641_10430836 3300026088 Bacteria 1271
434 Ga0207648_10009469 3300026089 Bacteria 9327
435 Ga0207648_10018035 3300026089 Bacteria 6396
436 Ga0207648_10095107 3300026089 Bacteria 2605
437 Ga0207648_10097994 3300026089 Bacteria 2566
438 Ga0207676_10004198 3300026095 Bacteria 10182
439 Ga0207676_10039226 3300026095 Bacteria 3621
440 Ga0207676_10076687 3300026095 Bacteria 2702
441 Ga0207676_10227075 3300026095 Bacteria 1666
442 Ga0207674_10022090 3300026116 Bacteria 6839
443 Ga0207675_100057233 3300026118 Bacteria 3637
444 Ga0207675_100070214 3300026118 Bacteria 3274
445 Ga0207683_10078100 3300026121 Bacteria 2933
446 Ga0207683_10179420 3300026121 Bacteria 1920
447 Ga0207683_10423726 3300026121 Bacteria 1226
448 Ga0207698_10448515 3300026142 Bacteria 1245
449 Ga0207698_10706598 3300026142 Unclassified 1003
450 Ga0209996_1000437 3300027395 Bacteria 5020
451 Ga0209984_1010499 3300027424 Bacteria 1189
452 Ga0210000_1009653 3300027462 Bacteria 1422
453 Ga0209995_1003242 3300027471 Bacteria 2589
454 Ga0209179_1013621 3300027512 Bacteria 1480
455 Ga0209968_1000769 3300027526 Bacteria 4947
456 Ga0209999_1000908 3300027543 Bacteria 4969
457 Ga0209982_1001961 3300027552 Bacteria 2851
458 Ga0209970_1000737 3300027614 Bacteria 5667
459 Ga0210002_1024207 3300027617 Bacteria 990
460 Ga0209983_1000271 3300027665 Bacteria 10774
461 Ga0209588_1004919 3300027671 Bacteria 3799
462 Ga0209971_1000036 3300027682 Bacteria 46401
463 Ga0209966_1000021 3300027695 Bacteria 68287
464 Ga0209998_10000002 3300027717 Bacteria 126355
465 Ga0209998_10023228 3300027717 Bacteria 1340
466 Ga0209974_10002471 3300027876 Bacteria 6691
467 Ga0207428_10000027 3300027907 Bacteria 250186
468 Ga0207428_10000239 3300027907 Bacteria 75249
469 Ga0207428_10005083 3300027907 Bacteria 12354
470 Ga0207428_10023392 3300027907 Bacteria 5196
471 Ga0207428_10042288 3300027907 Bacteria 3684
472 Ga0207428_10238954 3300027907 Bacteria 1358
473 Ga0207428_10435746 3300027907 Bacteria 957
474 Ga0268265_10008105 3300028380 Bacteria 7100
475 Ga0268265_10012301 3300028380 Bacteria 5799
476 Ga0268265_10191618 3300028380 Bacteria 1766
477 Ga0268265_10535433 3300028380 Bacteria 1109
478 Ga0268264_10140736 3300028381 Bacteria 2151
479 Ga0268264_10575601 3300028381 Bacteria 1107
480 Ga0265337_1024465 3300028556 Bacteria 1848
481 Ga0265318_10003548 3300028577 Bacteria 7818
482 Ga0265338_10076275 3300028800 Unclassified 2840
483 Ga0265332_10011096 3300031238 Bacteria 4004
484 Ga0265329_10006071 3300031242 Bacteria 4823
485 Ga0265313_10106204 3300031595 Bacteria 1240
486 Ga0265314_10003180 3300031711 Bacteria 16087
487 Ga0307410_10272828 3300031852 Bacteria 1324
488 Ga0307406_10241253 3300031901 Bacteria 1356
489 Ga0307416_100009526 3300032002 Bacteria 6364
490 Ga0307416_100479814 3300032002 Bacteria 1303
491 Ga0373930_0039796 3300034816 Bacteria 998
492 Ga0373948_0018883 3300034817 Bacteria 1299
493 Ga0373928_0013191 3300035084 Bacteria 1657
494 Ga0373951_0014935 3300035091 Bacteria 1747
495 Ga0373932_0017703 3300035112 Bacteria 1833
496 Ga0373932_0031834 3300035112 Bacteria 1472
497 Ga0373939_0006538 3300035114 Bacteria 2811
498 Ga0373960_0005718 3300035121 Bacteria 2890
499 Ga0373943_0104521 3300035170 Unclassified 1486
500 Ga0373943_0274091 3300035170 Unclassified 952
501 Ga0373955_0002628 3300035172 Bacteria 7862
502 Ga0373955_0027841 3300035172 Bacteria 2926
503 Ga0373955_0048691 3300035172 Bacteria 2299
504 Ga0373962_0076125 3300035242 Bacteria 1011
505 Ga0373924_0015082 3300035410 Bacteria 2930
506 Ga0373931_0030071 3300035691 Bacteria 2794
507 Ga0373931_0038481 3300035691 Bacteria 2502
508 Ga0373931_0075287 3300035691 Bacteria 1851
509 Ga0373935_0042106 3300035692 Bacteria 2871
510 Ga0373935_0358332 3300035692 Bacteria 1041
511 Ga0373927_0088486 3300035695 Bacteria 2011
512 Ga0373927_0146852 3300035695 Unclassified 1544
513 Ga0373933_0007224 3300035724 Bacteria 6055
514 Ga0373933_0183498 3300035724 Bacteria 1335
515 Ga0373947_0156203 3300035725 Bacteria 1472
516 Ga0373937_0014749 3300036401 Bacteria 6899
517 Ga0373937_0023034 3300036401 Bacteria 5602
518 Ga0373937_0032893 3300036401 Bacteria 4705
519 Ga0373937_0370545 3300036401 Unclassified 1358
520 Ga0373937_0384630 3300036401 Bacteria 1331
521 Ga0373925_0113004 3300037068 Unclassified 2100
522 Ga0373925_0148541 3300037068 Bacteria 1838
523 Ga0395899_0009538 3300037312 Bacteria 7451
524 Ga0395900_0013526 3300037418 Bacteria 8337
525 Ga0436364_0210276 3300037853 Bacteria 2932
526 Ga0436364_0660746 3300037853 Bacteria 1179
527 Ga0436364_0675117 3300037853 Bacteria 1030
528 Ga0436364_0793378 3300037853 Bacteria 2614
529 Ga0436364_0883536 3300037853 Bacteria 58970
530 Ga0436364_1013423 3300037853 Bacteria 35685
531 Ga0436364_1072565 3300037853 Bacteria 7836
532 Ga0436364_1226760 3300037853 Bacteria 13597
533 Ga0436364_1524375 3300037853 Bacteria 1972
534 Ga0395901_0003070 3300038443 Bacteria 16818
535 Ga0436365_0036618 3300039437 Bacteria 5006
536 Ga0436365_0158096 3300039437 Bacteria 1160
537 Ga0436365_0469579 3300039437 Bacteria 37854
538 Ga0436365_1088548 3300039437 Unclassified 1167
539 Ga0436365_1156765 3300039437 Bacteria 3298
540 Ga0436365_1692579 3300039437 Bacteria 13333
541 Ga0436360_0063921 3300039438 Bacteria 1202
542 Ga0436360_0301600 3300039438 Bacteria 1610
543 Ga0436360_0416464 3300039438 Bacteria 1769
544 Ga0436361_0156140 3300039447 Bacteria 2919
545 Ga0436363_0127255 3300039450 Bacteria 2417
546 Ga0436363_0290638 3300039450 Bacteria 1761
547 Ga0436363_0845692 3300039450 Bacteria 2767
548 Ga0436363_1076056 3300039450 Unclassified 1979
549 Ga0436362_0329835 3300039453 Bacteria 1487
550 Ga0436362_0672745 3300039453 Unclassified 1270
551 Ga0439441_013384 3300042001 Bacteria 1422
552 Ga0439448_0004515 3300042005 Bacteria 3930
553 Ga0439455_0038172 3300042012 Bacteria 1221
554 Ga0439463_018975 3300042016 Bacteria 1713
555 Ga0439464_0000383 3300042439 Bacteria 8673
556 Ga0439460_0003649 3300042461 Bacteria 3730
557 Ga0451577_0004128 3300042876 Bacteria 15564
558 Ga0451577_0011112 3300042876 Bacteria 8543
559 Ga0451577_0129375 3300042876 Bacteria 2264
560 Ga0451577_0250281 3300042876 Bacteria 1604
561 Ga0453683_0022559 3300044673 Bacteria 4016
562 Ga0453683_0086763 3300044673 Bacteria 1961
563 Ga0453683_0135533 3300044673 Bacteria 1553
564 Ga0453683_0214742 3300044673 Bacteria 1222
565 Ga0466963_0076198 3300044694 Bacteria 2265
566 Ga0453684_0079456 3300044712 Bacteria 4100
567 Ga0453684_0114765 3300044712 Bacteria 3265
568 Ga0451576_0029646 3300045051 Bacteria 5853
569 Ga0451576_0051373 3300045051 Bacteria 4322
570 Ga0451576_0073845 3300045051 Bacteria 3549
571 Ga0451576_0330317 3300045051 Bacteria 1596
572 Ga0466967_0480637 3300045976 Bacteria 1217
573 Ga0495592_0052033 3300046454 Unclassified 3042
574 Ga0495592_0133588 3300046454 Bacteria 1733
575 Ga0495651_0020223 3300046462 Bacteria 5166
576 Ga0495651_0042141 3300046462 Bacteria 3545
577 Ga0495653_0256922 3300046463 Unclassified 1157
578 Ga0495580_0002075 3300046472 Bacteria 17590
579 Ga0495662_0037066 3300046476 Bacteria 2355
580 Ga0495664_0005183 3300046477 Bacteria 7152
581 Ga0495608_0028486 3300046511 Bacteria 3796
582 Ga0495608_0116991 3300046511 Unclassified 1710
583 Ga0495618_0024655 3300046514 Bacteria 3727
584 Ga0495628_0162829 3300046516 Bacteria 1695
585 Ga0495642_0016547 3300046528 Bacteria 2876
586 Ga0495652_0171837 3300046529 Bacteria 1672
587 Ga0495640_0103390 3300046533 Bacteria 1868
588 Ga0495586_0048986 3300046535 Bacteria 2284
589 Ga0495587_0028607 3300046536 Bacteria 3388
590 Ga0495598_0007052 3300046537 Bacteria 2561
591 Ga0495645_0001188 3300046543 Bacteria 17779
592 Ga0495667_0010033 3300046559 Bacteria 6415
593 Ga0495667_0165579 3300046559 Bacteria 1421
594 Ga0495656_0021249 3300046615 Bacteria 2525
595 Ga0495599_0021975 3300046678 Bacteria 3981
596 Ga0495646_0009838 3300046680 Bacteria 6076
597 Ga0495658_0094420 3300046683 Bacteria 1776
598 Ga0495600_0049089 3300046809 Bacteria 2753
599 Ga0495581_0188545 3300047315 Unclassified 1206
600 Ga0495604_0069906 3300047317 Bacteria 2660
601 Ga0495604_0265967 3300047317 Bacteria 1164
602 Ga0495636_0055524 3300047318 Unclassified 1666
603 Ga0495674_0153319 3300047319 Bacteria 1931
604 Ga0495680_0016744 3300047322 Bacteria 6286
605 Ga0495680_0030134 3300047322 Bacteria 4434
606 Ga0495675_0001602 3300047444 Bacteria 13605
607 Ga0495602_0000230 3300048088 Bacteria 52313
608 Ga0495602_0032285 3300048088 Unclassified 4932
609 Ga0496102_0026723 3300048905 Bacteria 5151
610 Ga0496102_0104125 3300048905 Bacteria 2639
611 Ga0496103_0231975 3300048906 Bacteria 1187
612 Ga0496105_0540347 3300048908 Unclassified 911
613 Ga0496108_0169510 3300048911 Unclassified 1889
614 Ga0496108_0357350 3300048911 Bacteria 1275
615 Ga0496109_0414803 3300048912 Unclassified 1272
616 Ga0496109_0473779 3300048912 Bacteria 1182
617 Ga0496110_0041884 3300048913 Bacteria 3997
618 Ga0496110_0102006 3300048913 Bacteria 2573
619 Ga0496110_0448626 3300048913 Bacteria 1176
620 Ga0496112_0122769 3300048915 Bacteria 2568
621 Ga0496113_0122374 3300048916 Bacteria 2035
622 Ga0496114_0005334 3300048917 Bacteria 10049
623 Ga0496114_0305120 3300048917 Bacteria 1406
624 Ga0496126_0155996 3300048929 Bacteria 1954
625 Ga0501031_0105071 3300049568 Bacteria 1843
626 Ga0501032_0310903 3300049569 Unclassified 1018
627 Ga0501033_0037843 3300049570 Bacteria 3610
628 Ga0501033_0178748 3300049570 Bacteria 1522
629 Ga0501034_0163724 3300049571 Bacteria 2194
630 Ga0501036_0033040 3300049572 Bacteria 4375
631 Ga0501036_0137253 3300049572 Bacteria 2064
632 Ga0501036_0219365 3300049572 Bacteria 1597
633 Ga0501037_0037983 3300049573 Bacteria 3550
634 Ga0501039_0018005 3300049575 Bacteria 5419
635 Ga0501039_0242598 3300049575 Bacteria 1417
636 Ga0501039_0266981 3300049575 Bacteria 1345
637 Ga0501040_0007257 3300049576 Bacteria 7182
638 Ga0501040_0010980 3300049576 Bacteria 5921
639 Ga0501041_0004421 3300049577 Bacteria 8130
640 Ga0501041_0030887 3300049577 Bacteria 3233
641 Ga0501041_0172113 3300049577 Bacteria 1355
642 Ga0501042_0003463 3300049578 Bacteria 9908
643 Ga0501042_0120251 3300049578 Bacteria 1891
644 Ga0501042_0130631 3300049578 Bacteria 1810
645 Ga0501042_0210040 3300049578 Bacteria 1404
646 Ga0501043_0049422 3300049579 Bacteria 3306
647 Ga0501043_0081308 3300049579 Bacteria 2546
648 Ga0501046_0000240 3300049580 Bacteria 56302
649 Ga0501047_0046156 3300049581 Bacteria 4211
650 Ga0501048_0018933 3300049582 Bacteria 5060
651 Ga0501048_0286847 3300049582 Bacteria 1171
652 Ga0501070_0451272 3300049586 Unclassified 1037
653 Ga0501071_0071454 3300049587 Bacteria 2530
654 Ga0501072_0039460 3300049588 Bacteria 3707
655 Ga0501072_0042515 3300049588 Bacteria 3569
656 Ga0501072_0110664 3300049588 Bacteria 2186
657 Ga0501072_0177125 3300049588 Bacteria 1701
658 Ga0501072_0328160 3300049588 Bacteria 1216
659 Ga0501073_0175977 3300049589 Bacteria 1481
660 Ga0501074_0010370 3300049590 Bacteria 6761
661 Ga0501075_0011788 3300049591 Bacteria 6198
662 Ga0501075_0124539 3300049591 Unclassified 1962
663 Ga0501075_0145704 3300049591 Bacteria 1805
664 Ga0501075_0146669 3300049591 Bacteria 1798
665 Ga0501075_0257981 3300049591 Bacteria 1328
666 Ga0501075_0277999 3300049591 Bacteria 1276
667 Ga0501076_0002469 3300049592 Bacteria 12699
668 Ga0501076_0006954 3300049592 Bacteria 8223
669 Ga0501076_0048596 3300049592 Bacteria 3353
670 Ga0501077_0012786 3300049593 Bacteria 5260
671 Ga0501077_0019306 3300049593 Bacteria 4311
672 Ga0501079_0005268 3300049741 Bacteria 9617
673 Ga0501079_0005994 3300049741 Bacteria 9101
674 Ga0501079_0027102 3300049741 Bacteria 4392
675 Ga0501079_0075611 3300049741 Bacteria 2605
676 Ga0501079_0078174 3300049741 Bacteria 2559
677 Ga0501079_0500457 3300049741 Bacteria 955
678 Ga0501080_0015063 3300049742 Bacteria 7126
679 Ga0501080_0024101 3300049742 Bacteria 5641
680 Ga0501080_0628070 3300049742 Bacteria 952
681 Ga0501081_0002066 3300049743 Bacteria 12521
682 Ga0501081_0002648 3300049743 Bacteria 11319
683 Ga0501081_0056081 3300049743 Bacteria 2722
684 Ga0501081_0118454 3300049743 Bacteria 1884
685 Ga0501083_0141644 3300049744 Bacteria 1575
686 Ga0501045_0003643 3300049824 Bacteria 10592
687 Ga0501045_0057687 3300049824 Bacteria 2842
688 nmdc:mga05p37_1308_c1 3300050507 Bacteria 28963
689 nmdc:mga05p37_13403_c1 3300050507 Bacteria 9825
690 nmdc:mga05p37_216892_c1 3300050507 Bacteria 2311
691 nmdc:mga05p37_221896_c1 3300050507 Bacteria 2281
692 nmdc:mga05p37_2288_c1 3300050507 Bacteria 22334
693 nmdc:mga05p37_292966_c1 3300050507 Bacteria 1937
694 nmdc:mga05p37_50288_c1 3300050507 Bacteria 5126
695 nmdc:mga05p37_72351_c1 3300050507 Bacteria 4242
696 nmdc:mga05p37_78184_c1 3300050507 Bacteria 4074
697 nmdc:mga05p37_88888_c1 3300050507 Bacteria 3808
698 nmdc:mga09592_134194_c1 3300050508 Bacteria 2132
699 nmdc:mga09592_1983_c1 3300050508 Bacteria 16505
700 nmdc:mga09592_27471_c1 3300050508 Bacteria 4722
701 nmdc:mga09592_3499_c1 3300050508 Bacteria 12676
702 nmdc:mga09592_376374_c1 3300050508 Bacteria 1228
703 nmdc:mga09592_45322_c1 3300050508 Bacteria 3704
704 nmdc:mga09592_471988_c1 3300050508 Bacteria 1082
705 nmdc:mga09592_49664_c1 3300050508 Bacteria 3537
706 nmdc:mga09592_9421_c1 3300050508 Bacteria 7933
707 nmdc:mga09592_991_c1 3300050508 Bacteria 22493
708 nmdc:mga0qj67_141_c1 3300050509 Bacteria 48622
709 nmdc:mga0qj67_29813_c1 3300050509 Bacteria 4240
710 nmdc:mga0qj67_6609_c1 3300050509 Bacteria 8519
711 nmdc:mga06r32_11284_c1 3300050510 Bacteria 8048
712 nmdc:mga06r32_1408_c1 3300050510 Bacteria 21711
713 nmdc:mga06r32_18996_c1 3300050510 Bacteria 6302
714 nmdc:mga06r32_226169_c1 3300050510 Bacteria 1859
715 nmdc:mga06r32_238933_c1 3300050510 Bacteria 1804
716 nmdc:mga06r32_257012_c1 3300050510 Bacteria 1735
717 nmdc:mga06r32_268_c1 3300050510 Bacteria 43133
718 nmdc:mga06r32_47927_c1 3300050510 Bacteria 4084
719 nmdc:mga06r32_573765_c1 3300050510 Unclassified 1101
720 nmdc:mga08y16_194012_c1 3300050511 Bacteria 2106
721 nmdc:mga08y16_21560_c1 3300050511 Bacteria 6803
722 nmdc:mga08y16_40638_c1 3300050511 Bacteria 4873
723 nmdc:mga08y16_54366_c1 3300050511 Bacteria 4184
724 nmdc:mga08y16_5571_c1 3300050511 Bacteria 13190
725 nmdc:mga08y16_558676_c1 3300050511 Bacteria 1158
726 nmdc:mga08y16_7748_c1 3300050511 Bacteria 11248
727 nmdc:mga08y16_7784_c1 3300050511 Bacteria 11223
728 nmdc:mga0n895_117104_c1 3300050512 Bacteria 2683
729 nmdc:mga0n895_148729_c1 3300050512 Bacteria 2371
730 nmdc:mga0n895_21898_c1 3300050512 Bacteria 5986
731 nmdc:mga0n895_251457_c1 3300050512 Bacteria 1794
732 nmdc:mga0n895_285413_c1 3300050512 Bacteria 1674
733 nmdc:mga0n895_3955_c1 3300050512 Bacteria 12046
734 nmdc:mga0n895_415170_c1 3300050512 Bacteria 1361
735 nmdc:mga0n895_4479_c1 3300050512 Bacteria 11481
736 nmdc:mga0n895_52283_c1 3300050512 Bacteria 4010
737 nmdc:mga0n895_826_c1 3300050512 Bacteria 22185
738 nmdc:mga0rr50_103708_c1 3300050513 Bacteria 2239
739 nmdc:mga0rr50_11081_c1 3300050513 Bacteria 5751
740 nmdc:mga0rr50_18674_c1 3300050513 Bacteria 4663
741 nmdc:mga0rr50_21882_c1 3300050513 Bacteria 4376
742 nmdc:mga0rr50_309872_c1 3300050513 Bacteria 1322
743 nmdc:mga0rr50_37300_c1 3300050513 Bacteria 3507
744 nmdc:mga0rr50_506534_c1 3300050513 Bacteria 1027
745 nmdc:mga0rr50_6133_c1 3300050513 Bacteria 7276
746 nmdc:mga0rr50_82534_c1 3300050513 Bacteria 2483
747 nmdc:mga08x19_212600_c1 3300050514 Bacteria 1328
748 nmdc:mga08x19_26225_c1 3300050514 Bacteria 3635
749 nmdc:mga08x19_2837_c1 3300050514 Bacteria 10452
750 nmdc:mga08x19_42291_c1 3300050514 Bacteria 2904
751 nmdc:mga08x19_4910_c1 3300050514 Bacteria 7899
752 nmdc:mga08x19_69414_c1 3300050514 Bacteria 2295
753 nmdc:mga0a205_104897_c1 3300050515 Bacteria 2725
754 nmdc:mga0a205_12814_c1 3300050515 Bacteria 7776
755 nmdc:mga0a205_13391_c1 3300050515 Bacteria 7636
756 nmdc:mga0a205_149018_c1 3300050515 Bacteria 2240
757 nmdc:mga0a205_25809_c1 3300050515 Bacteria 5599
758 nmdc:mga0a205_26719_c1 3300050515 Bacteria 5508
759 nmdc:mga0a205_295091_c1 3300050515 Bacteria 1495
760 nmdc:mga0a205_3041_c2 3300050515 Bacteria 3932
761 nmdc:mga0a205_33777_c1 3300050515 Bacteria 4906
762 nmdc:mga0a205_5169_c1 3300050515 Bacteria 11734
763 nmdc:mga0a205_99302_c1 3300050515 Bacteria 2809
764 Ga0495601_0001753 3300053077 Bacteria 12008
765 Ga0495601_0171110 3300053077 Bacteria 1420
766 Ga0495612_0002063 3300053078 Bacteria 8272
767 Ga0495612_0112150 3300053078 Unclassified 1168
768 Ga0495595_0108173 3300053084 Unclassified 1346
769 Ga0495619_0237310 3300053085 Bacteria 1263
770 Ga0501084_0011701 3300054114 Bacteria 7263
771 Ga0501084_0013355 3300054114 Bacteria 6795
772 Ga0501084_0070061 3300054114 Bacteria 2936
773 Ga0501084_0109146 3300054114 Bacteria 2325
774 Ga0501084_0190645 3300054114 Bacteria 1729
775 Ga0501084_0352855 3300054114 Bacteria 1242
776 Ga0501082_0000691 3300060353 Bacteria 29759
777 Ga0501082_0002744 3300060353 Bacteria 15383
778 Ga0501082_0009737 3300060353 Bacteria 8279
779 Ga0501082_0088907 3300060353 Bacteria 2666
780 Ga0501082_0261744 3300060353 Bacteria 1505
781 Ga0530510_0002570 3300061734 Bacteria 12468
782 Ga0530510_0017719 3300061734 Bacteria 5047
783 Ga0530510_0374154 3300061734 Bacteria 1072

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048911 Ga0496108_0357350 Ga0496108_0357350_578_1252 222
2 3300027717 Ga0209998_10023228 Ga0209998_100232282 232
3 3300050508 nmdc:mga09592_471988_c1 nmdc:mga09592_471988_c1_65_916 257
4 3300037853 Ga0436364_1524375 Ga0436364_1524375_881_1726 258
5 3300044673 Ga0453683_0135533 Ga0453683_0135533_418_1272 259
6 3300042876 Ga0451577_0250281 Ga0451577_0250281_54_902 263
7 3300005545 Ga0070695_100114809 Ga0070695_1001148092 264
8 3300025917 Ga0207660_10062257 Ga0207660_100622572 264
9 3300028577 Ga0265318_10003548 Ga0265318_100035487 264
10 3300031238 Ga0265332_10011096 Ga0265332_100110963 264
11 3300031242 Ga0265329_10006071 Ga0265329_100060714 264
12 3300031595 Ga0265313_10106204 Ga0265313_101062041 264
13 3300031711 Ga0265314_10003180 Ga0265314_1000318014 264
14 3300035691 Ga0373931_0038481 Ga0373931_0038481_1551_2399 264
15 3300048905 Ga0496102_0026723 Ga0496102_0026723_1151_1999 264
16 3300006846 Ga0075430_100036582 Ga0075430_1000365824 266
17 3300006847 Ga0075431_100158834 Ga0075431_1001588342 266
18 3300009094 Ga0111539_10003777 Ga0111539_1000377717 266
19 3300027907 Ga0207428_10000027 Ga0207428_10000027121 266
20 3300035112 Ga0373932_0017703 Ga0373932_0017703_775_1626 266
21 3300035114 Ga0373939_0006538 Ga0373939_0006538_1154_2005 266
22 3300050509 nmdc:mga0qj67_29813_c1 nmdc:mga0qj67_29813_c1_3062_3913 266
23 3300050510 nmdc:mga06r32_257012_c1 nmdc:mga06r32_257012_c1_200_1051 266
24 3300050511 nmdc:mga08y16_21560_c1 nmdc:mga08y16_21560_c1_5084_5935 266
25 3300013104 Ga0157370_10312303 Ga0157370_103123032 269
26 3300025915 Ga0207693_10046200 Ga0207693_100462002 269
27 3300035170 Ga0373943_0274091 Ga0373943_0274091_102_935 269
28 3300035172 Ga0373955_0002628 Ga0373955_0002628_319_1152 269
29 3300035695 Ga0373927_0146852 Ga0373927_0146852_228_1061 269
30 3300035725 Ga0373947_0156203 Ga0373947_0156203_459_1292 269
31 3300036401 Ga0373937_0370545 Ga0373937_0370545_355_1188 269
32 3300037068 Ga0373925_0148541 Ga0373925_0148541_50_883 269
33 3300037853 Ga0436364_0210276 Ga0436364_0210276_37_873 269
34 3300046463 Ga0495653_0256922 Ga0495653_0256922_88_921 269
35 3300039450 Ga0436363_1076056 Ga0436363_1076056_1008_1844 272
36 3300045051 Ga0451576_0330317 Ga0451576_0330317_21_860 272
37 3300005327 Ga0070658_10051305 Ga0070658_100513053 273
38 3300005328 Ga0070676_10064433 Ga0070676_100644333 273
39 3300005330 Ga0070690_100010677 Ga0070690_1000106776 273
40 3300005331 Ga0070670_100062981 Ga0070670_1000629811 273
41 3300005333 Ga0070677_10010018 Ga0070677_100100184 273
42 3300005335 Ga0070666_10058323 Ga0070666_100583231 273
43 3300005335 Ga0070666_10225728 Ga0070666_102257281 273
44 3300005335 Ga0070666_10373623 Ga0070666_103736232 273
45 3300005338 Ga0068868_100332802 Ga0068868_1003328021 273
46 3300005340 Ga0070689_100267039 Ga0070689_1002670391 273
47 3300005347 Ga0070668_100018225 Ga0070668_1000182253 273
48 3300005353 Ga0070669_100020459 Ga0070669_1000204596 273
49 3300005354 Ga0070675_100032040 Ga0070675_1000320402 273
50 3300005355 Ga0070671_100098960 Ga0070671_1000989603 273
51 3300005356 Ga0070674_100043915 Ga0070674_1000439154 273
52 3300005364 Ga0070673_100084444 Ga0070673_1000844442 273
53 3300005365 Ga0070688_100026974 Ga0070688_1000269745 273
54 3300005367 Ga0070667_100337323 Ga0070667_1003373232 273
55 3300005367 Ga0070667_100372727 Ga0070667_1003727272 273
56 3300005438 Ga0070701_10016634 Ga0070701_100166345 273
57 3300005444 Ga0070694_100164966 Ga0070694_1001649662 273
58 3300005457 Ga0070662_100020262 Ga0070662_1000202622 273
59 3300005458 Ga0070681_10038418 Ga0070681_100384184 273
60 3300005530 Ga0070679_100281326 Ga0070679_1002813262 273
61 3300005543 Ga0070672_100077635 Ga0070672_1000776353 273
62 3300005545 Ga0070695_100215593 Ga0070695_1002155931 273
63 3300005617 Ga0068859_100578593 Ga0068859_1005785932 273
64 3300005618 Ga0068864_100029363 Ga0068864_1000293632 273
65 3300005718 Ga0068866_10011868 Ga0068866_100118682 273
66 3300005719 Ga0068861_100008733 Ga0068861_1000087333 273
67 3300005840 Ga0068870_10002446 Ga0068870_100024467 273
68 3300005841 Ga0068863_100225933 Ga0068863_1002259332 273
69 3300005841 Ga0068863_100386266 Ga0068863_1003862661 273
70 3300005842 Ga0068858_100124714 Ga0068858_1001247143 273
71 3300005843 Ga0068860_100058243 Ga0068860_1000582433 273
72 3300005843 Ga0068860_100472076 Ga0068860_1004720762 273
73 3300005844 Ga0068862_100017892 Ga0068862_1000178925 273
74 3300006237 Ga0097621_100136507 Ga0097621_1001365072 273
75 3300006237 Ga0097621_100306701 Ga0097621_1003067012 273
76 3300006881 Ga0068865_100208964 Ga0068865_1002089642 273
77 3300006931 Ga0097620_100578589 Ga0097620_1005785892 273
78 3300009094 Ga0111539_10054232 Ga0111539_100542325 273
79 3300009098 Ga0105245_10272929 Ga0105245_102729292 273
80 3300009101 Ga0105247_10114373 Ga0105247_101143732 273
81 3300009148 Ga0105243_10015145 Ga0105243_100151457 273
82 3300009176 Ga0105242_10132260 Ga0105242_101322601 273
83 3300009177 Ga0105248_10057324 Ga0105248_100573241 273
84 3300009553 Ga0105249_10132999 Ga0105249_101329992 273
85 3300011119 Ga0105246_10145320 Ga0105246_101453202 273
86 3300013296 Ga0157374_10053226 Ga0157374_100532262 273
87 3300013297 Ga0157378_10467386 Ga0157378_104673862 273
88 3300013306 Ga0163162_10134585 Ga0163162_101345851 273
89 3300013308 Ga0157375_10014050 Ga0157375_100140502 273
90 3300014325 Ga0163163_10184372 Ga0163163_101843723 273
91 3300014326 Ga0157380_10036806 Ga0157380_100368065 273
92 3300014745 Ga0157377_10045882 Ga0157377_100458821 273
93 3300014968 Ga0157379_10220429 Ga0157379_102204292 273
94 3300014969 Ga0157376_10029306 Ga0157376_100293062 273
95 3300017792 Ga0163161_10014586 Ga0163161_100145864 273
96 3300017792 Ga0163161_10591729 Ga0163161_105917291 273
97 3300025271 Ga0207666_1015518 Ga0207666_10155182 273
98 3300025893 Ga0207682_10014559 Ga0207682_100145591 273
99 3300025899 Ga0207642_10024383 Ga0207642_100243831 273
100 3300025899 Ga0207642_10096462 Ga0207642_100964621 273
101 3300025901 Ga0207688_10005957 Ga0207688_100059578 273
102 3300025903 Ga0207680_10012243 Ga0207680_100122434 273
103 3300025908 Ga0207643_10060259 Ga0207643_100602591 273
104 3300025920 Ga0207649_10083580 Ga0207649_100835802 273
105 3300025925 Ga0207650_10026018 Ga0207650_100260181 273
106 3300025925 Ga0207650_10092028 Ga0207650_100920283 273
107 3300025925 Ga0207650_10137943 Ga0207650_101379431 273
108 3300025925 Ga0207650_10291318 Ga0207650_102913181 273
109 3300025926 Ga0207659_10011144 Ga0207659_100111443 273
110 3300025926 Ga0207659_10392435 Ga0207659_103924352 273
111 3300025926 Ga0207659_10409742 Ga0207659_104097422 273
112 3300025927 Ga0207687_10016642 Ga0207687_100166423 273
113 3300025931 Ga0207644_10072039 Ga0207644_100720393 273
114 3300025931 Ga0207644_10220117 Ga0207644_102201172 273
115 3300025933 Ga0207706_10013948 Ga0207706_100139486 273
116 3300025933 Ga0207706_10395187 Ga0207706_103951872 273
117 3300025935 Ga0207709_10047835 Ga0207709_100478353 273
118 3300025936 Ga0207670_10271095 Ga0207670_102710952 273
119 3300025937 Ga0207669_10069448 Ga0207669_100694483 273
120 3300025938 Ga0207704_10049398 Ga0207704_100493981 273
121 3300025940 Ga0207691_10018115 Ga0207691_100181157 273
122 3300025940 Ga0207691_10067145 Ga0207691_100671455 273
123 3300025940 Ga0207691_10195337 Ga0207691_101953372 273
124 3300025941 Ga0207711_10058850 Ga0207711_100588501 273
125 3300025941 Ga0207711_10104303 Ga0207711_101043033 273
126 3300025942 Ga0207689_10041899 Ga0207689_100418993 273
127 3300025961 Ga0207712_10066434 Ga0207712_100664342 273
128 3300025986 Ga0207658_10391434 Ga0207658_103914342 273
129 3300026023 Ga0207677_10070093 Ga0207677_100700932 273
130 3300026023 Ga0207677_10590118 Ga0207677_105901182 273
131 3300026035 Ga0207703_10310108 Ga0207703_103101081 273
132 3300026075 Ga0207708_10027298 Ga0207708_100272981 273
133 3300026088 Ga0207641_10026717 Ga0207641_100267172 273
134 3300026088 Ga0207641_10430836 Ga0207641_104308361 273
135 3300026089 Ga0207648_10018035 Ga0207648_100180351 273
136 3300026095 Ga0207676_10004198 Ga0207676_100041989 273
137 3300026095 Ga0207676_10076687 Ga0207676_100766871 273
138 3300026095 Ga0207676_10227075 Ga0207676_102270752 273
139 3300026118 Ga0207675_100057233 Ga0207675_1000572332 273
140 3300026121 Ga0207683_10078100 Ga0207683_100781001 273
141 3300026121 Ga0207683_10423726 Ga0207683_104237261 273
142 3300026142 Ga0207698_10448515 Ga0207698_104485152 273
143 3300027907 Ga0207428_10435746 Ga0207428_104357461 273
144 3300028380 Ga0268265_10535433 Ga0268265_105354332 273
145 3300028381 Ga0268264_10140736 Ga0268264_101407361 273
146 3300028381 Ga0268264_10575601 Ga0268264_105756011 273
147 3300039453 Ga0436362_0672745 Ga0436362_0672745_184_1032 273
148 3300046528 Ga0495642_0016547 Ga0495642_0016547_587_1420 273
149 3300046537 Ga0495598_0007052 Ga0495598_0007052_367_1200 273
150 3300046683 Ga0495658_0094420 Ga0495658_0094420_527_1360 273
151 3300048912 Ga0496109_0414803 Ga0496109_0414803_367_1197 273
152 3300048913 Ga0496110_0041884 Ga0496110_0041884_2794_3624 273
153 3300048913 Ga0496110_0448626 Ga0496110_0448626_287_1108 273
154 3300048917 Ga0496114_0305120 Ga0496114_0305120_347_1180 273
155 3300050511 nmdc:mga08y16_558676_c1 nmdc:mga08y16_558676_c1_77_910 273
156 3300005354 Ga0070675_100075714 Ga0070675_1000757142 274
157 3300005434 Ga0070709_10257894 Ga0070709_102578941 274
158 3300005435 Ga0070714_100032868 Ga0070714_1000328682 274
159 3300005435 Ga0070714_100413839 Ga0070714_1004138391 274
160 3300005444 Ga0070694_100104772 Ga0070694_1001047722 274
161 3300005445 Ga0070708_100042642 Ga0070708_1000426423 274
162 3300005467 Ga0070706_100405927 Ga0070706_1004059272 274
163 3300005468 Ga0070707_100029238 Ga0070707_1000292384 274
164 3300005518 Ga0070699_100005810 Ga0070699_1000058108 274
165 3300005536 Ga0070697_100091218 Ga0070697_1000912184 274
166 3300005545 Ga0070695_100005791 Ga0070695_1000057916 274
167 3300005545 Ga0070695_100157100 Ga0070695_1001571002 274
168 3300005546 Ga0070696_100036674 Ga0070696_1000366742 274
169 3300005546 Ga0070696_100598705 Ga0070696_1005987051 274
170 3300005549 Ga0070704_100231572 Ga0070704_1002315722 274
171 3300005614 Ga0068856_100155490 Ga0068856_1001554902 274
172 3300005615 Ga0070702_100077461 Ga0070702_1000774612 274
173 3300005615 Ga0070702_100227410 Ga0070702_1002274102 274
174 3300005617 Ga0068859_100528360 Ga0068859_1005283601 274
175 3300005618 Ga0068864_100140213 Ga0068864_1001402133 274
176 3300005844 Ga0068862_100013361 Ga0068862_1000133614 274
177 3300005844 Ga0068862_100146488 Ga0068862_1001464883 274
178 3300005937 Ga0081455_10003829 Ga0081455_1000382911 274
179 3300006028 Ga0070717_10055316 Ga0070717_100553163 274
180 3300006844 Ga0075428_100526758 Ga0075428_1005267582 274
181 3300006880 Ga0075429_100289998 Ga0075429_1002899982 274
182 3300006931 Ga0097620_100528340 Ga0097620_1005283402 274
183 3300007076 Ga0075435_100057953 Ga0075435_1000579533 274
184 3300009098 Ga0105245_10109569 Ga0105245_101095692 274
185 3300009147 Ga0114129_10329703 Ga0114129_103297032 274
186 3300009148 Ga0105243_10017154 Ga0105243_100171545 274
187 3300009553 Ga0105249_10261224 Ga0105249_102612242 274
188 3300013306 Ga0163162_10603647 Ga0163162_106036472 274
189 3300013307 Ga0157372_10523849 Ga0157372_105238492 274
190 3300025907 Ga0207645_10107017 Ga0207645_101070172 274
191 3300025910 Ga0207684_10000673 Ga0207684_100006736 274
192 3300025922 Ga0207646_10001668 Ga0207646_1000166828 274
193 3300025922 Ga0207646_10024791 Ga0207646_100247914 274
194 3300025927 Ga0207687_10201853 Ga0207687_102018532 274
195 3300025928 Ga0207700_10029038 Ga0207700_100290385 274
196 3300025928 Ga0207700_10144112 Ga0207700_101441122 274
197 3300025928 Ga0207700_10168225 Ga0207700_101682252 274
198 3300025929 Ga0207664_10012103 Ga0207664_100121035 274
199 3300025929 Ga0207664_10192368 Ga0207664_101923682 274
200 3300025931 Ga0207644_10071757 Ga0207644_100717572 274
201 3300025934 Ga0207686_10146121 Ga0207686_101461212 274
202 3300025935 Ga0207709_10063266 Ga0207709_100632662 274
203 3300025939 Ga0207665_10085816 Ga0207665_100858163 274
204 3300025942 Ga0207689_10002119 Ga0207689_1000211914 274
205 3300025949 Ga0207667_10408278 Ga0207667_104082782 274
206 3300025961 Ga0207712_10261095 Ga0207712_102610952 274
207 3300026075 Ga0207708_10152174 Ga0207708_101521742 274
208 3300026078 Ga0207702_10048474 Ga0207702_100484742 274
209 3300026089 Ga0207648_10097994 Ga0207648_100979944 274
210 3300027395 Ga0209996_1000437 Ga0209996_10004375 274
211 3300027424 Ga0209984_1010499 Ga0209984_10104991 274
212 3300027462 Ga0210000_1009653 Ga0210000_10096532 274
213 3300027471 Ga0209995_1003242 Ga0209995_10032422 274
214 3300027526 Ga0209968_1000769 Ga0209968_10007695 274
215 3300027543 Ga0209999_1000908 Ga0209999_10009082 274
216 3300027552 Ga0209982_1001961 Ga0209982_10019612 274
217 3300027614 Ga0209970_1000737 Ga0209970_10007374 274
218 3300027617 Ga0210002_1024207 Ga0210002_10242071 274
219 3300027665 Ga0209983_1000271 Ga0209983_10002714 274
220 3300027682 Ga0209971_1000036 Ga0209971_100003645 274
221 3300027695 Ga0209966_1000021 Ga0209966_100002144 274
222 3300027717 Ga0209998_10000002 Ga0209998_1000000276 274
223 3300027876 Ga0209974_10002471 Ga0209974_100024712 274
224 3300028380 Ga0268265_10008105 Ga0268265_100081052 274
225 3300035691 Ga0373931_0075287 Ga0373931_0075287_19_873 274
226 3300035695 Ga0373927_0088486 Ga0373927_0088486_244_1098 274
227 3300037853 Ga0436364_0675117 Ga0436364_0675117_55_954 274
228 3300039437 Ga0436365_1156765 Ga0436365_1156765_2030_2881 274
229 3300039450 Ga0436363_0290638 Ga0436363_0290638_734_1585 274
230 3300042012 Ga0439455_0038172 Ga0439455_0038172_172_1002 274
231 3300042016 Ga0439463_018975 Ga0439463_018975_755_1582 274
232 3300042439 Ga0439464_0000383 Ga0439464_0000383_2740_3567 274
233 3300042461 Ga0439460_0003649 Ga0439460_0003649_2431_3258 274
234 3300042876 Ga0451577_0129375 Ga0451577_0129375_405_1232 274
235 3300045051 Ga0451576_0073845 Ga0451576_0073845_906_1733 274
236 3300048908 Ga0496105_0540347 Ga0496105_0540347_28_879 274
237 3300048912 Ga0496109_0473779 Ga0496109_0473779_217_1068 274
238 3300048913 Ga0496110_0102006 Ga0496110_0102006_1264_2118 274
239 3300048916 Ga0496113_0122374 Ga0496113_0122374_172_1026 274
240 3300048917 Ga0496114_0005334 Ga0496114_0005334_7533_8384 274
241 3300049568 Ga0501031_0105071 Ga0501031_0105071_434_1261 274
242 3300049569 Ga0501032_0310903 Ga0501032_0310903_50_898 274
243 3300049571 Ga0501034_0163724 Ga0501034_0163724_510_1355 274
244 3300049572 Ga0501036_0137253 Ga0501036_0137253_1172_1999 274
245 3300049573 Ga0501037_0037983 Ga0501037_0037983_1061_1888 274
246 3300049575 Ga0501039_0018005 Ga0501039_0018005_3380_4207 274
247 3300049575 Ga0501039_0242598 Ga0501039_0242598_480_1310 274
248 3300049576 Ga0501040_0010980 Ga0501040_0010980_741_1568 274
249 3300049577 Ga0501041_0030887 Ga0501041_0030887_1016_1843 274
250 3300049578 Ga0501042_0003463 Ga0501042_0003463_8456_9283 274
251 3300049578 Ga0501042_0130631 Ga0501042_0130631_502_1347 274
252 3300049578 Ga0501042_0210040 Ga0501042_0210040_458_1285 274
253 3300049579 Ga0501043_0049422 Ga0501043_0049422_1753_2580 274
254 3300049580 Ga0501046_0000240 Ga0501046_0000240_20029_20856 274
255 3300049581 Ga0501047_0046156 Ga0501047_0046156_2766_3593 274
256 3300049582 Ga0501048_0018933 Ga0501048_0018933_4092_4919 274
257 3300049587 Ga0501071_0071454 Ga0501071_0071454_425_1270 274
258 3300049588 Ga0501072_0039460 Ga0501072_0039460_2089_2934 274
259 3300049588 Ga0501072_0110664 Ga0501072_0110664_1150_1977 274
260 3300049590 Ga0501074_0010370 Ga0501074_0010370_1494_2321 274
261 3300049591 Ga0501075_0257981 Ga0501075_0257981_73_900 274
262 3300049592 Ga0501076_0006954 Ga0501076_0006954_692_1519 274
263 3300049592 Ga0501076_0048596 Ga0501076_0048596_2098_2943 274
264 3300049593 Ga0501077_0019306 Ga0501077_0019306_2510_3337 274
265 3300049741 Ga0501079_0005994 Ga0501079_0005994_1378_2205 274
266 3300049741 Ga0501079_0075611 Ga0501079_0075611_1064_1909 274
267 3300049741 Ga0501079_0078174 Ga0501079_0078174_477_1307 274
268 3300049742 Ga0501080_0024101 Ga0501080_0024101_670_1497 274
269 3300049743 Ga0501081_0002066 Ga0501081_0002066_252_1079 274
270 3300049743 Ga0501081_0118454 Ga0501081_0118454_521_1348 274
271 3300049824 Ga0501045_0003643 Ga0501045_0003643_4630_5457 274
272 3300049824 Ga0501045_0057687 Ga0501045_0057687_882_1727 274
273 3300050512 nmdc:mga0n895_148729_c1 nmdc:mga0n895_148729_c1_1383_2228 274
274 3300050513 nmdc:mga0rr50_103708_c1 nmdc:mga0rr50_103708_c1_499_1344 274
275 3300054114 Ga0501084_0011701 Ga0501084_0011701_6201_7028 274
276 3300054114 Ga0501084_0352855 Ga0501084_0352855_96_941 274
277 3300060353 Ga0501082_0002744 Ga0501082_0002744_13742_14569 274
278 3300061734 Ga0530510_0017719 Ga0530510_0017719_318_1145 274
279 3300061734 Ga0530510_0374154 Ga0530510_0374154_192_1037 274
280 3300003203 JGI25406J46586_10005914 JGI25406J46586_100059146 275
281 3300005330 Ga0070690_100275106 Ga0070690_1002751062 275
282 3300005330 Ga0070690_100459037 Ga0070690_1004590371 275
283 3300005331 Ga0070670_100004356 Ga0070670_1000043563 275
284 3300005334 Ga0068869_100001903 Ga0068869_1000019038 275
285 3300005334 Ga0068869_100466183 Ga0068869_1004661831 275
286 3300005335 Ga0070666_10099455 Ga0070666_100994552 275
287 3300005336 Ga0070680_100002663 Ga0070680_1000026637 275
288 3300005337 Ga0070682_100005961 Ga0070682_1000059613 275
289 3300005338 Ga0068868_100051865 Ga0068868_1000518653 275
290 3300005339 Ga0070660_100000640 Ga0070660_1000006407 275
291 3300005340 Ga0070689_100011348 Ga0070689_1000113482 275
292 3300005345 Ga0070692_10048151 Ga0070692_100481512 275
293 3300005353 Ga0070669_100042300 Ga0070669_1000423003 275
294 3300005353 Ga0070669_100059128 Ga0070669_1000591282 275
295 3300005353 Ga0070669_100155477 Ga0070669_1001554772 275
296 3300005353 Ga0070669_100291805 Ga0070669_1002918052 275
297 3300005356 Ga0070674_100125540 Ga0070674_1001255402 275
298 3300005364 Ga0070673_100097873 Ga0070673_1000978732 275
299 3300005366 Ga0070659_100004266 Ga0070659_1000042663 275
300 3300005435 Ga0070714_100089109 Ga0070714_1000891092 275
301 3300005436 Ga0070713_100019223 Ga0070713_1000192233 275
302 3300005436 Ga0070713_100055242 Ga0070713_1000552422 275
303 3300005436 Ga0070713_100089786 Ga0070713_1000897863 275
304 3300005436 Ga0070713_100398598 Ga0070713_1003985981 275
305 3300005437 Ga0070710_10024515 Ga0070710_100245152 275
306 3300005437 Ga0070710_10272451 Ga0070710_102724512 275
307 3300005438 Ga0070701_10026266 Ga0070701_100262662 275
308 3300005440 Ga0070705_100001700 Ga0070705_1000017004 275
309 3300005440 Ga0070705_100082834 Ga0070705_1000828342 275
310 3300005444 Ga0070694_100002292 Ga0070694_1000022927 275
311 3300005444 Ga0070694_100045828 Ga0070694_1000458281 275
312 3300005445 Ga0070708_100004836 Ga0070708_1000048362 275
313 3300005445 Ga0070708_100043416 Ga0070708_1000434165 275
314 3300005445 Ga0070708_100108359 Ga0070708_1001083592 275
315 3300005445 Ga0070708_100117321 Ga0070708_1001173212 275
316 3300005455 Ga0070663_100007247 Ga0070663_1000072475 275
317 3300005456 Ga0070678_100073447 Ga0070678_1000734473 275
318 3300005457 Ga0070662_100002555 Ga0070662_1000025558 275
319 3300005458 Ga0070681_10170393 Ga0070681_101703932 275
320 3300005458 Ga0070681_10341027 Ga0070681_103410272 275
321 3300005459 Ga0068867_100013214 Ga0068867_1000132144 275
322 3300005459 Ga0068867_100133964 Ga0068867_1001339643 275
323 3300005466 Ga0070685_10134825 Ga0070685_101348251 275
324 3300005467 Ga0070706_100028326 Ga0070706_1000283262 275
325 3300005467 Ga0070706_100035276 Ga0070706_1000352762 275
326 3300005467 Ga0070706_100497470 Ga0070706_1004974702 275
327 3300005468 Ga0070707_100018737 Ga0070707_1000187374 275
328 3300005468 Ga0070707_100031685 Ga0070707_1000316854 275
329 3300005468 Ga0070707_100033692 Ga0070707_1000336925 275
330 3300005468 Ga0070707_100228442 Ga0070707_1002284422 275
331 3300005468 Ga0070707_100396853 Ga0070707_1003968532 275
332 3300005471 Ga0070698_100002771 Ga0070698_10000277116 275
333 3300005471 Ga0070698_100010750 Ga0070698_1000107504 275
334 3300005471 Ga0070698_100066274 Ga0070698_1000662743 275
335 3300005471 Ga0070698_100319063 Ga0070698_1003190632 275
336 3300005518 Ga0070699_100001298 Ga0070699_1000012986 275
337 3300005518 Ga0070699_100079176 Ga0070699_1000791762 275
338 3300005518 Ga0070699_100086970 Ga0070699_1000869704 275
339 3300005518 Ga0070699_100087282 Ga0070699_1000872822 275
340 3300005518 Ga0070699_100196457 Ga0070699_1001964572 275
341 3300005518 Ga0070699_100222187 Ga0070699_1002221872 275
342 3300005518 Ga0070699_100308771 Ga0070699_1003087711 275
343 3300005518 Ga0070699_100523005 Ga0070699_1005230051 275
344 3300005530 Ga0070679_100002921 Ga0070679_1000029217 275
345 3300005530 Ga0070679_100201853 Ga0070679_1002018532 275
346 3300005535 Ga0070684_100139178 Ga0070684_1001391783 275
347 3300005536 Ga0070697_100044718 Ga0070697_1000447184 275
348 3300005536 Ga0070697_100074319 Ga0070697_1000743192 275
349 3300005536 Ga0070697_100131637 Ga0070697_1001316372 275
350 3300005539 Ga0068853_100023398 Ga0068853_1000233983 275
351 3300005543 Ga0070672_100014156 Ga0070672_1000141565 275
352 3300005544 Ga0070686_100118364 Ga0070686_1001183642 275
353 3300005545 Ga0070695_100008322 Ga0070695_1000083222 275
354 3300005546 Ga0070696_100002170 Ga0070696_1000021705 275
355 3300005547 Ga0070693_100000283 Ga0070693_10000028316 275
356 3300005547 Ga0070693_100428098 Ga0070693_1004280981 275
357 3300005548 Ga0070665_100509302 Ga0070665_1005093021 275
358 3300005549 Ga0070704_100193532 Ga0070704_1001935322 275
359 3300005549 Ga0070704_100203833 Ga0070704_1002038332 275
360 3300005549 Ga0070704_100291594 Ga0070704_1002915942 275
361 3300005563 Ga0068855_100008748 Ga0068855_1000087485 275
362 3300005577 Ga0068857_100539293 Ga0068857_1005392931 275
363 3300005578 Ga0068854_100000849 Ga0068854_10000084913 275
364 3300005614 Ga0068856_100015440 Ga0068856_1000154405 275
365 3300005614 Ga0068856_100369559 Ga0068856_1003695592 275
366 3300005617 Ga0068859_100015115 Ga0068859_1000151156 275
367 3300005618 Ga0068864_100077990 Ga0068864_1000779902 275
368 3300005719 Ga0068861_100044905 Ga0068861_1000449052 275
369 3300005719 Ga0068861_100049093 Ga0068861_1000490934 275
370 3300005719 Ga0068861_100310977 Ga0068861_1003109773 275
371 3300005841 Ga0068863_100023209 Ga0068863_1000232093 275
372 3300005841 Ga0068863_100082178 Ga0068863_1000821782 275
373 3300005842 Ga0068858_100040117 Ga0068858_1000401172 275
374 3300005843 Ga0068860_100599264 Ga0068860_1005992642 275
375 3300005844 Ga0068862_100002414 Ga0068862_1000024145 275
376 3300005844 Ga0068862_100505706 Ga0068862_1005057062 275
377 3300005983 Ga0081540_1002103 Ga0081540_100210312 275
378 3300005985 Ga0081539_10000044 Ga0081539_10000044205 275
379 3300006028 Ga0070717_10001390 Ga0070717_100013903 275
380 3300006028 Ga0070717_10063058 Ga0070717_100630583 275
381 3300006175 Ga0070712_100060180 Ga0070712_1000601803 275
382 3300006175 Ga0070712_100374553 Ga0070712_1003745532 275
383 3300006237 Ga0097621_100674383 Ga0097621_1006743832 275
384 3300006358 Ga0068871_100317860 Ga0068871_1003178601 275
385 3300006844 Ga0075428_100010575 Ga0075428_1000105754 275
386 3300006844 Ga0075428_100013472 Ga0075428_1000134721 275
387 3300006844 Ga0075428_100025119 Ga0075428_1000251194 275
388 3300006844 Ga0075428_100046058 Ga0075428_1000460583 275
389 3300006844 Ga0075428_100055445 Ga0075428_1000554454 275
390 3300006844 Ga0075428_100308038 Ga0075428_1003080382 275
391 3300006846 Ga0075430_100000577 Ga0075430_10000057725 275
392 3300006846 Ga0075430_100000658 Ga0075430_1000006584 275
393 3300006847 Ga0075431_100000635 Ga0075431_10000063513 275
394 3300006847 Ga0075431_100000847 Ga0075431_10000084711 275
395 3300006847 Ga0075431_100005898 Ga0075431_1000058982 275
396 3300006847 Ga0075431_100007172 Ga0075431_10000717210 275
397 3300006847 Ga0075431_100117031 Ga0075431_1001170313 275
398 3300006847 Ga0075431_100117969 Ga0075431_1001179694 275
399 3300006847 Ga0075431_100441051 Ga0075431_1004410512 275
400 3300006852 Ga0075433_10001836 Ga0075433_100018368 275
401 3300006852 Ga0075433_10005357 Ga0075433_100053575 275
402 3300006852 Ga0075433_10009282 Ga0075433_100092827 275
403 3300006852 Ga0075433_10009564 Ga0075433_100095647 275
404 3300006852 Ga0075433_10016703 Ga0075433_100167033 275
405 3300006852 Ga0075433_10018680 Ga0075433_100186801 275
406 3300006852 Ga0075433_10081243 Ga0075433_100812433 275
407 3300006852 Ga0075433_10092314 Ga0075433_100923144 275
408 3300006852 Ga0075433_10267092 Ga0075433_102670922 275
409 3300006871 Ga0075434_100010082 Ga0075434_10001008210 275
410 3300006871 Ga0075434_100014963 Ga0075434_1000149637 275
411 3300006871 Ga0075434_100017262 Ga0075434_1000172626 275
412 3300006871 Ga0075434_100055043 Ga0075434_1000550432 275
413 3300006871 Ga0075434_100300616 Ga0075434_1003006162 275
414 3300006871 Ga0075434_100306757 Ga0075434_1003067571 275
415 3300006871 Ga0075434_100567100 Ga0075434_1005671002 275
416 3300006871 Ga0075434_100731558 Ga0075434_1007315581 275
417 3300006880 Ga0075429_100000237 Ga0075429_10000023736 275
418 3300006880 Ga0075429_100000485 Ga0075429_10000048523 275
419 3300006880 Ga0075429_100003182 Ga0075429_1000031824 275
420 3300006880 Ga0075429_100013779 Ga0075429_1000137795 275
421 3300006880 Ga0075429_100029625 Ga0075429_1000296254 275
422 3300006880 Ga0075429_100060882 Ga0075429_1000608823 275
423 3300006880 Ga0075429_100288484 Ga0075429_1002884842 275
424 3300006880 Ga0075429_100338754 Ga0075429_1003387542 275
425 3300006914 Ga0075436_100001548 Ga0075436_1000015482 275
426 3300006914 Ga0075436_100020521 Ga0075436_1000205214 275
427 3300006914 Ga0075436_100023406 Ga0075436_1000234064 275
428 3300006914 Ga0075436_100039002 Ga0075436_1000390022 275
429 3300006914 Ga0075436_100061038 Ga0075436_1000610384 275
430 3300006914 Ga0075436_100107640 Ga0075436_1001076402 275
431 3300006931 Ga0097620_100015115 Ga0097620_1000151152 275
432 3300007076 Ga0075435_100010992 Ga0075435_1000109926 275
433 3300007076 Ga0075435_100013882 Ga0075435_1000138822 275
434 3300007076 Ga0075435_100016614 Ga0075435_1000166145 275
435 3300007076 Ga0075435_100182920 Ga0075435_1001829202 275
436 3300007265 Ga0099794_10003220 Ga0099794_100032203 275
437 3300007788 Ga0099795_10015030 Ga0099795_100150302 275
438 3300007788 Ga0099795_10061093 Ga0099795_100610932 275
439 3300009094 Ga0111539_10000139 Ga0111539_1000013960 275
440 3300009094 Ga0111539_10005684 Ga0111539_100056847 275
441 3300009094 Ga0111539_10027347 Ga0111539_100273474 275
442 3300009094 Ga0111539_10029747 Ga0111539_100297475 275
443 3300009094 Ga0111539_10043841 Ga0111539_100438414 275
444 3300009094 Ga0111539_10137181 Ga0111539_101371815 275
445 3300009094 Ga0111539_10152633 Ga0111539_101526332 275
446 3300009094 Ga0111539_10801890 Ga0111539_108018901 275
447 3300009147 Ga0114129_10000149 Ga0114129_1000014956 275
448 3300009147 Ga0114129_10000562 Ga0114129_1000056235 275
449 3300009147 Ga0114129_10009090 Ga0114129_100090905 275
450 3300009147 Ga0114129_10041323 Ga0114129_100413235 275
451 3300009147 Ga0114129_10049654 Ga0114129_100496546 275
452 3300009147 Ga0114129_10053694 Ga0114129_100536947 275
453 3300009147 Ga0114129_10057600 Ga0114129_100576005 275
454 3300009147 Ga0114129_10072996 Ga0114129_100729962 275
455 3300009147 Ga0114129_10128949 Ga0114129_101289493 275
456 3300009147 Ga0114129_10136000 Ga0114129_101360003 275
457 3300009147 Ga0114129_10572313 Ga0114129_105723132 275
458 3300009147 Ga0114129_11196120 Ga0114129_111961201 275
459 3300009148 Ga0105243_10050781 Ga0105243_100507814 275
460 3300009148 Ga0105243_10428915 Ga0105243_104289152 275
461 3300009148 Ga0105243_10451637 Ga0105243_104516372 275
462 3300009174 Ga0105241_10010553 Ga0105241_100105534 275
463 3300009174 Ga0105241_10028648 Ga0105241_100286485 275
464 3300009177 Ga0105248_10068601 Ga0105248_100686014 275
465 3300009177 Ga0105248_10442636 Ga0105248_104426362 275
466 3300009177 Ga0105248_10478469 Ga0105248_104784691 275
467 3300010159 Ga0099796_10056947 Ga0099796_100569471 275
468 3300010375 Ga0105239_10032525 Ga0105239_100325251 275
469 3300010375 Ga0105239_10772432 Ga0105239_107724321 275
470 3300011119 Ga0105246_10056054 Ga0105246_100560542 275
471 3300013100 Ga0157373_10000457 Ga0157373_100004578 275
472 3300013105 Ga0157369_10005377 Ga0157369_100053775 275
473 3300013105 Ga0157369_10092406 Ga0157369_100924061 275
474 3300013297 Ga0157378_10069886 Ga0157378_100698863 275
475 3300013297 Ga0157378_10094574 Ga0157378_100945743 275
476 3300013306 Ga0163162_10070826 Ga0163162_100708263 275
477 3300013307 Ga0157372_10024219 Ga0157372_100242193 275
478 3300014326 Ga0157380_10079992 Ga0157380_100799923 275
479 3300014497 Ga0182008_10046829 Ga0182008_100468292 275
480 3300014968 Ga0157379_10534292 Ga0157379_105342922 275
481 3300017792 Ga0163161_10191900 Ga0163161_101919002 275
482 3300021384 Ga0213876_10002708 Ga0213876_100027087 275
483 3300021388 Ga0213875_10000152 Ga0213875_1000015253 275
484 3300021388 Ga0213875_10007069 Ga0213875_100070692 275
485 3300021388 Ga0213875_10071533 Ga0213875_100715332 275
486 3300021388 Ga0213875_10118933 Ga0213875_101189331 275
487 3300022467 Ga0224712_10062806 Ga0224712_100628061 275
488 3300025885 Ga0207653_10012207 Ga0207653_100122072 275
489 3300025898 Ga0207692_10104611 Ga0207692_101046111 275
490 3300025898 Ga0207692_10203210 Ga0207692_102032102 275
491 3300025903 Ga0207680_10058046 Ga0207680_100580462 275
492 3300025903 Ga0207680_10312813 Ga0207680_103128131 275
493 3300025906 Ga0207699_10008581 Ga0207699_100085814 275
494 3300025906 Ga0207699_10033054 Ga0207699_100330543 275
495 3300025907 Ga0207645_10006681 Ga0207645_100066814 275
496 3300025908 Ga0207643_10001151 Ga0207643_100011519 275
497 3300025910 Ga0207684_10008211 Ga0207684_1000821111 275
498 3300025910 Ga0207684_10015297 Ga0207684_100152973 275
499 3300025910 Ga0207684_10016306 Ga0207684_100163065 275
500 3300025910 Ga0207684_10020113 Ga0207684_100201136 275
501 3300025910 Ga0207684_10030055 Ga0207684_100300554 275
502 3300025910 Ga0207684_10046446 Ga0207684_100464462 275
503 3300025910 Ga0207684_10338360 Ga0207684_103383602 275
504 3300025910 Ga0207684_10464587 Ga0207684_104645871 275
505 3300025911 Ga0207654_10026695 Ga0207654_100266954 275
506 3300025912 Ga0207707_10000158 Ga0207707_1000015822 275
507 3300025912 Ga0207707_10231471 Ga0207707_102314711 275
508 3300025915 Ga0207693_10014075 Ga0207693_100140757 275
509 3300025915 Ga0207693_10028525 Ga0207693_100285254 275
510 3300025915 Ga0207693_10107006 Ga0207693_101070062 275
511 3300025916 Ga0207663_10106012 Ga0207663_101060122 275
512 3300025917 Ga0207660_10000220 Ga0207660_1000022030 275
513 3300025920 Ga0207649_10058290 Ga0207649_100582902 275
514 3300025921 Ga0207652_10000290 Ga0207652_1000029030 275
515 3300025921 Ga0207652_10052275 Ga0207652_100522752 275
516 3300025922 Ga0207646_10023356 Ga0207646_100233566 275
517 3300025922 Ga0207646_10062141 Ga0207646_100621412 275
518 3300025923 Ga0207681_10079999 Ga0207681_100799993 275
519 3300025923 Ga0207681_10167084 Ga0207681_101670842 275
520 3300025923 Ga0207681_10215655 Ga0207681_102156552 275
521 3300025925 Ga0207650_10020548 Ga0207650_100205483 275
522 3300025926 Ga0207659_10049794 Ga0207659_100497941 275
523 3300025928 Ga0207700_10032949 Ga0207700_100329493 275
524 3300025928 Ga0207700_10063618 Ga0207700_100636183 275
525 3300025928 Ga0207700_10320485 Ga0207700_103204852 275
526 3300025928 Ga0207700_10436578 Ga0207700_104365781 275
527 3300025929 Ga0207664_10062701 Ga0207664_100627013 275
528 3300025929 Ga0207664_10273051 Ga0207664_102730511 275
529 3300025931 Ga0207644_10041322 Ga0207644_100413222 275
530 3300025932 Ga0207690_10001918 Ga0207690_100019185 275
531 3300025933 Ga0207706_10008340 Ga0207706_100083404 275
532 3300025933 Ga0207706_10068268 Ga0207706_100682682 275
533 3300025936 Ga0207670_10003369 Ga0207670_100033695 275
534 3300025936 Ga0207670_10338045 Ga0207670_103380451 275
535 3300025937 Ga0207669_10089703 Ga0207669_100897032 275
536 3300025938 Ga0207704_10433227 Ga0207704_104332271 275
537 3300025939 Ga0207665_10056133 Ga0207665_100561332 275
538 3300025940 Ga0207691_10013162 Ga0207691_100131626 275
539 3300025940 Ga0207691_10035866 Ga0207691_100358663 275
540 3300025941 Ga0207711_10232008 Ga0207711_102320082 275
541 3300025942 Ga0207689_10000277 Ga0207689_1000027739 275
542 3300025942 Ga0207689_10181365 Ga0207689_101813651 275
543 3300025944 Ga0207661_10293128 Ga0207661_102931282 275
544 3300025945 Ga0207679_10000820 Ga0207679_1000082016 275
545 3300025949 Ga0207667_10001638 Ga0207667_100016389 275
546 3300025960 Ga0207651_10186842 Ga0207651_101868422 275
547 3300025961 Ga0207712_10463820 Ga0207712_104638202 275
548 3300025972 Ga0207668_10146646 Ga0207668_101466462 275
549 3300025981 Ga0207640_10029885 Ga0207640_100298854 275
550 3300026035 Ga0207703_10017809 Ga0207703_100178092 275
551 3300026041 Ga0207639_10028956 Ga0207639_100289562 275
552 3300026067 Ga0207678_10031501 Ga0207678_100315012 275
553 3300026078 Ga0207702_10306424 Ga0207702_103064242 275
554 3300026088 Ga0207641_10080626 Ga0207641_100806262 275
555 3300026089 Ga0207648_10009469 Ga0207648_100094696 275
556 3300026089 Ga0207648_10095107 Ga0207648_100951074 275
557 3300026095 Ga0207676_10039226 Ga0207676_100392265 275
558 3300026116 Ga0207674_10022090 Ga0207674_100220903 275
559 3300026118 Ga0207675_100070214 Ga0207675_1000702144 275
560 3300026121 Ga0207683_10179420 Ga0207683_101794202 275
561 3300026142 Ga0207698_10706598 Ga0207698_107065981 275
562 3300027512 Ga0209179_1013621 Ga0209179_10136212 275
563 3300027671 Ga0209588_1004919 Ga0209588_10049194 275
564 3300027907 Ga0207428_10000239 Ga0207428_1000023957 275
565 3300027907 Ga0207428_10005083 Ga0207428_100050836 275
566 3300027907 Ga0207428_10023392 Ga0207428_100233922 275
567 3300027907 Ga0207428_10042288 Ga0207428_100422883 275
568 3300027907 Ga0207428_10238954 Ga0207428_102389542 275
569 3300028380 Ga0268265_10012301 Ga0268265_100123012 275
570 3300028380 Ga0268265_10191618 Ga0268265_101916182 275
571 3300028556 Ga0265337_1024465 Ga0265337_10244651 275
572 3300028800 Ga0265338_10076275 Ga0265338_100762752 275
573 3300031852 Ga0307410_10272828 Ga0307410_102728282 275
574 3300031901 Ga0307406_10241253 Ga0307406_102412532 275
575 3300032002 Ga0307416_100009526 Ga0307416_1000095262 275
576 3300032002 Ga0307416_100479814 Ga0307416_1004798141 275
577 3300034816 Ga0373930_0039796 Ga0373930_0039796_73_906 275
578 3300034817 Ga0373948_0018883 Ga0373948_0018883_194_1036 275
579 3300035084 Ga0373928_0013191 Ga0373928_0013191_391_1233 275
580 3300035091 Ga0373951_0014935 Ga0373951_0014935_605_1447 275
581 3300035112 Ga0373932_0031834 Ga0373932_0031834_474_1310 275
582 3300035121 Ga0373960_0005718 Ga0373960_0005718_1842_2684 275
583 3300035170 Ga0373943_0104521 Ga0373943_0104521_122_973 275
584 3300035172 Ga0373955_0027841 Ga0373955_0027841_2016_2867 275
585 3300035172 Ga0373955_0048691 Ga0373955_0048691_347_1198 275
586 3300035242 Ga0373962_0076125 Ga0373962_0076125_90_926 275
587 3300035410 Ga0373924_0015082 Ga0373924_0015082_1330_2181 275
588 3300035691 Ga0373931_0030071 Ga0373931_0030071_947_1789 275
589 3300035692 Ga0373935_0042106 Ga0373935_0042106_1571_2422 275
590 3300035692 Ga0373935_0358332 Ga0373935_0358332_50_904 275
591 3300035724 Ga0373933_0007224 Ga0373933_0007224_2741_3592 275
592 3300035724 Ga0373933_0183498 Ga0373933_0183498_277_1134 275
593 3300036401 Ga0373937_0014749 Ga0373937_0014749_2356_3213 275
594 3300036401 Ga0373937_0023034 Ga0373937_0023034_438_1289 275
595 3300036401 Ga0373937_0032893 Ga0373937_0032893_423_1274 275
596 3300036401 Ga0373937_0384630 Ga0373937_0384630_320_1174 275
597 3300037068 Ga0373925_0113004 Ga0373925_0113004_247_1098 275
598 3300037312 Ga0395899_0009538 Ga0395899_0009538_1659_2489 275
599 3300037418 Ga0395900_0013526 Ga0395900_0013526_6875_7705 275
600 3300037853 Ga0436364_0660746 Ga0436364_0660746_164_1003 275
601 3300037853 Ga0436364_0793378 Ga0436364_0793378_1038_1958 275
602 3300037853 Ga0436364_0883536 Ga0436364_0883536_53672_54526 275
603 3300037853 Ga0436364_1013423 Ga0436364_1013423_28258_29115 275
604 3300037853 Ga0436364_1072565 Ga0436364_1072565_5352_6209 275
605 3300037853 Ga0436364_1226760 Ga0436364_1226760_9473_10303 275
606 3300038443 Ga0395901_0003070 Ga0395901_0003070_5007_5837 275
607 3300039437 Ga0436365_0036618 Ga0436365_0036618_2731_3588 275
608 3300039437 Ga0436365_0158096 Ga0436365_0158096_76_909 275
609 3300039437 Ga0436365_0469579 Ga0436365_0469579_3559_4434 275
610 3300039437 Ga0436365_1088548 Ga0436365_1088548_257_1096 275
611 3300039437 Ga0436365_1692579 Ga0436365_1692579_3259_4089 275
612 3300039438 Ga0436360_0063921 Ga0436360_0063921_26_883 275
613 3300039438 Ga0436360_0301600 Ga0436360_0301600_735_1589 275
614 3300039438 Ga0436360_0416464 Ga0436360_0416464_709_1545 275
615 3300039447 Ga0436361_0156140 Ga0436361_0156140_23_853 275
616 3300039450 Ga0436363_0127255 Ga0436363_0127255_1259_2116 275
617 3300039450 Ga0436363_0845692 Ga0436363_0845692_1772_2626 275
618 3300039453 Ga0436362_0329835 Ga0436362_0329835_128_964 275
619 3300042001 Ga0439441_013384 Ga0439441_013384_261_1100 275
620 3300042005 Ga0439448_0004515 Ga0439448_0004515_1849_2691 275
621 3300042876 Ga0451577_0004128 Ga0451577_0004128_14405_15247 275
622 3300042876 Ga0451577_0011112 Ga0451577_0011112_4914_5744 275
623 3300044673 Ga0453683_0022559 Ga0453683_0022559_1642_2472 275
624 3300044673 Ga0453683_0086763 Ga0453683_0086763_139_993 275
625 3300044673 Ga0453683_0214742 Ga0453683_0214742_92_925 275
626 3300044694 Ga0466963_0076198 Ga0466963_0076198_329_1186 275
627 3300044712 Ga0453684_0079456 Ga0453684_0079456_2676_3506 275
628 3300044712 Ga0453684_0114765 Ga0453684_0114765_1178_2020 275
629 3300045051 Ga0451576_0029646 Ga0451576_0029646_3254_4084 275
630 3300045051 Ga0451576_0051373 Ga0451576_0051373_1502_2332 275
631 3300045976 Ga0466967_0480637 Ga0466967_0480637_182_1051 275
632 3300046454 Ga0495592_0052033 Ga0495592_0052033_195_1046 275
633 3300046454 Ga0495592_0133588 Ga0495592_0133588_373_1224 275
634 3300046462 Ga0495651_0020223 Ga0495651_0020223_48_899 275
635 3300046462 Ga0495651_0042141 Ga0495651_0042141_2005_2856 275
636 3300046472 Ga0495580_0002075 Ga0495580_0002075_7955_8791 275
637 3300046476 Ga0495662_0037066 Ga0495662_0037066_882_1736 275
638 3300046477 Ga0495664_0005183 Ga0495664_0005183_847_1698 275
639 3300046511 Ga0495608_0028486 Ga0495608_0028486_2159_3010 275
640 3300046511 Ga0495608_0116991 Ga0495608_0116991_73_924 275
641 3300046514 Ga0495618_0024655 Ga0495618_0024655_1338_2189 275
642 3300046516 Ga0495628_0162829 Ga0495628_0162829_583_1437 275
643 3300046529 Ga0495652_0171837 Ga0495652_0171837_345_1196 275
644 3300046533 Ga0495640_0103390 Ga0495640_0103390_50_901 275
645 3300046535 Ga0495586_0048986 Ga0495586_0048986_337_1191 275
646 3300046536 Ga0495587_0028607 Ga0495587_0028607_2158_3009 275
647 3300046543 Ga0495645_0001188 Ga0495645_0001188_15578_16429 275
648 3300046559 Ga0495667_0010033 Ga0495667_0010033_2093_2944 275
649 3300046559 Ga0495667_0165579 Ga0495667_0165579_357_1211 275
650 3300046615 Ga0495656_0021249 Ga0495656_0021249_447_1280 275
651 3300046678 Ga0495599_0021975 Ga0495599_0021975_1443_2294 275
652 3300046680 Ga0495646_0009838 Ga0495646_0009838_2927_3778 275
653 3300046809 Ga0495600_0049089 Ga0495600_0049089_269_1120 275
654 3300047315 Ga0495581_0188545 Ga0495581_0188545_311_1162 275
655 3300047317 Ga0495604_0069906 Ga0495604_0069906_1382_2233 275
656 3300047317 Ga0495604_0265967 Ga0495604_0265967_226_1077 275
657 3300047318 Ga0495636_0055524 Ga0495636_0055524_135_971 275
658 3300047319 Ga0495674_0153319 Ga0495674_0153319_274_1125 275
659 3300047322 Ga0495680_0016744 Ga0495680_0016744_3736_4590 275
660 3300047322 Ga0495680_0030134 Ga0495680_0030134_1664_2515 275
661 3300047444 Ga0495675_0001602 Ga0495675_0001602_1385_2236 275
662 3300048088 Ga0495602_0000230 Ga0495602_0000230_423_1274 275
663 3300048088 Ga0495602_0032285 Ga0495602_0032285_4064_4915 275
664 3300048905 Ga0496102_0104125 Ga0496102_0104125_1214_2056 275
665 3300048906 Ga0496103_0231975 Ga0496103_0231975_280_1122 275
666 3300048911 Ga0496108_0169510 Ga0496108_0169510_1018_1860 275
667 3300048915 Ga0496112_0122769 Ga0496112_0122769_175_1017 275
668 3300048929 Ga0496126_0155996 Ga0496126_0155996_335_1174 275
669 3300049570 Ga0501033_0037843 Ga0501033_0037843_2448_3281 275
670 3300049570 Ga0501033_0178748 Ga0501033_0178748_405_1235 275
671 3300049572 Ga0501036_0033040 Ga0501036_0033040_2244_3077 275
672 3300049572 Ga0501036_0219365 Ga0501036_0219365_318_1148 275
673 3300049575 Ga0501039_0266981 Ga0501039_0266981_113_946 275
674 3300049576 Ga0501040_0007257 Ga0501040_0007257_2843_3679 275
675 3300049577 Ga0501041_0004421 Ga0501041_0004421_4352_5185 275
676 3300049577 Ga0501041_0172113 Ga0501041_0172113_11_859 275
677 3300049578 Ga0501042_0120251 Ga0501042_0120251_220_1053 275
678 3300049579 Ga0501043_0081308 Ga0501043_0081308_1184_2035 275
679 3300049582 Ga0501048_0286847 Ga0501048_0286847_251_1081 275
680 3300049586 Ga0501070_0451272 Ga0501070_0451272_139_999 275
681 3300049588 Ga0501072_0042515 Ga0501072_0042515_571_1404 275
682 3300049588 Ga0501072_0177125 Ga0501072_0177125_109_939 275
683 3300049588 Ga0501072_0328160 Ga0501072_0328160_47_898 275
684 3300049589 Ga0501073_0175977 Ga0501073_0175977_411_1259 275
685 3300049591 Ga0501075_0011788 Ga0501075_0011788_269_1102 275
686 3300049591 Ga0501075_0124539 Ga0501075_0124539_847_1698 275
687 3300049591 Ga0501075_0145704 Ga0501075_0145704_903_1736 275
688 3300049591 Ga0501075_0146669 Ga0501075_0146669_712_1542 275
689 3300049591 Ga0501075_0277999 Ga0501075_0277999_172_1008 275
690 3300049592 Ga0501076_0002469 Ga0501076_0002469_2683_3516 275
691 3300049593 Ga0501077_0012786 Ga0501077_0012786_817_1647 275
692 3300049741 Ga0501079_0005268 Ga0501079_0005268_1606_2436 275
693 3300049741 Ga0501079_0027102 Ga0501079_0027102_1634_2467 275
694 3300049741 Ga0501079_0500457 Ga0501079_0500457_35_871 275
695 3300049742 Ga0501080_0015063 Ga0501080_0015063_3329_4159 275
696 3300049742 Ga0501080_0628070 Ga0501080_0628070_42_926 275
697 3300049743 Ga0501081_0002648 Ga0501081_0002648_5242_6072 275
698 3300049743 Ga0501081_0056081 Ga0501081_0056081_233_1066 275
699 3300049744 Ga0501083_0141644 Ga0501083_0141644_721_1554 275
700 3300050507 nmdc:mga05p37_1308_c1 nmdc:mga05p37_1308_c1_3588_4418 275
701 3300050507 nmdc:mga05p37_13403_c1 nmdc:mga05p37_13403_c1_2844_3692 275
702 3300050507 nmdc:mga05p37_216892_c1 nmdc:mga05p37_216892_c1_409_1239 275
703 3300050507 nmdc:mga05p37_221896_c1 nmdc:mga05p37_221896_c1_1367_2197 275
704 3300050507 nmdc:mga05p37_2288_c1 nmdc:mga05p37_2288_c1_9614_10444 275
705 3300050507 nmdc:mga05p37_292966_c1 nmdc:mga05p37_292966_c1_357_1208 275
706 3300050507 nmdc:mga05p37_50288_c1 nmdc:mga05p37_50288_c1_1567_2403 275
707 3300050507 nmdc:mga05p37_72351_c1 nmdc:mga05p37_72351_c1_1646_2488 275
708 3300050507 nmdc:mga05p37_78184_c1 nmdc:mga05p37_78184_c1_2442_3275 275
709 3300050507 nmdc:mga05p37_88888_c1 nmdc:mga05p37_88888_c1_1772_2602 275
710 3300050508 nmdc:mga09592_134194_c1 nmdc:mga09592_134194_c1_907_1737 275
711 3300050508 nmdc:mga09592_1983_c1 nmdc:mga09592_1983_c1_4634_5464 275
712 3300050508 nmdc:mga09592_27471_c1 nmdc:mga09592_27471_c1_2141_3031 275
713 3300050508 nmdc:mga09592_3499_c1 nmdc:mga09592_3499_c1_2586_3416 275
714 3300050508 nmdc:mga09592_376374_c1 nmdc:mga09592_376374_c1_361_1188 275
715 3300050508 nmdc:mga09592_45322_c1 nmdc:mga09592_45322_c1_1504_2352 275
716 3300050508 nmdc:mga09592_49664_c1 nmdc:mga09592_49664_c1_618_1445 275
717 3300050508 nmdc:mga09592_9421_c1 nmdc:mga09592_9421_c1_3242_4075 275
718 3300050508 nmdc:mga09592_991_c1 nmdc:mga09592_991_c1_14840_15691 275
719 3300050509 nmdc:mga0qj67_141_c1 nmdc:mga0qj67_141_c1_22711_23541 275
720 3300050509 nmdc:mga0qj67_6609_c1 nmdc:mga0qj67_6609_c1_6381_7229 275
721 3300050510 nmdc:mga06r32_11284_c1 nmdc:mga06r32_11284_c1_5508_6338 275
722 3300050510 nmdc:mga06r32_1408_c1 nmdc:mga06r32_1408_c1_16291_17121 275
723 3300050510 nmdc:mga06r32_18996_c1 nmdc:mga06r32_18996_c1_4969_5817 275
724 3300050510 nmdc:mga06r32_226169_c1 nmdc:mga06r32_226169_c1_725_1591 275
725 3300050510 nmdc:mga06r32_238933_c1 nmdc:mga06r32_238933_c1_688_1599 275
726 3300050510 nmdc:mga06r32_268_c1 nmdc:mga06r32_268_c1_24532_25362 275
727 3300050510 nmdc:mga06r32_47927_c1 nmdc:mga06r32_47927_c1_3211_4059 275
728 3300050510 nmdc:mga06r32_573765_c1 nmdc:mga06r32_573765_c1_178_1005 275
729 3300050511 nmdc:mga08y16_194012_c1 nmdc:mga08y16_194012_c1_69_899 275
730 3300050511 nmdc:mga08y16_40638_c1 nmdc:mga08y16_40638_c1_1838_2677 275
731 3300050511 nmdc:mga08y16_54366_c1 nmdc:mga08y16_54366_c1_1538_2380 275
732 3300050511 nmdc:mga08y16_5571_c1 nmdc:mga08y16_5571_c1_9091_9924 275
733 3300050511 nmdc:mga08y16_7748_c1 nmdc:mga08y16_7748_c1_8332_9165 275
734 3300050511 nmdc:mga08y16_7784_c1 nmdc:mga08y16_7784_c1_4914_5744 275
735 3300050512 nmdc:mga0n895_117104_c1 nmdc:mga0n895_117104_c1_1714_2568 275
736 3300050512 nmdc:mga0n895_21898_c1 nmdc:mga0n895_21898_c1_180_1010 275
737 3300050512 nmdc:mga0n895_251457_c1 nmdc:mga0n895_251457_c1_207_1061 275
738 3300050512 nmdc:mga0n895_285413_c1 nmdc:mga0n895_285413_c1_357_1208 275
739 3300050512 nmdc:mga0n895_3955_c1 nmdc:mga0n895_3955_c1_7938_8768 275
740 3300050512 nmdc:mga0n895_415170_c1 nmdc:mga0n895_415170_c1_143_988 275
741 3300050512 nmdc:mga0n895_4479_c1 nmdc:mga0n895_4479_c1_2534_3370 275
742 3300050512 nmdc:mga0n895_52283_c1 nmdc:mga0n895_52283_c1_496_1326 275
743 3300050512 nmdc:mga0n895_826_c1 nmdc:mga0n895_826_c1_20984_21820 275
744 3300050513 nmdc:mga0rr50_11081_c1 nmdc:mga0rr50_11081_c1_4258_5109 275
745 3300050513 nmdc:mga0rr50_18674_c1 nmdc:mga0rr50_18674_c1_37_891 275
746 3300050513 nmdc:mga0rr50_21882_c1 nmdc:mga0rr50_21882_c1_2071_3018 275
747 3300050513 nmdc:mga0rr50_309872_c1 nmdc:mga0rr50_309872_c1_37_867 275
748 3300050513 nmdc:mga0rr50_37300_c1 nmdc:mga0rr50_37300_c1_1981_2811 275
749 3300050513 nmdc:mga0rr50_506534_c1 nmdc:mga0rr50_506534_c1_45_890 275
750 3300050513 nmdc:mga0rr50_6133_c1 nmdc:mga0rr50_6133_c1_6184_7020 275
751 3300050513 nmdc:mga0rr50_82534_c1 nmdc:mga0rr50_82534_c1_1560_2390 275
752 3300050514 nmdc:mga08x19_212600_c1 nmdc:mga08x19_212600_c1_291_1121 275
753 3300050514 nmdc:mga08x19_26225_c1 nmdc:mga08x19_26225_c1_2255_3109 275
754 3300050514 nmdc:mga08x19_2837_c1 nmdc:mga08x19_2837_c1_7417_8364 275
755 3300050514 nmdc:mga08x19_42291_c1 nmdc:mga08x19_42291_c1_1542_2384 275
756 3300050514 nmdc:mga08x19_4910_c1 nmdc:mga08x19_4910_c1_4530_5366 275
757 3300050514 nmdc:mga08x19_69414_c1 nmdc:mga08x19_69414_c1_83_913 275
758 3300050515 nmdc:mga0a205_104897_c1 nmdc:mga0a205_104897_c1_1459_2313 275
759 3300050515 nmdc:mga0a205_12814_c1 nmdc:mga0a205_12814_c1_4276_5106 275
760 3300050515 nmdc:mga0a205_13391_c1 nmdc:mga0a205_13391_c1_4832_5668 275
761 3300050515 nmdc:mga0a205_149018_c1 nmdc:mga0a205_149018_c1_266_1096 275
762 3300050515 nmdc:mga0a205_25809_c1 nmdc:mga0a205_25809_c1_4274_5104 275
763 3300050515 nmdc:mga0a205_26719_c1 nmdc:mga0a205_26719_c1_885_1727 275
764 3300050515 nmdc:mga0a205_295091_c1 nmdc:mga0a205_295091_c1_77_907 275
765 3300050515 nmdc:mga0a205_3041_c2 nmdc:mga0a205_3041_c2_1065_1895 275
766 3300050515 nmdc:mga0a205_33777_c1 nmdc:mga0a205_33777_c1_2682_3533 275
767 3300050515 nmdc:mga0a205_5169_c1 nmdc:mga0a205_5169_c1_3155_4102 275
768 3300050515 nmdc:mga0a205_99302_c1 nmdc:mga0a205_99302_c1_470_1297 275
769 3300053077 Ga0495601_0001753 Ga0495601_0001753_906_1757 275
770 3300053077 Ga0495601_0171110 Ga0495601_0171110_27_878 275
771 3300053078 Ga0495612_0002063 Ga0495612_0002063_2166_3017 275
772 3300053078 Ga0495612_0112150 Ga0495612_0112150_274_1125 275
773 3300053084 Ga0495595_0108173 Ga0495595_0108173_184_1035 275
774 3300053085 Ga0495619_0237310 Ga0495619_0237310_252_1106 275
775 3300054114 Ga0501084_0013355 Ga0501084_0013355_1128_1958 275
776 3300054114 Ga0501084_0070061 Ga0501084_0070061_1419_2252 275
777 3300054114 Ga0501084_0109146 Ga0501084_0109146_455_1306 275
778 3300054114 Ga0501084_0190645 Ga0501084_0190645_694_1527 275
779 3300060353 Ga0501082_0000691 Ga0501082_0000691_1995_2828 275
780 3300060353 Ga0501082_0009737 Ga0501082_0009737_3338_4168 275
781 3300060353 Ga0501082_0088907 Ga0501082_0088907_881_1714 275
782 3300060353 Ga0501082_0261744 Ga0501082_0261744_291_1142 275
783 3300061734 Ga0530510_0002570 Ga0530510_0002570_287_1120 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02668

TauD

Taurine catabolism dioxygenase TauD, TfdA family

46

314

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d3j-assembly1.cif.gz_A ft_t dioxygenase holoenzyme 0.9486 2 272
7qtf-assembly1.cif.gz_B crystal structure of the fe(ii)/alpha-ketoglutarate dependent dioxygenase plao1 in complex with sodium succinate 0.94 2 272
7qtf-assembly1.cif.gz_A crystal structure of the fe(ii)/alpha-ketoglutarate dependent dioxygenase plao1 in complex with sodium succinate 0.9383 3 272
1oij-assembly4.cif.gz_D crystal structure of the alkylsulfatase atsk, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with alphaketoglutarate 0.9369 1 275
7qtg-assembly1.cif.gz_B-2 crystal structure of the fe(ii)/alpha-ketoglutarate dependent dioxygenase plao1 0.935 3 272
ID Description Score Start End Superfamily
5hsxA00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.9155 1 275 3.60.130.10
1vz4D00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.9074 1 275 3.60.130.10
5j92B00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.897 1 272 3.60.130.10
6d0oA00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.8906 2 275 3.60.130.10
1gqwB00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.8882 1 272 3.60.130.10
ID Description Score Start End GO Terms
AF-A0A257PAL0-F1-model_v4 TauD/TfdA-like domain-containing protein 0.9802 1 274 GO:0000908
GO:0005737
GO:0006790
AF-A0A257PAL0-F1-model_v4 TauD/TfdA-like domain-containing protein 0.9731 1 274 GO:0000908
GO:0005737
GO:0006790
AF-A0A6J6HQC8-F1-model_v4 Unannotated protein 0.942 1 272 GO:0005737
GO:0016706
AF-A0A6A7KRT8-F1-model_v4 TauD/TfdA family dioxygenase 0.9364 1 275 GO:0000908
GO:0005737
GO:0006790
AF-A0A537Z8W6-F1-model_v4 Taurine dioxygenase 0.9347 1 274 GO:0005737
GO:0016706

Feature Viewer

pLDDT pTM Quality
93.06 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map