F480658

General Info

Members Datasets Scaffolds Average Seq Length
783 507 1566 311

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10448022|Ga0157372_104480222
Length 347
Sequence MNATPIFRRIALIGFGLIGGSIARAARAQGLASEIVTTARSEKTRARVTELGIVDRVLETNAEAVQDADLVILCIPVQSYGAVMEKIGPYLEPGAILSDVGSVKEYVTKAMAPHIPKGVHLIPGHPIAGTEHSGPAAGFPELFINRWCVLTPGKTVPAEAIARLTAFWSDLGSNVELMEPTHHDMVLAITSHIPHLVAYNIVGTVSDLEQATQSEVIKFSASGFRDFTRIAASDPVMWRDVFLTNRDAVLEMLGRFLEDLSKLQRMVRVGDGPGMEDLFTRTRKIRRSIITAGQETAAADFGRPHGDVKTLSGPSGTALAEGTAAPLVDTNVEVASPVREHGGGDDA

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
85 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
86 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
87 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
90 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
145 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
146 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
147 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
150 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
158 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
159 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
169 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
173 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
174 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
175 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
176 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
178 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
179 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
180 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
190 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
193 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
194 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
195 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
196 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
208 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
209 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
212 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
213 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
218 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
223 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
224 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
225 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
245 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
263 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
269 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
270 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
271 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
272 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
273 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
274 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
278 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
279 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
280 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
281 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
282 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
283 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
284 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
285 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
291 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
292 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
293 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
294 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
295 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
296 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
297 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
298 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
299 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
300 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
301 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
302 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
303 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
304 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
305 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
306 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
307 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
308 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
309 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
310 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
311 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
312 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
313 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
314 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
315 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
316 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
317 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
318 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
319 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
320 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
321 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
322 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
323 2508501050 Microvirga lupini Lut6 Isolate Nodule
324 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
325 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
326 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
327 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
328 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
329 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
330 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
331 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
332 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
333 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
334 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
335 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
336 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
337 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
338 2643221580 Devosia sp. Root635 Isolate Unclassified
339 2643221591 Devosia sp. Root685 Isolate Unclassified
340 2643221629 Devosia sp. Root105 Isolate Unclassified
341 2643221662 Devosia sp. Root413D1 Isolate Unclassified
342 2643221674 Devosia sp. Root436 Isolate Unclassified
343 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
344 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
345 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
346 2773857925 Microvirga vignae BR3299 Isolate Unclassified
347 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
348 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
349 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
350 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
351 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
352 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
353 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
354 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
355 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
356 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
357 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
358 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
359 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
360 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
361 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
362 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
363 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
364 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
365 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
366 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
367 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
368 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
369 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
370 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
371 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
372 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
373 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
374 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
375 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
376 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
377 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
378 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
379 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
380 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
381 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
382 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
383 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
384 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
385 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
386 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
387 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
388 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
389 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
390 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
391 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
392 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
393 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
394 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
395 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
396 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
397 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
398 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
399 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
400 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
401 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
402 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
403 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
404 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
405 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
406 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
407 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
408 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
409 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
410 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
411 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
412 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
413 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
414 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
415 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
416 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
417 2909042592 Labrys sp. LIt4 Isolate Nodule
418 2922368715
419 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
420 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
421 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
422 2932401849 Devosia sp. 2618 Isolate Rhizosphere
423 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
424 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
425 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
426 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
427 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
428 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
429 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
430 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
431 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
432 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
433 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
434 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
435 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
436 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
437 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
438 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
439 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
440 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
441 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
442 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
443 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
444 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
445 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
446 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
447 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
448 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
449 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
450 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
451 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
452 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
453 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
454 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
455 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
456 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
457 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
458 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
459 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
460 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
461 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
462 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
463 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
464 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
465 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
466 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
467 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
468 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
469 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
470 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
471 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
472 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
473 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
474 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
475 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
476 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
477 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
478 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
479 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
480 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
481 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
482 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
483 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
484 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
485 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
486 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
487 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
488 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
489 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
490 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
491 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
492 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
493 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
494 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
495 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
496 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
497 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
498 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
499 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
500 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
501 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
502 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
503 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
504 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
505 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
506 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
507 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.96
Metatranscriptomes 0.13
Isolates 23.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.71
Nodule 16.48
Rhizoplane 2.81
Rhizosphere 60.54
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10448022 3300013307 Bacteria 1504
2 JGI25151J46595_10000364 3300003187 Bacteria 47703
3 JGI25406J46586_10004226 3300003203 Bacteria 6705
4 JGI25153J46596_10001434 3300003215 Bacteria 14270
5 rootH2_10066442 3300003320 Bacteria 8724
6 rootH2_10142552 3300003320 Bacteria 1590
7 JGI25160J50197_1001208 3300003354 Bacteria 13129
8 JGI25404J52841_10033949 3300003659 Bacteria 1087
9 Ga0065165_1000370 3300005262 Bacteria 73604
10 Ga0065165_1001957 3300005262 Bacteria 19507
11 Ga0065165_1005374 3300005262 Bacteria 7243
12 Ga0070658_10004155 3300005327 Bacteria 11854
13 Ga0070658_10047644 3300005327 Bacteria 3468
14 Ga0070658_10088141 3300005327 Bacteria 2555
15 Ga0070658_10166809 3300005327 Bacteria 1849
16 Ga0070683_100037482 3300005329 Bacteria 4438
17 Ga0068869_100037313 3300005334 Bacteria 3455
18 Ga0070680_100016995 3300005336 Bacteria 5729
19 Ga0070660_100078596 3300005339 Bacteria 2587
20 Ga0070660_100108955 3300005339 Bacteria 2202
21 Ga0070660_100120072 3300005339 Bacteria 2097
22 Ga0070661_100000296 3300005344 Bacteria 40209
23 Ga0070661_100052782 3300005344 Bacteria 2975
24 Ga0070692_10181832 3300005345 Bacteria 1219
25 Ga0070668_100006611 3300005347 Bacteria 8591
26 Ga0070674_100077375 3300005356 Bacteria 2368
27 Ga0070659_100019155 3300005366 Bacteria 5179
28 Ga0070659_100077345 3300005366 Bacteria 2654
29 Ga0070659_100230528 3300005366 Bacteria 1530
30 Ga0070667_100068854 3300005367 Bacteria 3012
31 Ga0070713_100289226 3300005436 Bacteria 1505
32 Ga0070711_100026226 3300005439 Bacteria 3818
33 Ga0070711_100305302 3300005439 Bacteria 1267
34 Ga0070700_100043939 3300005441 Bacteria 2750
35 Ga0070663_100352032 3300005455 Bacteria 1193
36 Ga0070662_100378642 3300005457 Bacteria 1165
37 Ga0068867_100053823 3300005459 Bacteria 2973
38 Ga0070685_10001551 3300005466 Bacteria 12107
39 Ga0070706_100190045 3300005467 Bacteria 1919
40 Ga0070707_100135995 3300005468 Bacteria 2391
41 Ga0070698_100190944 3300005471 Bacteria 1986
42 Ga0070679_100015177 3300005530 Bacteria 7401
43 Ga0070679_100068564 3300005530 Bacteria 3538
44 Ga0070697_100106840 3300005536 Bacteria 2329
45 Ga0068853_100003694 3300005539 Bacteria 11746
46 Ga0068853_100004956 3300005539 Bacteria 10373
47 Ga0068853_100039780 3300005539 Bacteria 4011
48 Ga0068853_100193669 3300005539 Bacteria 1848
49 Ga0068853_100382481 3300005539 Bacteria 1314
50 Ga0068853_100456238 3300005539 Bacteria 1202
51 Ga0070672_100051615 3300005543 Bacteria 3208
52 Ga0070672_100305665 3300005543 Bacteria 1349
53 Ga0070686_100118452 3300005544 Bacteria 1815
54 Ga0070695_100003415 3300005545 Bacteria 9279
55 Ga0070693_100125560 3300005547 Bacteria 1597
56 Ga0070693_100181357 3300005547 Bacteria 1356
57 Ga0070665_100036876 3300005548 Bacteria 4916
58 Ga0070665_100056839 3300005548 Bacteria 3923
59 Ga0070665_100104771 3300005548 Bacteria 2830
60 Ga0068855_100006841 3300005563 Bacteria 13833
61 Ga0068855_100008845 3300005563 Bacteria 12172
62 Ga0068855_100032594 3300005563 Bacteria 6220
63 Ga0068855_100117641 3300005563 Bacteria 3044
64 Ga0068855_100121746 3300005563 Bacteria 2986
65 Ga0068855_100173592 3300005563 Unclassified 2440
66 Ga0070664_100108745 3300005564 Bacteria 2418
67 Ga0068857_100008234 3300005577 Bacteria 9010
68 Ga0068857_100035375 3300005577 Bacteria 4424
69 Ga0068854_100022479 3300005578 Bacteria 4297
70 Ga0068854_100108470 3300005578 Bacteria 2091
71 Ga0068854_100135849 3300005578 Bacteria 1882
72 Ga0068856_100037083 3300005614 Bacteria 4783
73 Ga0068856_100113050 3300005614 Bacteria 2713
74 Ga0068856_100185382 3300005614 Bacteria 2095
75 Ga0068856_100335598 3300005614 Bacteria 1530
76 Ga0070702_100138826 3300005615 Bacteria 1546
77 Ga0068852_100006572 3300005616 Bacteria 8416
78 Ga0068852_100138707 3300005616 Bacteria 2248
79 Ga0068859_100032209 3300005617 Bacteria 5266
80 Ga0068859_100257204 3300005617 Bacteria 1837
81 Ga0068861_100026505 3300005719 Bacteria 4214
82 Ga0068851_10166874 3300005834 Bacteria 1212
83 Ga0068858_100090754 3300005842 Bacteria 2844
84 Ga0081455_10009815 3300005937 Bacteria 9803
85 Ga0081455_10013086 3300005937 Bacteria 8225
86 Ga0081455_10057249 3300005937 Bacteria 3304
87 Ga0081540_1000024 3300005983 Bacteria 158868
88 Ga0081540_1005059 3300005983 Bacteria 9895
89 Ga0081540_1008220 3300005983 Bacteria 7309
90 Ga0081539_10002797 3300005985 Bacteria 23391
91 Ga0075368_10033032 3300006042 Bacteria 2012
92 Ga0075363_100046010 3300006048 Bacteria 2314
93 Ga0070712_100240971 3300006175 Bacteria 1440
94 Ga0075362_10047135 3300006177 Bacteria 1919
95 Ga0075367_10055274 3300006178 Bacteria 2356
96 Ga0075367_10058420 3300006178 Bacteria 2295
97 Ga0075367_10182112 3300006178 Bacteria 1310
98 Ga0075366_10142314 3300006195 Bacteria 1450
99 Ga0097621_100125937 3300006237 Bacteria 2176
100 Ga0075428_100069849 3300006844 Bacteria 3840
101 Ga0075428_100310243 3300006844 Bacteria 1696
102 Ga0075433_10003359 3300006852 Bacteria 12372
103 Ga0075434_100007129 3300006871 Bacteria 10329
104 Ga0075434_100011459 3300006871 Bacteria 8367
105 Ga0075434_100014087 3300006871 Bacteria 7637
106 Ga0068865_100058248 3300006881 Bacteria 2698
107 Ga0068865_100060720 3300006881 Bacteria 2648
108 Ga0075436_100014041 3300006914 Bacteria 5481
109 Ga0075436_100377212 3300006914 Bacteria 1025
110 Ga0097620_100032204 3300006931 Bacteria 5266
111 Ga0097620_100257203 3300006931 Bacteria 1837
112 Ga0105240_10000330 3300009093 Bacteria 89049
113 Ga0105240_10000528 3300009093 Bacteria 70421
114 Ga0105240_10000580 3300009093 Bacteria 67901
115 Ga0105240_10006878 3300009093 Bacteria 16621
116 Ga0105240_10095611 3300009093 Bacteria 3622
117 Ga0105240_10149956 3300009093 Bacteria 2778
118 Ga0105240_10156006 3300009093 Bacteria 2715
119 Ga0105240_10503143 3300009093 Bacteria 1347
120 Ga0111539_10245669 3300009094 Bacteria 2084
121 Ga0105245_10084638 3300009098 Bacteria 2906
122 Ga0105247_10072812 3300009101 Bacteria 2151
123 Ga0105247_10174424 3300009101 Bacteria 1431
124 Ga0114129_10263995 3300009147 Bacteria 2306
125 Ga0105243_10271706 3300009148 Bacteria 1522
126 Ga0105243_10332332 3300009148 Bacteria 1389
127 Ga0105242_10201528 3300009176 Bacteria 1768
128 Ga0105248_10396834 3300009177 Bacteria 1553
129 Ga0105237_10000203 3300009545 Bacteria 84732
130 Ga0105237_10013295 3300009545 Bacteria 8634
131 Ga0105237_10061656 3300009545 Bacteria 3749
132 Ga0105237_10086902 3300009545 Bacteria 3117
133 Ga0105237_10088428 3300009545 Bacteria 3087
134 Ga0105237_10146577 3300009545 Bacteria 2355
135 Ga0105237_10280046 3300009545 Bacteria 1670
136 Ga0105237_10332517 3300009545 Bacteria 1523
137 Ga0105238_10036434 3300009551 Bacteria 5000
138 Ga0105238_10108214 3300009551 Bacteria 2761
139 Ga0105238_10191372 3300009551 Bacteria 2022
140 Ga0105238_10248726 3300009551 Bacteria 1756
141 Ga0105249_10268161 3300009553 Bacteria 1700
142 Ga0105239_10016961 3300010375 Bacteria 8050
143 Ga0105239_10017508 3300010375 Bacteria 7924
144 Ga0105239_10089786 3300010375 Bacteria 3389
145 Ga0105239_10092739 3300010375 Bacteria 3334
146 Ga0105239_10102866 3300010375 Bacteria 3161
147 Ga0105239_10497434 3300010375 Bacteria 1386
148 Ga0157370_10041917 3300013104 Bacteria 4413
149 Ga0157370_10191880 3300013104 Bacteria 1896
150 Ga0157369_10389341 3300013105 Bacteria 1446
151 Ga0157374_10038068 3300013296 Bacteria 4419
152 Ga0157378_10304938 3300013297 Bacteria 1542
153 Ga0157372_10021475 3300013307 Bacteria 6975
154 Ga0157375_10256440 3300013308 Bacteria 1910
155 Ga0163163_10112189 3300014325 Bacteria 2756
156 Ga0163163_10565447 3300014325 Bacteria 1200
157 Ga0157377_10085211 3300014745 Bacteria 1855
158 Ga0157377_10116249 3300014745 Bacteria 1615
159 Ga0214544_1000003 3300021320 Bacteria 643752
160 Ga0214542_1000003 3300021321 Bacteria 435700
161 Ga0214545_1000004 3300021324 Bacteria 453352
162 Ga0214543_1000007 3300021327 Bacteria 414744
163 Ga0213876_10009961 3300021384 Bacteria 5109
164 Ga0213876_10117339 3300021384 Bacteria 1413
165 Ga0224572_1000989 3300024225 Bacteria 3923
166 Ga0209563_103333 3300025230 Bacteria 3351
167 Ga0209677_106867 3300025253 Bacteria 2582
168 Ga0209233_1005180 3300025261 Bacteria 4353
169 Ga0209130_1000662 3300025284 Bacteria 31434
170 Ga0209675_1000680 3300025291 Bacteria 23730
171 Ga0209025_1000936 3300025294 Bacteria 44418
172 Ga0209564_1007175 3300025295 Bacteria 5809
173 Ga0209564_1022974 3300025295 Bacteria 2183
174 Ga0209758_1000030 3300025297 Bacteria 509217
175 Ga0209758_1002104 3300025297 Bacteria 21134
176 Ga0209758_1003575 3300025297 Bacteria 13918
177 Ga0209758_1007165 3300025297 Bacteria 7693
178 Ga0209758_1044600 3300025297 Bacteria 1618
179 Ga0207426_1000066 3300025302 Bacteria 351182
180 Ga0207426_1000271 3300025302 Bacteria 108392
181 Ga0207426_1000913 3300025302 Bacteria 29549
182 Ga0209257_1000947 3300025304 Bacteria 40051
183 Ga0207692_10214171 3300025898 Bacteria 1139
184 Ga0207642_10034552 3300025899 Bacteria 2151
185 Ga0207710_10028594 3300025900 Bacteria 2420
186 Ga0207710_10091150 3300025900 Bacteria 1427
187 Ga0207645_10055751 3300025907 Bacteria 2523
188 Ga0207645_10070555 3300025907 Bacteria 2235
189 Ga0207643_10265495 3300025908 Bacteria 1061
190 Ga0207705_10008307 3300025909 Bacteria 7581
191 Ga0207705_10063998 3300025909 Bacteria 2658
192 Ga0207705_10079609 3300025909 Bacteria 2386
193 Ga0207684_10118574 3300025910 Bacteria 2268
194 Ga0207654_10015970 3300025911 Bacteria 3904
195 Ga0207707_10019821 3300025912 Bacteria 5871
196 Ga0207695_10000690 3300025913 Bacteria 66191
197 Ga0207695_10000905 3300025913 Bacteria 53386
198 Ga0207695_10005181 3300025913 Bacteria 17451
199 Ga0207695_10010385 3300025913 Bacteria 11392
200 Ga0207695_10010966 3300025913 Bacteria 11017
201 Ga0207695_10029626 3300025913 Bacteria 6042
202 Ga0207695_10051385 3300025913 Bacteria 4329
203 Ga0207671_10000177 3300025914 Bacteria 97072
204 Ga0207671_10028074 3300025914 Bacteria 4206
205 Ga0207671_10034193 3300025914 Bacteria 3778
206 Ga0207671_10060893 3300025914 Bacteria 2801
207 Ga0207671_10086095 3300025914 Bacteria 2362
208 Ga0207693_10235492 3300025915 Bacteria 1438
209 Ga0207660_10012501 3300025917 Bacteria 5556
210 Ga0207662_10044839 3300025918 Bacteria 2612
211 Ga0207657_10006065 3300025919 Bacteria 12571
212 Ga0207657_10025952 3300025919 Bacteria 5394
213 Ga0207657_10084537 3300025919 Bacteria 2659
214 Ga0207657_10116463 3300025919 Bacteria 2202
215 Ga0207649_10001647 3300025920 Bacteria 12960
216 Ga0207649_10031008 3300025920 Bacteria 3173
217 Ga0207652_10018718 3300025921 Bacteria 5683
218 Ga0207652_10509882 3300025921 Bacteria 1082
219 Ga0207646_10039151 3300025922 Bacteria 4266
220 Ga0207681_10188884 3300025923 Bacteria 1575
221 Ga0207694_10056003 3300025924 Bacteria 3062
222 Ga0207694_10081994 3300025924 Bacteria 2534
223 Ga0207659_10075811 3300025926 Bacteria 2469
224 Ga0207706_10385037 3300025933 Bacteria 1217
225 Ga0207686_10111085 3300025934 Bacteria 1849
226 Ga0207669_10024305 3300025937 Bacteria 3254
227 Ga0207669_10029063 3300025937 Bacteria 3051
228 Ga0207691_10197128 3300025940 Bacteria 1754
229 Ga0207691_10471918 3300025940 Bacteria 1067
230 Ga0207679_10019416 3300025945 Bacteria 4565
231 Ga0207667_10010129 3300025949 Bacteria 11039
232 Ga0207667_10016466 3300025949 Bacteria 8354
233 Ga0207667_10040989 3300025949 Bacteria 4928
234 Ga0207667_10128253 3300025949 Unclassified 2613
235 Ga0207667_10148394 3300025949 Bacteria 2414
236 Ga0207667_10214724 3300025949 Bacteria 1971
237 Ga0207667_10227228 3300025949 Bacteria 1912
238 Ga0207668_10003807 3300025972 Bacteria 8889
239 Ga0207668_10208381 3300025972 Bacteria 1562
240 Ga0207668_10316355 3300025972 Bacteria 1294
241 Ga0207640_10001371 3300025981 Bacteria 13177
242 Ga0207640_10114375 3300025981 Bacteria 1920
243 Ga0207640_10129385 3300025981 Bacteria 1822
244 Ga0207703_10084431 3300026035 Bacteria 2655
245 Ga0207639_10000742 3300026041 Bacteria 22258
246 Ga0207639_10002078 3300026041 Bacteria 13488
247 Ga0207639_10145638 3300026041 Bacteria 1978
248 Ga0207639_10188128 3300026041 Bacteria 1761
249 Ga0207639_10252376 3300026041 Bacteria 1539
250 Ga0207678_10066025 3300026067 Bacteria 3107
251 Ga0207678_10075164 3300026067 Bacteria 2894
252 Ga0207702_10059827 3300026078 Bacteria 3246
253 Ga0207702_10188310 3300026078 Bacteria 1905
254 Ga0207702_10233844 3300026078 Bacteria 1719
255 Ga0207641_10080653 3300026088 Bacteria 2824
256 Ga0207648_10067618 3300026089 Bacteria 3114
257 Ga0207674_10009842 3300026116 Bacteria 10885
258 Ga0207674_10017618 3300026116 Bacteria 7790
259 Ga0207674_10119808 3300026116 Bacteria 2600
260 Ga0207675_100029932 3300026118 Bacteria 5069
261 Ga0207675_100033029 3300026118 Bacteria 4822
262 Ga0207683_10071382 3300026121 Bacteria 3069
263 Ga0207683_10229177 3300026121 Bacteria 1694
264 Ga0207698_10037040 3300026142 Bacteria 3588
265 Ga0207698_10104687 3300026142 Bacteria 2355
266 Ga0207698_10133430 3300026142 Bacteria 2126
267 Ga0209998_10004564 3300027717 Bacteria 2938
268 Ga0207428_10076596 3300027907 Bacteria 2619
269 Ga0268266_10012948 3300028379 Bacteria 7192
270 Ga0268266_10048986 3300028379 Bacteria 3621
271 Ga0268266_10183564 3300028379 Bacteria 1906
272 Ga0268266_10275551 3300028379 Bacteria 1563
273 Ga0268265_10007551 3300028380 Bacteria 7339
274 Ga0268264_10040911 3300028381 Bacteria 3830
275 Ga0265319_1011945 3300028563 Bacteria 3530
276 Ga0265334_10000859 3300028573 Bacteria 15224
277 Ga0265334_10001692 3300028573 Bacteria 10542
278 Ga0265318_10000235 3300028577 Bacteria 48102
279 Ga0265318_10027425 3300028577 Bacteria 2238
280 Ga0265336_10029870 3300028666 Bacteria 1698
281 Ga0265338_10000231 3300028800 Bacteria 103805
282 Ga0265338_10063502 3300028800 Bacteria 3219
283 Ga0265338_10071491 3300028800 Bacteria 2967
284 Ga0265324_10019653 3300029957 Bacteria 2431
285 Ga0265324_10031827 3300029957 Bacteria 1846
286 Ga0316177_1090439 3300030731 Bacteria 1750
287 Ga0265325_10003040 3300031241 Bacteria 11100
288 Ga0265325_10015261 3300031241 Bacteria 4323
289 Ga0265325_10021367 3300031241 Bacteria 3556
290 Ga0265340_10024277 3300031247 Bacteria 3081
291 Ga0265339_10001183 3300031249 Bacteria 19723
292 Ga0265339_10003193 3300031249 Bacteria 11505
293 Ga0265339_10004646 3300031249 Bacteria 9334
294 Ga0265331_10022918 3300031250 Bacteria 3180
295 Ga0265331_10029199 3300031250 Bacteria 2754
296 Ga0265327_10004210 3300031251 Bacteria 12931
297 Ga0265327_10006360 3300031251 Bacteria 9469
298 Ga0265327_10009323 3300031251 Bacteria 7103
299 Ga0265316_10019755 3300031344 Bacteria 5753
300 Ga0265316_10084889 3300031344 Bacteria 2424
301 Ga0265316_10106930 3300031344 Bacteria 2122
302 Ga0265313_10000070 3300031595 Bacteria 99384
303 Ga0265313_10001097 3300031595 Bacteria 26024
304 Ga0307508_10108006 3300031616 Bacteria 2382
305 Ga0316575_10013558 3300031665 Bacteria 3046
306 Ga0265314_10022597 3300031711 Bacteria 4817
307 Ga0265314_10049410 3300031711 Bacteria 2945
308 Ga0265314_10160012 3300031711 Bacteria 1371
309 Ga0265342_10019942 3300031712 Bacteria 4312
310 Ga0316576_10040394 3300031727 Bacteria 3353
311 Ga0307405_10437692 3300031731 Bacteria 1033
312 Ga0307413_10030417 3300031824 Bacteria 3033
313 Ga0307410_10093016 3300031852 Bacteria 2145
314 Ga0307407_10072534 3300031903 Bacteria 2054
315 Ga0307407_10100881 3300031903 Bacteria 1791
316 Ga0307414_10040643 3300032004 Bacteria 3143
317 Ga0307414_10047596 3300032004 Bacteria 2952
318 Ga0307414_10390669 3300032004 Bacteria 1206
319 Ga0316585_10050231 3300032137 Bacteria 1339
320 Ga0316580_10018695 3300032139 Bacteria 2132
321 Ga0307510_10069558 3300033180 Bacteria 3524
322 Ga0307510_10168112 3300033180 Bacteria 1777
323 Ga0316596_1020632 3300033541 Bacteria 1677
324 Ga0373926_0057399 3300035083 Bacteria 1414
325 Ga0373928_0053371 3300035084 Bacteria 960
326 Ga0373952_0004512 3300035092 Bacteria 2527
327 Ga0373932_0011863 3300035112 Bacteria 2136
328 Ga0373936_0124052 3300035113 Bacteria 1106
329 Ga0373939_0023631 3300035114 Bacteria 1705
330 Ga0373960_0002357 3300035121 Bacteria 4242
331 Ga0373942_0021556 3300035207 Bacteria 1626
332 Ga0373962_0000511 3300035242 Bacteria 8651
333 Ga0373931_0000317 3300035691 Bacteria 20240
334 Ga0373931_0004250 3300035691 Bacteria 6519
335 Ga0373931_0056848 3300035691 Bacteria 2097
336 Ga0373931_0111734 3300035691 Bacteria 1551
337 Ga0373937_0292426 3300036401 Bacteria 1539
338 Ga0316584_0026886 3300036712 Bacteria 4231
339 Ga0395899_0090875 3300037312 Bacteria 2213
340 Ga0395899_0135921 3300037312 Bacteria 1752
341 Ga0395900_0088124 3300037418 Bacteria 3190
342 Ga0395900_0130332 3300037418 Bacteria 2577
343 Ga0395898_0015010 3300037466 Bacteria 7950
344 Ga0395898_0095492 3300037466 Bacteria 2856
345 Ga0395905_0001838 3300037471 Bacteria 24511
346 Ga0395905_0006347 3300037471 Bacteria 11914
347 Ga0395905_0038350 3300037471 Bacteria 4496
348 Ga0395901_0016268 3300038443 Bacteria 7576
349 Ga0395901_0596900 3300038443 Bacteria 1114
350 Ga0400486_20503 3300038742 Bacteria 1798
351 Ga0400483_205793 3300039062 Bacteria 1918
352 Ga0436365_1001561 3300039437 Bacteria 3202
353 Ga0436360_0818014 3300039438 Bacteria 5526
354 Ga0436360_1148784 3300039438 Bacteria 1050
355 Ga0436361_0660345 3300039447 Bacteria 3103
356 Ga0439465_0017313 3300041413 Bacteria 2250
357 Ga0439431_0010018 3300041997 Bacteria 2147
358 Ga0450898_033063 3300042134 Bacteria 956
359 Ga0466966_0000514 3300044684 Bacteria 24679
360 Ga0466961_0000065 3300044693 Bacteria 63259
361 Ga0453684_0309219 3300044712 Bacteria 1794
362 Ga0453684_0351520 3300044712 Bacteria 1662
363 Ga0453684_0793664 3300044712 Bacteria 1022
364 Ga0466960_0099565 3300044901 Bacteria 1495
365 Ga0466959_0034929 3300045049 Bacteria 3718
366 Ga0451576_0002723 3300045051 Bacteria 25665
367 Ga0495603_0014974 3300046455 Bacteria 4689
368 Ga0495629_0033520 3300046459 Bacteria 3632
369 Ga0495638_0004694 3300046460 Bacteria 10329
370 Ga0495638_0114179 3300046460 Bacteria 1602
371 Ga0495582_0137397 3300046473 Bacteria 1384
372 Ga0495605_0108500 3300046474 Bacteria 1269
373 Ga0495584_0033583 3300046491 Bacteria 2596
374 Ga0495606_0089469 3300046507 Bacteria 1896
375 Ga0495608_0046172 3300046511 Bacteria 2900
376 Ga0495610_0012643 3300046512 Bacteria 5065
377 Ga0495648_0009770 3300046524 Bacteria 7390
378 Ga0495642_0126784 3300046528 Bacteria 1097
379 Ga0495640_0046096 3300046533 Bacteria 3023
380 Ga0495622_0012727 3300046557 Bacteria 3901
381 Ga0495622_0018741 3300046557 Bacteria 3223
382 Ga0495634_0083755 3300046642 Bacteria 2081
383 Ga0495649_0102515 3300046694 Bacteria 1520
384 Ga0495589_0139462 3300046794 Bacteria 1162
385 Ga0495600_0035934 3300046809 Bacteria 3220
386 Ga0495604_0005237 3300047317 Bacteria 10272
387 Ga0495672_0008715 3300047320 Bacteria 7440
388 Ga0495676_0054208 3300047321 Bacteria 3189
389 Ga0495683_0156123 3300047323 Bacteria 1058
390 Ga0495685_011583 3300047447 Bacteria 2979
391 Ga0495686_0081092 3300047472 Bacteria 1982
392 Ga0496100_0031553 3300048903 Bacteria 3296
393 Ga0496100_0138828 3300048903 Bacteria 1720
394 Ga0496101_0351453 3300048904 Bacteria 1158
395 Ga0496102_0250076 3300048905 Bacteria 1671
396 Ga0496102_0291725 3300048905 Bacteria 1537
397 Ga0496102_0662700 3300048905 Bacteria 967
398 Ga0496104_0002953 3300048907 Bacteria 14655
399 Ga0496104_0017706 3300048907 Bacteria 6495
400 Ga0496104_0061414 3300048907 Bacteria 3563
401 Ga0496104_0136008 3300048907 Bacteria 2361
402 Ga0496105_0006535 3300048908 Bacteria 8969
403 Ga0496105_0046907 3300048908 Bacteria 3566
404 Ga0496106_0016353 3300048909 Bacteria 5488
405 Ga0496106_0236064 3300048909 Bacteria 1461
406 Ga0496107_0130036 3300048910 Bacteria 1858
407 Ga0496108_0130499 3300048911 Bacteria 2160
408 Ga0496109_0107931 3300048912 Bacteria 2587
409 Ga0496110_0064428 3300048913 Bacteria 3239
410 Ga0496111_0039403 3300048914 Bacteria 3387
411 Ga0496112_0048414 3300048915 Bacteria 4167
412 Ga0496113_0048761 3300048916 Bacteria 3152
413 Ga0496115_0013248 3300048918 Bacteria 6231
414 Ga0496118_0013220 3300048921 Bacteria 7828
415 Ga0496119_0003665 3300048922 Bacteria 15760
416 Ga0496120_0009533 3300048923 Bacteria 6874
417 Ga0496121_0009006 3300048924 Bacteria 11574
418 Ga0496121_0129656 3300048924 Bacteria 1890
419 Ga0496122_0165963 3300048925 Bacteria 1339
420 Ga0496124_0264997 3300048927 Bacteria 1262
421 Ga0496125_0000129 3300048928 Bacteria 163342
422 Ga0496125_0052412 3300048928 Bacteria 3355
423 Ga0496126_0060831 3300048929 Bacteria 3395
424 Ga0496126_0138968 3300048929 Bacteria 2093
425 Ga0496126_0172047 3300048929 Bacteria 1844
426 Ga0501031_0026839 3300049568 Bacteria 3754
427 Ga0501031_0046568 3300049568 Bacteria 2828
428 Ga0501032_0001280 3300049569 Bacteria 20167
429 Ga0501032_0002117 3300049569 Bacteria 15668
430 Ga0501032_0034381 3300049569 Bacteria 3470
431 Ga0501032_0149610 3300049569 Bacteria 1536
432 Ga0501032_0190931 3300049569 Bacteria 1339
433 Ga0501033_0278829 3300049570 Bacteria 1180
434 Ga0501034_0000014 3300049571 Bacteria 297798
435 Ga0501034_0002255 3300049571 Bacteria 23658
436 Ga0501034_0027234 3300049571 Bacteria 5815
437 Ga0501034_0035985 3300049571 Bacteria 5020
438 Ga0501034_0045903 3300049571 Bacteria 4414
439 Ga0501034_0048444 3300049571 Bacteria 4288
440 Ga0501034_0065054 3300049571 Bacteria 3659
441 Ga0501034_0082433 3300049571 Bacteria 3218
442 Ga0501034_0144197 3300049571 Bacteria 2359
443 Ga0501034_0150473 3300049571 Bacteria 2303
444 Ga0501034_0274711 3300049571 Bacteria 1625
445 Ga0501034_0283965 3300049571 Bacteria 1594
446 Ga0501034_0411917 3300049571 Bacteria 1274
447 Ga0501036_0005290 3300049572 Bacteria 10442
448 Ga0501036_0033700 3300049572 Bacteria 4331
449 Ga0501036_0049535 3300049572 Bacteria 3557
450 Ga0501036_0090811 3300049572 Bacteria 2580
451 Ga0501037_0001132 3300049573 Bacteria 19740
452 Ga0501037_0026272 3300049573 Bacteria 4303
453 Ga0501037_0040541 3300049573 Bacteria 3427
454 Ga0501037_0213251 3300049573 Bacteria 1361
455 Ga0501038_0025537 3300049574 Bacteria 5265
456 Ga0501038_0343538 3300049574 Bacteria 1164
457 Ga0501039_0000087 3300049575 Bacteria 69688
458 Ga0501039_0065716 3300049575 Bacteria 2814
459 Ga0501040_0128850 3300049576 Bacteria 1778
460 Ga0501040_0243381 3300049576 Bacteria 1283
461 Ga0501042_0068376 3300049578 Bacteria 2540
462 Ga0501043_0005072 3300049579 Bacteria 10653
463 Ga0501043_0207789 3300049579 Bacteria 1518
464 Ga0501043_0250460 3300049579 Bacteria 1364
465 Ga0501043_0318966 3300049579 Bacteria 1185
466 Ga0501046_0013316 3300049580 Bacteria 6967
467 Ga0501046_0031958 3300049580 Bacteria 4264
468 Ga0501046_0042249 3300049580 Bacteria 3635
469 Ga0501046_0167845 3300049580 Bacteria 1648
470 Ga0501047_0000684 3300049581 Bacteria 35329
471 Ga0501047_0020745 3300049581 Bacteria 6312
472 Ga0501047_0090564 3300049581 Bacteria 2936
473 Ga0501047_0272201 3300049581 Bacteria 1540
474 Ga0501047_0283361 3300049581 Bacteria 1501
475 Ga0501047_0448438 3300049581 Bacteria 1120
476 Ga0501048_0000662 3300049582 Bacteria 24880
477 Ga0501048_0039825 3300049582 Bacteria 3369
478 Ga0501048_0162808 3300049582 Bacteria 1579
479 Ga0501067_0000308 3300049583 Bacteria 26907
480 Ga0501067_0000499 3300049583 Bacteria 21525
481 Ga0501067_0024598 3300049583 Bacteria 3340
482 Ga0501068_0001071 3300049584 Bacteria 14464
483 Ga0501070_0019277 3300049586 Bacteria 5721
484 Ga0501070_0047767 3300049586 Bacteria 3556
485 Ga0501070_0107854 3300049586 Bacteria 2301
486 Ga0501070_0221803 3300049586 Bacteria 1550
487 Ga0501070_0276074 3300049586 Bacteria 1372
488 Ga0501070_0428406 3300049586 Bacteria 1068
489 Ga0501071_0195109 3300049587 Bacteria 1519
490 Ga0501072_0055628 3300049588 Bacteria 3118
491 Ga0501072_0253755 3300049588 Bacteria 1400
492 Ga0501072_0291288 3300049588 Bacteria 1298
493 Ga0501072_0329890 3300049588 Bacteria 1212
494 Ga0501072_0380144 3300049588 Bacteria 1121
495 Ga0501073_0000010 3300049589 Bacteria 171144
496 Ga0501073_0060766 3300049589 Bacteria 2637
497 Ga0501073_0076947 3300049589 Bacteria 2322
498 Ga0501074_0082193 3300049590 Bacteria 2310
499 Ga0501074_0109807 3300049590 Bacteria 1973
500 Ga0501074_0151443 3300049590 Bacteria 1658
501 Ga0501075_0056591 3300049591 Bacteria 2952
502 Ga0501075_0198885 3300049591 Bacteria 1528
503 Ga0501076_0184287 3300049592 Bacteria 1702
504 Ga0501077_0000020 3300049593 Bacteria 80360
505 Ga0501077_0008063 3300049593 Bacteria 6511
506 Ga0501077_0015004 3300049593 Bacteria 4870
507 Ga0501080_0000010 3300049742 Bacteria 115062
508 Ga0501080_0229534 3300049742 Bacteria 1697
509 Ga0501080_0294217 3300049742 Bacteria 1474
510 Ga0501081_0001600 3300049743 Bacteria 13983
511 Ga0501081_0080906 3300049743 Bacteria 2274
512 Ga0501081_0162116 3300049743 Bacteria 1611
513 Ga0501083_0086804 3300049744 Bacteria 2069
514 Ga0501083_0227693 3300049744 Bacteria 1214
515 Ga0501035_0000034 3300049822 Bacteria 174589
516 Ga0501044_0000039 3300049823 Bacteria 158218
517 Ga0501044_0005041 3300049823 Bacteria 14749
518 Ga0501044_0008445 3300049823 Bacteria 11289
519 Ga0501044_0029578 3300049823 Bacteria 5775
520 Ga0501044_0045934 3300049823 Bacteria 4523
521 Ga0501044_0152178 3300049823 Bacteria 2295
522 Ga0501044_0256049 3300049823 Bacteria 1690
523 Ga0501044_0355494 3300049823 Bacteria 1384
524 Ga0501045_0035496 3300049824 Bacteria 3620
525 Ga0501045_0089774 3300049824 Bacteria 2270
526 nmdc:mga03683_6846_c1 3300050489 Bacteria 3925
527 nmdc:mga03n38_41493_c1 3300050490 Bacteria 2006
528 nmdc:mga03n38_65694_c1 3300050490 Bacteria 1664
529 nmdc:mga0k408_79495_c1 3300050493 Bacteria 1919
530 nmdc:mga06z11_140066_c1 3300050494 Bacteria 1367
531 nmdc:mga06z11_65237_c1 3300050494 Bacteria 1910
532 nmdc:mga07m45_22760_c1 3300050496 Bacteria 3423
533 nmdc:mga05p37_260609_c1 3300050507 Bacteria 2075
534 nmdc:mga0qj67_129900_c1 3300050509 Bacteria 2040
535 nmdc:mga0qj67_141420_c1 3300050509 Bacteria 1951
536 nmdc:mga06r32_130964_c1 3300050510 Bacteria 2480
537 nmdc:mga06r32_388932_c1 3300050510 Bacteria 1377
538 nmdc:mga08y16_158892_c1 3300050511 Bacteria 2349
539 nmdc:mga0n895_108082_c1 3300050512 Bacteria 2796
540 nmdc:mga0n895_6477_c1 3300050512 Bacteria 9946
541 nmdc:mga0n895_66835_c1 3300050512 Bacteria 3559
542 nmdc:mga0n895_9018_c1 3300050512 Bacteria 8699
543 nmdc:mga08x19_336539_c1 3300050514 Bacteria 1052
544 nmdc:mga0a205_1693_c1 3300050515 Bacteria 19041
545 nmdc:mga0sz30_72508_c1 3300050516 Bacteria 1484
546 Ga0495601_0006336 3300053077 Bacteria 6914
547 Ga0500635_0001030 3300053080 Bacteria 6665
548 Ga0500635_0008518 3300053080 Bacteria 2815
549 Ga0500643_011377 3300053087 Bacteria 3250
550 Ga0500643_018319 3300053087 Bacteria 2327
551 Ga0500566_0000351 3300053094 Bacteria 25000
552 Ga0500566_0003690 3300053094 Bacteria 9142
553 Ga0500566_0004102 3300053094 Bacteria 8686
554 Ga0500566_0101534 3300053094 Bacteria 1576
555 Ga0500640_002238 3300053095 Bacteria 6318
556 Ga0500641_0000510 3300053096 Bacteria 13992
557 Ga0500641_0072540 3300053096 Bacteria 1451
558 Ga0500556_0002319 3300053104 Bacteria 6243
559 Ga0500572_000903 3300053111 Bacteria 9176
560 Ga0500591_050672 3300053115 Bacteria 1947
561 Ga0500593_000015 3300053117 Bacteria 58134
562 Ga0500595_000141 3300053119 Bacteria 46988
563 Ga0500595_012010 3300053119 Bacteria 3362
564 Ga0500595_016954 3300053119 Bacteria 2703
565 Ga0500607_038072 3300053121 Bacteria 2618
566 Ga0500608_018687 3300053122 Bacteria 3167
567 Ga0500652_065002 3300053131 Bacteria 1507
568 Ga0500568_0000004 3300053139 Bacteria 621666
569 Ga0500568_0034233 3300053139 Bacteria 2079
570 Ga0500577_0094289 3300053142 Bacteria 1215
571 Ga0500603_011934 3300053150 Bacteria 1986
572 Ga0500604_0003067 3300053151 Bacteria 4488
573 Ga0500616_0005500 3300053153 Bacteria 8590
574 Ga0500616_0023683 3300053153 Bacteria 3419
575 Ga0500630_000445 3300053159 Bacteria 18003
576 Ga0500634_0000017 3300053161 Bacteria 111983
577 Ga0500639_000103 3300053163 Bacteria 39784
578 Ga0500636_0021148 3300053177 Bacteria 3852
579 Ga0500636_0162035 3300053177 Bacteria 1218
580 Ga0500637_0000311 3300053178 Bacteria 18186
581 Ga0500637_0005785 3300053178 Bacteria 6018
582 Ga0500637_0093985 3300053178 Bacteria 1737
583 Ga0500599_005464 3300053736 Bacteria 1597
584 Ga0500601_000420 3300053737 Bacteria 7101
585 Ga0501084_0004495 3300054114 Bacteria 11396
586 Ga0501084_0278533 3300054114 Bacteria 1412
587 Ga0501084_0328188 3300054114 Bacteria 1292
588 Ga0501084_0636341 3300054114 Bacteria 901
589 Ga0501082_0019819 3300060353 Bacteria 5800
590 Ga0501082_0055412 3300060353 Bacteria 3416
591 Ga0501082_0180033 3300060353 Bacteria 1838
592 Ga0501082_0209574 3300060353 Bacteria 1696
593 Ga0501082_0266752 3300060353 Bacteria 1490
594 Ga0530510_0023645 3300061734 Bacteria 4381
595 Ga0530510_0027092 3300061734 Bacteria 4105
596 2507504430 2507262055 Bacteria 8048963
597 2508545858 2508501009 Bacteria 7784016
598 2508694685 2508501042 Bacteria 8719808
599 2508734279 2508501050 Bacteria 9633614
600 2509079177 2508501114 Bacteria 7082538
601 2511396414 2511231028 Bacteria 8046582
602 2513590631 2513237087 Bacteria 5817514
603 2513624236 2513237092 Bacteria 8341956
604 2513638724 2513237094 Bacteria 8789602
605 2513649196 2513237095 Bacteria 8976980
606 2513702124 2513237102 Bacteria 7703324
607 2513874187 2513237139 Bacteria 8737671
608 2514010055 2513237161 Bacteria 8871253
609 2515624396 2515154112 Bacteria 8294334
610 2517103087 2517093001 Bacteria 9002274
611 2528849429 2528768022 Bacteria 10457665
612 2617350306 2617270735 Bacteria 9163226
613 2617374392 2617270741 Bacteria 8201522
614 2643911770 2643221580 Bacteria 3816678
615 2643965629 2643221591 Bacteria 4397626
616 2644169439 2643221629 Bacteria 5850260
617 2644350837 2643221662 Bacteria 5851492
618 2644413138 2643221674 Bacteria 3919126
619 2671693828 2671180139 Bacteria 4196045
620 2738744894 2738541281 Bacteria 5112672
621 2739354124 2738543032 Bacteria 5115625
622 2774871670 2773857925 Bacteria 6472445
623 2776257822 2775506901 Bacteria 9631051
624 2793059307 2791355196 Bacteria 7323613
625 2805920905 2802429603 Bacteria 8777136
626 2818240583 2816332527 Bacteria 8933356
627 2821450797 2821443989 Bacteria 7658172
628 2824604689 2824600985 Bacteria 8488197
629 2824615392 2824609381 Bacteria 8672835
630 2824618848 2824617872 Bacteria 8814715
631 2824628954 2824626560 Bacteria 8813858
632 2824639247 2824635225 Bacteria 8785348
633 2824648833 2824644064 Bacteria 8743947
634 2824658638 2824653114 Bacteria 8493680
635 2824665830 2824661429 Bacteria 9877870
636 2824675095 2824671348 Bacteria 8369588
637 2824692542 2824687955 Bacteria 8360029
638 2824700895 2824696289 Bacteria 8335049
639 2824711305 2824704595 Bacteria 9667483
640 2824717532 2824714736 Bacteria 8717648
641 2824726776 2824723954 Bacteria 8758240
642 2824737694 2824732956 Bacteria 7810675
643 2824751197 2824746037 Bacteria 7911610
644 2824759679 2824753945 Bacteria 9787441
645 2824769940 2824763712 Bacteria 9792355
646 2824780312 2824773399 Bacteria 8360218
647 2828306445 2828305725 Bacteria 4916900
648 2829746515 2829745981 Bacteria 5406054
649 2835315581 2835312727 Bacteria 7413381
650 2838126036 2838122688 Bacteria 8803140
651 2841942570 2841941048 Bacteria 8688029
652 2841953080 2841949485 Bacteria 8680857
653 2841963933 2841957949 Bacteria 8652217
654 2841970895 2841966195 Bacteria 8673214
655 2841977845 2841974524 Bacteria 8931498
656 2841984591 2841983080 Bacteria 8395090
657 2842041685 2842038055 Bacteria 8002051
658 2842049727 2842045827 Bacteria 8006841
659 2842699745 2842698319 Bacteria 5190321
660 2844533975 2844533157 Bacteria 7517899
661 2847931976 2847930680 Bacteria 9342022
662 2847943223 2847939898 Bacteria 8606328
663 2849076952 2849076700 Bacteria 7039503
664 2857514779 2857509624 Bacteria 7472071
665 2874595623 2874590934 Bacteria 8299676
666 2874620382 2874612657 Bacteria 8252029
667 2874621870 2874620515 Bacteria 8290088
668 2874629646 2874628541 Bacteria 8630250
669 2874651743 2874645413 Bacteria 8214782
670 2876769224 2876761206 Bacteria 10111113
671 2876775818 2876771140 Bacteria 8287509
672 2876821639 2876818435 Bacteria 8274608
673 2879079909 2879074833 Bacteria 8279565
674 2879085658 2879083081 Bacteria 8587928
675 2879104497 2879099564 Bacteria 10442239
676 2879133994 2879127579 Bacteria 8294491
677 2879148479 2879142872 Bacteria 8267021
678 2881364626 2881364244 Bacteria 7710352
679 2881671358 2881665667 Bacteria 8175609
680 2882457303 2882456835 Bacteria 6863978
681 2885374392 2885366525 Bacteria 8326213
682 2885413477 2885409591 Bacteria 9235467
683 2888387262 2888378607 Bacteria 9652610
684 2888391439 2888388044 Bacteria 7304136
685 2888426944 2888419890 Bacteria 7857137
686 2903727996 2903727486 Bacteria 8281579
687 2904669537 2904666416 Bacteria 8226587
688 2904713650 2904711408 Bacteria 9771557
689 2906602520 2906602504 Bacteria 8295279
690 2906635103 2906626472 Bacteria 8826946
691 2906649701 2906643746 Bacteria 8722424
692 2908776873 2908775508 Bacteria 8092255
693 2909046936 2909042592 Bacteria 6499737
694 2922370314
695 2922398862 2922393267 Bacteria 8285685
696 2929622630 2929615660 Bacteria 9193770
697 2929632267 2929624759 Bacteria 9339455
698 2932406023 2932401849 Bacteria 4262978
699 2932790028 2932784394 Bacteria 9704911
700 2932800696 2932794094 Bacteria 7915132
701 2932808427 2932801729 Bacteria 7987968
702 2932815571 2932809354 Bacteria 9135765
703 2932824853 2932818245 Bacteria 9955613
704 2932829115 2932828146 Bacteria 9745859
705 2933584739 2933577622 Bacteria 9116884
706 2935613165 2935608549 Bacteria 8203142
707 2935617591 2935616580 Bacteria 9032984
708 2935643636 2935638405 Bacteria 10015038
709 2935654123 2935648319 Bacteria 8801166
710 2935662775 2935656913 Bacteria 8965014
711 2935671054 2935665750 Bacteria 9571747
712 2935681697 2935675223 Bacteria 9928132
713 2935692674 2935684952 Bacteria 9590419
714 2935702661 2935694250 Bacteria 9291695
715 2935711948 2935703347 Bacteria 10242284
716 2935721292 2935713505 Bacteria 9608509
717 2935730714 2935722832 Bacteria 9608746
718 2935739982 2935732158 Bacteria 9706831
719 2935749020 2935741537 Bacteria 9707219
720 2935758890 2935750917 Bacteria 9590372
721 2935767155 2935760218 Bacteria 9817913
722 2935774815 2935769743 Bacteria 7878163
723 2935779999 2935777560 Bacteria 8077691
724 2935792985 2935785616 Bacteria 7962367
725 2935798563 2935793552 Bacteria 8012592
726 2935806919 2935801545 Bacteria 9301974
727 2935818816 2935810662 Bacteria 9401221
728 2935824983 2935819856 Bacteria 8261050
729 2935834321 2935827899 Bacteria 10038562
730 2935843954 2935837841 Bacteria 9454360
731 2935852202 2935847175 Bacteria 8228321
732 2935856910 2935855204 Bacteria 9035059
733 2935868437 2935864058 Bacteria 9784707
734 2935879747 2935873716 Bacteria 9632195
735 2935883534 2935883170 Bacteria 7964738
736 2935910636 2935908558 Bacteria 8568796
737 2935921816 2935916978 Bacteria 9113783
738 2935930045 2935926038 Bacteria 8601059
739 2935937713 2935934488 Bacteria 8602579
740 2935949817 2935942939 Bacteria 8599779
741 2935956913 2935951376 Bacteria 8602333
742 2935965370 2935959822 Bacteria 7869783
743 2935970830 2935967501 Bacteria 8603075
744 2935980145 2935975950 Bacteria 8347125
745 2935984314 2935984226 Bacteria 8302647
746 2935997254 2935992306 Bacteria 9802711
747 2936010000 2936002035 Bacteria 9362176
748 2936017028 2936011229 Bacteria 8801034
749 2936025564 2936019824 Bacteria 8804134
750 2936034406 2936028420 Bacteria 8965941
751 2936045498 2936037263 Bacteria 9446081
752 2936052560 2936046547 Bacteria 8903709
753 2936055394 2936055302 Bacteria 8785755
754 2940564520 2940556831 Bacteria 9590747
755 2941545202 2941538514 Bacteria 9402094
756 3005490835 3005483717 Bacteria 7877331
757 3005506573 3005506211 Bacteria 6943378
758 3005601788 3005594810 Bacteria 8716512
759 3005724469 3005718088 Bacteria 8283608
760 643603436 643348564 Bacteria 8839022
761 8001846938 8001845381 Bacteria 5804942
762 8006927552 8006926726 Bacteria 6749210
763 8016519103 8016511872 Bacteria 9921665
764 8016543076 8016539877 Bacteria 8155419
765 8016550216 8016548790 Bacteria 8155074
766 8016558620 8016557553 Bacteria 8154380
767 8016568483 8016566248 Bacteria 8158151
768 8016581133 8016575299 Bacteria 8154085
769 8016587576 8016583857 Bacteria 10421953
770 8016596604 8016595262 Bacteria 8149947
771 8016619269 8016613128 Bacteria 8794220
772 8017057598 8017057580 Bacteria 10023680
773 8019538459 8019530166 Bacteria 8155624
774 8019578221 8019576017 Bacteria 10049540
775 8019596255 8019586578 Bacteria 10212056
776 8019613099 8019608314 Bacteria 10042931
777 8019638250 8019629233 Bacteria 8687553
778 8019641389 8019638758 Bacteria 9062356
779 8019675676 8019668869 Bacteria 8791617
780 8019695396 8019687851 Bacteria 8712826
781 8045869063 8045864390 Bacteria 5043873
782 8055750513 8055742211 Bacteria 9226248
783 8056975298 8056967851 Bacteria 9038162
784 Ga0157372_10448022
785 JGI25151J46595_10000364
786 JGI25406J46586_10004226
787 JGI25153J46596_10001434
788 rootH2_10066442
789 rootH2_10142552
790 JGI25160J50197_1001208
791 JGI25404J52841_10033949
792 Ga0065165_1000370
793 Ga0065165_1001957
794 Ga0065165_1005374
795 Ga0070658_10004155
796 Ga0070658_10047644
797 Ga0070658_10088141
798 Ga0070658_10166809
799 Ga0070683_100037482
800 Ga0068869_100037313
801 Ga0070680_100016995
802 Ga0070660_100078596
803 Ga0070660_100108955
804 Ga0070660_100120072
805 Ga0070661_100000296
806 Ga0070661_100052782
807 Ga0070692_10181832
808 Ga0070668_100006611
809 Ga0070674_100077375
810 Ga0070659_100019155
811 Ga0070659_100077345
812 Ga0070659_100230528
813 Ga0070667_100068854
814 Ga0070713_100289226
815 Ga0070711_100026226
816 Ga0070711_100305302
817 Ga0070700_100043939
818 Ga0070663_100352032
819 Ga0070662_100378642
820 Ga0068867_100053823
821 Ga0070685_10001551
822 Ga0070706_100190045
823 Ga0070707_100135995
824 Ga0070698_100190944
825 Ga0070679_100015177
826 Ga0070679_100068564
827 Ga0070697_100106840
828 Ga0068853_100003694
829 Ga0068853_100004956
830 Ga0068853_100039780
831 Ga0068853_100193669
832 Ga0068853_100382481
833 Ga0068853_100456238
834 Ga0070672_100051615
835 Ga0070672_100305665
836 Ga0070686_100118452
837 Ga0070695_100003415
838 Ga0070693_100125560
839 Ga0070693_100181357
840 Ga0070665_100036876
841 Ga0070665_100056839
842 Ga0070665_100104771
843 Ga0068855_100006841
844 Ga0068855_100008845
845 Ga0068855_100032594
846 Ga0068855_100117641
847 Ga0068855_100121746
848 Ga0068855_100173592
849 Ga0070664_100108745
850 Ga0068857_100008234
851 Ga0068857_100035375
852 Ga0068854_100022479
853 Ga0068854_100108470
854 Ga0068854_100135849
855 Ga0068856_100037083
856 Ga0068856_100113050
857 Ga0068856_100185382
858 Ga0068856_100335598
859 Ga0070702_100138826
860 Ga0068852_100006572
861 Ga0068852_100138707
862 Ga0068859_100032209
863 Ga0068859_100257204
864 Ga0068861_100026505
865 Ga0068851_10166874
866 Ga0068858_100090754
867 Ga0081455_10009815
868 Ga0081455_10013086
869 Ga0081455_10057249
870 Ga0081540_1000024
871 Ga0081540_1005059
872 Ga0081540_1008220
873 Ga0081539_10002797
874 Ga0075368_10033032
875 Ga0075363_100046010
876 Ga0070712_100240971
877 Ga0075362_10047135
878 Ga0075367_10055274
879 Ga0075367_10058420
880 Ga0075367_10182112
881 Ga0075366_10142314
882 Ga0097621_100125937
883 Ga0075428_100069849
884 Ga0075428_100310243
885 Ga0075433_10003359
886 Ga0075434_100007129
887 Ga0075434_100011459
888 Ga0075434_100014087
889 Ga0068865_100058248
890 Ga0068865_100060720
891 Ga0075436_100014041
892 Ga0075436_100377212
893 Ga0097620_100032204
894 Ga0097620_100257203
895 Ga0105240_10000330
896 Ga0105240_10000528
897 Ga0105240_10000580
898 Ga0105240_10006878
899 Ga0105240_10095611
900 Ga0105240_10149956
901 Ga0105240_10156006
902 Ga0105240_10503143
903 Ga0111539_10245669
904 Ga0105245_10084638
905 Ga0105247_10072812
906 Ga0105247_10174424
907 Ga0114129_10263995
908 Ga0105243_10271706
909 Ga0105243_10332332
910 Ga0105242_10201528
911 Ga0105248_10396834
912 Ga0105237_10000203
913 Ga0105237_10013295
914 Ga0105237_10061656
915 Ga0105237_10086902
916 Ga0105237_10088428
917 Ga0105237_10146577
918 Ga0105237_10280046
919 Ga0105237_10332517
920 Ga0105238_10036434
921 Ga0105238_10108214
922 Ga0105238_10191372
923 Ga0105238_10248726
924 Ga0105249_10268161
925 Ga0105239_10016961
926 Ga0105239_10017508
927 Ga0105239_10089786
928 Ga0105239_10092739
929 Ga0105239_10102866
930 Ga0105239_10497434
931 Ga0157370_10041917
932 Ga0157370_10191880
933 Ga0157369_10389341
934 Ga0157374_10038068
935 Ga0157378_10304938
936 Ga0157372_10021475
937 Ga0157375_10256440
938 Ga0163163_10112189
939 Ga0163163_10565447
940 Ga0157377_10085211
941 Ga0157377_10116249
942 Ga0214544_1000003
943 Ga0214542_1000003
944 Ga0214545_1000004
945 Ga0214543_1000007
946 Ga0213876_10009961
947 Ga0213876_10117339
948 Ga0224572_1000989
949 Ga0209563_103333
950 Ga0209677_106867
951 Ga0209233_1005180
952 Ga0209130_1000662
953 Ga0209675_1000680
954 Ga0209025_1000936
955 Ga0209564_1007175
956 Ga0209564_1022974
957 Ga0209758_1000030
958 Ga0209758_1002104
959 Ga0209758_1003575
960 Ga0209758_1007165
961 Ga0209758_1044600
962 Ga0207426_1000066
963 Ga0207426_1000271
964 Ga0207426_1000913
965 Ga0209257_1000947
966 Ga0207692_10214171
967 Ga0207642_10034552
968 Ga0207710_10028594
969 Ga0207710_10091150
970 Ga0207645_10055751
971 Ga0207645_10070555
972 Ga0207643_10265495
973 Ga0207705_10008307
974 Ga0207705_10063998
975 Ga0207705_10079609
976 Ga0207684_10118574
977 Ga0207654_10015970
978 Ga0207707_10019821
979 Ga0207695_10000690
980 Ga0207695_10000905
981 Ga0207695_10005181
982 Ga0207695_10010385
983 Ga0207695_10010966
984 Ga0207695_10029626
985 Ga0207695_10051385
986 Ga0207671_10000177
987 Ga0207671_10028074
988 Ga0207671_10034193
989 Ga0207671_10060893
990 Ga0207671_10086095
991 Ga0207693_10235492
992 Ga0207660_10012501
993 Ga0207662_10044839
994 Ga0207657_10006065
995 Ga0207657_10025952
996 Ga0207657_10084537
997 Ga0207657_10116463
998 Ga0207649_10001647
999 Ga0207649_10031008
1000 Ga0207652_10018718
1001 Ga0207652_10509882
1002 Ga0207646_10039151
1003 Ga0207681_10188884
1004 Ga0207694_10056003
1005 Ga0207694_10081994
1006 Ga0207659_10075811
1007 Ga0207706_10385037
1008 Ga0207686_10111085
1009 Ga0207669_10024305
1010 Ga0207669_10029063
1011 Ga0207691_10197128
1012 Ga0207691_10471918
1013 Ga0207679_10019416
1014 Ga0207667_10010129
1015 Ga0207667_10016466
1016 Ga0207667_10040989
1017 Ga0207667_10128253
1018 Ga0207667_10148394
1019 Ga0207667_10214724
1020 Ga0207667_10227228
1021 Ga0207668_10003807
1022 Ga0207668_10208381
1023 Ga0207668_10316355
1024 Ga0207640_10001371
1025 Ga0207640_10114375
1026 Ga0207640_10129385
1027 Ga0207703_10084431
1028 Ga0207639_10000742
1029 Ga0207639_10002078
1030 Ga0207639_10145638
1031 Ga0207639_10188128
1032 Ga0207639_10252376
1033 Ga0207678_10066025
1034 Ga0207678_10075164
1035 Ga0207702_10059827
1036 Ga0207702_10188310
1037 Ga0207702_10233844
1038 Ga0207641_10080653
1039 Ga0207648_10067618
1040 Ga0207674_10009842
1041 Ga0207674_10017618
1042 Ga0207674_10119808
1043 Ga0207675_100029932
1044 Ga0207675_100033029
1045 Ga0207683_10071382
1046 Ga0207683_10229177
1047 Ga0207698_10037040
1048 Ga0207698_10104687
1049 Ga0207698_10133430
1050 Ga0209998_10004564
1051 Ga0207428_10076596
1052 Ga0268266_10012948
1053 Ga0268266_10048986
1054 Ga0268266_10183564
1055 Ga0268266_10275551
1056 Ga0268265_10007551
1057 Ga0268264_10040911
1058 Ga0265319_1011945
1059 Ga0265334_10000859
1060 Ga0265334_10001692
1061 Ga0265318_10000235
1062 Ga0265318_10027425
1063 Ga0265336_10029870
1064 Ga0265338_10000231
1065 Ga0265338_10063502
1066 Ga0265338_10071491
1067 Ga0265324_10019653
1068 Ga0265324_10031827
1069 Ga0316177_1090439
1070 Ga0265325_10003040
1071 Ga0265325_10015261
1072 Ga0265325_10021367
1073 Ga0265340_10024277
1074 Ga0265339_10001183
1075 Ga0265339_10003193
1076 Ga0265339_10004646
1077 Ga0265331_10022918
1078 Ga0265331_10029199
1079 Ga0265327_10004210
1080 Ga0265327_10006360
1081 Ga0265327_10009323
1082 Ga0265316_10019755
1083 Ga0265316_10084889
1084 Ga0265316_10106930
1085 Ga0265313_10000070
1086 Ga0265313_10001097
1087 Ga0307508_10108006
1088 Ga0316575_10013558
1089 Ga0265314_10022597
1090 Ga0265314_10049410
1091 Ga0265314_10160012
1092 Ga0265342_10019942
1093 Ga0316576_10040394
1094 Ga0307405_10437692
1095 Ga0307413_10030417
1096 Ga0307410_10093016
1097 Ga0307407_10072534
1098 Ga0307407_10100881
1099 Ga0307414_10040643
1100 Ga0307414_10047596
1101 Ga0307414_10390669
1102 Ga0316585_10050231
1103 Ga0316580_10018695
1104 Ga0307510_10069558
1105 Ga0307510_10168112
1106 Ga0316596_1020632
1107 Ga0373926_0057399
1108 Ga0373928_0053371
1109 Ga0373952_0004512
1110 Ga0373932_0011863
1111 Ga0373936_0124052
1112 Ga0373939_0023631
1113 Ga0373960_0002357
1114 Ga0373942_0021556
1115 Ga0373962_0000511
1116 Ga0373931_0000317
1117 Ga0373931_0004250
1118 Ga0373931_0056848
1119 Ga0373931_0111734
1120 Ga0373937_0292426
1121 Ga0316584_0026886
1122 Ga0395899_0090875
1123 Ga0395899_0135921
1124 Ga0395900_0088124
1125 Ga0395900_0130332
1126 Ga0395898_0015010
1127 Ga0395898_0095492
1128 Ga0395905_0001838
1129 Ga0395905_0006347
1130 Ga0395905_0038350
1131 Ga0395901_0016268
1132 Ga0395901_0596900
1133 Ga0400486_20503
1134 Ga0400483_205793
1135 Ga0436365_1001561
1136 Ga0436360_0818014
1137 Ga0436360_1148784
1138 Ga0436361_0660345
1139 Ga0439465_0017313
1140 Ga0439431_0010018
1141 Ga0450898_033063
1142 Ga0466966_0000514
1143 Ga0466961_0000065
1144 Ga0453684_0309219
1145 Ga0453684_0351520
1146 Ga0453684_0793664
1147 Ga0466960_0099565
1148 Ga0466959_0034929
1149 Ga0451576_0002723
1150 Ga0495603_0014974
1151 Ga0495629_0033520
1152 Ga0495638_0004694
1153 Ga0495638_0114179
1154 Ga0495582_0137397
1155 Ga0495605_0108500
1156 Ga0495584_0033583
1157 Ga0495606_0089469
1158 Ga0495608_0046172
1159 Ga0495610_0012643
1160 Ga0495648_0009770
1161 Ga0495642_0126784
1162 Ga0495640_0046096
1163 Ga0495622_0012727
1164 Ga0495622_0018741
1165 Ga0495634_0083755
1166 Ga0495649_0102515
1167 Ga0495589_0139462
1168 Ga0495600_0035934
1169 Ga0495604_0005237
1170 Ga0495672_0008715
1171 Ga0495676_0054208
1172 Ga0495683_0156123
1173 Ga0495685_011583
1174 Ga0495686_0081092
1175 Ga0496100_0031553
1176 Ga0496100_0138828
1177 Ga0496101_0351453
1178 Ga0496102_0250076
1179 Ga0496102_0291725
1180 Ga0496102_0662700
1181 Ga0496104_0002953
1182 Ga0496104_0017706
1183 Ga0496104_0061414
1184 Ga0496104_0136008
1185 Ga0496105_0006535
1186 Ga0496105_0046907
1187 Ga0496106_0016353
1188 Ga0496106_0236064
1189 Ga0496107_0130036
1190 Ga0496108_0130499
1191 Ga0496109_0107931
1192 Ga0496110_0064428
1193 Ga0496111_0039403
1194 Ga0496112_0048414
1195 Ga0496113_0048761
1196 Ga0496115_0013248
1197 Ga0496118_0013220
1198 Ga0496119_0003665
1199 Ga0496120_0009533
1200 Ga0496121_0009006
1201 Ga0496121_0129656
1202 Ga0496122_0165963
1203 Ga0496124_0264997
1204 Ga0496125_0000129
1205 Ga0496125_0052412
1206 Ga0496126_0060831
1207 Ga0496126_0138968
1208 Ga0496126_0172047
1209 Ga0501031_0026839
1210 Ga0501031_0046568
1211 Ga0501032_0001280
1212 Ga0501032_0002117
1213 Ga0501032_0034381
1214 Ga0501032_0149610
1215 Ga0501032_0190931
1216 Ga0501033_0278829
1217 Ga0501034_0000014
1218 Ga0501034_0002255
1219 Ga0501034_0027234
1220 Ga0501034_0035985
1221 Ga0501034_0045903
1222 Ga0501034_0048444
1223 Ga0501034_0065054
1224 Ga0501034_0082433
1225 Ga0501034_0144197
1226 Ga0501034_0150473
1227 Ga0501034_0274711
1228 Ga0501034_0283965
1229 Ga0501034_0411917
1230 Ga0501036_0005290
1231 Ga0501036_0033700
1232 Ga0501036_0049535
1233 Ga0501036_0090811
1234 Ga0501037_0001132
1235 Ga0501037_0026272
1236 Ga0501037_0040541
1237 Ga0501037_0213251
1238 Ga0501038_0025537
1239 Ga0501038_0343538
1240 Ga0501039_0000087
1241 Ga0501039_0065716
1242 Ga0501040_0128850
1243 Ga0501040_0243381
1244 Ga0501042_0068376
1245 Ga0501043_0005072
1246 Ga0501043_0207789
1247 Ga0501043_0250460
1248 Ga0501043_0318966
1249 Ga0501046_0013316
1250 Ga0501046_0031958
1251 Ga0501046_0042249
1252 Ga0501046_0167845
1253 Ga0501047_0000684
1254 Ga0501047_0020745
1255 Ga0501047_0090564
1256 Ga0501047_0272201
1257 Ga0501047_0283361
1258 Ga0501047_0448438
1259 Ga0501048_0000662
1260 Ga0501048_0039825
1261 Ga0501048_0162808
1262 Ga0501067_0000308
1263 Ga0501067_0000499
1264 Ga0501067_0024598
1265 Ga0501068_0001071
1266 Ga0501070_0019277
1267 Ga0501070_0047767
1268 Ga0501070_0107854
1269 Ga0501070_0221803
1270 Ga0501070_0276074
1271 Ga0501070_0428406
1272 Ga0501071_0195109
1273 Ga0501072_0055628
1274 Ga0501072_0253755
1275 Ga0501072_0291288
1276 Ga0501072_0329890
1277 Ga0501072_0380144
1278 Ga0501073_0000010
1279 Ga0501073_0060766
1280 Ga0501073_0076947
1281 Ga0501074_0082193
1282 Ga0501074_0109807
1283 Ga0501074_0151443
1284 Ga0501075_0056591
1285 Ga0501075_0198885
1286 Ga0501076_0184287
1287 Ga0501077_0000020
1288 Ga0501077_0008063
1289 Ga0501077_0015004
1290 Ga0501080_0000010
1291 Ga0501080_0229534
1292 Ga0501080_0294217
1293 Ga0501081_0001600
1294 Ga0501081_0080906
1295 Ga0501081_0162116
1296 Ga0501083_0086804
1297 Ga0501083_0227693
1298 Ga0501035_0000034
1299 Ga0501044_0000039
1300 Ga0501044_0005041
1301 Ga0501044_0008445
1302 Ga0501044_0029578
1303 Ga0501044_0045934
1304 Ga0501044_0152178
1305 Ga0501044_0256049
1306 Ga0501044_0355494
1307 Ga0501045_0035496
1308 Ga0501045_0089774
1309 nmdc:mga03683_6846_c1
1310 nmdc:mga03n38_41493_c1
1311 nmdc:mga03n38_65694_c1
1312 nmdc:mga0k408_79495_c1
1313 nmdc:mga06z11_140066_c1
1314 nmdc:mga06z11_65237_c1
1315 nmdc:mga07m45_22760_c1
1316 nmdc:mga05p37_260609_c1
1317 nmdc:mga0qj67_129900_c1
1318 nmdc:mga0qj67_141420_c1
1319 nmdc:mga06r32_130964_c1
1320 nmdc:mga06r32_388932_c1
1321 nmdc:mga08y16_158892_c1
1322 nmdc:mga0n895_108082_c1
1323 nmdc:mga0n895_6477_c1
1324 nmdc:mga0n895_66835_c1
1325 nmdc:mga0n895_9018_c1
1326 nmdc:mga08x19_336539_c1
1327 nmdc:mga0a205_1693_c1
1328 nmdc:mga0sz30_72508_c1
1329 Ga0495601_0006336
1330 Ga0500635_0001030
1331 Ga0500635_0008518
1332 Ga0500643_011377
1333 Ga0500643_018319
1334 Ga0500566_0000351
1335 Ga0500566_0003690
1336 Ga0500566_0004102
1337 Ga0500566_0101534
1338 Ga0500640_002238
1339 Ga0500641_0000510
1340 Ga0500641_0072540
1341 Ga0500556_0002319
1342 Ga0500572_000903
1343 Ga0500591_050672
1344 Ga0500593_000015
1345 Ga0500595_000141
1346 Ga0500595_012010
1347 Ga0500595_016954
1348 Ga0500607_038072
1349 Ga0500608_018687
1350 Ga0500652_065002
1351 Ga0500568_0000004
1352 Ga0500568_0034233
1353 Ga0500577_0094289
1354 Ga0500603_011934
1355 Ga0500604_0003067
1356 Ga0500616_0005500
1357 Ga0500616_0023683
1358 Ga0500630_000445
1359 Ga0500634_0000017
1360 Ga0500639_000103
1361 Ga0500636_0021148
1362 Ga0500636_0162035
1363 Ga0500637_0000311
1364 Ga0500637_0005785
1365 Ga0500637_0093985
1366 Ga0500599_005464
1367 Ga0500601_000420
1368 Ga0501084_0004495
1369 Ga0501084_0278533
1370 Ga0501084_0328188
1371 Ga0501084_0636341
1372 Ga0501082_0019819
1373 Ga0501082_0055412
1374 Ga0501082_0180033
1375 Ga0501082_0209574
1376 Ga0501082_0266752
1377 Ga0530510_0023645
1378 Ga0530510_0027092
1379 2507504430
1380 2508545858
1381 2508694685
1382 2508734279
1383 2509079177
1384 2511396414
1385 2513590631
1386 2513624236
1387 2513638724
1388 2513649196
1389 2513702124
1390 2513874187
1391 2514010055
1392 2515624396
1393 2517103087
1394 2528849429
1395 2617350306
1396 2617374392
1397 2643911770
1398 2643965629
1399 2644169439
1400 2644350837
1401 2644413138
1402 2671693828
1403 2738744894
1404 2739354124
1405 2774871670
1406 2776257822
1407 2793059307
1408 2805920905
1409 2818240583
1410 2821450797
1411 2824604689
1412 2824615392
1413 2824618848
1414 2824628954
1415 2824639247
1416 2824648833
1417 2824658638
1418 2824665830
1419 2824675095
1420 2824692542
1421 2824700895
1422 2824711305
1423 2824717532
1424 2824726776
1425 2824737694
1426 2824751197
1427 2824759679
1428 2824769940
1429 2824780312
1430 2828306445
1431 2829746515
1432 2835315581
1433 2838126036
1434 2841942570
1435 2841953080
1436 2841963933
1437 2841970895
1438 2841977845
1439 2841984591
1440 2842041685
1441 2842049727
1442 2842699745
1443 2844533975
1444 2847931976
1445 2847943223
1446 2849076952
1447 2857514779
1448 2874595623
1449 2874620382
1450 2874621870
1451 2874629646
1452 2874651743
1453 2876769224
1454 2876775818
1455 2876821639
1456 2879079909
1457 2879085658
1458 2879104497
1459 2879133994
1460 2879148479
1461 2881364626
1462 2881671358
1463 2882457303
1464 2885374392
1465 2885413477
1466 2888387262
1467 2888391439
1468 2888426944
1469 2903727996
1470 2904669537
1471 2904713650
1472 2906602520
1473 2906635103
1474 2906649701
1475 2908776873
1476 2909046936
1477 2922370314
1478 2922398862
1479 2929622630
1480 2929632267
1481 2932406023
1482 2932790028
1483 2932800696
1484 2932808427
1485 2932815571
1486 2932824853
1487 2932829115
1488 2933584739
1489 2935613165
1490 2935617591
1491 2935643636
1492 2935654123
1493 2935662775
1494 2935671054
1495 2935681697
1496 2935692674
1497 2935702661
1498 2935711948
1499 2935721292
1500 2935730714
1501 2935739982
1502 2935749020
1503 2935758890
1504 2935767155
1505 2935774815
1506 2935779999
1507 2935792985
1508 2935798563
1509 2935806919
1510 2935818816
1511 2935824983
1512 2935834321
1513 2935843954
1514 2935852202
1515 2935856910
1516 2935868437
1517 2935879747
1518 2935883534
1519 2935910636
1520 2935921816
1521 2935930045
1522 2935937713
1523 2935949817
1524 2935956913
1525 2935965370
1526 2935970830
1527 2935980145
1528 2935984314
1529 2935997254
1530 2936010000
1531 2936017028
1532 2936025564
1533 2936034406
1534 2936045498
1535 2936052560
1536 2936055394
1537 2940564520
1538 2941545202
1539 3005490835
1540 3005506573
1541 3005601788
1542 3005724469
1543 643603436
1544 8001846938
1545 8006927552
1546 8016519103
1547 8016543076
1548 8016550216
1549 8016558620
1550 8016568483
1551 8016581133
1552 8016587576
1553 8016596604
1554 8016619269
1555 8017057598
1556 8019538459
1557 8019578221
1558 8019596255
1559 8019613099
1560 8019638250
1561 8019641389
1562 8019675676
1563 8019695396
1564 8045869063
1565 8055750513
1566 8056975298

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02153

PDH_N

Prephenate dehydrogenase, nucleotide-binding domain

22

177

0.98

PF20463

PDH_C

Prephenate dehydrogenase, dimerization domain

179

281

0.93

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

9

138

0.83

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

9

102

0.82

PF07991

IlvN

Acetohydroxy acid isomeroreductase, NADPH-binding domain

7

107

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wji-assembly1.cif.gz_A-2 crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with nadp and tyrosine 0.9492 10 283
3ggp-assembly2.cif.gz_D crystal structure of prephenate dehydrogenase from a. aeolicus in complex with hydroxyphenyl propionate and nad+ 0.9155 14 283
5uyy-assembly2.cif.gz_D crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with l-tyrosine 0.9133 14 284
3b1f-assembly1.cif.gz_A-2 crystal structure of prephenate dehydrogenase from streptococcus mutans 0.9098 14 285
2g5c-assembly1.cif.gz_A crystal structure of prephenate dehydrogenase from aquifex aeolicus 0.9088 16 283
ID Description Score Start End Superfamily
2f1kB02 Mainly Alpha;Orthogonal Bundle;6-phosphogluconate dehydrogenase C-terminal fold;6-phosphogluconate dehydrogenase C-terminal like domain 0.9326 179 283 1.10.3660.10
2f1kC02 Mainly Alpha;Orthogonal Bundle;6-phosphogluconate dehydrogenase C-terminal fold;6-phosphogluconate dehydrogenase C-terminal like domain 0.9176 179 283 1.10.3660.10
af_Q2FYS1_1_176_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9155 14 180 3.40.50.720
2g5cC02 Mainly Alpha;Orthogonal Bundle;6-phosphogluconate dehydrogenase C-terminal fold;6-phosphogluconate dehydrogenase C-terminal like domain 0.8952 179 285 1.10.3660.10
af_Q9Y7N4_8_341_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.894 14 47 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A257QIA3-F1-model_v4 Cyclohexadienyl dehydrogenase 0.9925 9 101 GO:0004665
GO:0006571
GO:0008977
GO:0070403
AF-A0A840ARH8-F1-model_v4 Cyclohexadieny/prephenate dehydrogenase (EC 1.3.1.12, EC 1.3.1.43) 0.974 10 283 GO:0004665
GO:0006571
GO:0008977
GO:0070403
AF-A0A353IQS3-F1-model_v4 Prephenate/arogenate dehydrogenase family protein 0.9725 9 282 GO:0004665
GO:0006571
GO:0008977
GO:0070403
AF-A0A176RXM8-F1-model_v4 Prephenate dehydrogenase (EC 1.3.1.12) 0.972 122 272 GO:0004665
GO:0006571
GO:0008977
GO:0070403
AF-A0A6L7S3G0-F1-model_v4 Prephenate dehydrogenase/arogenate dehydrogenase family protein 0.9719 11 207 GO:0004665
GO:0006571
GO:0008977
GO:0070403

Map