F480658
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 783 | 507 | 1566 | 311 |
Family's Representative Sequence
| Representative Sequence | 3300013307|Ga0157372_10448022|Ga0157372_104480222 |
| Length | 347 |
| Sequence | MNATPIFRRIALIGFGLIGGSIARAARAQGLASEIVTTARSEKTRARVTELGIVDRVLETNAEAVQDADLVILCIPVQSYGAVMEKIGPYLEPGAILSDVGSVKEYVTKAMAPHIPKGVHLIPGHPIAGTEHSGPAAGFPELFINRWCVLTPGKTVPAEAIARLTAFWSDLGSNVELMEPTHHDMVLAITSHIPHLVAYNIVGTVSDLEQATQSEVIKFSASGFRDFTRIAASDPVMWRDVFLTNRDAVLEMLGRFLEDLSKLQRMVRVGDGPGMEDLFTRTRKIRRSIITAGQETAAADFGRPHGDVKTLSGPSGTALAEGTAAPLVDTNVEVASPVREHGGGDDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 53 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 56 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 57 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 85 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 86 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 87 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 88 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 89 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 90 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 141 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 145 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 146 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 147 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 148 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 150 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 151 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 152 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 153 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 154 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 155 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 156 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 157 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 158 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 159 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 160 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 163 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 165 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 166 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 167 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 168 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 169 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 170 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 171 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 173 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 174 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 175 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 177 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 178 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 181 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 184 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 185 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 186 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 187 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 188 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 189 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 190 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 191 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 192 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 193 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 194 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 195 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 196 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 197 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 198 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 199 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 200 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 201 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 202 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 203 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 229 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 230 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 231 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 232 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 233 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 236 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 237 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 238 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 239 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 240 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 241 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 242 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 243 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 244 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 245 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 246 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 247 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 248 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 279 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 280 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 281 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 282 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 283 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 291 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 293 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 294 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 295 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 296 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 297 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 298 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 299 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 300 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 301 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 302 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 303 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 304 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 305 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 306 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 307 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 308 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 309 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 310 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 311 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 312 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 313 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 314 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 315 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 316 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 317 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 320 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 321 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 322 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 323 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 324 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 325 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 326 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 327 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 328 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 329 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 330 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 331 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 332 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 333 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 334 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 335 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 336 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 337 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 338 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 339 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 340 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 341 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 342 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 343 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 344 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 345 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 346 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 347 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 348 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 349 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 350 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 351 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 352 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 353 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 354 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 355 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 356 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 357 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 358 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 359 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 360 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 361 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 362 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 363 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 364 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 365 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 366 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 367 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 368 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 369 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 370 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 371 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 372 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 373 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 374 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 375 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 376 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 377 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 378 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 379 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 380 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 381 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 382 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 383 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 384 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 385 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 386 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 387 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 388 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 389 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 390 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 391 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 392 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 393 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 394 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 395 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 396 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 397 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 398 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 399 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 400 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 401 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 402 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 403 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 404 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 405 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 406 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 407 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 408 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 409 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 410 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 411 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 412 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 413 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 414 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 415 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 416 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 417 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 418 | 2922368715 | |||
| 419 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 420 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 421 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 422 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 423 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 424 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 425 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 426 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 427 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 428 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 429 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 430 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 431 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 432 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 433 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 434 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 435 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 436 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 437 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 438 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 439 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 440 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 441 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 442 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 443 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 444 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 445 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 446 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 447 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 448 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 449 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 450 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 451 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 452 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 453 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 454 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 455 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 456 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 457 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 458 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 459 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 460 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 461 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 462 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 463 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 464 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 465 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 466 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 467 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 468 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 469 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 470 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 471 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 472 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 473 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 474 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 475 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 476 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 477 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 478 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 479 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 480 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 481 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 482 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 483 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 484 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 485 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 486 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 487 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 488 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 489 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 490 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 491 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 492 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 493 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 494 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 495 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 496 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 497 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 498 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 499 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 500 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 501 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 502 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 503 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 504 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 505 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 506 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 507 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.96 |
| Metatranscriptomes | 0.13 |
| Isolates | 23.91 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.71 |
| Nodule | 16.48 |
| Rhizoplane | 2.81 |
| Rhizosphere | 60.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157372_10448022 | 3300013307 | Bacteria | 1504 |
| 2 | JGI25151J46595_10000364 | 3300003187 | Bacteria | 47703 |
| 3 | JGI25406J46586_10004226 | 3300003203 | Bacteria | 6705 |
| 4 | JGI25153J46596_10001434 | 3300003215 | Bacteria | 14270 |
| 5 | rootH2_10066442 | 3300003320 | Bacteria | 8724 |
| 6 | rootH2_10142552 | 3300003320 | Bacteria | 1590 |
| 7 | JGI25160J50197_1001208 | 3300003354 | Bacteria | 13129 |
| 8 | JGI25404J52841_10033949 | 3300003659 | Bacteria | 1087 |
| 9 | Ga0065165_1000370 | 3300005262 | Bacteria | 73604 |
| 10 | Ga0065165_1001957 | 3300005262 | Bacteria | 19507 |
| 11 | Ga0065165_1005374 | 3300005262 | Bacteria | 7243 |
| 12 | Ga0070658_10004155 | 3300005327 | Bacteria | 11854 |
| 13 | Ga0070658_10047644 | 3300005327 | Bacteria | 3468 |
| 14 | Ga0070658_10088141 | 3300005327 | Bacteria | 2555 |
| 15 | Ga0070658_10166809 | 3300005327 | Bacteria | 1849 |
| 16 | Ga0070683_100037482 | 3300005329 | Bacteria | 4438 |
| 17 | Ga0068869_100037313 | 3300005334 | Bacteria | 3455 |
| 18 | Ga0070680_100016995 | 3300005336 | Bacteria | 5729 |
| 19 | Ga0070660_100078596 | 3300005339 | Bacteria | 2587 |
| 20 | Ga0070660_100108955 | 3300005339 | Bacteria | 2202 |
| 21 | Ga0070660_100120072 | 3300005339 | Bacteria | 2097 |
| 22 | Ga0070661_100000296 | 3300005344 | Bacteria | 40209 |
| 23 | Ga0070661_100052782 | 3300005344 | Bacteria | 2975 |
| 24 | Ga0070692_10181832 | 3300005345 | Bacteria | 1219 |
| 25 | Ga0070668_100006611 | 3300005347 | Bacteria | 8591 |
| 26 | Ga0070674_100077375 | 3300005356 | Bacteria | 2368 |
| 27 | Ga0070659_100019155 | 3300005366 | Bacteria | 5179 |
| 28 | Ga0070659_100077345 | 3300005366 | Bacteria | 2654 |
| 29 | Ga0070659_100230528 | 3300005366 | Bacteria | 1530 |
| 30 | Ga0070667_100068854 | 3300005367 | Bacteria | 3012 |
| 31 | Ga0070713_100289226 | 3300005436 | Bacteria | 1505 |
| 32 | Ga0070711_100026226 | 3300005439 | Bacteria | 3818 |
| 33 | Ga0070711_100305302 | 3300005439 | Bacteria | 1267 |
| 34 | Ga0070700_100043939 | 3300005441 | Bacteria | 2750 |
| 35 | Ga0070663_100352032 | 3300005455 | Bacteria | 1193 |
| 36 | Ga0070662_100378642 | 3300005457 | Bacteria | 1165 |
| 37 | Ga0068867_100053823 | 3300005459 | Bacteria | 2973 |
| 38 | Ga0070685_10001551 | 3300005466 | Bacteria | 12107 |
| 39 | Ga0070706_100190045 | 3300005467 | Bacteria | 1919 |
| 40 | Ga0070707_100135995 | 3300005468 | Bacteria | 2391 |
| 41 | Ga0070698_100190944 | 3300005471 | Bacteria | 1986 |
| 42 | Ga0070679_100015177 | 3300005530 | Bacteria | 7401 |
| 43 | Ga0070679_100068564 | 3300005530 | Bacteria | 3538 |
| 44 | Ga0070697_100106840 | 3300005536 | Bacteria | 2329 |
| 45 | Ga0068853_100003694 | 3300005539 | Bacteria | 11746 |
| 46 | Ga0068853_100004956 | 3300005539 | Bacteria | 10373 |
| 47 | Ga0068853_100039780 | 3300005539 | Bacteria | 4011 |
| 48 | Ga0068853_100193669 | 3300005539 | Bacteria | 1848 |
| 49 | Ga0068853_100382481 | 3300005539 | Bacteria | 1314 |
| 50 | Ga0068853_100456238 | 3300005539 | Bacteria | 1202 |
| 51 | Ga0070672_100051615 | 3300005543 | Bacteria | 3208 |
| 52 | Ga0070672_100305665 | 3300005543 | Bacteria | 1349 |
| 53 | Ga0070686_100118452 | 3300005544 | Bacteria | 1815 |
| 54 | Ga0070695_100003415 | 3300005545 | Bacteria | 9279 |
| 55 | Ga0070693_100125560 | 3300005547 | Bacteria | 1597 |
| 56 | Ga0070693_100181357 | 3300005547 | Bacteria | 1356 |
| 57 | Ga0070665_100036876 | 3300005548 | Bacteria | 4916 |
| 58 | Ga0070665_100056839 | 3300005548 | Bacteria | 3923 |
| 59 | Ga0070665_100104771 | 3300005548 | Bacteria | 2830 |
| 60 | Ga0068855_100006841 | 3300005563 | Bacteria | 13833 |
| 61 | Ga0068855_100008845 | 3300005563 | Bacteria | 12172 |
| 62 | Ga0068855_100032594 | 3300005563 | Bacteria | 6220 |
| 63 | Ga0068855_100117641 | 3300005563 | Bacteria | 3044 |
| 64 | Ga0068855_100121746 | 3300005563 | Bacteria | 2986 |
| 65 | Ga0068855_100173592 | 3300005563 | Unclassified | 2440 |
| 66 | Ga0070664_100108745 | 3300005564 | Bacteria | 2418 |
| 67 | Ga0068857_100008234 | 3300005577 | Bacteria | 9010 |
| 68 | Ga0068857_100035375 | 3300005577 | Bacteria | 4424 |
| 69 | Ga0068854_100022479 | 3300005578 | Bacteria | 4297 |
| 70 | Ga0068854_100108470 | 3300005578 | Bacteria | 2091 |
| 71 | Ga0068854_100135849 | 3300005578 | Bacteria | 1882 |
| 72 | Ga0068856_100037083 | 3300005614 | Bacteria | 4783 |
| 73 | Ga0068856_100113050 | 3300005614 | Bacteria | 2713 |
| 74 | Ga0068856_100185382 | 3300005614 | Bacteria | 2095 |
| 75 | Ga0068856_100335598 | 3300005614 | Bacteria | 1530 |
| 76 | Ga0070702_100138826 | 3300005615 | Bacteria | 1546 |
| 77 | Ga0068852_100006572 | 3300005616 | Bacteria | 8416 |
| 78 | Ga0068852_100138707 | 3300005616 | Bacteria | 2248 |
| 79 | Ga0068859_100032209 | 3300005617 | Bacteria | 5266 |
| 80 | Ga0068859_100257204 | 3300005617 | Bacteria | 1837 |
| 81 | Ga0068861_100026505 | 3300005719 | Bacteria | 4214 |
| 82 | Ga0068851_10166874 | 3300005834 | Bacteria | 1212 |
| 83 | Ga0068858_100090754 | 3300005842 | Bacteria | 2844 |
| 84 | Ga0081455_10009815 | 3300005937 | Bacteria | 9803 |
| 85 | Ga0081455_10013086 | 3300005937 | Bacteria | 8225 |
| 86 | Ga0081455_10057249 | 3300005937 | Bacteria | 3304 |
| 87 | Ga0081540_1000024 | 3300005983 | Bacteria | 158868 |
| 88 | Ga0081540_1005059 | 3300005983 | Bacteria | 9895 |
| 89 | Ga0081540_1008220 | 3300005983 | Bacteria | 7309 |
| 90 | Ga0081539_10002797 | 3300005985 | Bacteria | 23391 |
| 91 | Ga0075368_10033032 | 3300006042 | Bacteria | 2012 |
| 92 | Ga0075363_100046010 | 3300006048 | Bacteria | 2314 |
| 93 | Ga0070712_100240971 | 3300006175 | Bacteria | 1440 |
| 94 | Ga0075362_10047135 | 3300006177 | Bacteria | 1919 |
| 95 | Ga0075367_10055274 | 3300006178 | Bacteria | 2356 |
| 96 | Ga0075367_10058420 | 3300006178 | Bacteria | 2295 |
| 97 | Ga0075367_10182112 | 3300006178 | Bacteria | 1310 |
| 98 | Ga0075366_10142314 | 3300006195 | Bacteria | 1450 |
| 99 | Ga0097621_100125937 | 3300006237 | Bacteria | 2176 |
| 100 | Ga0075428_100069849 | 3300006844 | Bacteria | 3840 |
| 101 | Ga0075428_100310243 | 3300006844 | Bacteria | 1696 |
| 102 | Ga0075433_10003359 | 3300006852 | Bacteria | 12372 |
| 103 | Ga0075434_100007129 | 3300006871 | Bacteria | 10329 |
| 104 | Ga0075434_100011459 | 3300006871 | Bacteria | 8367 |
| 105 | Ga0075434_100014087 | 3300006871 | Bacteria | 7637 |
| 106 | Ga0068865_100058248 | 3300006881 | Bacteria | 2698 |
| 107 | Ga0068865_100060720 | 3300006881 | Bacteria | 2648 |
| 108 | Ga0075436_100014041 | 3300006914 | Bacteria | 5481 |
| 109 | Ga0075436_100377212 | 3300006914 | Bacteria | 1025 |
| 110 | Ga0097620_100032204 | 3300006931 | Bacteria | 5266 |
| 111 | Ga0097620_100257203 | 3300006931 | Bacteria | 1837 |
| 112 | Ga0105240_10000330 | 3300009093 | Bacteria | 89049 |
| 113 | Ga0105240_10000528 | 3300009093 | Bacteria | 70421 |
| 114 | Ga0105240_10000580 | 3300009093 | Bacteria | 67901 |
| 115 | Ga0105240_10006878 | 3300009093 | Bacteria | 16621 |
| 116 | Ga0105240_10095611 | 3300009093 | Bacteria | 3622 |
| 117 | Ga0105240_10149956 | 3300009093 | Bacteria | 2778 |
| 118 | Ga0105240_10156006 | 3300009093 | Bacteria | 2715 |
| 119 | Ga0105240_10503143 | 3300009093 | Bacteria | 1347 |
| 120 | Ga0111539_10245669 | 3300009094 | Bacteria | 2084 |
| 121 | Ga0105245_10084638 | 3300009098 | Bacteria | 2906 |
| 122 | Ga0105247_10072812 | 3300009101 | Bacteria | 2151 |
| 123 | Ga0105247_10174424 | 3300009101 | Bacteria | 1431 |
| 124 | Ga0114129_10263995 | 3300009147 | Bacteria | 2306 |
| 125 | Ga0105243_10271706 | 3300009148 | Bacteria | 1522 |
| 126 | Ga0105243_10332332 | 3300009148 | Bacteria | 1389 |
| 127 | Ga0105242_10201528 | 3300009176 | Bacteria | 1768 |
| 128 | Ga0105248_10396834 | 3300009177 | Bacteria | 1553 |
| 129 | Ga0105237_10000203 | 3300009545 | Bacteria | 84732 |
| 130 | Ga0105237_10013295 | 3300009545 | Bacteria | 8634 |
| 131 | Ga0105237_10061656 | 3300009545 | Bacteria | 3749 |
| 132 | Ga0105237_10086902 | 3300009545 | Bacteria | 3117 |
| 133 | Ga0105237_10088428 | 3300009545 | Bacteria | 3087 |
| 134 | Ga0105237_10146577 | 3300009545 | Bacteria | 2355 |
| 135 | Ga0105237_10280046 | 3300009545 | Bacteria | 1670 |
| 136 | Ga0105237_10332517 | 3300009545 | Bacteria | 1523 |
| 137 | Ga0105238_10036434 | 3300009551 | Bacteria | 5000 |
| 138 | Ga0105238_10108214 | 3300009551 | Bacteria | 2761 |
| 139 | Ga0105238_10191372 | 3300009551 | Bacteria | 2022 |
| 140 | Ga0105238_10248726 | 3300009551 | Bacteria | 1756 |
| 141 | Ga0105249_10268161 | 3300009553 | Bacteria | 1700 |
| 142 | Ga0105239_10016961 | 3300010375 | Bacteria | 8050 |
| 143 | Ga0105239_10017508 | 3300010375 | Bacteria | 7924 |
| 144 | Ga0105239_10089786 | 3300010375 | Bacteria | 3389 |
| 145 | Ga0105239_10092739 | 3300010375 | Bacteria | 3334 |
| 146 | Ga0105239_10102866 | 3300010375 | Bacteria | 3161 |
| 147 | Ga0105239_10497434 | 3300010375 | Bacteria | 1386 |
| 148 | Ga0157370_10041917 | 3300013104 | Bacteria | 4413 |
| 149 | Ga0157370_10191880 | 3300013104 | Bacteria | 1896 |
| 150 | Ga0157369_10389341 | 3300013105 | Bacteria | 1446 |
| 151 | Ga0157374_10038068 | 3300013296 | Bacteria | 4419 |
| 152 | Ga0157378_10304938 | 3300013297 | Bacteria | 1542 |
| 153 | Ga0157372_10021475 | 3300013307 | Bacteria | 6975 |
| 154 | Ga0157375_10256440 | 3300013308 | Bacteria | 1910 |
| 155 | Ga0163163_10112189 | 3300014325 | Bacteria | 2756 |
| 156 | Ga0163163_10565447 | 3300014325 | Bacteria | 1200 |
| 157 | Ga0157377_10085211 | 3300014745 | Bacteria | 1855 |
| 158 | Ga0157377_10116249 | 3300014745 | Bacteria | 1615 |
| 159 | Ga0214544_1000003 | 3300021320 | Bacteria | 643752 |
| 160 | Ga0214542_1000003 | 3300021321 | Bacteria | 435700 |
| 161 | Ga0214545_1000004 | 3300021324 | Bacteria | 453352 |
| 162 | Ga0214543_1000007 | 3300021327 | Bacteria | 414744 |
| 163 | Ga0213876_10009961 | 3300021384 | Bacteria | 5109 |
| 164 | Ga0213876_10117339 | 3300021384 | Bacteria | 1413 |
| 165 | Ga0224572_1000989 | 3300024225 | Bacteria | 3923 |
| 166 | Ga0209563_103333 | 3300025230 | Bacteria | 3351 |
| 167 | Ga0209677_106867 | 3300025253 | Bacteria | 2582 |
| 168 | Ga0209233_1005180 | 3300025261 | Bacteria | 4353 |
| 169 | Ga0209130_1000662 | 3300025284 | Bacteria | 31434 |
| 170 | Ga0209675_1000680 | 3300025291 | Bacteria | 23730 |
| 171 | Ga0209025_1000936 | 3300025294 | Bacteria | 44418 |
| 172 | Ga0209564_1007175 | 3300025295 | Bacteria | 5809 |
| 173 | Ga0209564_1022974 | 3300025295 | Bacteria | 2183 |
| 174 | Ga0209758_1000030 | 3300025297 | Bacteria | 509217 |
| 175 | Ga0209758_1002104 | 3300025297 | Bacteria | 21134 |
| 176 | Ga0209758_1003575 | 3300025297 | Bacteria | 13918 |
| 177 | Ga0209758_1007165 | 3300025297 | Bacteria | 7693 |
| 178 | Ga0209758_1044600 | 3300025297 | Bacteria | 1618 |
| 179 | Ga0207426_1000066 | 3300025302 | Bacteria | 351182 |
| 180 | Ga0207426_1000271 | 3300025302 | Bacteria | 108392 |
| 181 | Ga0207426_1000913 | 3300025302 | Bacteria | 29549 |
| 182 | Ga0209257_1000947 | 3300025304 | Bacteria | 40051 |
| 183 | Ga0207692_10214171 | 3300025898 | Bacteria | 1139 |
| 184 | Ga0207642_10034552 | 3300025899 | Bacteria | 2151 |
| 185 | Ga0207710_10028594 | 3300025900 | Bacteria | 2420 |
| 186 | Ga0207710_10091150 | 3300025900 | Bacteria | 1427 |
| 187 | Ga0207645_10055751 | 3300025907 | Bacteria | 2523 |
| 188 | Ga0207645_10070555 | 3300025907 | Bacteria | 2235 |
| 189 | Ga0207643_10265495 | 3300025908 | Bacteria | 1061 |
| 190 | Ga0207705_10008307 | 3300025909 | Bacteria | 7581 |
| 191 | Ga0207705_10063998 | 3300025909 | Bacteria | 2658 |
| 192 | Ga0207705_10079609 | 3300025909 | Bacteria | 2386 |
| 193 | Ga0207684_10118574 | 3300025910 | Bacteria | 2268 |
| 194 | Ga0207654_10015970 | 3300025911 | Bacteria | 3904 |
| 195 | Ga0207707_10019821 | 3300025912 | Bacteria | 5871 |
| 196 | Ga0207695_10000690 | 3300025913 | Bacteria | 66191 |
| 197 | Ga0207695_10000905 | 3300025913 | Bacteria | 53386 |
| 198 | Ga0207695_10005181 | 3300025913 | Bacteria | 17451 |
| 199 | Ga0207695_10010385 | 3300025913 | Bacteria | 11392 |
| 200 | Ga0207695_10010966 | 3300025913 | Bacteria | 11017 |
| 201 | Ga0207695_10029626 | 3300025913 | Bacteria | 6042 |
| 202 | Ga0207695_10051385 | 3300025913 | Bacteria | 4329 |
| 203 | Ga0207671_10000177 | 3300025914 | Bacteria | 97072 |
| 204 | Ga0207671_10028074 | 3300025914 | Bacteria | 4206 |
| 205 | Ga0207671_10034193 | 3300025914 | Bacteria | 3778 |
| 206 | Ga0207671_10060893 | 3300025914 | Bacteria | 2801 |
| 207 | Ga0207671_10086095 | 3300025914 | Bacteria | 2362 |
| 208 | Ga0207693_10235492 | 3300025915 | Bacteria | 1438 |
| 209 | Ga0207660_10012501 | 3300025917 | Bacteria | 5556 |
| 210 | Ga0207662_10044839 | 3300025918 | Bacteria | 2612 |
| 211 | Ga0207657_10006065 | 3300025919 | Bacteria | 12571 |
| 212 | Ga0207657_10025952 | 3300025919 | Bacteria | 5394 |
| 213 | Ga0207657_10084537 | 3300025919 | Bacteria | 2659 |
| 214 | Ga0207657_10116463 | 3300025919 | Bacteria | 2202 |
| 215 | Ga0207649_10001647 | 3300025920 | Bacteria | 12960 |
| 216 | Ga0207649_10031008 | 3300025920 | Bacteria | 3173 |
| 217 | Ga0207652_10018718 | 3300025921 | Bacteria | 5683 |
| 218 | Ga0207652_10509882 | 3300025921 | Bacteria | 1082 |
| 219 | Ga0207646_10039151 | 3300025922 | Bacteria | 4266 |
| 220 | Ga0207681_10188884 | 3300025923 | Bacteria | 1575 |
| 221 | Ga0207694_10056003 | 3300025924 | Bacteria | 3062 |
| 222 | Ga0207694_10081994 | 3300025924 | Bacteria | 2534 |
| 223 | Ga0207659_10075811 | 3300025926 | Bacteria | 2469 |
| 224 | Ga0207706_10385037 | 3300025933 | Bacteria | 1217 |
| 225 | Ga0207686_10111085 | 3300025934 | Bacteria | 1849 |
| 226 | Ga0207669_10024305 | 3300025937 | Bacteria | 3254 |
| 227 | Ga0207669_10029063 | 3300025937 | Bacteria | 3051 |
| 228 | Ga0207691_10197128 | 3300025940 | Bacteria | 1754 |
| 229 | Ga0207691_10471918 | 3300025940 | Bacteria | 1067 |
| 230 | Ga0207679_10019416 | 3300025945 | Bacteria | 4565 |
| 231 | Ga0207667_10010129 | 3300025949 | Bacteria | 11039 |
| 232 | Ga0207667_10016466 | 3300025949 | Bacteria | 8354 |
| 233 | Ga0207667_10040989 | 3300025949 | Bacteria | 4928 |
| 234 | Ga0207667_10128253 | 3300025949 | Unclassified | 2613 |
| 235 | Ga0207667_10148394 | 3300025949 | Bacteria | 2414 |
| 236 | Ga0207667_10214724 | 3300025949 | Bacteria | 1971 |
| 237 | Ga0207667_10227228 | 3300025949 | Bacteria | 1912 |
| 238 | Ga0207668_10003807 | 3300025972 | Bacteria | 8889 |
| 239 | Ga0207668_10208381 | 3300025972 | Bacteria | 1562 |
| 240 | Ga0207668_10316355 | 3300025972 | Bacteria | 1294 |
| 241 | Ga0207640_10001371 | 3300025981 | Bacteria | 13177 |
| 242 | Ga0207640_10114375 | 3300025981 | Bacteria | 1920 |
| 243 | Ga0207640_10129385 | 3300025981 | Bacteria | 1822 |
| 244 | Ga0207703_10084431 | 3300026035 | Bacteria | 2655 |
| 245 | Ga0207639_10000742 | 3300026041 | Bacteria | 22258 |
| 246 | Ga0207639_10002078 | 3300026041 | Bacteria | 13488 |
| 247 | Ga0207639_10145638 | 3300026041 | Bacteria | 1978 |
| 248 | Ga0207639_10188128 | 3300026041 | Bacteria | 1761 |
| 249 | Ga0207639_10252376 | 3300026041 | Bacteria | 1539 |
| 250 | Ga0207678_10066025 | 3300026067 | Bacteria | 3107 |
| 251 | Ga0207678_10075164 | 3300026067 | Bacteria | 2894 |
| 252 | Ga0207702_10059827 | 3300026078 | Bacteria | 3246 |
| 253 | Ga0207702_10188310 | 3300026078 | Bacteria | 1905 |
| 254 | Ga0207702_10233844 | 3300026078 | Bacteria | 1719 |
| 255 | Ga0207641_10080653 | 3300026088 | Bacteria | 2824 |
| 256 | Ga0207648_10067618 | 3300026089 | Bacteria | 3114 |
| 257 | Ga0207674_10009842 | 3300026116 | Bacteria | 10885 |
| 258 | Ga0207674_10017618 | 3300026116 | Bacteria | 7790 |
| 259 | Ga0207674_10119808 | 3300026116 | Bacteria | 2600 |
| 260 | Ga0207675_100029932 | 3300026118 | Bacteria | 5069 |
| 261 | Ga0207675_100033029 | 3300026118 | Bacteria | 4822 |
| 262 | Ga0207683_10071382 | 3300026121 | Bacteria | 3069 |
| 263 | Ga0207683_10229177 | 3300026121 | Bacteria | 1694 |
| 264 | Ga0207698_10037040 | 3300026142 | Bacteria | 3588 |
| 265 | Ga0207698_10104687 | 3300026142 | Bacteria | 2355 |
| 266 | Ga0207698_10133430 | 3300026142 | Bacteria | 2126 |
| 267 | Ga0209998_10004564 | 3300027717 | Bacteria | 2938 |
| 268 | Ga0207428_10076596 | 3300027907 | Bacteria | 2619 |
| 269 | Ga0268266_10012948 | 3300028379 | Bacteria | 7192 |
| 270 | Ga0268266_10048986 | 3300028379 | Bacteria | 3621 |
| 271 | Ga0268266_10183564 | 3300028379 | Bacteria | 1906 |
| 272 | Ga0268266_10275551 | 3300028379 | Bacteria | 1563 |
| 273 | Ga0268265_10007551 | 3300028380 | Bacteria | 7339 |
| 274 | Ga0268264_10040911 | 3300028381 | Bacteria | 3830 |
| 275 | Ga0265319_1011945 | 3300028563 | Bacteria | 3530 |
| 276 | Ga0265334_10000859 | 3300028573 | Bacteria | 15224 |
| 277 | Ga0265334_10001692 | 3300028573 | Bacteria | 10542 |
| 278 | Ga0265318_10000235 | 3300028577 | Bacteria | 48102 |
| 279 | Ga0265318_10027425 | 3300028577 | Bacteria | 2238 |
| 280 | Ga0265336_10029870 | 3300028666 | Bacteria | 1698 |
| 281 | Ga0265338_10000231 | 3300028800 | Bacteria | 103805 |
| 282 | Ga0265338_10063502 | 3300028800 | Bacteria | 3219 |
| 283 | Ga0265338_10071491 | 3300028800 | Bacteria | 2967 |
| 284 | Ga0265324_10019653 | 3300029957 | Bacteria | 2431 |
| 285 | Ga0265324_10031827 | 3300029957 | Bacteria | 1846 |
| 286 | Ga0316177_1090439 | 3300030731 | Bacteria | 1750 |
| 287 | Ga0265325_10003040 | 3300031241 | Bacteria | 11100 |
| 288 | Ga0265325_10015261 | 3300031241 | Bacteria | 4323 |
| 289 | Ga0265325_10021367 | 3300031241 | Bacteria | 3556 |
| 290 | Ga0265340_10024277 | 3300031247 | Bacteria | 3081 |
| 291 | Ga0265339_10001183 | 3300031249 | Bacteria | 19723 |
| 292 | Ga0265339_10003193 | 3300031249 | Bacteria | 11505 |
| 293 | Ga0265339_10004646 | 3300031249 | Bacteria | 9334 |
| 294 | Ga0265331_10022918 | 3300031250 | Bacteria | 3180 |
| 295 | Ga0265331_10029199 | 3300031250 | Bacteria | 2754 |
| 296 | Ga0265327_10004210 | 3300031251 | Bacteria | 12931 |
| 297 | Ga0265327_10006360 | 3300031251 | Bacteria | 9469 |
| 298 | Ga0265327_10009323 | 3300031251 | Bacteria | 7103 |
| 299 | Ga0265316_10019755 | 3300031344 | Bacteria | 5753 |
| 300 | Ga0265316_10084889 | 3300031344 | Bacteria | 2424 |
| 301 | Ga0265316_10106930 | 3300031344 | Bacteria | 2122 |
| 302 | Ga0265313_10000070 | 3300031595 | Bacteria | 99384 |
| 303 | Ga0265313_10001097 | 3300031595 | Bacteria | 26024 |
| 304 | Ga0307508_10108006 | 3300031616 | Bacteria | 2382 |
| 305 | Ga0316575_10013558 | 3300031665 | Bacteria | 3046 |
| 306 | Ga0265314_10022597 | 3300031711 | Bacteria | 4817 |
| 307 | Ga0265314_10049410 | 3300031711 | Bacteria | 2945 |
| 308 | Ga0265314_10160012 | 3300031711 | Bacteria | 1371 |
| 309 | Ga0265342_10019942 | 3300031712 | Bacteria | 4312 |
| 310 | Ga0316576_10040394 | 3300031727 | Bacteria | 3353 |
| 311 | Ga0307405_10437692 | 3300031731 | Bacteria | 1033 |
| 312 | Ga0307413_10030417 | 3300031824 | Bacteria | 3033 |
| 313 | Ga0307410_10093016 | 3300031852 | Bacteria | 2145 |
| 314 | Ga0307407_10072534 | 3300031903 | Bacteria | 2054 |
| 315 | Ga0307407_10100881 | 3300031903 | Bacteria | 1791 |
| 316 | Ga0307414_10040643 | 3300032004 | Bacteria | 3143 |
| 317 | Ga0307414_10047596 | 3300032004 | Bacteria | 2952 |
| 318 | Ga0307414_10390669 | 3300032004 | Bacteria | 1206 |
| 319 | Ga0316585_10050231 | 3300032137 | Bacteria | 1339 |
| 320 | Ga0316580_10018695 | 3300032139 | Bacteria | 2132 |
| 321 | Ga0307510_10069558 | 3300033180 | Bacteria | 3524 |
| 322 | Ga0307510_10168112 | 3300033180 | Bacteria | 1777 |
| 323 | Ga0316596_1020632 | 3300033541 | Bacteria | 1677 |
| 324 | Ga0373926_0057399 | 3300035083 | Bacteria | 1414 |
| 325 | Ga0373928_0053371 | 3300035084 | Bacteria | 960 |
| 326 | Ga0373952_0004512 | 3300035092 | Bacteria | 2527 |
| 327 | Ga0373932_0011863 | 3300035112 | Bacteria | 2136 |
| 328 | Ga0373936_0124052 | 3300035113 | Bacteria | 1106 |
| 329 | Ga0373939_0023631 | 3300035114 | Bacteria | 1705 |
| 330 | Ga0373960_0002357 | 3300035121 | Bacteria | 4242 |
| 331 | Ga0373942_0021556 | 3300035207 | Bacteria | 1626 |
| 332 | Ga0373962_0000511 | 3300035242 | Bacteria | 8651 |
| 333 | Ga0373931_0000317 | 3300035691 | Bacteria | 20240 |
| 334 | Ga0373931_0004250 | 3300035691 | Bacteria | 6519 |
| 335 | Ga0373931_0056848 | 3300035691 | Bacteria | 2097 |
| 336 | Ga0373931_0111734 | 3300035691 | Bacteria | 1551 |
| 337 | Ga0373937_0292426 | 3300036401 | Bacteria | 1539 |
| 338 | Ga0316584_0026886 | 3300036712 | Bacteria | 4231 |
| 339 | Ga0395899_0090875 | 3300037312 | Bacteria | 2213 |
| 340 | Ga0395899_0135921 | 3300037312 | Bacteria | 1752 |
| 341 | Ga0395900_0088124 | 3300037418 | Bacteria | 3190 |
| 342 | Ga0395900_0130332 | 3300037418 | Bacteria | 2577 |
| 343 | Ga0395898_0015010 | 3300037466 | Bacteria | 7950 |
| 344 | Ga0395898_0095492 | 3300037466 | Bacteria | 2856 |
| 345 | Ga0395905_0001838 | 3300037471 | Bacteria | 24511 |
| 346 | Ga0395905_0006347 | 3300037471 | Bacteria | 11914 |
| 347 | Ga0395905_0038350 | 3300037471 | Bacteria | 4496 |
| 348 | Ga0395901_0016268 | 3300038443 | Bacteria | 7576 |
| 349 | Ga0395901_0596900 | 3300038443 | Bacteria | 1114 |
| 350 | Ga0400486_20503 | 3300038742 | Bacteria | 1798 |
| 351 | Ga0400483_205793 | 3300039062 | Bacteria | 1918 |
| 352 | Ga0436365_1001561 | 3300039437 | Bacteria | 3202 |
| 353 | Ga0436360_0818014 | 3300039438 | Bacteria | 5526 |
| 354 | Ga0436360_1148784 | 3300039438 | Bacteria | 1050 |
| 355 | Ga0436361_0660345 | 3300039447 | Bacteria | 3103 |
| 356 | Ga0439465_0017313 | 3300041413 | Bacteria | 2250 |
| 357 | Ga0439431_0010018 | 3300041997 | Bacteria | 2147 |
| 358 | Ga0450898_033063 | 3300042134 | Bacteria | 956 |
| 359 | Ga0466966_0000514 | 3300044684 | Bacteria | 24679 |
| 360 | Ga0466961_0000065 | 3300044693 | Bacteria | 63259 |
| 361 | Ga0453684_0309219 | 3300044712 | Bacteria | 1794 |
| 362 | Ga0453684_0351520 | 3300044712 | Bacteria | 1662 |
| 363 | Ga0453684_0793664 | 3300044712 | Bacteria | 1022 |
| 364 | Ga0466960_0099565 | 3300044901 | Bacteria | 1495 |
| 365 | Ga0466959_0034929 | 3300045049 | Bacteria | 3718 |
| 366 | Ga0451576_0002723 | 3300045051 | Bacteria | 25665 |
| 367 | Ga0495603_0014974 | 3300046455 | Bacteria | 4689 |
| 368 | Ga0495629_0033520 | 3300046459 | Bacteria | 3632 |
| 369 | Ga0495638_0004694 | 3300046460 | Bacteria | 10329 |
| 370 | Ga0495638_0114179 | 3300046460 | Bacteria | 1602 |
| 371 | Ga0495582_0137397 | 3300046473 | Bacteria | 1384 |
| 372 | Ga0495605_0108500 | 3300046474 | Bacteria | 1269 |
| 373 | Ga0495584_0033583 | 3300046491 | Bacteria | 2596 |
| 374 | Ga0495606_0089469 | 3300046507 | Bacteria | 1896 |
| 375 | Ga0495608_0046172 | 3300046511 | Bacteria | 2900 |
| 376 | Ga0495610_0012643 | 3300046512 | Bacteria | 5065 |
| 377 | Ga0495648_0009770 | 3300046524 | Bacteria | 7390 |
| 378 | Ga0495642_0126784 | 3300046528 | Bacteria | 1097 |
| 379 | Ga0495640_0046096 | 3300046533 | Bacteria | 3023 |
| 380 | Ga0495622_0012727 | 3300046557 | Bacteria | 3901 |
| 381 | Ga0495622_0018741 | 3300046557 | Bacteria | 3223 |
| 382 | Ga0495634_0083755 | 3300046642 | Bacteria | 2081 |
| 383 | Ga0495649_0102515 | 3300046694 | Bacteria | 1520 |
| 384 | Ga0495589_0139462 | 3300046794 | Bacteria | 1162 |
| 385 | Ga0495600_0035934 | 3300046809 | Bacteria | 3220 |
| 386 | Ga0495604_0005237 | 3300047317 | Bacteria | 10272 |
| 387 | Ga0495672_0008715 | 3300047320 | Bacteria | 7440 |
| 388 | Ga0495676_0054208 | 3300047321 | Bacteria | 3189 |
| 389 | Ga0495683_0156123 | 3300047323 | Bacteria | 1058 |
| 390 | Ga0495685_011583 | 3300047447 | Bacteria | 2979 |
| 391 | Ga0495686_0081092 | 3300047472 | Bacteria | 1982 |
| 392 | Ga0496100_0031553 | 3300048903 | Bacteria | 3296 |
| 393 | Ga0496100_0138828 | 3300048903 | Bacteria | 1720 |
| 394 | Ga0496101_0351453 | 3300048904 | Bacteria | 1158 |
| 395 | Ga0496102_0250076 | 3300048905 | Bacteria | 1671 |
| 396 | Ga0496102_0291725 | 3300048905 | Bacteria | 1537 |
| 397 | Ga0496102_0662700 | 3300048905 | Bacteria | 967 |
| 398 | Ga0496104_0002953 | 3300048907 | Bacteria | 14655 |
| 399 | Ga0496104_0017706 | 3300048907 | Bacteria | 6495 |
| 400 | Ga0496104_0061414 | 3300048907 | Bacteria | 3563 |
| 401 | Ga0496104_0136008 | 3300048907 | Bacteria | 2361 |
| 402 | Ga0496105_0006535 | 3300048908 | Bacteria | 8969 |
| 403 | Ga0496105_0046907 | 3300048908 | Bacteria | 3566 |
| 404 | Ga0496106_0016353 | 3300048909 | Bacteria | 5488 |
| 405 | Ga0496106_0236064 | 3300048909 | Bacteria | 1461 |
| 406 | Ga0496107_0130036 | 3300048910 | Bacteria | 1858 |
| 407 | Ga0496108_0130499 | 3300048911 | Bacteria | 2160 |
| 408 | Ga0496109_0107931 | 3300048912 | Bacteria | 2587 |
| 409 | Ga0496110_0064428 | 3300048913 | Bacteria | 3239 |
| 410 | Ga0496111_0039403 | 3300048914 | Bacteria | 3387 |
| 411 | Ga0496112_0048414 | 3300048915 | Bacteria | 4167 |
| 412 | Ga0496113_0048761 | 3300048916 | Bacteria | 3152 |
| 413 | Ga0496115_0013248 | 3300048918 | Bacteria | 6231 |
| 414 | Ga0496118_0013220 | 3300048921 | Bacteria | 7828 |
| 415 | Ga0496119_0003665 | 3300048922 | Bacteria | 15760 |
| 416 | Ga0496120_0009533 | 3300048923 | Bacteria | 6874 |
| 417 | Ga0496121_0009006 | 3300048924 | Bacteria | 11574 |
| 418 | Ga0496121_0129656 | 3300048924 | Bacteria | 1890 |
| 419 | Ga0496122_0165963 | 3300048925 | Bacteria | 1339 |
| 420 | Ga0496124_0264997 | 3300048927 | Bacteria | 1262 |
| 421 | Ga0496125_0000129 | 3300048928 | Bacteria | 163342 |
| 422 | Ga0496125_0052412 | 3300048928 | Bacteria | 3355 |
| 423 | Ga0496126_0060831 | 3300048929 | Bacteria | 3395 |
| 424 | Ga0496126_0138968 | 3300048929 | Bacteria | 2093 |
| 425 | Ga0496126_0172047 | 3300048929 | Bacteria | 1844 |
| 426 | Ga0501031_0026839 | 3300049568 | Bacteria | 3754 |
| 427 | Ga0501031_0046568 | 3300049568 | Bacteria | 2828 |
| 428 | Ga0501032_0001280 | 3300049569 | Bacteria | 20167 |
| 429 | Ga0501032_0002117 | 3300049569 | Bacteria | 15668 |
| 430 | Ga0501032_0034381 | 3300049569 | Bacteria | 3470 |
| 431 | Ga0501032_0149610 | 3300049569 | Bacteria | 1536 |
| 432 | Ga0501032_0190931 | 3300049569 | Bacteria | 1339 |
| 433 | Ga0501033_0278829 | 3300049570 | Bacteria | 1180 |
| 434 | Ga0501034_0000014 | 3300049571 | Bacteria | 297798 |
| 435 | Ga0501034_0002255 | 3300049571 | Bacteria | 23658 |
| 436 | Ga0501034_0027234 | 3300049571 | Bacteria | 5815 |
| 437 | Ga0501034_0035985 | 3300049571 | Bacteria | 5020 |
| 438 | Ga0501034_0045903 | 3300049571 | Bacteria | 4414 |
| 439 | Ga0501034_0048444 | 3300049571 | Bacteria | 4288 |
| 440 | Ga0501034_0065054 | 3300049571 | Bacteria | 3659 |
| 441 | Ga0501034_0082433 | 3300049571 | Bacteria | 3218 |
| 442 | Ga0501034_0144197 | 3300049571 | Bacteria | 2359 |
| 443 | Ga0501034_0150473 | 3300049571 | Bacteria | 2303 |
| 444 | Ga0501034_0274711 | 3300049571 | Bacteria | 1625 |
| 445 | Ga0501034_0283965 | 3300049571 | Bacteria | 1594 |
| 446 | Ga0501034_0411917 | 3300049571 | Bacteria | 1274 |
| 447 | Ga0501036_0005290 | 3300049572 | Bacteria | 10442 |
| 448 | Ga0501036_0033700 | 3300049572 | Bacteria | 4331 |
| 449 | Ga0501036_0049535 | 3300049572 | Bacteria | 3557 |
| 450 | Ga0501036_0090811 | 3300049572 | Bacteria | 2580 |
| 451 | Ga0501037_0001132 | 3300049573 | Bacteria | 19740 |
| 452 | Ga0501037_0026272 | 3300049573 | Bacteria | 4303 |
| 453 | Ga0501037_0040541 | 3300049573 | Bacteria | 3427 |
| 454 | Ga0501037_0213251 | 3300049573 | Bacteria | 1361 |
| 455 | Ga0501038_0025537 | 3300049574 | Bacteria | 5265 |
| 456 | Ga0501038_0343538 | 3300049574 | Bacteria | 1164 |
| 457 | Ga0501039_0000087 | 3300049575 | Bacteria | 69688 |
| 458 | Ga0501039_0065716 | 3300049575 | Bacteria | 2814 |
| 459 | Ga0501040_0128850 | 3300049576 | Bacteria | 1778 |
| 460 | Ga0501040_0243381 | 3300049576 | Bacteria | 1283 |
| 461 | Ga0501042_0068376 | 3300049578 | Bacteria | 2540 |
| 462 | Ga0501043_0005072 | 3300049579 | Bacteria | 10653 |
| 463 | Ga0501043_0207789 | 3300049579 | Bacteria | 1518 |
| 464 | Ga0501043_0250460 | 3300049579 | Bacteria | 1364 |
| 465 | Ga0501043_0318966 | 3300049579 | Bacteria | 1185 |
| 466 | Ga0501046_0013316 | 3300049580 | Bacteria | 6967 |
| 467 | Ga0501046_0031958 | 3300049580 | Bacteria | 4264 |
| 468 | Ga0501046_0042249 | 3300049580 | Bacteria | 3635 |
| 469 | Ga0501046_0167845 | 3300049580 | Bacteria | 1648 |
| 470 | Ga0501047_0000684 | 3300049581 | Bacteria | 35329 |
| 471 | Ga0501047_0020745 | 3300049581 | Bacteria | 6312 |
| 472 | Ga0501047_0090564 | 3300049581 | Bacteria | 2936 |
| 473 | Ga0501047_0272201 | 3300049581 | Bacteria | 1540 |
| 474 | Ga0501047_0283361 | 3300049581 | Bacteria | 1501 |
| 475 | Ga0501047_0448438 | 3300049581 | Bacteria | 1120 |
| 476 | Ga0501048_0000662 | 3300049582 | Bacteria | 24880 |
| 477 | Ga0501048_0039825 | 3300049582 | Bacteria | 3369 |
| 478 | Ga0501048_0162808 | 3300049582 | Bacteria | 1579 |
| 479 | Ga0501067_0000308 | 3300049583 | Bacteria | 26907 |
| 480 | Ga0501067_0000499 | 3300049583 | Bacteria | 21525 |
| 481 | Ga0501067_0024598 | 3300049583 | Bacteria | 3340 |
| 482 | Ga0501068_0001071 | 3300049584 | Bacteria | 14464 |
| 483 | Ga0501070_0019277 | 3300049586 | Bacteria | 5721 |
| 484 | Ga0501070_0047767 | 3300049586 | Bacteria | 3556 |
| 485 | Ga0501070_0107854 | 3300049586 | Bacteria | 2301 |
| 486 | Ga0501070_0221803 | 3300049586 | Bacteria | 1550 |
| 487 | Ga0501070_0276074 | 3300049586 | Bacteria | 1372 |
| 488 | Ga0501070_0428406 | 3300049586 | Bacteria | 1068 |
| 489 | Ga0501071_0195109 | 3300049587 | Bacteria | 1519 |
| 490 | Ga0501072_0055628 | 3300049588 | Bacteria | 3118 |
| 491 | Ga0501072_0253755 | 3300049588 | Bacteria | 1400 |
| 492 | Ga0501072_0291288 | 3300049588 | Bacteria | 1298 |
| 493 | Ga0501072_0329890 | 3300049588 | Bacteria | 1212 |
| 494 | Ga0501072_0380144 | 3300049588 | Bacteria | 1121 |
| 495 | Ga0501073_0000010 | 3300049589 | Bacteria | 171144 |
| 496 | Ga0501073_0060766 | 3300049589 | Bacteria | 2637 |
| 497 | Ga0501073_0076947 | 3300049589 | Bacteria | 2322 |
| 498 | Ga0501074_0082193 | 3300049590 | Bacteria | 2310 |
| 499 | Ga0501074_0109807 | 3300049590 | Bacteria | 1973 |
| 500 | Ga0501074_0151443 | 3300049590 | Bacteria | 1658 |
| 501 | Ga0501075_0056591 | 3300049591 | Bacteria | 2952 |
| 502 | Ga0501075_0198885 | 3300049591 | Bacteria | 1528 |
| 503 | Ga0501076_0184287 | 3300049592 | Bacteria | 1702 |
| 504 | Ga0501077_0000020 | 3300049593 | Bacteria | 80360 |
| 505 | Ga0501077_0008063 | 3300049593 | Bacteria | 6511 |
| 506 | Ga0501077_0015004 | 3300049593 | Bacteria | 4870 |
| 507 | Ga0501080_0000010 | 3300049742 | Bacteria | 115062 |
| 508 | Ga0501080_0229534 | 3300049742 | Bacteria | 1697 |
| 509 | Ga0501080_0294217 | 3300049742 | Bacteria | 1474 |
| 510 | Ga0501081_0001600 | 3300049743 | Bacteria | 13983 |
| 511 | Ga0501081_0080906 | 3300049743 | Bacteria | 2274 |
| 512 | Ga0501081_0162116 | 3300049743 | Bacteria | 1611 |
| 513 | Ga0501083_0086804 | 3300049744 | Bacteria | 2069 |
| 514 | Ga0501083_0227693 | 3300049744 | Bacteria | 1214 |
| 515 | Ga0501035_0000034 | 3300049822 | Bacteria | 174589 |
| 516 | Ga0501044_0000039 | 3300049823 | Bacteria | 158218 |
| 517 | Ga0501044_0005041 | 3300049823 | Bacteria | 14749 |
| 518 | Ga0501044_0008445 | 3300049823 | Bacteria | 11289 |
| 519 | Ga0501044_0029578 | 3300049823 | Bacteria | 5775 |
| 520 | Ga0501044_0045934 | 3300049823 | Bacteria | 4523 |
| 521 | Ga0501044_0152178 | 3300049823 | Bacteria | 2295 |
| 522 | Ga0501044_0256049 | 3300049823 | Bacteria | 1690 |
| 523 | Ga0501044_0355494 | 3300049823 | Bacteria | 1384 |
| 524 | Ga0501045_0035496 | 3300049824 | Bacteria | 3620 |
| 525 | Ga0501045_0089774 | 3300049824 | Bacteria | 2270 |
| 526 | nmdc:mga03683_6846_c1 | 3300050489 | Bacteria | 3925 |
| 527 | nmdc:mga03n38_41493_c1 | 3300050490 | Bacteria | 2006 |
| 528 | nmdc:mga03n38_65694_c1 | 3300050490 | Bacteria | 1664 |
| 529 | nmdc:mga0k408_79495_c1 | 3300050493 | Bacteria | 1919 |
| 530 | nmdc:mga06z11_140066_c1 | 3300050494 | Bacteria | 1367 |
| 531 | nmdc:mga06z11_65237_c1 | 3300050494 | Bacteria | 1910 |
| 532 | nmdc:mga07m45_22760_c1 | 3300050496 | Bacteria | 3423 |
| 533 | nmdc:mga05p37_260609_c1 | 3300050507 | Bacteria | 2075 |
| 534 | nmdc:mga0qj67_129900_c1 | 3300050509 | Bacteria | 2040 |
| 535 | nmdc:mga0qj67_141420_c1 | 3300050509 | Bacteria | 1951 |
| 536 | nmdc:mga06r32_130964_c1 | 3300050510 | Bacteria | 2480 |
| 537 | nmdc:mga06r32_388932_c1 | 3300050510 | Bacteria | 1377 |
| 538 | nmdc:mga08y16_158892_c1 | 3300050511 | Bacteria | 2349 |
| 539 | nmdc:mga0n895_108082_c1 | 3300050512 | Bacteria | 2796 |
| 540 | nmdc:mga0n895_6477_c1 | 3300050512 | Bacteria | 9946 |
| 541 | nmdc:mga0n895_66835_c1 | 3300050512 | Bacteria | 3559 |
| 542 | nmdc:mga0n895_9018_c1 | 3300050512 | Bacteria | 8699 |
| 543 | nmdc:mga08x19_336539_c1 | 3300050514 | Bacteria | 1052 |
| 544 | nmdc:mga0a205_1693_c1 | 3300050515 | Bacteria | 19041 |
| 545 | nmdc:mga0sz30_72508_c1 | 3300050516 | Bacteria | 1484 |
| 546 | Ga0495601_0006336 | 3300053077 | Bacteria | 6914 |
| 547 | Ga0500635_0001030 | 3300053080 | Bacteria | 6665 |
| 548 | Ga0500635_0008518 | 3300053080 | Bacteria | 2815 |
| 549 | Ga0500643_011377 | 3300053087 | Bacteria | 3250 |
| 550 | Ga0500643_018319 | 3300053087 | Bacteria | 2327 |
| 551 | Ga0500566_0000351 | 3300053094 | Bacteria | 25000 |
| 552 | Ga0500566_0003690 | 3300053094 | Bacteria | 9142 |
| 553 | Ga0500566_0004102 | 3300053094 | Bacteria | 8686 |
| 554 | Ga0500566_0101534 | 3300053094 | Bacteria | 1576 |
| 555 | Ga0500640_002238 | 3300053095 | Bacteria | 6318 |
| 556 | Ga0500641_0000510 | 3300053096 | Bacteria | 13992 |
| 557 | Ga0500641_0072540 | 3300053096 | Bacteria | 1451 |
| 558 | Ga0500556_0002319 | 3300053104 | Bacteria | 6243 |
| 559 | Ga0500572_000903 | 3300053111 | Bacteria | 9176 |
| 560 | Ga0500591_050672 | 3300053115 | Bacteria | 1947 |
| 561 | Ga0500593_000015 | 3300053117 | Bacteria | 58134 |
| 562 | Ga0500595_000141 | 3300053119 | Bacteria | 46988 |
| 563 | Ga0500595_012010 | 3300053119 | Bacteria | 3362 |
| 564 | Ga0500595_016954 | 3300053119 | Bacteria | 2703 |
| 565 | Ga0500607_038072 | 3300053121 | Bacteria | 2618 |
| 566 | Ga0500608_018687 | 3300053122 | Bacteria | 3167 |
| 567 | Ga0500652_065002 | 3300053131 | Bacteria | 1507 |
| 568 | Ga0500568_0000004 | 3300053139 | Bacteria | 621666 |
| 569 | Ga0500568_0034233 | 3300053139 | Bacteria | 2079 |
| 570 | Ga0500577_0094289 | 3300053142 | Bacteria | 1215 |
| 571 | Ga0500603_011934 | 3300053150 | Bacteria | 1986 |
| 572 | Ga0500604_0003067 | 3300053151 | Bacteria | 4488 |
| 573 | Ga0500616_0005500 | 3300053153 | Bacteria | 8590 |
| 574 | Ga0500616_0023683 | 3300053153 | Bacteria | 3419 |
| 575 | Ga0500630_000445 | 3300053159 | Bacteria | 18003 |
| 576 | Ga0500634_0000017 | 3300053161 | Bacteria | 111983 |
| 577 | Ga0500639_000103 | 3300053163 | Bacteria | 39784 |
| 578 | Ga0500636_0021148 | 3300053177 | Bacteria | 3852 |
| 579 | Ga0500636_0162035 | 3300053177 | Bacteria | 1218 |
| 580 | Ga0500637_0000311 | 3300053178 | Bacteria | 18186 |
| 581 | Ga0500637_0005785 | 3300053178 | Bacteria | 6018 |
| 582 | Ga0500637_0093985 | 3300053178 | Bacteria | 1737 |
| 583 | Ga0500599_005464 | 3300053736 | Bacteria | 1597 |
| 584 | Ga0500601_000420 | 3300053737 | Bacteria | 7101 |
| 585 | Ga0501084_0004495 | 3300054114 | Bacteria | 11396 |
| 586 | Ga0501084_0278533 | 3300054114 | Bacteria | 1412 |
| 587 | Ga0501084_0328188 | 3300054114 | Bacteria | 1292 |
| 588 | Ga0501084_0636341 | 3300054114 | Bacteria | 901 |
| 589 | Ga0501082_0019819 | 3300060353 | Bacteria | 5800 |
| 590 | Ga0501082_0055412 | 3300060353 | Bacteria | 3416 |
| 591 | Ga0501082_0180033 | 3300060353 | Bacteria | 1838 |
| 592 | Ga0501082_0209574 | 3300060353 | Bacteria | 1696 |
| 593 | Ga0501082_0266752 | 3300060353 | Bacteria | 1490 |
| 594 | Ga0530510_0023645 | 3300061734 | Bacteria | 4381 |
| 595 | Ga0530510_0027092 | 3300061734 | Bacteria | 4105 |
| 596 | 2507504430 | 2507262055 | Bacteria | 8048963 |
| 597 | 2508545858 | 2508501009 | Bacteria | 7784016 |
| 598 | 2508694685 | 2508501042 | Bacteria | 8719808 |
| 599 | 2508734279 | 2508501050 | Bacteria | 9633614 |
| 600 | 2509079177 | 2508501114 | Bacteria | 7082538 |
| 601 | 2511396414 | 2511231028 | Bacteria | 8046582 |
| 602 | 2513590631 | 2513237087 | Bacteria | 5817514 |
| 603 | 2513624236 | 2513237092 | Bacteria | 8341956 |
| 604 | 2513638724 | 2513237094 | Bacteria | 8789602 |
| 605 | 2513649196 | 2513237095 | Bacteria | 8976980 |
| 606 | 2513702124 | 2513237102 | Bacteria | 7703324 |
| 607 | 2513874187 | 2513237139 | Bacteria | 8737671 |
| 608 | 2514010055 | 2513237161 | Bacteria | 8871253 |
| 609 | 2515624396 | 2515154112 | Bacteria | 8294334 |
| 610 | 2517103087 | 2517093001 | Bacteria | 9002274 |
| 611 | 2528849429 | 2528768022 | Bacteria | 10457665 |
| 612 | 2617350306 | 2617270735 | Bacteria | 9163226 |
| 613 | 2617374392 | 2617270741 | Bacteria | 8201522 |
| 614 | 2643911770 | 2643221580 | Bacteria | 3816678 |
| 615 | 2643965629 | 2643221591 | Bacteria | 4397626 |
| 616 | 2644169439 | 2643221629 | Bacteria | 5850260 |
| 617 | 2644350837 | 2643221662 | Bacteria | 5851492 |
| 618 | 2644413138 | 2643221674 | Bacteria | 3919126 |
| 619 | 2671693828 | 2671180139 | Bacteria | 4196045 |
| 620 | 2738744894 | 2738541281 | Bacteria | 5112672 |
| 621 | 2739354124 | 2738543032 | Bacteria | 5115625 |
| 622 | 2774871670 | 2773857925 | Bacteria | 6472445 |
| 623 | 2776257822 | 2775506901 | Bacteria | 9631051 |
| 624 | 2793059307 | 2791355196 | Bacteria | 7323613 |
| 625 | 2805920905 | 2802429603 | Bacteria | 8777136 |
| 626 | 2818240583 | 2816332527 | Bacteria | 8933356 |
| 627 | 2821450797 | 2821443989 | Bacteria | 7658172 |
| 628 | 2824604689 | 2824600985 | Bacteria | 8488197 |
| 629 | 2824615392 | 2824609381 | Bacteria | 8672835 |
| 630 | 2824618848 | 2824617872 | Bacteria | 8814715 |
| 631 | 2824628954 | 2824626560 | Bacteria | 8813858 |
| 632 | 2824639247 | 2824635225 | Bacteria | 8785348 |
| 633 | 2824648833 | 2824644064 | Bacteria | 8743947 |
| 634 | 2824658638 | 2824653114 | Bacteria | 8493680 |
| 635 | 2824665830 | 2824661429 | Bacteria | 9877870 |
| 636 | 2824675095 | 2824671348 | Bacteria | 8369588 |
| 637 | 2824692542 | 2824687955 | Bacteria | 8360029 |
| 638 | 2824700895 | 2824696289 | Bacteria | 8335049 |
| 639 | 2824711305 | 2824704595 | Bacteria | 9667483 |
| 640 | 2824717532 | 2824714736 | Bacteria | 8717648 |
| 641 | 2824726776 | 2824723954 | Bacteria | 8758240 |
| 642 | 2824737694 | 2824732956 | Bacteria | 7810675 |
| 643 | 2824751197 | 2824746037 | Bacteria | 7911610 |
| 644 | 2824759679 | 2824753945 | Bacteria | 9787441 |
| 645 | 2824769940 | 2824763712 | Bacteria | 9792355 |
| 646 | 2824780312 | 2824773399 | Bacteria | 8360218 |
| 647 | 2828306445 | 2828305725 | Bacteria | 4916900 |
| 648 | 2829746515 | 2829745981 | Bacteria | 5406054 |
| 649 | 2835315581 | 2835312727 | Bacteria | 7413381 |
| 650 | 2838126036 | 2838122688 | Bacteria | 8803140 |
| 651 | 2841942570 | 2841941048 | Bacteria | 8688029 |
| 652 | 2841953080 | 2841949485 | Bacteria | 8680857 |
| 653 | 2841963933 | 2841957949 | Bacteria | 8652217 |
| 654 | 2841970895 | 2841966195 | Bacteria | 8673214 |
| 655 | 2841977845 | 2841974524 | Bacteria | 8931498 |
| 656 | 2841984591 | 2841983080 | Bacteria | 8395090 |
| 657 | 2842041685 | 2842038055 | Bacteria | 8002051 |
| 658 | 2842049727 | 2842045827 | Bacteria | 8006841 |
| 659 | 2842699745 | 2842698319 | Bacteria | 5190321 |
| 660 | 2844533975 | 2844533157 | Bacteria | 7517899 |
| 661 | 2847931976 | 2847930680 | Bacteria | 9342022 |
| 662 | 2847943223 | 2847939898 | Bacteria | 8606328 |
| 663 | 2849076952 | 2849076700 | Bacteria | 7039503 |
| 664 | 2857514779 | 2857509624 | Bacteria | 7472071 |
| 665 | 2874595623 | 2874590934 | Bacteria | 8299676 |
| 666 | 2874620382 | 2874612657 | Bacteria | 8252029 |
| 667 | 2874621870 | 2874620515 | Bacteria | 8290088 |
| 668 | 2874629646 | 2874628541 | Bacteria | 8630250 |
| 669 | 2874651743 | 2874645413 | Bacteria | 8214782 |
| 670 | 2876769224 | 2876761206 | Bacteria | 10111113 |
| 671 | 2876775818 | 2876771140 | Bacteria | 8287509 |
| 672 | 2876821639 | 2876818435 | Bacteria | 8274608 |
| 673 | 2879079909 | 2879074833 | Bacteria | 8279565 |
| 674 | 2879085658 | 2879083081 | Bacteria | 8587928 |
| 675 | 2879104497 | 2879099564 | Bacteria | 10442239 |
| 676 | 2879133994 | 2879127579 | Bacteria | 8294491 |
| 677 | 2879148479 | 2879142872 | Bacteria | 8267021 |
| 678 | 2881364626 | 2881364244 | Bacteria | 7710352 |
| 679 | 2881671358 | 2881665667 | Bacteria | 8175609 |
| 680 | 2882457303 | 2882456835 | Bacteria | 6863978 |
| 681 | 2885374392 | 2885366525 | Bacteria | 8326213 |
| 682 | 2885413477 | 2885409591 | Bacteria | 9235467 |
| 683 | 2888387262 | 2888378607 | Bacteria | 9652610 |
| 684 | 2888391439 | 2888388044 | Bacteria | 7304136 |
| 685 | 2888426944 | 2888419890 | Bacteria | 7857137 |
| 686 | 2903727996 | 2903727486 | Bacteria | 8281579 |
| 687 | 2904669537 | 2904666416 | Bacteria | 8226587 |
| 688 | 2904713650 | 2904711408 | Bacteria | 9771557 |
| 689 | 2906602520 | 2906602504 | Bacteria | 8295279 |
| 690 | 2906635103 | 2906626472 | Bacteria | 8826946 |
| 691 | 2906649701 | 2906643746 | Bacteria | 8722424 |
| 692 | 2908776873 | 2908775508 | Bacteria | 8092255 |
| 693 | 2909046936 | 2909042592 | Bacteria | 6499737 |
| 694 | 2922370314 | |||
| 695 | 2922398862 | 2922393267 | Bacteria | 8285685 |
| 696 | 2929622630 | 2929615660 | Bacteria | 9193770 |
| 697 | 2929632267 | 2929624759 | Bacteria | 9339455 |
| 698 | 2932406023 | 2932401849 | Bacteria | 4262978 |
| 699 | 2932790028 | 2932784394 | Bacteria | 9704911 |
| 700 | 2932800696 | 2932794094 | Bacteria | 7915132 |
| 701 | 2932808427 | 2932801729 | Bacteria | 7987968 |
| 702 | 2932815571 | 2932809354 | Bacteria | 9135765 |
| 703 | 2932824853 | 2932818245 | Bacteria | 9955613 |
| 704 | 2932829115 | 2932828146 | Bacteria | 9745859 |
| 705 | 2933584739 | 2933577622 | Bacteria | 9116884 |
| 706 | 2935613165 | 2935608549 | Bacteria | 8203142 |
| 707 | 2935617591 | 2935616580 | Bacteria | 9032984 |
| 708 | 2935643636 | 2935638405 | Bacteria | 10015038 |
| 709 | 2935654123 | 2935648319 | Bacteria | 8801166 |
| 710 | 2935662775 | 2935656913 | Bacteria | 8965014 |
| 711 | 2935671054 | 2935665750 | Bacteria | 9571747 |
| 712 | 2935681697 | 2935675223 | Bacteria | 9928132 |
| 713 | 2935692674 | 2935684952 | Bacteria | 9590419 |
| 714 | 2935702661 | 2935694250 | Bacteria | 9291695 |
| 715 | 2935711948 | 2935703347 | Bacteria | 10242284 |
| 716 | 2935721292 | 2935713505 | Bacteria | 9608509 |
| 717 | 2935730714 | 2935722832 | Bacteria | 9608746 |
| 718 | 2935739982 | 2935732158 | Bacteria | 9706831 |
| 719 | 2935749020 | 2935741537 | Bacteria | 9707219 |
| 720 | 2935758890 | 2935750917 | Bacteria | 9590372 |
| 721 | 2935767155 | 2935760218 | Bacteria | 9817913 |
| 722 | 2935774815 | 2935769743 | Bacteria | 7878163 |
| 723 | 2935779999 | 2935777560 | Bacteria | 8077691 |
| 724 | 2935792985 | 2935785616 | Bacteria | 7962367 |
| 725 | 2935798563 | 2935793552 | Bacteria | 8012592 |
| 726 | 2935806919 | 2935801545 | Bacteria | 9301974 |
| 727 | 2935818816 | 2935810662 | Bacteria | 9401221 |
| 728 | 2935824983 | 2935819856 | Bacteria | 8261050 |
| 729 | 2935834321 | 2935827899 | Bacteria | 10038562 |
| 730 | 2935843954 | 2935837841 | Bacteria | 9454360 |
| 731 | 2935852202 | 2935847175 | Bacteria | 8228321 |
| 732 | 2935856910 | 2935855204 | Bacteria | 9035059 |
| 733 | 2935868437 | 2935864058 | Bacteria | 9784707 |
| 734 | 2935879747 | 2935873716 | Bacteria | 9632195 |
| 735 | 2935883534 | 2935883170 | Bacteria | 7964738 |
| 736 | 2935910636 | 2935908558 | Bacteria | 8568796 |
| 737 | 2935921816 | 2935916978 | Bacteria | 9113783 |
| 738 | 2935930045 | 2935926038 | Bacteria | 8601059 |
| 739 | 2935937713 | 2935934488 | Bacteria | 8602579 |
| 740 | 2935949817 | 2935942939 | Bacteria | 8599779 |
| 741 | 2935956913 | 2935951376 | Bacteria | 8602333 |
| 742 | 2935965370 | 2935959822 | Bacteria | 7869783 |
| 743 | 2935970830 | 2935967501 | Bacteria | 8603075 |
| 744 | 2935980145 | 2935975950 | Bacteria | 8347125 |
| 745 | 2935984314 | 2935984226 | Bacteria | 8302647 |
| 746 | 2935997254 | 2935992306 | Bacteria | 9802711 |
| 747 | 2936010000 | 2936002035 | Bacteria | 9362176 |
| 748 | 2936017028 | 2936011229 | Bacteria | 8801034 |
| 749 | 2936025564 | 2936019824 | Bacteria | 8804134 |
| 750 | 2936034406 | 2936028420 | Bacteria | 8965941 |
| 751 | 2936045498 | 2936037263 | Bacteria | 9446081 |
| 752 | 2936052560 | 2936046547 | Bacteria | 8903709 |
| 753 | 2936055394 | 2936055302 | Bacteria | 8785755 |
| 754 | 2940564520 | 2940556831 | Bacteria | 9590747 |
| 755 | 2941545202 | 2941538514 | Bacteria | 9402094 |
| 756 | 3005490835 | 3005483717 | Bacteria | 7877331 |
| 757 | 3005506573 | 3005506211 | Bacteria | 6943378 |
| 758 | 3005601788 | 3005594810 | Bacteria | 8716512 |
| 759 | 3005724469 | 3005718088 | Bacteria | 8283608 |
| 760 | 643603436 | 643348564 | Bacteria | 8839022 |
| 761 | 8001846938 | 8001845381 | Bacteria | 5804942 |
| 762 | 8006927552 | 8006926726 | Bacteria | 6749210 |
| 763 | 8016519103 | 8016511872 | Bacteria | 9921665 |
| 764 | 8016543076 | 8016539877 | Bacteria | 8155419 |
| 765 | 8016550216 | 8016548790 | Bacteria | 8155074 |
| 766 | 8016558620 | 8016557553 | Bacteria | 8154380 |
| 767 | 8016568483 | 8016566248 | Bacteria | 8158151 |
| 768 | 8016581133 | 8016575299 | Bacteria | 8154085 |
| 769 | 8016587576 | 8016583857 | Bacteria | 10421953 |
| 770 | 8016596604 | 8016595262 | Bacteria | 8149947 |
| 771 | 8016619269 | 8016613128 | Bacteria | 8794220 |
| 772 | 8017057598 | 8017057580 | Bacteria | 10023680 |
| 773 | 8019538459 | 8019530166 | Bacteria | 8155624 |
| 774 | 8019578221 | 8019576017 | Bacteria | 10049540 |
| 775 | 8019596255 | 8019586578 | Bacteria | 10212056 |
| 776 | 8019613099 | 8019608314 | Bacteria | 10042931 |
| 777 | 8019638250 | 8019629233 | Bacteria | 8687553 |
| 778 | 8019641389 | 8019638758 | Bacteria | 9062356 |
| 779 | 8019675676 | 8019668869 | Bacteria | 8791617 |
| 780 | 8019695396 | 8019687851 | Bacteria | 8712826 |
| 781 | 8045869063 | 8045864390 | Bacteria | 5043873 |
| 782 | 8055750513 | 8055742211 | Bacteria | 9226248 |
| 783 | 8056975298 | 8056967851 | Bacteria | 9038162 |
| 784 | Ga0157372_10448022 | |||
| 785 | JGI25151J46595_10000364 | |||
| 786 | JGI25406J46586_10004226 | |||
| 787 | JGI25153J46596_10001434 | |||
| 788 | rootH2_10066442 | |||
| 789 | rootH2_10142552 | |||
| 790 | JGI25160J50197_1001208 | |||
| 791 | JGI25404J52841_10033949 | |||
| 792 | Ga0065165_1000370 | |||
| 793 | Ga0065165_1001957 | |||
| 794 | Ga0065165_1005374 | |||
| 795 | Ga0070658_10004155 | |||
| 796 | Ga0070658_10047644 | |||
| 797 | Ga0070658_10088141 | |||
| 798 | Ga0070658_10166809 | |||
| 799 | Ga0070683_100037482 | |||
| 800 | Ga0068869_100037313 | |||
| 801 | Ga0070680_100016995 | |||
| 802 | Ga0070660_100078596 | |||
| 803 | Ga0070660_100108955 | |||
| 804 | Ga0070660_100120072 | |||
| 805 | Ga0070661_100000296 | |||
| 806 | Ga0070661_100052782 | |||
| 807 | Ga0070692_10181832 | |||
| 808 | Ga0070668_100006611 | |||
| 809 | Ga0070674_100077375 | |||
| 810 | Ga0070659_100019155 | |||
| 811 | Ga0070659_100077345 | |||
| 812 | Ga0070659_100230528 | |||
| 813 | Ga0070667_100068854 | |||
| 814 | Ga0070713_100289226 | |||
| 815 | Ga0070711_100026226 | |||
| 816 | Ga0070711_100305302 | |||
| 817 | Ga0070700_100043939 | |||
| 818 | Ga0070663_100352032 | |||
| 819 | Ga0070662_100378642 | |||
| 820 | Ga0068867_100053823 | |||
| 821 | Ga0070685_10001551 | |||
| 822 | Ga0070706_100190045 | |||
| 823 | Ga0070707_100135995 | |||
| 824 | Ga0070698_100190944 | |||
| 825 | Ga0070679_100015177 | |||
| 826 | Ga0070679_100068564 | |||
| 827 | Ga0070697_100106840 | |||
| 828 | Ga0068853_100003694 | |||
| 829 | Ga0068853_100004956 | |||
| 830 | Ga0068853_100039780 | |||
| 831 | Ga0068853_100193669 | |||
| 832 | Ga0068853_100382481 | |||
| 833 | Ga0068853_100456238 | |||
| 834 | Ga0070672_100051615 | |||
| 835 | Ga0070672_100305665 | |||
| 836 | Ga0070686_100118452 | |||
| 837 | Ga0070695_100003415 | |||
| 838 | Ga0070693_100125560 | |||
| 839 | Ga0070693_100181357 | |||
| 840 | Ga0070665_100036876 | |||
| 841 | Ga0070665_100056839 | |||
| 842 | Ga0070665_100104771 | |||
| 843 | Ga0068855_100006841 | |||
| 844 | Ga0068855_100008845 | |||
| 845 | Ga0068855_100032594 | |||
| 846 | Ga0068855_100117641 | |||
| 847 | Ga0068855_100121746 | |||
| 848 | Ga0068855_100173592 | |||
| 849 | Ga0070664_100108745 | |||
| 850 | Ga0068857_100008234 | |||
| 851 | Ga0068857_100035375 | |||
| 852 | Ga0068854_100022479 | |||
| 853 | Ga0068854_100108470 | |||
| 854 | Ga0068854_100135849 | |||
| 855 | Ga0068856_100037083 | |||
| 856 | Ga0068856_100113050 | |||
| 857 | Ga0068856_100185382 | |||
| 858 | Ga0068856_100335598 | |||
| 859 | Ga0070702_100138826 | |||
| 860 | Ga0068852_100006572 | |||
| 861 | Ga0068852_100138707 | |||
| 862 | Ga0068859_100032209 | |||
| 863 | Ga0068859_100257204 | |||
| 864 | Ga0068861_100026505 | |||
| 865 | Ga0068851_10166874 | |||
| 866 | Ga0068858_100090754 | |||
| 867 | Ga0081455_10009815 | |||
| 868 | Ga0081455_10013086 | |||
| 869 | Ga0081455_10057249 | |||
| 870 | Ga0081540_1000024 | |||
| 871 | Ga0081540_1005059 | |||
| 872 | Ga0081540_1008220 | |||
| 873 | Ga0081539_10002797 | |||
| 874 | Ga0075368_10033032 | |||
| 875 | Ga0075363_100046010 | |||
| 876 | Ga0070712_100240971 | |||
| 877 | Ga0075362_10047135 | |||
| 878 | Ga0075367_10055274 | |||
| 879 | Ga0075367_10058420 | |||
| 880 | Ga0075367_10182112 | |||
| 881 | Ga0075366_10142314 | |||
| 882 | Ga0097621_100125937 | |||
| 883 | Ga0075428_100069849 | |||
| 884 | Ga0075428_100310243 | |||
| 885 | Ga0075433_10003359 | |||
| 886 | Ga0075434_100007129 | |||
| 887 | Ga0075434_100011459 | |||
| 888 | Ga0075434_100014087 | |||
| 889 | Ga0068865_100058248 | |||
| 890 | Ga0068865_100060720 | |||
| 891 | Ga0075436_100014041 | |||
| 892 | Ga0075436_100377212 | |||
| 893 | Ga0097620_100032204 | |||
| 894 | Ga0097620_100257203 | |||
| 895 | Ga0105240_10000330 | |||
| 896 | Ga0105240_10000528 | |||
| 897 | Ga0105240_10000580 | |||
| 898 | Ga0105240_10006878 | |||
| 899 | Ga0105240_10095611 | |||
| 900 | Ga0105240_10149956 | |||
| 901 | Ga0105240_10156006 | |||
| 902 | Ga0105240_10503143 | |||
| 903 | Ga0111539_10245669 | |||
| 904 | Ga0105245_10084638 | |||
| 905 | Ga0105247_10072812 | |||
| 906 | Ga0105247_10174424 | |||
| 907 | Ga0114129_10263995 | |||
| 908 | Ga0105243_10271706 | |||
| 909 | Ga0105243_10332332 | |||
| 910 | Ga0105242_10201528 | |||
| 911 | Ga0105248_10396834 | |||
| 912 | Ga0105237_10000203 | |||
| 913 | Ga0105237_10013295 | |||
| 914 | Ga0105237_10061656 | |||
| 915 | Ga0105237_10086902 | |||
| 916 | Ga0105237_10088428 | |||
| 917 | Ga0105237_10146577 | |||
| 918 | Ga0105237_10280046 | |||
| 919 | Ga0105237_10332517 | |||
| 920 | Ga0105238_10036434 | |||
| 921 | Ga0105238_10108214 | |||
| 922 | Ga0105238_10191372 | |||
| 923 | Ga0105238_10248726 | |||
| 924 | Ga0105249_10268161 | |||
| 925 | Ga0105239_10016961 | |||
| 926 | Ga0105239_10017508 | |||
| 927 | Ga0105239_10089786 | |||
| 928 | Ga0105239_10092739 | |||
| 929 | Ga0105239_10102866 | |||
| 930 | Ga0105239_10497434 | |||
| 931 | Ga0157370_10041917 | |||
| 932 | Ga0157370_10191880 | |||
| 933 | Ga0157369_10389341 | |||
| 934 | Ga0157374_10038068 | |||
| 935 | Ga0157378_10304938 | |||
| 936 | Ga0157372_10021475 | |||
| 937 | Ga0157375_10256440 | |||
| 938 | Ga0163163_10112189 | |||
| 939 | Ga0163163_10565447 | |||
| 940 | Ga0157377_10085211 | |||
| 941 | Ga0157377_10116249 | |||
| 942 | Ga0214544_1000003 | |||
| 943 | Ga0214542_1000003 | |||
| 944 | Ga0214545_1000004 | |||
| 945 | Ga0214543_1000007 | |||
| 946 | Ga0213876_10009961 | |||
| 947 | Ga0213876_10117339 | |||
| 948 | Ga0224572_1000989 | |||
| 949 | Ga0209563_103333 | |||
| 950 | Ga0209677_106867 | |||
| 951 | Ga0209233_1005180 | |||
| 952 | Ga0209130_1000662 | |||
| 953 | Ga0209675_1000680 | |||
| 954 | Ga0209025_1000936 | |||
| 955 | Ga0209564_1007175 | |||
| 956 | Ga0209564_1022974 | |||
| 957 | Ga0209758_1000030 | |||
| 958 | Ga0209758_1002104 | |||
| 959 | Ga0209758_1003575 | |||
| 960 | Ga0209758_1007165 | |||
| 961 | Ga0209758_1044600 | |||
| 962 | Ga0207426_1000066 | |||
| 963 | Ga0207426_1000271 | |||
| 964 | Ga0207426_1000913 | |||
| 965 | Ga0209257_1000947 | |||
| 966 | Ga0207692_10214171 | |||
| 967 | Ga0207642_10034552 | |||
| 968 | Ga0207710_10028594 | |||
| 969 | Ga0207710_10091150 | |||
| 970 | Ga0207645_10055751 | |||
| 971 | Ga0207645_10070555 | |||
| 972 | Ga0207643_10265495 | |||
| 973 | Ga0207705_10008307 | |||
| 974 | Ga0207705_10063998 | |||
| 975 | Ga0207705_10079609 | |||
| 976 | Ga0207684_10118574 | |||
| 977 | Ga0207654_10015970 | |||
| 978 | Ga0207707_10019821 | |||
| 979 | Ga0207695_10000690 | |||
| 980 | Ga0207695_10000905 | |||
| 981 | Ga0207695_10005181 | |||
| 982 | Ga0207695_10010385 | |||
| 983 | Ga0207695_10010966 | |||
| 984 | Ga0207695_10029626 | |||
| 985 | Ga0207695_10051385 | |||
| 986 | Ga0207671_10000177 | |||
| 987 | Ga0207671_10028074 | |||
| 988 | Ga0207671_10034193 | |||
| 989 | Ga0207671_10060893 | |||
| 990 | Ga0207671_10086095 | |||
| 991 | Ga0207693_10235492 | |||
| 992 | Ga0207660_10012501 | |||
| 993 | Ga0207662_10044839 | |||
| 994 | Ga0207657_10006065 | |||
| 995 | Ga0207657_10025952 | |||
| 996 | Ga0207657_10084537 | |||
| 997 | Ga0207657_10116463 | |||
| 998 | Ga0207649_10001647 | |||
| 999 | Ga0207649_10031008 | |||
| 1000 | Ga0207652_10018718 | |||
| 1001 | Ga0207652_10509882 | |||
| 1002 | Ga0207646_10039151 | |||
| 1003 | Ga0207681_10188884 | |||
| 1004 | Ga0207694_10056003 | |||
| 1005 | Ga0207694_10081994 | |||
| 1006 | Ga0207659_10075811 | |||
| 1007 | Ga0207706_10385037 | |||
| 1008 | Ga0207686_10111085 | |||
| 1009 | Ga0207669_10024305 | |||
| 1010 | Ga0207669_10029063 | |||
| 1011 | Ga0207691_10197128 | |||
| 1012 | Ga0207691_10471918 | |||
| 1013 | Ga0207679_10019416 | |||
| 1014 | Ga0207667_10010129 | |||
| 1015 | Ga0207667_10016466 | |||
| 1016 | Ga0207667_10040989 | |||
| 1017 | Ga0207667_10128253 | |||
| 1018 | Ga0207667_10148394 | |||
| 1019 | Ga0207667_10214724 | |||
| 1020 | Ga0207667_10227228 | |||
| 1021 | Ga0207668_10003807 | |||
| 1022 | Ga0207668_10208381 | |||
| 1023 | Ga0207668_10316355 | |||
| 1024 | Ga0207640_10001371 | |||
| 1025 | Ga0207640_10114375 | |||
| 1026 | Ga0207640_10129385 | |||
| 1027 | Ga0207703_10084431 | |||
| 1028 | Ga0207639_10000742 | |||
| 1029 | Ga0207639_10002078 | |||
| 1030 | Ga0207639_10145638 | |||
| 1031 | Ga0207639_10188128 | |||
| 1032 | Ga0207639_10252376 | |||
| 1033 | Ga0207678_10066025 | |||
| 1034 | Ga0207678_10075164 | |||
| 1035 | Ga0207702_10059827 | |||
| 1036 | Ga0207702_10188310 | |||
| 1037 | Ga0207702_10233844 | |||
| 1038 | Ga0207641_10080653 | |||
| 1039 | Ga0207648_10067618 | |||
| 1040 | Ga0207674_10009842 | |||
| 1041 | Ga0207674_10017618 | |||
| 1042 | Ga0207674_10119808 | |||
| 1043 | Ga0207675_100029932 | |||
| 1044 | Ga0207675_100033029 | |||
| 1045 | Ga0207683_10071382 | |||
| 1046 | Ga0207683_10229177 | |||
| 1047 | Ga0207698_10037040 | |||
| 1048 | Ga0207698_10104687 | |||
| 1049 | Ga0207698_10133430 | |||
| 1050 | Ga0209998_10004564 | |||
| 1051 | Ga0207428_10076596 | |||
| 1052 | Ga0268266_10012948 | |||
| 1053 | Ga0268266_10048986 | |||
| 1054 | Ga0268266_10183564 | |||
| 1055 | Ga0268266_10275551 | |||
| 1056 | Ga0268265_10007551 | |||
| 1057 | Ga0268264_10040911 | |||
| 1058 | Ga0265319_1011945 | |||
| 1059 | Ga0265334_10000859 | |||
| 1060 | Ga0265334_10001692 | |||
| 1061 | Ga0265318_10000235 | |||
| 1062 | Ga0265318_10027425 | |||
| 1063 | Ga0265336_10029870 | |||
| 1064 | Ga0265338_10000231 | |||
| 1065 | Ga0265338_10063502 | |||
| 1066 | Ga0265338_10071491 | |||
| 1067 | Ga0265324_10019653 | |||
| 1068 | Ga0265324_10031827 | |||
| 1069 | Ga0316177_1090439 | |||
| 1070 | Ga0265325_10003040 | |||
| 1071 | Ga0265325_10015261 | |||
| 1072 | Ga0265325_10021367 | |||
| 1073 | Ga0265340_10024277 | |||
| 1074 | Ga0265339_10001183 | |||
| 1075 | Ga0265339_10003193 | |||
| 1076 | Ga0265339_10004646 | |||
| 1077 | Ga0265331_10022918 | |||
| 1078 | Ga0265331_10029199 | |||
| 1079 | Ga0265327_10004210 | |||
| 1080 | Ga0265327_10006360 | |||
| 1081 | Ga0265327_10009323 | |||
| 1082 | Ga0265316_10019755 | |||
| 1083 | Ga0265316_10084889 | |||
| 1084 | Ga0265316_10106930 | |||
| 1085 | Ga0265313_10000070 | |||
| 1086 | Ga0265313_10001097 | |||
| 1087 | Ga0307508_10108006 | |||
| 1088 | Ga0316575_10013558 | |||
| 1089 | Ga0265314_10022597 | |||
| 1090 | Ga0265314_10049410 | |||
| 1091 | Ga0265314_10160012 | |||
| 1092 | Ga0265342_10019942 | |||
| 1093 | Ga0316576_10040394 | |||
| 1094 | Ga0307405_10437692 | |||
| 1095 | Ga0307413_10030417 | |||
| 1096 | Ga0307410_10093016 | |||
| 1097 | Ga0307407_10072534 | |||
| 1098 | Ga0307407_10100881 | |||
| 1099 | Ga0307414_10040643 | |||
| 1100 | Ga0307414_10047596 | |||
| 1101 | Ga0307414_10390669 | |||
| 1102 | Ga0316585_10050231 | |||
| 1103 | Ga0316580_10018695 | |||
| 1104 | Ga0307510_10069558 | |||
| 1105 | Ga0307510_10168112 | |||
| 1106 | Ga0316596_1020632 | |||
| 1107 | Ga0373926_0057399 | |||
| 1108 | Ga0373928_0053371 | |||
| 1109 | Ga0373952_0004512 | |||
| 1110 | Ga0373932_0011863 | |||
| 1111 | Ga0373936_0124052 | |||
| 1112 | Ga0373939_0023631 | |||
| 1113 | Ga0373960_0002357 | |||
| 1114 | Ga0373942_0021556 | |||
| 1115 | Ga0373962_0000511 | |||
| 1116 | Ga0373931_0000317 | |||
| 1117 | Ga0373931_0004250 | |||
| 1118 | Ga0373931_0056848 | |||
| 1119 | Ga0373931_0111734 | |||
| 1120 | Ga0373937_0292426 | |||
| 1121 | Ga0316584_0026886 | |||
| 1122 | Ga0395899_0090875 | |||
| 1123 | Ga0395899_0135921 | |||
| 1124 | Ga0395900_0088124 | |||
| 1125 | Ga0395900_0130332 | |||
| 1126 | Ga0395898_0015010 | |||
| 1127 | Ga0395898_0095492 | |||
| 1128 | Ga0395905_0001838 | |||
| 1129 | Ga0395905_0006347 | |||
| 1130 | Ga0395905_0038350 | |||
| 1131 | Ga0395901_0016268 | |||
| 1132 | Ga0395901_0596900 | |||
| 1133 | Ga0400486_20503 | |||
| 1134 | Ga0400483_205793 | |||
| 1135 | Ga0436365_1001561 | |||
| 1136 | Ga0436360_0818014 | |||
| 1137 | Ga0436360_1148784 | |||
| 1138 | Ga0436361_0660345 | |||
| 1139 | Ga0439465_0017313 | |||
| 1140 | Ga0439431_0010018 | |||
| 1141 | Ga0450898_033063 | |||
| 1142 | Ga0466966_0000514 | |||
| 1143 | Ga0466961_0000065 | |||
| 1144 | Ga0453684_0309219 | |||
| 1145 | Ga0453684_0351520 | |||
| 1146 | Ga0453684_0793664 | |||
| 1147 | Ga0466960_0099565 | |||
| 1148 | Ga0466959_0034929 | |||
| 1149 | Ga0451576_0002723 | |||
| 1150 | Ga0495603_0014974 | |||
| 1151 | Ga0495629_0033520 | |||
| 1152 | Ga0495638_0004694 | |||
| 1153 | Ga0495638_0114179 | |||
| 1154 | Ga0495582_0137397 | |||
| 1155 | Ga0495605_0108500 | |||
| 1156 | Ga0495584_0033583 | |||
| 1157 | Ga0495606_0089469 | |||
| 1158 | Ga0495608_0046172 | |||
| 1159 | Ga0495610_0012643 | |||
| 1160 | Ga0495648_0009770 | |||
| 1161 | Ga0495642_0126784 | |||
| 1162 | Ga0495640_0046096 | |||
| 1163 | Ga0495622_0012727 | |||
| 1164 | Ga0495622_0018741 | |||
| 1165 | Ga0495634_0083755 | |||
| 1166 | Ga0495649_0102515 | |||
| 1167 | Ga0495589_0139462 | |||
| 1168 | Ga0495600_0035934 | |||
| 1169 | Ga0495604_0005237 | |||
| 1170 | Ga0495672_0008715 | |||
| 1171 | Ga0495676_0054208 | |||
| 1172 | Ga0495683_0156123 | |||
| 1173 | Ga0495685_011583 | |||
| 1174 | Ga0495686_0081092 | |||
| 1175 | Ga0496100_0031553 | |||
| 1176 | Ga0496100_0138828 | |||
| 1177 | Ga0496101_0351453 | |||
| 1178 | Ga0496102_0250076 | |||
| 1179 | Ga0496102_0291725 | |||
| 1180 | Ga0496102_0662700 | |||
| 1181 | Ga0496104_0002953 | |||
| 1182 | Ga0496104_0017706 | |||
| 1183 | Ga0496104_0061414 | |||
| 1184 | Ga0496104_0136008 | |||
| 1185 | Ga0496105_0006535 | |||
| 1186 | Ga0496105_0046907 | |||
| 1187 | Ga0496106_0016353 | |||
| 1188 | Ga0496106_0236064 | |||
| 1189 | Ga0496107_0130036 | |||
| 1190 | Ga0496108_0130499 | |||
| 1191 | Ga0496109_0107931 | |||
| 1192 | Ga0496110_0064428 | |||
| 1193 | Ga0496111_0039403 | |||
| 1194 | Ga0496112_0048414 | |||
| 1195 | Ga0496113_0048761 | |||
| 1196 | Ga0496115_0013248 | |||
| 1197 | Ga0496118_0013220 | |||
| 1198 | Ga0496119_0003665 | |||
| 1199 | Ga0496120_0009533 | |||
| 1200 | Ga0496121_0009006 | |||
| 1201 | Ga0496121_0129656 | |||
| 1202 | Ga0496122_0165963 | |||
| 1203 | Ga0496124_0264997 | |||
| 1204 | Ga0496125_0000129 | |||
| 1205 | Ga0496125_0052412 | |||
| 1206 | Ga0496126_0060831 | |||
| 1207 | Ga0496126_0138968 | |||
| 1208 | Ga0496126_0172047 | |||
| 1209 | Ga0501031_0026839 | |||
| 1210 | Ga0501031_0046568 | |||
| 1211 | Ga0501032_0001280 | |||
| 1212 | Ga0501032_0002117 | |||
| 1213 | Ga0501032_0034381 | |||
| 1214 | Ga0501032_0149610 | |||
| 1215 | Ga0501032_0190931 | |||
| 1216 | Ga0501033_0278829 | |||
| 1217 | Ga0501034_0000014 | |||
| 1218 | Ga0501034_0002255 | |||
| 1219 | Ga0501034_0027234 | |||
| 1220 | Ga0501034_0035985 | |||
| 1221 | Ga0501034_0045903 | |||
| 1222 | Ga0501034_0048444 | |||
| 1223 | Ga0501034_0065054 | |||
| 1224 | Ga0501034_0082433 | |||
| 1225 | Ga0501034_0144197 | |||
| 1226 | Ga0501034_0150473 | |||
| 1227 | Ga0501034_0274711 | |||
| 1228 | Ga0501034_0283965 | |||
| 1229 | Ga0501034_0411917 | |||
| 1230 | Ga0501036_0005290 | |||
| 1231 | Ga0501036_0033700 | |||
| 1232 | Ga0501036_0049535 | |||
| 1233 | Ga0501036_0090811 | |||
| 1234 | Ga0501037_0001132 | |||
| 1235 | Ga0501037_0026272 | |||
| 1236 | Ga0501037_0040541 | |||
| 1237 | Ga0501037_0213251 | |||
| 1238 | Ga0501038_0025537 | |||
| 1239 | Ga0501038_0343538 | |||
| 1240 | Ga0501039_0000087 | |||
| 1241 | Ga0501039_0065716 | |||
| 1242 | Ga0501040_0128850 | |||
| 1243 | Ga0501040_0243381 | |||
| 1244 | Ga0501042_0068376 | |||
| 1245 | Ga0501043_0005072 | |||
| 1246 | Ga0501043_0207789 | |||
| 1247 | Ga0501043_0250460 | |||
| 1248 | Ga0501043_0318966 | |||
| 1249 | Ga0501046_0013316 | |||
| 1250 | Ga0501046_0031958 | |||
| 1251 | Ga0501046_0042249 | |||
| 1252 | Ga0501046_0167845 | |||
| 1253 | Ga0501047_0000684 | |||
| 1254 | Ga0501047_0020745 | |||
| 1255 | Ga0501047_0090564 | |||
| 1256 | Ga0501047_0272201 | |||
| 1257 | Ga0501047_0283361 | |||
| 1258 | Ga0501047_0448438 | |||
| 1259 | Ga0501048_0000662 | |||
| 1260 | Ga0501048_0039825 | |||
| 1261 | Ga0501048_0162808 | |||
| 1262 | Ga0501067_0000308 | |||
| 1263 | Ga0501067_0000499 | |||
| 1264 | Ga0501067_0024598 | |||
| 1265 | Ga0501068_0001071 | |||
| 1266 | Ga0501070_0019277 | |||
| 1267 | Ga0501070_0047767 | |||
| 1268 | Ga0501070_0107854 | |||
| 1269 | Ga0501070_0221803 | |||
| 1270 | Ga0501070_0276074 | |||
| 1271 | Ga0501070_0428406 | |||
| 1272 | Ga0501071_0195109 | |||
| 1273 | Ga0501072_0055628 | |||
| 1274 | Ga0501072_0253755 | |||
| 1275 | Ga0501072_0291288 | |||
| 1276 | Ga0501072_0329890 | |||
| 1277 | Ga0501072_0380144 | |||
| 1278 | Ga0501073_0000010 | |||
| 1279 | Ga0501073_0060766 | |||
| 1280 | Ga0501073_0076947 | |||
| 1281 | Ga0501074_0082193 | |||
| 1282 | Ga0501074_0109807 | |||
| 1283 | Ga0501074_0151443 | |||
| 1284 | Ga0501075_0056591 | |||
| 1285 | Ga0501075_0198885 | |||
| 1286 | Ga0501076_0184287 | |||
| 1287 | Ga0501077_0000020 | |||
| 1288 | Ga0501077_0008063 | |||
| 1289 | Ga0501077_0015004 | |||
| 1290 | Ga0501080_0000010 | |||
| 1291 | Ga0501080_0229534 | |||
| 1292 | Ga0501080_0294217 | |||
| 1293 | Ga0501081_0001600 | |||
| 1294 | Ga0501081_0080906 | |||
| 1295 | Ga0501081_0162116 | |||
| 1296 | Ga0501083_0086804 | |||
| 1297 | Ga0501083_0227693 | |||
| 1298 | Ga0501035_0000034 | |||
| 1299 | Ga0501044_0000039 | |||
| 1300 | Ga0501044_0005041 | |||
| 1301 | Ga0501044_0008445 | |||
| 1302 | Ga0501044_0029578 | |||
| 1303 | Ga0501044_0045934 | |||
| 1304 | Ga0501044_0152178 | |||
| 1305 | Ga0501044_0256049 | |||
| 1306 | Ga0501044_0355494 | |||
| 1307 | Ga0501045_0035496 | |||
| 1308 | Ga0501045_0089774 | |||
| 1309 | nmdc:mga03683_6846_c1 | |||
| 1310 | nmdc:mga03n38_41493_c1 | |||
| 1311 | nmdc:mga03n38_65694_c1 | |||
| 1312 | nmdc:mga0k408_79495_c1 | |||
| 1313 | nmdc:mga06z11_140066_c1 | |||
| 1314 | nmdc:mga06z11_65237_c1 | |||
| 1315 | nmdc:mga07m45_22760_c1 | |||
| 1316 | nmdc:mga05p37_260609_c1 | |||
| 1317 | nmdc:mga0qj67_129900_c1 | |||
| 1318 | nmdc:mga0qj67_141420_c1 | |||
| 1319 | nmdc:mga06r32_130964_c1 | |||
| 1320 | nmdc:mga06r32_388932_c1 | |||
| 1321 | nmdc:mga08y16_158892_c1 | |||
| 1322 | nmdc:mga0n895_108082_c1 | |||
| 1323 | nmdc:mga0n895_6477_c1 | |||
| 1324 | nmdc:mga0n895_66835_c1 | |||
| 1325 | nmdc:mga0n895_9018_c1 | |||
| 1326 | nmdc:mga08x19_336539_c1 | |||
| 1327 | nmdc:mga0a205_1693_c1 | |||
| 1328 | nmdc:mga0sz30_72508_c1 | |||
| 1329 | Ga0495601_0006336 | |||
| 1330 | Ga0500635_0001030 | |||
| 1331 | Ga0500635_0008518 | |||
| 1332 | Ga0500643_011377 | |||
| 1333 | Ga0500643_018319 | |||
| 1334 | Ga0500566_0000351 | |||
| 1335 | Ga0500566_0003690 | |||
| 1336 | Ga0500566_0004102 | |||
| 1337 | Ga0500566_0101534 | |||
| 1338 | Ga0500640_002238 | |||
| 1339 | Ga0500641_0000510 | |||
| 1340 | Ga0500641_0072540 | |||
| 1341 | Ga0500556_0002319 | |||
| 1342 | Ga0500572_000903 | |||
| 1343 | Ga0500591_050672 | |||
| 1344 | Ga0500593_000015 | |||
| 1345 | Ga0500595_000141 | |||
| 1346 | Ga0500595_012010 | |||
| 1347 | Ga0500595_016954 | |||
| 1348 | Ga0500607_038072 | |||
| 1349 | Ga0500608_018687 | |||
| 1350 | Ga0500652_065002 | |||
| 1351 | Ga0500568_0000004 | |||
| 1352 | Ga0500568_0034233 | |||
| 1353 | Ga0500577_0094289 | |||
| 1354 | Ga0500603_011934 | |||
| 1355 | Ga0500604_0003067 | |||
| 1356 | Ga0500616_0005500 | |||
| 1357 | Ga0500616_0023683 | |||
| 1358 | Ga0500630_000445 | |||
| 1359 | Ga0500634_0000017 | |||
| 1360 | Ga0500639_000103 | |||
| 1361 | Ga0500636_0021148 | |||
| 1362 | Ga0500636_0162035 | |||
| 1363 | Ga0500637_0000311 | |||
| 1364 | Ga0500637_0005785 | |||
| 1365 | Ga0500637_0093985 | |||
| 1366 | Ga0500599_005464 | |||
| 1367 | Ga0500601_000420 | |||
| 1368 | Ga0501084_0004495 | |||
| 1369 | Ga0501084_0278533 | |||
| 1370 | Ga0501084_0328188 | |||
| 1371 | Ga0501084_0636341 | |||
| 1372 | Ga0501082_0019819 | |||
| 1373 | Ga0501082_0055412 | |||
| 1374 | Ga0501082_0180033 | |||
| 1375 | Ga0501082_0209574 | |||
| 1376 | Ga0501082_0266752 | |||
| 1377 | Ga0530510_0023645 | |||
| 1378 | Ga0530510_0027092 | |||
| 1379 | 2507504430 | |||
| 1380 | 2508545858 | |||
| 1381 | 2508694685 | |||
| 1382 | 2508734279 | |||
| 1383 | 2509079177 | |||
| 1384 | 2511396414 | |||
| 1385 | 2513590631 | |||
| 1386 | 2513624236 | |||
| 1387 | 2513638724 | |||
| 1388 | 2513649196 | |||
| 1389 | 2513702124 | |||
| 1390 | 2513874187 | |||
| 1391 | 2514010055 | |||
| 1392 | 2515624396 | |||
| 1393 | 2517103087 | |||
| 1394 | 2528849429 | |||
| 1395 | 2617350306 | |||
| 1396 | 2617374392 | |||
| 1397 | 2643911770 | |||
| 1398 | 2643965629 | |||
| 1399 | 2644169439 | |||
| 1400 | 2644350837 | |||
| 1401 | 2644413138 | |||
| 1402 | 2671693828 | |||
| 1403 | 2738744894 | |||
| 1404 | 2739354124 | |||
| 1405 | 2774871670 | |||
| 1406 | 2776257822 | |||
| 1407 | 2793059307 | |||
| 1408 | 2805920905 | |||
| 1409 | 2818240583 | |||
| 1410 | 2821450797 | |||
| 1411 | 2824604689 | |||
| 1412 | 2824615392 | |||
| 1413 | 2824618848 | |||
| 1414 | 2824628954 | |||
| 1415 | 2824639247 | |||
| 1416 | 2824648833 | |||
| 1417 | 2824658638 | |||
| 1418 | 2824665830 | |||
| 1419 | 2824675095 | |||
| 1420 | 2824692542 | |||
| 1421 | 2824700895 | |||
| 1422 | 2824711305 | |||
| 1423 | 2824717532 | |||
| 1424 | 2824726776 | |||
| 1425 | 2824737694 | |||
| 1426 | 2824751197 | |||
| 1427 | 2824759679 | |||
| 1428 | 2824769940 | |||
| 1429 | 2824780312 | |||
| 1430 | 2828306445 | |||
| 1431 | 2829746515 | |||
| 1432 | 2835315581 | |||
| 1433 | 2838126036 | |||
| 1434 | 2841942570 | |||
| 1435 | 2841953080 | |||
| 1436 | 2841963933 | |||
| 1437 | 2841970895 | |||
| 1438 | 2841977845 | |||
| 1439 | 2841984591 | |||
| 1440 | 2842041685 | |||
| 1441 | 2842049727 | |||
| 1442 | 2842699745 | |||
| 1443 | 2844533975 | |||
| 1444 | 2847931976 | |||
| 1445 | 2847943223 | |||
| 1446 | 2849076952 | |||
| 1447 | 2857514779 | |||
| 1448 | 2874595623 | |||
| 1449 | 2874620382 | |||
| 1450 | 2874621870 | |||
| 1451 | 2874629646 | |||
| 1452 | 2874651743 | |||
| 1453 | 2876769224 | |||
| 1454 | 2876775818 | |||
| 1455 | 2876821639 | |||
| 1456 | 2879079909 | |||
| 1457 | 2879085658 | |||
| 1458 | 2879104497 | |||
| 1459 | 2879133994 | |||
| 1460 | 2879148479 | |||
| 1461 | 2881364626 | |||
| 1462 | 2881671358 | |||
| 1463 | 2882457303 | |||
| 1464 | 2885374392 | |||
| 1465 | 2885413477 | |||
| 1466 | 2888387262 | |||
| 1467 | 2888391439 | |||
| 1468 | 2888426944 | |||
| 1469 | 2903727996 | |||
| 1470 | 2904669537 | |||
| 1471 | 2904713650 | |||
| 1472 | 2906602520 | |||
| 1473 | 2906635103 | |||
| 1474 | 2906649701 | |||
| 1475 | 2908776873 | |||
| 1476 | 2909046936 | |||
| 1477 | 2922370314 | |||
| 1478 | 2922398862 | |||
| 1479 | 2929622630 | |||
| 1480 | 2929632267 | |||
| 1481 | 2932406023 | |||
| 1482 | 2932790028 | |||
| 1483 | 2932800696 | |||
| 1484 | 2932808427 | |||
| 1485 | 2932815571 | |||
| 1486 | 2932824853 | |||
| 1487 | 2932829115 | |||
| 1488 | 2933584739 | |||
| 1489 | 2935613165 | |||
| 1490 | 2935617591 | |||
| 1491 | 2935643636 | |||
| 1492 | 2935654123 | |||
| 1493 | 2935662775 | |||
| 1494 | 2935671054 | |||
| 1495 | 2935681697 | |||
| 1496 | 2935692674 | |||
| 1497 | 2935702661 | |||
| 1498 | 2935711948 | |||
| 1499 | 2935721292 | |||
| 1500 | 2935730714 | |||
| 1501 | 2935739982 | |||
| 1502 | 2935749020 | |||
| 1503 | 2935758890 | |||
| 1504 | 2935767155 | |||
| 1505 | 2935774815 | |||
| 1506 | 2935779999 | |||
| 1507 | 2935792985 | |||
| 1508 | 2935798563 | |||
| 1509 | 2935806919 | |||
| 1510 | 2935818816 | |||
| 1511 | 2935824983 | |||
| 1512 | 2935834321 | |||
| 1513 | 2935843954 | |||
| 1514 | 2935852202 | |||
| 1515 | 2935856910 | |||
| 1516 | 2935868437 | |||
| 1517 | 2935879747 | |||
| 1518 | 2935883534 | |||
| 1519 | 2935910636 | |||
| 1520 | 2935921816 | |||
| 1521 | 2935930045 | |||
| 1522 | 2935937713 | |||
| 1523 | 2935949817 | |||
| 1524 | 2935956913 | |||
| 1525 | 2935965370 | |||
| 1526 | 2935970830 | |||
| 1527 | 2935980145 | |||
| 1528 | 2935984314 | |||
| 1529 | 2935997254 | |||
| 1530 | 2936010000 | |||
| 1531 | 2936017028 | |||
| 1532 | 2936025564 | |||
| 1533 | 2936034406 | |||
| 1534 | 2936045498 | |||
| 1535 | 2936052560 | |||
| 1536 | 2936055394 | |||
| 1537 | 2940564520 | |||
| 1538 | 2941545202 | |||
| 1539 | 3005490835 | |||
| 1540 | 3005506573 | |||
| 1541 | 3005601788 | |||
| 1542 | 3005724469 | |||
| 1543 | 643603436 | |||
| 1544 | 8001846938 | |||
| 1545 | 8006927552 | |||
| 1546 | 8016519103 | |||
| 1547 | 8016543076 | |||
| 1548 | 8016550216 | |||
| 1549 | 8016558620 | |||
| 1550 | 8016568483 | |||
| 1551 | 8016581133 | |||
| 1552 | 8016587576 | |||
| 1553 | 8016596604 | |||
| 1554 | 8016619269 | |||
| 1555 | 8017057598 | |||
| 1556 | 8019538459 | |||
| 1557 | 8019578221 | |||
| 1558 | 8019596255 | |||
| 1559 | 8019613099 | |||
| 1560 | 8019638250 | |||
| 1561 | 8019641389 | |||
| 1562 | 8019675676 | |||
| 1563 | 8019695396 | |||
| 1564 | 8045869063 | |||
| 1565 | 8055750513 | |||
| 1566 | 8056975298 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wji-assembly1.cif.gz_A-2 | crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with nadp and tyrosine | 0.9492 | 10 | 283 |
| 3ggp-assembly2.cif.gz_D | crystal structure of prephenate dehydrogenase from a. aeolicus in complex with hydroxyphenyl propionate and nad+ | 0.9155 | 14 | 283 |
| 5uyy-assembly2.cif.gz_D | crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with l-tyrosine | 0.9133 | 14 | 284 |
| 3b1f-assembly1.cif.gz_A-2 | crystal structure of prephenate dehydrogenase from streptococcus mutans | 0.9098 | 14 | 285 |
| 2g5c-assembly1.cif.gz_A | crystal structure of prephenate dehydrogenase from aquifex aeolicus | 0.9088 | 16 | 283 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2f1kB02 | Mainly Alpha;Orthogonal Bundle;6-phosphogluconate dehydrogenase C-terminal fold;6-phosphogluconate dehydrogenase C-terminal like domain | 0.9326 | 179 | 283 | 1.10.3660.10 |
| 2f1kC02 | Mainly Alpha;Orthogonal Bundle;6-phosphogluconate dehydrogenase C-terminal fold;6-phosphogluconate dehydrogenase C-terminal like domain | 0.9176 | 179 | 283 | 1.10.3660.10 |
| af_Q2FYS1_1_176_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9155 | 14 | 180 | 3.40.50.720 |
| 2g5cC02 | Mainly Alpha;Orthogonal Bundle;6-phosphogluconate dehydrogenase C-terminal fold;6-phosphogluconate dehydrogenase C-terminal like domain | 0.8952 | 179 | 285 | 1.10.3660.10 |
| af_Q9Y7N4_8_341_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.894 | 14 | 47 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257QIA3-F1-model_v4 | Cyclohexadienyl dehydrogenase | 0.9925 | 9 | 101 |
GO:0004665
GO:0006571 GO:0008977 GO:0070403 |
| AF-A0A840ARH8-F1-model_v4 | Cyclohexadieny/prephenate dehydrogenase (EC 1.3.1.12, EC 1.3.1.43) | 0.974 | 10 | 283 |
GO:0004665
GO:0006571 GO:0008977 GO:0070403 |
| AF-A0A353IQS3-F1-model_v4 | Prephenate/arogenate dehydrogenase family protein | 0.9725 | 9 | 282 |
GO:0004665
GO:0006571 GO:0008977 GO:0070403 |
| AF-A0A176RXM8-F1-model_v4 | Prephenate dehydrogenase (EC 1.3.1.12) | 0.972 | 122 | 272 |
GO:0004665
GO:0006571 GO:0008977 GO:0070403 |
| AF-A0A6L7S3G0-F1-model_v4 | Prephenate dehydrogenase/arogenate dehydrogenase family protein | 0.9719 | 11 | 207 |
GO:0004665
GO:0006571 GO:0008977 GO:0070403 |