F480668

General Info

Members Datasets Scaffolds Average Seq Length
783 322 1566 266

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0021621|Ga0395899_0021621_1684_2574
Length 296
Sequence LAFEACGPDNRLLAHPRGTAVYVDNASVPARKPVTVPGLRAMKAQGRKIVMLTAYDASFAWQLEAAGVDVALVGDSLGMVVQGHRSTLPVTLDDMAYHTRAVARGLTSTLLIADLPFMADRDVAHSLEAAARLVGEAGAAAVKIEGAAPHILDAIATLSARAVPVCAHLGLTPQSVHKFGGFRIQGREQEAADRVLSEALAVQSAGADLLVLEGVPSALGDRITRAVQIPVIGIGAGPHCDGQVLVIYDMLGITPGKRPKFSKDFLAGRNAVGEAIAAFAEDVRSGAFPAPEHCFD

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
90 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
91 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
96 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
106 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
107 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
110 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
111 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
112 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
158 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
159 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
160 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
161 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
162 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
166 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
167 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
169 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
170 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
174 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
179 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
180 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
181 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
182 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
183 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
184 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
185 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
186 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
187 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
190 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
191 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
192 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
193 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
194 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
199 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
200 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
207 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
208 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
211 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
214 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
215 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
216 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
217 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
218 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
219 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
220 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
221 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
222 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
223 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
224 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
225 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
226 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
227 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
228 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
229 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
230 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
231 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
232 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
233 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
236 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
237 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
238 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
239 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
240 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
250 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
251 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
252 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
253 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
254 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
255 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
256 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
257 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
258 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
261 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
262 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
280 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
283 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
289 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
290 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
291 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
292 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
293 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
294 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
295 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
296 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
297 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
298 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
299 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
300 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
301 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
302 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
303 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
304 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
305 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
306 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
307 2734482264 Dyella sp. AD052 Isolate Unclassified
308 2738543009 Luteibacter sp. OK325 Isolate Unclassified
309 2739367700 Dyella sp. YR388 Isolate Unclassified
310 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
311 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
312 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
313 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
314 2884411467 Dyella sp. AD56 Isolate Rhizosphere
315 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
316 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
317 2919085039 Luteibacter sp. 1214 Isolate Unclassified
318 2919404418 Luteibacter sp. 3190 Isolate Unclassified
319 2928963466 Dyella japonica 1073 Isolate Unclassified
320 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
321 2941471342 Luteibacter sp. 621 Isolate Unclassified
322 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.27
Metatranscriptomes 1.53
Isolates 3.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.41
Nodule 0
Rhizoplane 2.55
Rhizosphere 71.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0021621 3300037312 Bacteria 4879
2 JGI24740J21852_10005728 3300001979 Bacteria 5226
3 JGI24739J22299_10001151 3300001989 Bacteria 9883
4 JGI24739J22299_10012267 3300001989 Bacteria 3147
5 JGI24737J22298_10015018 3300001990 Bacteria 2508
6 JGI24738J21930_10000954 3300002075 Bacteria 8293
7 JGI25156J39149_1004146 3300002705 Bacteria 4497
8 JGI25156J39149_1010840 3300002705 Bacteria 2109
9 JGI25162J39368_1000226 3300002737 Bacteria 57732
10 JGI25162J39368_1000311 3300002737 Bacteria 43163
11 JGI25162J39368_1000790 3300002737 Bacteria 21152
12 JGI25162J39368_1001503 3300002737 Bacteria 12152
13 JGI25162J39368_1004324 3300002737 Bacteria 3368
14 JGI25157J39369_1000345 3300002741 Bacteria 32775
15 JGI25157J39369_1000541 3300002741 Bacteria 22715
16 JGI25157J39369_1001083 3300002741 Bacteria 12255
17 JGI25157J39369_1002119 3300002741 Bacteria 5579
18 JGI25157J39369_1002687 3300002741 Bacteria 4140
19 JGI25163J39215_1000171 3300002771 Bacteria 25502
20 JGI25164J39214_1000035 3300002772 Bacteria 139987
21 JGI25164J39214_1000214 3300002772 Bacteria 47762
22 JGI25164J39214_1000742 3300002772 Bacteria 12152
23 JGI25164J39214_1000752 3300002772 Bacteria 12009
24 JGI25165J46597_1000226 3300003214 Bacteria 78481
25 JGI25165J46597_1000260 3300003214 Bacteria 70453
26 JGI25165J46597_1001473 3300003214 Bacteria 12149
27 JGI25165J46597_1003296 3300003214 Bacteria 4142
28 rootH1_10016990 3300003316 Bacteria 2562
29 rootH2_10004402 3300003320 Bacteria 19303
30 Ga0006562J51391_1022736 3300003578 Bacteria 5703
31 Ga0006562J51391_1022737 3300003578 Bacteria 3470
32 Ga0006562J51391_1106400 3300003578 Bacteria 3790
33 Ga0006562J51391_1106401 3300003578 Bacteria 3620
34 Ga0055538_1002052 3300003751 Bacteria 3245
35 Ga0055539_1003463 3300003752 Bacteria 2206
36 Ga0055533_1002036 3300003756 Bacteria 4902
37 Ga0055525_1000452 3300003759 Bacteria 23636
38 Ga0055527_1000082 3300003760 Bacteria 75048
39 Ga0055527_1000907 3300003760 Bacteria 7517
40 Ga0055535_1000143 3300003761 Bacteria 75049
41 Ga0055535_1000323 3300003761 Bacteria 48370
42 Ga0055535_1000593 3300003761 Bacteria 29891
43 Ga0055535_1002180 3300003761 Bacteria 7513
44 Ga0055535_1002438 3300003761 Bacteria 6511
45 Ga0055542_1000067 3300003762 Bacteria 154585
46 Ga0055542_1000190 3300003762 Bacteria 75049
47 Ga0055542_1000275 3300003762 Bacteria 57732
48 Ga0055542_1000622 3300003762 Bacteria 29891
49 Ga0055542_1002065 3300003762 Bacteria 7517
50 Ga0055542_1002332 3300003762 Bacteria 6511
51 Ga0055529_1000217 3300003763 Bacteria 75049
52 Ga0055529_1000233 3300003763 Bacteria 70453
53 Ga0055529_1000367 3300003763 Bacteria 48920
54 Ga0055529_1001133 3300003763 Bacteria 11354
55 Ga0055543_1020812 3300004625 Bacteria 1201
56 Ga0065165_1000028 3300005262 Bacteria 224430
57 Ga0065165_1001244 3300005262 Bacteria 29035
58 Ga0070658_10001605 3300005327 Bacteria 19114
59 Ga0070683_100168976 3300005329 Bacteria 2075
60 Ga0068869_100004548 3300005334 Bacteria 8636
61 Ga0070666_10000012 3300005335 Bacteria 244720
62 Ga0070666_10168093 3300005335 Bacteria 1535
63 Ga0070680_100295793 3300005336 Bacteria 1372
64 Ga0070680_100332401 3300005336 Bacteria 1291
65 Ga0070682_100001599 3300005337 Bacteria 12628
66 Ga0070682_100005594 3300005337 Bacteria 7003
67 Ga0070660_100016387 3300005339 Bacteria 5378
68 Ga0070689_100010606 3300005340 Bacteria 6570
69 Ga0070691_10040331 3300005341 Bacteria 2206
70 Ga0070661_100042502 3300005344 Bacteria 3318
71 Ga0070661_100050352 3300005344 Bacteria 3047
72 Ga0070661_100050468 3300005344 Bacteria 3044
73 Ga0070661_100072708 3300005344 Bacteria 2531
74 Ga0070692_10045384 3300005345 Bacteria 2266
75 Ga0070692_10153602 3300005345 Bacteria 1313
76 Ga0070668_100103313 3300005347 Bacteria 2261
77 Ga0070659_100043525 3300005366 Bacteria 3511
78 Ga0070659_100118427 3300005366 Bacteria 2142
79 Ga0070667_100000041 3300005367 Bacteria 170008
80 Ga0070667_100013273 3300005367 Bacteria 6805
81 Ga0070667_100122410 3300005367 Bacteria 2264
82 Ga0070667_100485351 3300005367 Bacteria 1131
83 Ga0070714_100000650 3300005435 Bacteria 24670
84 Ga0070713_100000697 3300005436 Bacteria 21613
85 Ga0070663_100000080 3300005455 Bacteria 42856
86 Ga0070663_100043617 3300005455 Bacteria 3157
87 Ga0070681_10000422 3300005458 Bacteria 34427
88 Ga0070681_10004784 3300005458 Bacteria 12975
89 Ga0070685_10007572 3300005466 Bacteria 5557
90 Ga0070685_10115922 3300005466 Bacteria 1657
91 Ga0070679_100008773 3300005530 Bacteria 9536
92 Ga0070679_100033998 3300005530 Bacteria 5050
93 Ga0070679_100035082 3300005530 Bacteria 4975
94 Ga0070679_100136895 3300005530 Bacteria 2430
95 Ga0070679_100269264 3300005530 Bacteria 1658
96 Ga0068853_100006935 3300005539 Bacteria 9045
97 Ga0068853_100013978 3300005539 Bacteria 6566
98 Ga0068853_100036801 3300005539 Bacteria 4162
99 Ga0068853_100059765 3300005539 Bacteria 3293
100 Ga0068853_100165200 3300005539 Bacteria 2000
101 Ga0068853_100174863 3300005539 Bacteria 1944
102 Ga0068853_100286720 3300005539 Bacteria 1519
103 Ga0070672_100000967 3300005543 Bacteria 17369
104 Ga0070696_100006770 3300005546 Bacteria 7651
105 Ga0070693_100002525 3300005547 Bacteria 8435
106 Ga0070665_100000062 3300005548 Bacteria 220304
107 Ga0070665_100011046 3300005548 Bacteria 9126
108 Ga0070665_100012001 3300005548 Bacteria 8741
109 Ga0070665_100015833 3300005548 Bacteria 7571
110 Ga0068855_100000186 3300005563 Bacteria 79655
111 Ga0068855_100003219 3300005563 Bacteria 19978
112 Ga0068855_100035273 3300005563 Bacteria 5958
113 Ga0068855_100055852 3300005563 Bacteria 4635
114 Ga0068855_100068209 3300005563 Bacteria 4141
115 Ga0068855_100151751 3300005563 Bacteria 2634
116 Ga0068855_100434603 3300005563 Bacteria 1434
117 Ga0068857_100002448 3300005577 Bacteria 15165
118 Ga0068857_100012794 3300005577 Bacteria 7313
119 Ga0068857_100024073 3300005577 Bacteria 5360
120 Ga0068857_100309750 3300005577 Bacteria 1456
121 Ga0068854_100000486 3300005578 Bacteria 24257
122 Ga0068854_100010548 3300005578 Bacteria 5994
123 Ga0068854_100040225 3300005578 Bacteria 3298
124 Ga0068854_100307736 3300005578 Bacteria 1284
125 Ga0068856_100002830 3300005614 Bacteria 17768
126 Ga0068856_100011894 3300005614 Bacteria 8427
127 Ga0068856_100137208 3300005614 Bacteria 2452
128 Ga0068856_100259666 3300005614 Bacteria 1752
129 Ga0068852_100024421 3300005616 Bacteria 4884
130 Ga0068852_100095568 3300005616 Bacteria 2669
131 Ga0068852_100109245 3300005616 Bacteria 2511
132 Ga0068852_100309565 3300005616 Bacteria 1531
133 Ga0068852_100371509 3300005616 Bacteria 1401
134 Ga0068859_100000704 3300005617 Bacteria 33583
135 Ga0068861_100071323 3300005719 Bacteria 2693
136 Ga0068851_10001144 3300005834 Bacteria 11493
137 Ga0068851_10022152 3300005834 Bacteria 3092
138 Ga0068858_100399759 3300005842 Bacteria 1320
139 Ga0068860_100250787 3300005843 Bacteria 1724
140 Ga0068860_100386975 3300005843 Bacteria 1381
141 Ga0068862_100001686 3300005844 Bacteria 20019
142 Ga0075369_10034813 3300006186 Bacteria 2138
143 Ga0075369_10043586 3300006186 Bacteria 1926
144 Ga0097621_100034797 3300006237 Bacteria 4021
145 Ga0097621_100499297 3300006237 Bacteria 1102
146 Ga0068865_100001033 3300006881 Bacteria 16026
147 Ga0097620_100000704 3300006931 Bacteria 33583
148 Ga0105240_10003480 3300009093 Bacteria 24428
149 Ga0105240_10005037 3300009093 Bacteria 19823
150 Ga0105240_10014526 3300009093 Bacteria 10749
151 Ga0105240_10018376 3300009093 Bacteria 9389
152 Ga0105240_10112732 3300009093 Bacteria 3287
153 Ga0105240_10280220 3300009093 Bacteria 1915
154 Ga0105247_10018982 3300009101 Bacteria 4130
155 Ga0105241_10041060 3300009174 Bacteria 3494
156 Ga0105241_10178303 3300009174 Bacteria 1760
157 Ga0105241_10560220 3300009174 Bacteria 1027
158 Ga0105242_10002687 3300009176 Bacteria 13910
159 Ga0105248_10010085 3300009177 Bacteria 10402
160 Ga0105248_10125934 3300009177 Bacteria 2890
161 Ga0105237_10000152 3300009545 Bacteria 96802
162 Ga0105237_10054848 3300009545 Bacteria 3993
163 Ga0105237_10055379 3300009545 Bacteria 3972
164 Ga0105237_10059438 3300009545 Bacteria 3824
165 Ga0105237_10101582 3300009545 Bacteria 2868
166 Ga0105238_10000540 3300009551 Bacteria 39588
167 Ga0105238_10014166 3300009551 Bacteria 8064
168 Ga0105238_10051996 3300009551 Bacteria 4119
169 Ga0105238_10062921 3300009551 Bacteria 3711
170 Ga0105238_10106626 3300009551 Bacteria 2783
171 Ga0105238_10113358 3300009551 Bacteria 2691
172 Ga0105238_10150423 3300009551 Bacteria 2303
173 Ga0105249_10000397 3300009553 Bacteria 41963
174 Ga0105239_10000020 3300010375 Bacteria 264435
175 Ga0105239_10002067 3300010375 Bacteria 26031
176 Ga0105239_10018443 3300010375 Bacteria 7707
177 Ga0105239_10021926 3300010375 Bacteria 7041
178 Ga0105239_10065757 3300010375 Bacteria 3983
179 Ga0105239_10074051 3300010375 Bacteria 3744
180 Ga0105239_10092121 3300010375 Bacteria 3345
181 Ga0105239_10160733 3300010375 Bacteria 2509
182 Ga0105239_10207563 3300010375 Bacteria 2195
183 Ga0157314_1000632 3300012500 Bacteria 3166
184 Ga0157373_10004922 3300013100 Bacteria 10056
185 Ga0157373_10014435 3300013100 Bacteria 5791
186 Ga0157373_10083316 3300013100 Bacteria 2254
187 Ga0157371_10004575 3300013102 Bacteria 12028
188 Ga0157371_10009024 3300013102 Bacteria 7882
189 Ga0157371_10108571 3300013102 Bacteria 1969
190 Ga0157370_10002917 3300013104 Bacteria 20365
191 Ga0157370_10006899 3300013104 Bacteria 12425
192 Ga0157370_10019459 3300013104 Bacteria 6809
193 Ga0157370_10029301 3300013104 Bacteria 5405
194 Ga0157370_10186698 3300013104 Bacteria 1924
195 Ga0157370_10191511 3300013104 Bacteria 1898
196 Ga0157370_10387572 3300013104 Bacteria 1287
197 Ga0157369_10000025 3300013105 Bacteria 225515
198 Ga0157369_10010299 3300013105 Bacteria 10664
199 Ga0157369_10015839 3300013105 Bacteria 8493
200 Ga0157369_10035517 3300013105 Bacteria 5464
201 Ga0157369_10218828 3300013105 Bacteria 1994
202 Ga0157369_10322123 3300013105 Bacteria 1607
203 Ga0157374_10099188 3300013296 Bacteria 2790
204 Ga0157378_10000130 3300013297 Bacteria 72949
205 Ga0157378_10607040 3300013297 Bacteria 1106
206 Ga0163162_10000015 3300013306 Bacteria 261996
207 Ga0163162_10006135 3300013306 Bacteria 11637
208 Ga0163162_10006951 3300013306 Bacteria 10972
209 Ga0163162_10164229 3300013306 Bacteria 2344
210 Ga0157372_10004575 3300013307 Bacteria 14715
211 Ga0157372_10007258 3300013307 Bacteria 11800
212 Ga0157372_10007377 3300013307 Bacteria 11699
213 Ga0157372_10050828 3300013307 Bacteria 4611
214 Ga0157372_10062380 3300013307 Bacteria 4176
215 Ga0157372_10076003 3300013307 Bacteria 3791
216 Ga0157372_10906394 3300013307 Bacteria 1023
217 Ga0157375_10001402 3300013308 Bacteria 20789
218 Ga0157375_10004646 3300013308 Bacteria 11935
219 Ga0157375_10093170 3300013308 Bacteria 3078
220 Ga0163163_10000143 3300014325 Bacteria 74622
221 Ga0182008_10000899 3300014497 Bacteria 20662
222 Ga0182008_10018678 3300014497 Bacteria 3588
223 Ga0182008_10037194 3300014497 Bacteria 2435
224 Ga0157376_10036909 3300014969 Bacteria 3962
225 Ga0157376_10195451 3300014969 Bacteria 1858
226 Ga0157376_10310487 3300014969 Bacteria 1496
227 Ga0182006_1000072 3300015261 Bacteria 133681
228 Ga0182006_1001852 3300015261 Bacteria 12129
229 Ga0182006_1091044 3300015261 Bacteria 1098
230 Ga0182007_10011710 3300015262 Bacteria 3405
231 Ga0182007_10012397 3300015262 Bacteria 3279
232 Ga0182007_10026592 3300015262 Bacteria 2003
233 Ga0182005_1000080 3300015265 Bacteria 76011
234 Ga0182005_1000551 3300015265 Bacteria 18847
235 Ga0182005_1004616 3300015265 Bacteria 4417
236 Ga0182005_1020416 3300015265 Bacteria 1823
237 Ga0183369_1006 3300015685 Bacteria 449058
238 Ga0183368_1003 3300015687 Bacteria 1276390
239 Ga0163161_10005653 3300017792 Bacteria 8670
240 Ga0206354_10548849 3300020081 Bacteria 2935
241 Ga0206354_11478949 3300020081 Bacteria 939
242 Ga0206353_10099980 3300020082 Bacteria 1533
243 Ga0206353_11983330 3300020082 Bacteria 1882
244 Ga0209435_104917 3300025206 Bacteria 1501
245 Ga0209435_104988 3300025206 Bacteria 1490
246 Ga0209760_100210 3300025207 Bacteria 26868
247 Ga0209784_100068 3300025224 Bacteria 152526
248 Ga0209566_102599 3300025225 Bacteria 3216
249 Ga0209674_100012 3300025226 Bacteria 950162
250 Ga0209674_100119 3300025226 Bacteria 135468
251 Ga0209674_100514 3300025226 Bacteria 15759
252 Ga0209674_101641 3300025226 Bacteria 5600
253 Ga0209674_102919 3300025226 Bacteria 3377
254 Ga0209672_100007 3300025228 Bacteria 959482
255 Ga0209672_100016 3300025228 Bacteria 522604
256 Ga0209672_100058 3300025228 Bacteria 211992
257 Ga0209672_100357 3300025228 Bacteria 28997
258 Ga0209672_100963 3300025228 Bacteria 12793
259 Ga0209563_100051 3300025230 Bacteria 340545
260 Ga0207427_100033 3300025231 Bacteria 338459
261 Ga0207427_100156 3300025231 Bacteria 77311
262 Ga0207427_100312 3300025231 Bacteria 33663
263 Ga0207427_100334 3300025231 Bacteria 31251
264 Ga0209437_100105 3300025233 Bacteria 220034
265 Ga0209437_100126 3300025233 Bacteria 192521
266 Ga0209437_100139 3300025233 Bacteria 172506
267 Ga0209437_100147 3300025233 Bacteria 161997
268 Ga0209437_100154 3300025233 Bacteria 153383
269 Ga0209437_102097 3300025233 Bacteria 4040
270 Ga0209437_110221 3300025233 Bacteria 1441
271 Ga0209258_100012 3300025242 Bacteria 825544
272 Ga0209258_100046 3300025242 Bacteria 369794
273 Ga0209258_100049 3300025242 Bacteria 358328
274 Ga0209258_100095 3300025242 Bacteria 223270
275 Ga0209258_100245 3300025242 Bacteria 100255
276 Ga0209258_107072 3300025242 Bacteria 1695
277 Ga0209646_1000517 3300025246 Bacteria 17280
278 Ga0209646_1001172 3300025246 Bacteria 7615
279 Ga0209646_1004456 3300025246 Bacteria 2550
280 Ga0209026_1000099 3300025250 Bacteria 161750
281 Ga0209026_1000140 3300025250 Bacteria 115081
282 Ga0209026_1000405 3300025250 Bacteria 38212
283 Ga0209026_1000726 3300025250 Bacteria 19324
284 Ga0209026_1002617 3300025250 Bacteria 6580
285 Ga0209677_101338 3300025253 Bacteria 10832
286 Ga0209148_1000002 3300025254 Bacteria 2399500
287 Ga0209148_1000010 3300025254 Bacteria 1265567
288 Ga0209148_1000014 3300025254 Bacteria 925277
289 Ga0209148_1000039 3300025254 Bacteria 482479
290 Ga0209148_1000087 3300025254 Bacteria 260905
291 Ga0209148_1000098 3300025254 Bacteria 233172
292 Ga0209148_1002333 3300025254 Bacteria 6746
293 Ga0209759_1000316 3300025256 Bacteria 64846
294 Ga0209759_1000338 3300025256 Bacteria 61744
295 Ga0209759_1001070 3300025256 Bacteria 17937
296 Ga0209759_1006753 3300025256 Bacteria 3804
297 Ga0209129_1001605 3300025258 Bacteria 12325
298 Ga0209129_1002940 3300025258 Bacteria 7790
299 Ga0209233_1000009 3300025261 Bacteria 1265567
300 Ga0209233_1000080 3300025261 Bacteria 338459
301 Ga0209233_1000083 3300025261 Bacteria 336016
302 Ga0209233_1000092 3300025261 Bacteria 308668
303 Ga0209233_1000191 3300025261 Bacteria 127938
304 Ga0209233_1025825 3300025261 Bacteria 1447
305 Ga0209455_1000010 3300025272 Bacteria 959482
306 Ga0209455_1000014 3300025272 Bacteria 806601
307 Ga0209455_1000034 3300025272 Bacteria 483129
308 Ga0209455_1000086 3300025272 Bacteria 244650
309 Ga0209455_1015163 3300025272 Bacteria 1707
310 Ga0209758_1004110 3300025297 Bacteria 12469
311 Ga0209758_1018206 3300025297 Bacteria 3456
312 Ga0209758_1023053 3300025297 Bacteria 2830
313 Ga0207656_10000907 3300025321 Bacteria 9634
314 Ga0207692_10036344 3300025898 Bacteria 2401
315 Ga0207680_10000013 3300025903 Bacteria 244716
316 Ga0207680_10072556 3300025903 Bacteria 2138
317 Ga0207647_10000029 3300025904 Bacteria 109732
318 Ga0207647_10001225 3300025904 Bacteria 19750
319 Ga0207647_10037439 3300025904 Bacteria 3076
320 Ga0207699_10152455 3300025906 Bacteria 1531
321 Ga0207705_10002035 3300025909 Bacteria 15735
322 Ga0207705_10005361 3300025909 Bacteria 9587
323 Ga0207705_10006840 3300025909 Bacteria 8426
324 Ga0207654_10000423 3300025911 Bacteria 24217
325 Ga0207707_10000380 3300025912 Bacteria 46409
326 Ga0207707_10014646 3300025912 Bacteria 6833
327 Ga0207707_10017519 3300025912 Bacteria 6246
328 Ga0207707_10032583 3300025912 Bacteria 4561
329 Ga0207707_10038162 3300025912 Bacteria 4198
330 Ga0207695_10001325 3300025913 Bacteria 41991
331 Ga0207695_10001580 3300025913 Bacteria 37116
332 Ga0207695_10005282 3300025913 Bacteria 17221
333 Ga0207695_10005709 3300025913 Bacteria 16406
334 Ga0207695_10007938 3300025913 Bacteria 13392
335 Ga0207695_10019900 3300025913 Bacteria 7713
336 Ga0207695_10036678 3300025913 Bacteria 5296
337 Ga0207695_10104456 3300025913 Bacteria 2822
338 Ga0207671_10000031 3300025914 Bacteria 247030
339 Ga0207671_10001506 3300025914 Bacteria 26857
340 Ga0207671_10018608 3300025914 Bacteria 5323
341 Ga0207671_10215670 3300025914 Bacteria 1502
342 Ga0207671_10385931 3300025914 Bacteria 1113
343 Ga0207693_10282053 3300025915 Bacteria 1302
344 Ga0207660_10111100 3300025917 Bacteria 2063
345 Ga0207657_10008885 3300025919 Bacteria 10164
346 Ga0207649_10006996 3300025920 Bacteria 6127
347 Ga0207649_10017262 3300025920 Bacteria 4090
348 Ga0207649_10047431 3300025920 Bacteria 2644
349 Ga0207649_10050424 3300025920 Bacteria 2574
350 Ga0207649_10059528 3300025920 Bacteria 2397
351 Ga0207652_10005420 3300025921 Bacteria 10349
352 Ga0207652_10098739 3300025921 Bacteria 2576
353 Ga0207694_10002048 3300025924 Bacteria 16672
354 Ga0207694_10002295 3300025924 Bacteria 15650
355 Ga0207694_10006873 3300025924 Bacteria 8642
356 Ga0207694_10057567 3300025924 Bacteria 3022
357 Ga0207650_10606128 3300025925 Bacteria 921
358 Ga0207700_10000795 3300025928 Bacteria 18225
359 Ga0207664_10000239 3300025929 Bacteria 41739
360 Ga0207664_10095942 3300025929 Bacteria 2440
361 Ga0207690_10000586 3300025932 Bacteria 23543
362 Ga0207690_10000992 3300025932 Bacteria 18165
363 Ga0207690_10034557 3300025932 Bacteria 3258
364 Ga0207690_10064484 3300025932 Bacteria 2501
365 Ga0207690_10082299 3300025932 Bacteria 2251
366 Ga0207706_10052307 3300025933 Bacteria 3606
367 Ga0207686_10003899 3300025934 Bacteria 8000
368 Ga0207670_10003200 3300025936 Bacteria 8671
369 Ga0207669_10505496 3300025937 Bacteria 968
370 Ga0207704_10000937 3300025938 Bacteria 12919
371 Ga0207691_10002689 3300025940 Bacteria 17383
372 Ga0207711_10037344 3300025941 Bacteria 4125
373 Ga0207689_10016448 3300025942 Bacteria 6260
374 Ga0207667_10001044 3300025949 Bacteria 35297
375 Ga0207667_10001074 3300025949 Bacteria 34666
376 Ga0207667_10002386 3300025949 Bacteria 23502
377 Ga0207667_10005225 3300025949 Bacteria 15835
378 Ga0207667_10007269 3300025949 Bacteria 13354
379 Ga0207667_10007692 3300025949 Bacteria 12899
380 Ga0207667_10273056 3300025949 Bacteria 1728
381 Ga0207712_10000843 3300025961 Bacteria 22439
382 Ga0207640_10000485 3300025981 Bacteria 24115
383 Ga0207640_10002635 3300025981 Bacteria 9610
384 Ga0207640_10019244 3300025981 Bacteria 4030
385 Ga0207640_10298746 3300025981 Bacteria 1273
386 Ga0207658_10000028 3300025986 Bacteria 174550
387 Ga0207658_10080038 3300025986 Bacteria 2501
388 Ga0207639_10000315 3300026041 Bacteria 34209
389 Ga0207639_10003518 3300026041 Bacteria 10530
390 Ga0207639_10007989 3300026041 Bacteria 7227
391 Ga0207639_10089944 3300026041 Bacteria 2454
392 Ga0207639_10170293 3300026041 Bacteria 1844
393 Ga0207639_10245351 3300026041 Bacteria 1559
394 Ga0207678_10000112 3300026067 Bacteria 67012
395 Ga0207678_10004531 3300026067 Bacteria 12493
396 Ga0207678_10024343 3300026067 Bacteria 5288
397 Ga0207678_10055903 3300026067 Bacteria 3399
398 Ga0207678_10141476 3300026067 Bacteria 2053
399 Ga0207702_10001547 3300026078 Bacteria 22753
400 Ga0207702_10006560 3300026078 Bacteria 10013
401 Ga0207641_10229369 3300026088 Bacteria 1725
402 Ga0207648_10156589 3300026089 Bacteria 2011
403 Ga0207674_10000685 3300026116 Bacteria 44017
404 Ga0207674_10050096 3300026116 Bacteria 4268
405 Ga0207674_10176265 3300026116 Bacteria 2090
406 Ga0207675_100141217 3300026118 Bacteria 2288
407 Ga0207698_10012151 3300026142 Bacteria 5620
408 Ga0207698_10015607 3300026142 Bacteria 5092
409 Ga0207698_10071842 3300026142 Bacteria 2748
410 Ga0268266_10000001 3300028379 Bacteria 4040580
411 Ga0268266_10000021 3300028379 Bacteria 522453
412 Ga0268266_10280941 3300028379 Bacteria 1548
413 Ga0268265_10000131 3300028380 Bacteria 95615
414 Ga0268264_10003643 3300028381 Bacteria 13255
415 Ga0268264_10484936 3300028381 Bacteria 1203
416 Ga0268264_10548486 3300028381 Bacteria 1133
417 Ga0307508_10014069 3300031616 Bacteria 7303
418 Ga0316575_10001810 3300031665 Bacteria 7011
419 Ga0316575_10020315 3300031665 Bacteria 2547
420 Ga0316575_10120670 3300031665 Bacteria 1072
421 Ga0316579_10000114 3300031691 Bacteria 21604
422 Ga0316576_10124892 3300031727 Bacteria 1933
423 Ga0316576_10195644 3300031727 Bacteria 1523
424 Ga0307516_10062132 3300031730 Bacteria 3621
425 Ga0316577_10038005 3300031733 Bacteria 2691
426 Ga0316577_10047768 3300031733 Bacteria 2390
427 Ga0307412_10000917 3300031911 Bacteria 16854
428 Ga0307409_100197930 3300031995 Bacteria 1795
429 Ga0316585_10003820 3300032137 Bacteria 4166
430 Ga0316580_10007241 3300032139 Bacteria 3298
431 Ga0316580_10011121 3300032139 Bacteria 2727
432 Ga0316593_10002104 3300032168 Bacteria 4627
433 Ga0316593_10002604 3300032168 Bacteria 4319
434 Ga0307507_10015315 3300033179 Bacteria 9033
435 Ga0307510_10000977 3300033180 Bacteria 30289
436 Ga0307510_10159835 3300033180 Bacteria 1852
437 Ga0316596_1001142 3300033541 Bacteria 5192
438 Ga0316596_1001867 3300033541 Bacteria 4393
439 Ga0316574_0000172 3300035398 Bacteria 21532
440 Ga0373937_0306011 3300036401 Bacteria 1503
441 Ga0316582_0010909 3300036647 Bacteria 5001
442 Ga0316584_0044035 3300036712 Bacteria 3328
443 Ga0395899_0000175 3300037312 Bacteria 95781
444 Ga0395899_0007904 3300037312 Bacteria 8192
445 Ga0395899_0030704 3300037312 Bacteria 4040
446 Ga0395899_0090203 3300037312 Bacteria 2222
447 Ga0395899_0156999 3300037312 Bacteria 1609
448 Ga0395900_0000012 3300037418 Bacteria 401198
449 Ga0395900_0000059 3300037418 Bacteria 205996
450 Ga0395900_0004207 3300037418 Bacteria 15274
451 Ga0395900_0004359 3300037418 Bacteria 15007
452 Ga0395900_0030705 3300037418 Bacteria 5518
453 Ga0395898_0000034 3300037466 Bacteria 356745
454 Ga0395898_0001311 3300037466 Bacteria 36213
455 Ga0395898_0006426 3300037466 Bacteria 12553
456 Ga0395898_0008278 3300037466 Bacteria 11000
457 Ga0395898_0074040 3300037466 Bacteria 3290
458 Ga0395898_0367324 3300037466 Bacteria 1372
459 Ga0395901_0000816 3300038443 Bacteria 34537
460 Ga0395901_0006163 3300038443 Bacteria 12151
461 Ga0395901_0009331 3300038443 Bacteria 9946
462 Ga0395901_0010234 3300038443 Bacteria 9501
463 Ga0395901_0050339 3300038443 Bacteria 4329
464 Ga0395901_0185453 3300038443 Bacteria 2182
465 Ga0395901_0329463 3300038443 Bacteria 1579
466 Ga0395901_0432333 3300038443 Bacteria 1348
467 Ga0439436_0000067 3300041404 Bacteria 29364
468 Ga0439465_0001040 3300041413 Bacteria 8836
469 Ga0451793_0739495 3300041452 Bacteria 3120
470 Ga0451797_0261258 3300041453 Bacteria 1237
471 Ga0451807_0171222 3300041486 Bacteria 4674
472 Ga0451807_0309039 3300041486 Bacteria 1028
473 Ga0451833_0446148 3300041491 Bacteria 1288
474 Ga0451853_0953777 3300041512 Bacteria 2888
475 Ga0451853_1433675 3300041512 Bacteria 1121
476 Ga0439437_001633 3300042000 Bacteria 2371
477 Ga0450908_001144 3300042184 Bacteria 5143
478 Ga0439459_0000055 3300042438 Bacteria 9345
479 Ga0451577_0204182 3300042876 Bacteria 1784
480 Ga0466969_0011574 3300044656 Bacteria 4669
481 Ga0466969_0020653 3300044656 Bacteria 3408
482 Ga0466972_0005739 3300044658 Bacteria 6219
483 Ga0466972_0047788 3300044658 Bacteria 2068
484 Ga0466975_0180042 3300044661 Bacteria 1449
485 Ga0466989_0018571 3300044663 Bacteria 3964
486 Ga0466982_0000013 3300044672 Bacteria 136227
487 Ga0466965_0002807 3300044683 Bacteria 7503
488 Ga0466965_0117981 3300044683 Bacteria 1368
489 Ga0466966_0004686 3300044684 Bacteria 8999
490 Ga0466966_0014630 3300044684 Bacteria 5193
491 Ga0466966_0020702 3300044684 Bacteria 4322
492 Ga0466961_0000967 3300044693 Bacteria 17790
493 Ga0466961_0013541 3300044693 Bacteria 5223
494 Ga0466961_0017074 3300044693 Bacteria 4661
495 Ga0466961_0028265 3300044693 Bacteria 3605
496 Ga0466963_0174554 3300044694 Bacteria 1499
497 Ga0466971_0022747 3300044719 Bacteria 2793
498 Ga0466971_0027748 3300044719 Bacteria 2535
499 Ga0466968_0002450 3300044735 Bacteria 6806
500 Ga0466968_0013890 3300044735 Bacteria 3173
501 Ga0466970_0010342 3300044765 Bacteria 4734
502 Ga0466957_0047688 3300044842 Bacteria 2603
503 Ga0466957_0128323 3300044842 Bacteria 1622
504 Ga0466960_0005543 3300044901 Bacteria 5004
505 Ga0466959_0000068 3300045049 Bacteria 73132
506 Ga0466959_0020265 3300045049 Bacteria 4897
507 Ga0466959_0062198 3300045049 Bacteria 2713
508 Ga0466958_0049101 3300045836 Bacteria 2552
509 Ga0466958_0101272 3300045836 Bacteria 1791
510 Ga0466967_0261737 3300045976 Bacteria 1655
511 Ga0495617_000117 3300046452 Bacteria 54105
512 Ga0495638_0000007 3300046460 Bacteria 602783
513 Ga0495638_0000899 3300046460 Bacteria 30415
514 Ga0495638_0001952 3300046460 Bacteria 17692
515 Ga0495638_0001995 3300046460 Bacteria 17416
516 Ga0495638_0018140 3300046460 Bacteria 4677
517 Ga0495650_0000497 3300046471 Bacteria 59612
518 Ga0495650_0000585 3300046471 Bacteria 50650
519 Ga0495650_0003111 3300046471 Bacteria 12451
520 Ga0495582_0055392 3300046473 Bacteria 2186
521 Ga0495584_0003980 3300046491 Bacteria 7970
522 Ga0495585_0008658 3300046492 Bacteria 6153
523 Ga0495585_0013229 3300046492 Bacteria 4834
524 Ga0495607_0000088 3300046501 Bacteria 95203
525 Ga0495607_0000122 3300046501 Bacteria 81489
526 Ga0495606_0000298 3300046507 Bacteria 85739
527 Ga0495606_0001210 3300046507 Bacteria 36218
528 Ga0495606_0004779 3300046507 Bacteria 13320
529 Ga0495606_0078069 3300046507 Bacteria 2066
530 Ga0495606_0089144 3300046507 Bacteria 1900
531 Ga0495610_0004565 3300046512 Bacteria 10178
532 Ga0495610_0015527 3300046512 Bacteria 4420
533 Ga0495616_0000565 3300046513 Bacteria 28011
534 Ga0495620_0005019 3300046515 Bacteria 7416
535 Ga0495631_0001445 3300046518 Bacteria 14425
536 Ga0495631_0003807 3300046518 Bacteria 8199
537 Ga0495632_0000004 3300046519 Bacteria 381372
538 Ga0495632_0038310 3300046519 Bacteria 2428
539 Ga0495632_0052398 3300046519 Bacteria 2006
540 Ga0495632_0113406 3300046519 Bacteria 1271
541 Ga0495632_0176962 3300046519 Bacteria 978
542 Ga0495648_0005079 3300046524 Bacteria 11041
543 Ga0495648_0009504 3300046524 Bacteria 7516
544 Ga0495665_0085971 3300046531 Bacteria 1653
545 Ga0495586_0117970 3300046535 Bacteria 1481
546 Ga0495609_0003579 3300046538 Bacteria 8834
547 Ga0495597_0104277 3300046542 Bacteria 1193
548 Ga0495622_0012969 3300046557 Bacteria 3867
549 Ga0495668_0012112 3300046616 Bacteria 5130
550 Ga0495611_0000001 3300046648 Bacteria 2628469
551 Ga0495611_0000060 3300046648 Bacteria 77971
552 Ga0495625_0000022 3300046660 Bacteria 278823
553 Ga0495625_0016189 3300046660 Bacteria 5873
554 Ga0495625_0022701 3300046660 Bacteria 4806
555 Ga0495625_0097090 3300046660 Bacteria 2028
556 Ga0495661_0003615 3300046665 Bacteria 11388
557 Ga0495670_0007331 3300046691 Bacteria 5422
558 Ga0495671_0004741 3300046692 Bacteria 8031
559 Ga0495649_0013114 3300046694 Bacteria 4790
560 Ga0495589_0000137 3300046794 Bacteria 67614
561 Ga0495660_0000728 3300046810 Bacteria 25032
562 Ga0495660_0003021 3300046810 Bacteria 10492
563 Ga0495672_0081196 3300047320 Bacteria 1806
564 Ga0495683_0006531 3300047323 Bacteria 6367
565 Ga0495679_000004 3300047446 Bacteria 748056
566 Ga0495673_0000202 3300047469 Bacteria 90523
567 Ga0495673_0000749 3300047469 Bacteria 30861
568 Ga0495681_0070594 3300047470 Bacteria 1583
569 Ga0495686_0000017 3300047472 Bacteria 435554
570 Ga0495686_0001035 3300047472 Bacteria 33368
571 Ga0495686_0002896 3300047472 Bacteria 15405
572 Ga0495686_0024798 3300047472 Bacteria 3935
573 Ga0495626_0153914 3300048091 Bacteria 967
574 Ga0496100_0001258 3300048903 Bacteria 12356
575 Ga0496101_0000491 3300048904 Bacteria 24921
576 Ga0496102_0032706 3300048905 Bacteria 4674
577 Ga0496102_0083022 3300048905 Bacteria 2956
578 Ga0496102_0228311 3300048905 Bacteria 1755
579 Ga0496103_0032821 3300048906 Bacteria 3170
580 Ga0496104_0000016 3300048907 Bacteria 335025
581 Ga0496104_0669353 3300048907 Bacteria 946
582 Ga0496105_0000010 3300048908 Bacteria 309880
583 Ga0496105_0000871 3300048908 Bacteria 20658
584 Ga0496106_0005789 3300048909 Bacteria 9139
585 Ga0496115_0000025 3300048918 Bacteria 151658
586 Ga0496115_0013784 3300048918 Bacteria 6121
587 Ga0496115_0029462 3300048918 Bacteria 4311
588 Ga0496115_0037030 3300048918 Bacteria 3865
589 Ga0496115_0251320 3300048918 Bacteria 1455
590 Ga0496116_0079482 3300048919 Bacteria 2041
591 Ga0496117_0004951 3300048920 Bacteria 14305
592 Ga0496117_0011610 3300048920 Bacteria 7872
593 Ga0496118_0000429 3300048921 Bacteria 69699
594 Ga0496118_0002079 3300048921 Bacteria 28158
595 Ga0496118_0002476 3300048921 Bacteria 24790
596 Ga0496118_0006655 3300048921 Bacteria 12612
597 Ga0496118_0015454 3300048921 Bacteria 7065
598 Ga0496118_0034247 3300048921 Bacteria 4148
599 Ga0496118_0053587 3300048921 Bacteria 3064
600 Ga0496118_0060887 3300048921 Bacteria 2800
601 Ga0496118_0242450 3300048921 Bacteria 1031
602 Ga0496119_0000058 3300048922 Bacteria 173131
603 Ga0496119_0039545 3300048922 Bacteria 3029
604 Ga0496120_0001252 3300048923 Bacteria 31938
605 Ga0496120_0001892 3300048923 Bacteria 23232
606 Ga0496121_0000045 3300048924 Bacteria 336130
607 Ga0496121_0000401 3300048924 Bacteria 86663
608 Ga0496121_0002752 3300048924 Bacteria 26142
609 Ga0496121_0009537 3300048924 Bacteria 11121
610 Ga0496121_0028054 3300048924 Bacteria 5250
611 Ga0496121_0034962 3300048924 Bacteria 4510
612 Ga0496121_0037826 3300048924 Bacteria 4281
613 Ga0496121_0046023 3300048924 Bacteria 3740
614 Ga0496121_0115688 3300048924 Bacteria 2036
615 Ga0496121_0117684 3300048924 Bacteria 2013
616 Ga0496121_0179141 3300048924 Bacteria 1531
617 Ga0496122_0000759 3300048925 Bacteria 62531
618 Ga0496122_0017227 3300048925 Bacteria 6770
619 Ga0496122_0067213 3300048925 Bacteria 2583
620 Ga0496123_0001142 3300048926 Bacteria 39631
621 Ga0496123_0003690 3300048926 Bacteria 16866
622 Ga0496123_0016381 3300048926 Bacteria 6023
623 Ga0496123_0030669 3300048926 Bacteria 3931
624 Ga0496124_0028363 3300048927 Bacteria 5008
625 Ga0496124_0057811 3300048927 Bacteria 3266
626 Ga0496125_0000137 3300048928 Bacteria 160328
627 Ga0496125_0018170 3300048928 Bacteria 6683
628 Ga0496126_0001102 3300048929 Bacteria 45348
629 Ga0496126_0047577 3300048929 Bacteria 3926
630 Ga0496126_0069008 3300048929 Bacteria 3154
631 Ga0496126_0121900 3300048929 Bacteria 2260
632 Ga0496126_0242597 3300048929 Bacteria 1505
633 Ga0496126_0349516 3300048929 Bacteria 1209
634 Ga0495678_000099 3300049459 Bacteria 106223
635 Ga0495678_041137 3300049459 Bacteria 1852
636 Ga0495682_0032976 3300049460 Bacteria 1912
637 Ga0501031_0005632 3300049568 Bacteria 8162
638 Ga0501032_0001939 3300049569 Bacteria 16291
639 Ga0501032_0014972 3300049569 Bacteria 5485
640 Ga0501033_0005614 3300049570 Bacteria 9913
641 Ga0501033_0007452 3300049570 Bacteria 8523
642 Ga0501033_0025649 3300049570 Bacteria 4440
643 Ga0501033_0079699 3300049570 Bacteria 2403
644 Ga0501034_0000605 3300049571 Bacteria 56544
645 Ga0501034_0003067 3300049571 Bacteria 19272
646 Ga0501034_0004478 3300049571 Bacteria 15529
647 Ga0501034_0017499 3300049571 Bacteria 7351
648 Ga0501034_0021485 3300049571 Bacteria 6579
649 Ga0501036_0015834 3300049572 Bacteria 6297
650 Ga0501036_0056431 3300049572 Bacteria 3328
651 Ga0501036_0523104 3300049572 Bacteria 986
652 Ga0501037_0001394 3300049573 Bacteria 17733
653 Ga0501037_0015899 3300049573 Bacteria 5541
654 Ga0501037_0039752 3300049573 Bacteria 3462
655 Ga0501037_0362493 3300049573 Bacteria 998
656 Ga0501038_0000141 3300049574 Bacteria 61476
657 Ga0501038_0009677 3300049574 Bacteria 8840
658 Ga0501038_0069413 3300049574 Bacteria 2993
659 Ga0501038_0103298 3300049574 Bacteria 2370
660 Ga0501039_0010357 3300049575 Bacteria 7111
661 Ga0501039_0087333 3300049575 Bacteria 2429
662 Ga0501042_0104785 3300049578 Bacteria 2035
663 Ga0501043_0000840 3300049579 Bacteria 27302
664 Ga0501043_0005095 3300049579 Bacteria 10636
665 Ga0501043_0013050 3300049579 Bacteria 6494
666 Ga0501043_0025582 3300049579 Bacteria 4631
667 Ga0501043_0071548 3300049579 Bacteria 2724
668 Ga0501043_0138949 3300049579 Bacteria 1903
669 Ga0501043_0436075 3300049579 Bacteria 986
670 Ga0501046_0012566 3300049580 Bacteria 7200
671 Ga0501046_0014090 3300049580 Bacteria 6752
672 Ga0501046_0115571 3300049580 Bacteria 2046
673 Ga0501046_0116612 3300049580 Bacteria 2035
674 Ga0501046_0141965 3300049580 Bacteria 1817
675 Ga0501047_0002983 3300049581 Bacteria 16053
676 Ga0501047_0004063 3300049581 Bacteria 13761
677 Ga0501047_0008730 3300049581 Bacteria 9564
678 Ga0501047_0010205 3300049581 Bacteria 8883
679 Ga0501047_0011872 3300049581 Bacteria 8240
680 Ga0501047_0025393 3300049581 Bacteria 5695
681 Ga0501047_0085696 3300049581 Bacteria 3027
682 Ga0501047_0251583 3300049581 Bacteria 1615
683 Ga0501047_0292364 3300049581 Bacteria 1473
684 Ga0501047_0300140 3300049581 Bacteria 1449
685 Ga0501047_0364304 3300049581 Bacteria 1281
686 Ga0501048_0025027 3300049582 Bacteria 4353
687 Ga0501048_0075485 3300049582 Bacteria 2378
688 Ga0501067_0003110 3300049583 Bacteria 9161
689 Ga0501068_0001426 3300049584 Bacteria 12696
690 Ga0501068_0129083 3300049584 Bacteria 1580
691 Ga0501069_0003434 3300049585 Bacteria 8142
692 Ga0501069_0035758 3300049585 Bacteria 2737
693 Ga0501069_0152380 3300049585 Bacteria 1329
694 Ga0501070_0003984 3300049586 Bacteria 12700
695 Ga0501070_0005506 3300049586 Bacteria 10802
696 Ga0501070_0013239 3300049586 Bacteria 6953
697 Ga0501070_0016391 3300049586 Bacteria 6225
698 Ga0501070_0042286 3300049586 Bacteria 3795
699 Ga0501070_0080309 3300049586 Bacteria 2698
700 Ga0501071_0026570 3300049587 Bacteria 4065
701 Ga0501072_0007222 3300049588 Bacteria 8432
702 Ga0501072_0087685 3300049588 Bacteria 2470
703 Ga0501073_0000072 3300049589 Bacteria 62953
704 Ga0501073_0012859 3300049589 Bacteria 6101
705 Ga0501073_0014820 3300049589 Bacteria 5658
706 Ga0501073_0022162 3300049589 Bacteria 4577
707 Ga0501073_0074253 3300049589 Bacteria 2368
708 Ga0501073_0086040 3300049589 Bacteria 2186
709 Ga0501074_0002293 3300049590 Bacteria 13304
710 Ga0501074_0011165 3300049590 Bacteria 6525
711 Ga0501074_0017385 3300049590 Bacteria 5217
712 Ga0501074_0019544 3300049590 Bacteria 4917
713 Ga0501074_0029972 3300049590 Bacteria 3943
714 Ga0501079_0039248 3300049741 Bacteria 3652
715 Ga0501079_0044763 3300049741 Bacteria 3415
716 Ga0501079_0254786 3300049741 Bacteria 1372
717 Ga0501080_0000097 3300049742 Bacteria 59356
718 Ga0501080_0000554 3300049742 Bacteria 29568
719 Ga0501080_0003092 3300049742 Bacteria 14701
720 Ga0501080_0012182 3300049742 Bacteria 7878
721 Ga0501080_0027360 3300049742 Bacteria 5301
722 Ga0501080_0105298 3300049742 Bacteria 2615
723 Ga0501080_0121722 3300049742 Bacteria 2418
724 Ga0501083_0000128 3300049744 Bacteria 51820
725 Ga0501083_0305659 3300049744 Bacteria 1034
726 Ga0501035_0001437 3300049822 Bacteria 24424
727 Ga0501035_0003810 3300049822 Bacteria 14372
728 Ga0501035_0021748 3300049822 Bacteria 5897
729 Ga0501035_0035960 3300049822 Bacteria 4492
730 Ga0501035_0043309 3300049822 Bacteria 4057
731 Ga0501035_0050847 3300049822 Bacteria 3712
732 Ga0501035_0074266 3300049822 Bacteria 3008
733 Ga0501035_0174472 3300049822 Bacteria 1855
734 Ga0501035_0198430 3300049822 Bacteria 1722
735 Ga0501044_0003555 3300049823 Bacteria 17539
736 Ga0501044_0003906 3300049823 Bacteria 16710
737 Ga0501044_0005029 3300049823 Bacteria 14761
738 Ga0501044_0012166 3300049823 Bacteria 9317
739 Ga0501044_0013452 3300049823 Bacteria 8850
740 Ga0501044_0015582 3300049823 Bacteria 8190
741 Ga0501044_0038033 3300049823 Bacteria 5026
742 Ga0501044_0044762 3300049823 Bacteria 4590
743 Ga0501044_0084014 3300049823 Bacteria 3218
744 Ga0501044_0203046 3300049823 Bacteria 1940
745 Ga0501044_0319870 3300049823 Bacteria 1476
746 nmdc:mga0sz30_64337_c1 3300050516 Bacteria 1571
747 Ga0500610_0003839 3300053079 Bacteria 5849
748 Ga0500643_000118 3300053087 Bacteria 82138
749 Ga0500643_003789 3300053087 Bacteria 7077
750 Ga0500651_0000245 3300053093 Bacteria 33226
751 Ga0500651_0042127 3300053093 Bacteria 2877
752 Ga0500555_001900 3300053103 Bacteria 6201
753 Ga0500597_000179 3300053120 Bacteria 13013
754 Ga0500633_0003671 3300053160 Bacteria 3392
755 Ga0500645_001641 3300053730 Bacteria 11022
756 Ga0501082_0057705 3300060353 Bacteria 3344
757 Ga0466962_0003530 3300061719 Bacteria 7453
758 Ga0466962_0007751 3300061719 Bacteria 5145
759 2525555823 2524614729 Bacteria 3091755
760 2538833033 2537561836 Bacteria 3910579
761 2595446722 2593339238 Bacteria 4182970
762 2595451777 2593339239 Bacteria 4124669
763 2630650837 2627854209 Bacteria 3093011
764 2643830895 2643221562 Bacteria 4048635
765 2643894163 2643221577 Bacteria 3710843
766 2644476365 2643221685 Bacteria 3673288
767 2721026632 2718218334 Bacteria 4765486
768 2735833375 2734482264 Unclassified 5014763
769 2739229372 2738543009 Bacteria 4944499
770 2739731932 2739367700 Bacteria 4747630
771 2819563813 2818991440 Bacteria 4774720
772 2842917886 2842914999 Bacteria 4419378
773 2842919754 2842918807 Bacteria 4289178
774 2884341368 2884338543 Bacteria 4610696
775 2884413337 2884411467 Bacteria 5246714
776 2895396919 2895395659 Bacteria 3983269
777 2904463876 2904463128 Bacteria 4775606
778 2919087608 2919085039 Bacteria 4532964
779 2919404858 2919404418 Bacteria 4232372
780 2928964630 2928963466 Bacteria 5165703
781 2939614278 2939611941 Bacteria 3892017
782 2941472826 2941471342 Bacteria 5018624
783 2953995055 2953994433 Bacteria 4303959
784 Ga0395899_0021621
785 JGI24740J21852_10005728
786 JGI24739J22299_10001151
787 JGI24739J22299_10012267
788 JGI24737J22298_10015018
789 JGI24738J21930_10000954
790 JGI25156J39149_1004146
791 JGI25156J39149_1010840
792 JGI25162J39368_1000226
793 JGI25162J39368_1000311
794 JGI25162J39368_1000790
795 JGI25162J39368_1001503
796 JGI25162J39368_1004324
797 JGI25157J39369_1000345
798 JGI25157J39369_1000541
799 JGI25157J39369_1001083
800 JGI25157J39369_1002119
801 JGI25157J39369_1002687
802 JGI25163J39215_1000171
803 JGI25164J39214_1000035
804 JGI25164J39214_1000214
805 JGI25164J39214_1000742
806 JGI25164J39214_1000752
807 JGI25165J46597_1000226
808 JGI25165J46597_1000260
809 JGI25165J46597_1001473
810 JGI25165J46597_1003296
811 rootH1_10016990
812 rootH2_10004402
813 Ga0006562J51391_1022736
814 Ga0006562J51391_1022737
815 Ga0006562J51391_1106400
816 Ga0006562J51391_1106401
817 Ga0055538_1002052
818 Ga0055539_1003463
819 Ga0055533_1002036
820 Ga0055525_1000452
821 Ga0055527_1000082
822 Ga0055527_1000907
823 Ga0055535_1000143
824 Ga0055535_1000323
825 Ga0055535_1000593
826 Ga0055535_1002180
827 Ga0055535_1002438
828 Ga0055542_1000067
829 Ga0055542_1000190
830 Ga0055542_1000275
831 Ga0055542_1000622
832 Ga0055542_1002065
833 Ga0055542_1002332
834 Ga0055529_1000217
835 Ga0055529_1000233
836 Ga0055529_1000367
837 Ga0055529_1001133
838 Ga0055543_1020812
839 Ga0065165_1000028
840 Ga0065165_1001244
841 Ga0070658_10001605
842 Ga0070683_100168976
843 Ga0068869_100004548
844 Ga0070666_10000012
845 Ga0070666_10168093
846 Ga0070680_100295793
847 Ga0070680_100332401
848 Ga0070682_100001599
849 Ga0070682_100005594
850 Ga0070660_100016387
851 Ga0070689_100010606
852 Ga0070691_10040331
853 Ga0070661_100042502
854 Ga0070661_100050352
855 Ga0070661_100050468
856 Ga0070661_100072708
857 Ga0070692_10045384
858 Ga0070692_10153602
859 Ga0070668_100103313
860 Ga0070659_100043525
861 Ga0070659_100118427
862 Ga0070667_100000041
863 Ga0070667_100013273
864 Ga0070667_100122410
865 Ga0070667_100485351
866 Ga0070714_100000650
867 Ga0070713_100000697
868 Ga0070663_100000080
869 Ga0070663_100043617
870 Ga0070681_10000422
871 Ga0070681_10004784
872 Ga0070685_10007572
873 Ga0070685_10115922
874 Ga0070679_100008773
875 Ga0070679_100033998
876 Ga0070679_100035082
877 Ga0070679_100136895
878 Ga0070679_100269264
879 Ga0068853_100006935
880 Ga0068853_100013978
881 Ga0068853_100036801
882 Ga0068853_100059765
883 Ga0068853_100165200
884 Ga0068853_100174863
885 Ga0068853_100286720
886 Ga0070672_100000967
887 Ga0070696_100006770
888 Ga0070693_100002525
889 Ga0070665_100000062
890 Ga0070665_100011046
891 Ga0070665_100012001
892 Ga0070665_100015833
893 Ga0068855_100000186
894 Ga0068855_100003219
895 Ga0068855_100035273
896 Ga0068855_100055852
897 Ga0068855_100068209
898 Ga0068855_100151751
899 Ga0068855_100434603
900 Ga0068857_100002448
901 Ga0068857_100012794
902 Ga0068857_100024073
903 Ga0068857_100309750
904 Ga0068854_100000486
905 Ga0068854_100010548
906 Ga0068854_100040225
907 Ga0068854_100307736
908 Ga0068856_100002830
909 Ga0068856_100011894
910 Ga0068856_100137208
911 Ga0068856_100259666
912 Ga0068852_100024421
913 Ga0068852_100095568
914 Ga0068852_100109245
915 Ga0068852_100309565
916 Ga0068852_100371509
917 Ga0068859_100000704
918 Ga0068861_100071323
919 Ga0068851_10001144
920 Ga0068851_10022152
921 Ga0068858_100399759
922 Ga0068860_100250787
923 Ga0068860_100386975
924 Ga0068862_100001686
925 Ga0075369_10034813
926 Ga0075369_10043586
927 Ga0097621_100034797
928 Ga0097621_100499297
929 Ga0068865_100001033
930 Ga0097620_100000704
931 Ga0105240_10003480
932 Ga0105240_10005037
933 Ga0105240_10014526
934 Ga0105240_10018376
935 Ga0105240_10112732
936 Ga0105240_10280220
937 Ga0105247_10018982
938 Ga0105241_10041060
939 Ga0105241_10178303
940 Ga0105241_10560220
941 Ga0105242_10002687
942 Ga0105248_10010085
943 Ga0105248_10125934
944 Ga0105237_10000152
945 Ga0105237_10054848
946 Ga0105237_10055379
947 Ga0105237_10059438
948 Ga0105237_10101582
949 Ga0105238_10000540
950 Ga0105238_10014166
951 Ga0105238_10051996
952 Ga0105238_10062921
953 Ga0105238_10106626
954 Ga0105238_10113358
955 Ga0105238_10150423
956 Ga0105249_10000397
957 Ga0105239_10000020
958 Ga0105239_10002067
959 Ga0105239_10018443
960 Ga0105239_10021926
961 Ga0105239_10065757
962 Ga0105239_10074051
963 Ga0105239_10092121
964 Ga0105239_10160733
965 Ga0105239_10207563
966 Ga0157314_1000632
967 Ga0157373_10004922
968 Ga0157373_10014435
969 Ga0157373_10083316
970 Ga0157371_10004575
971 Ga0157371_10009024
972 Ga0157371_10108571
973 Ga0157370_10002917
974 Ga0157370_10006899
975 Ga0157370_10019459
976 Ga0157370_10029301
977 Ga0157370_10186698
978 Ga0157370_10191511
979 Ga0157370_10387572
980 Ga0157369_10000025
981 Ga0157369_10010299
982 Ga0157369_10015839
983 Ga0157369_10035517
984 Ga0157369_10218828
985 Ga0157369_10322123
986 Ga0157374_10099188
987 Ga0157378_10000130
988 Ga0157378_10607040
989 Ga0163162_10000015
990 Ga0163162_10006135
991 Ga0163162_10006951
992 Ga0163162_10164229
993 Ga0157372_10004575
994 Ga0157372_10007258
995 Ga0157372_10007377
996 Ga0157372_10050828
997 Ga0157372_10062380
998 Ga0157372_10076003
999 Ga0157372_10906394
1000 Ga0157375_10001402
1001 Ga0157375_10004646
1002 Ga0157375_10093170
1003 Ga0163163_10000143
1004 Ga0182008_10000899
1005 Ga0182008_10018678
1006 Ga0182008_10037194
1007 Ga0157376_10036909
1008 Ga0157376_10195451
1009 Ga0157376_10310487
1010 Ga0182006_1000072
1011 Ga0182006_1001852
1012 Ga0182006_1091044
1013 Ga0182007_10011710
1014 Ga0182007_10012397
1015 Ga0182007_10026592
1016 Ga0182005_1000080
1017 Ga0182005_1000551
1018 Ga0182005_1004616
1019 Ga0182005_1020416
1020 Ga0183369_1006
1021 Ga0183368_1003
1022 Ga0163161_10005653
1023 Ga0206354_10548849
1024 Ga0206354_11478949
1025 Ga0206353_10099980
1026 Ga0206353_11983330
1027 Ga0209435_104917
1028 Ga0209435_104988
1029 Ga0209760_100210
1030 Ga0209784_100068
1031 Ga0209566_102599
1032 Ga0209674_100012
1033 Ga0209674_100119
1034 Ga0209674_100514
1035 Ga0209674_101641
1036 Ga0209674_102919
1037 Ga0209672_100007
1038 Ga0209672_100016
1039 Ga0209672_100058
1040 Ga0209672_100357
1041 Ga0209672_100963
1042 Ga0209563_100051
1043 Ga0207427_100033
1044 Ga0207427_100156
1045 Ga0207427_100312
1046 Ga0207427_100334
1047 Ga0209437_100105
1048 Ga0209437_100126
1049 Ga0209437_100139
1050 Ga0209437_100147
1051 Ga0209437_100154
1052 Ga0209437_102097
1053 Ga0209437_110221
1054 Ga0209258_100012
1055 Ga0209258_100046
1056 Ga0209258_100049
1057 Ga0209258_100095
1058 Ga0209258_100245
1059 Ga0209258_107072
1060 Ga0209646_1000517
1061 Ga0209646_1001172
1062 Ga0209646_1004456
1063 Ga0209026_1000099
1064 Ga0209026_1000140
1065 Ga0209026_1000405
1066 Ga0209026_1000726
1067 Ga0209026_1002617
1068 Ga0209677_101338
1069 Ga0209148_1000002
1070 Ga0209148_1000010
1071 Ga0209148_1000014
1072 Ga0209148_1000039
1073 Ga0209148_1000087
1074 Ga0209148_1000098
1075 Ga0209148_1002333
1076 Ga0209759_1000316
1077 Ga0209759_1000338
1078 Ga0209759_1001070
1079 Ga0209759_1006753
1080 Ga0209129_1001605
1081 Ga0209129_1002940
1082 Ga0209233_1000009
1083 Ga0209233_1000080
1084 Ga0209233_1000083
1085 Ga0209233_1000092
1086 Ga0209233_1000191
1087 Ga0209233_1025825
1088 Ga0209455_1000010
1089 Ga0209455_1000014
1090 Ga0209455_1000034
1091 Ga0209455_1000086
1092 Ga0209455_1015163
1093 Ga0209758_1004110
1094 Ga0209758_1018206
1095 Ga0209758_1023053
1096 Ga0207656_10000907
1097 Ga0207692_10036344
1098 Ga0207680_10000013
1099 Ga0207680_10072556
1100 Ga0207647_10000029
1101 Ga0207647_10001225
1102 Ga0207647_10037439
1103 Ga0207699_10152455
1104 Ga0207705_10002035
1105 Ga0207705_10005361
1106 Ga0207705_10006840
1107 Ga0207654_10000423
1108 Ga0207707_10000380
1109 Ga0207707_10014646
1110 Ga0207707_10017519
1111 Ga0207707_10032583
1112 Ga0207707_10038162
1113 Ga0207695_10001325
1114 Ga0207695_10001580
1115 Ga0207695_10005282
1116 Ga0207695_10005709
1117 Ga0207695_10007938
1118 Ga0207695_10019900
1119 Ga0207695_10036678
1120 Ga0207695_10104456
1121 Ga0207671_10000031
1122 Ga0207671_10001506
1123 Ga0207671_10018608
1124 Ga0207671_10215670
1125 Ga0207671_10385931
1126 Ga0207693_10282053
1127 Ga0207660_10111100
1128 Ga0207657_10008885
1129 Ga0207649_10006996
1130 Ga0207649_10017262
1131 Ga0207649_10047431
1132 Ga0207649_10050424
1133 Ga0207649_10059528
1134 Ga0207652_10005420
1135 Ga0207652_10098739
1136 Ga0207694_10002048
1137 Ga0207694_10002295
1138 Ga0207694_10006873
1139 Ga0207694_10057567
1140 Ga0207650_10606128
1141 Ga0207700_10000795
1142 Ga0207664_10000239
1143 Ga0207664_10095942
1144 Ga0207690_10000586
1145 Ga0207690_10000992
1146 Ga0207690_10034557
1147 Ga0207690_10064484
1148 Ga0207690_10082299
1149 Ga0207706_10052307
1150 Ga0207686_10003899
1151 Ga0207670_10003200
1152 Ga0207669_10505496
1153 Ga0207704_10000937
1154 Ga0207691_10002689
1155 Ga0207711_10037344
1156 Ga0207689_10016448
1157 Ga0207667_10001044
1158 Ga0207667_10001074
1159 Ga0207667_10002386
1160 Ga0207667_10005225
1161 Ga0207667_10007269
1162 Ga0207667_10007692
1163 Ga0207667_10273056
1164 Ga0207712_10000843
1165 Ga0207640_10000485
1166 Ga0207640_10002635
1167 Ga0207640_10019244
1168 Ga0207640_10298746
1169 Ga0207658_10000028
1170 Ga0207658_10080038
1171 Ga0207639_10000315
1172 Ga0207639_10003518
1173 Ga0207639_10007989
1174 Ga0207639_10089944
1175 Ga0207639_10170293
1176 Ga0207639_10245351
1177 Ga0207678_10000112
1178 Ga0207678_10004531
1179 Ga0207678_10024343
1180 Ga0207678_10055903
1181 Ga0207678_10141476
1182 Ga0207702_10001547
1183 Ga0207702_10006560
1184 Ga0207641_10229369
1185 Ga0207648_10156589
1186 Ga0207674_10000685
1187 Ga0207674_10050096
1188 Ga0207674_10176265
1189 Ga0207675_100141217
1190 Ga0207698_10012151
1191 Ga0207698_10015607
1192 Ga0207698_10071842
1193 Ga0268266_10000001
1194 Ga0268266_10000021
1195 Ga0268266_10280941
1196 Ga0268265_10000131
1197 Ga0268264_10003643
1198 Ga0268264_10484936
1199 Ga0268264_10548486
1200 Ga0307508_10014069
1201 Ga0316575_10001810
1202 Ga0316575_10020315
1203 Ga0316575_10120670
1204 Ga0316579_10000114
1205 Ga0316576_10124892
1206 Ga0316576_10195644
1207 Ga0307516_10062132
1208 Ga0316577_10038005
1209 Ga0316577_10047768
1210 Ga0307412_10000917
1211 Ga0307409_100197930
1212 Ga0316585_10003820
1213 Ga0316580_10007241
1214 Ga0316580_10011121
1215 Ga0316593_10002104
1216 Ga0316593_10002604
1217 Ga0307507_10015315
1218 Ga0307510_10000977
1219 Ga0307510_10159835
1220 Ga0316596_1001142
1221 Ga0316596_1001867
1222 Ga0316574_0000172
1223 Ga0373937_0306011
1224 Ga0316582_0010909
1225 Ga0316584_0044035
1226 Ga0395899_0000175
1227 Ga0395899_0007904
1228 Ga0395899_0030704
1229 Ga0395899_0090203
1230 Ga0395899_0156999
1231 Ga0395900_0000012
1232 Ga0395900_0000059
1233 Ga0395900_0004207
1234 Ga0395900_0004359
1235 Ga0395900_0030705
1236 Ga0395898_0000034
1237 Ga0395898_0001311
1238 Ga0395898_0006426
1239 Ga0395898_0008278
1240 Ga0395898_0074040
1241 Ga0395898_0367324
1242 Ga0395901_0000816
1243 Ga0395901_0006163
1244 Ga0395901_0009331
1245 Ga0395901_0010234
1246 Ga0395901_0050339
1247 Ga0395901_0185453
1248 Ga0395901_0329463
1249 Ga0395901_0432333
1250 Ga0439436_0000067
1251 Ga0439465_0001040
1252 Ga0451793_0739495
1253 Ga0451797_0261258
1254 Ga0451807_0171222
1255 Ga0451807_0309039
1256 Ga0451833_0446148
1257 Ga0451853_0953777
1258 Ga0451853_1433675
1259 Ga0439437_001633
1260 Ga0450908_001144
1261 Ga0439459_0000055
1262 Ga0451577_0204182
1263 Ga0466969_0011574
1264 Ga0466969_0020653
1265 Ga0466972_0005739
1266 Ga0466972_0047788
1267 Ga0466975_0180042
1268 Ga0466989_0018571
1269 Ga0466982_0000013
1270 Ga0466965_0002807
1271 Ga0466965_0117981
1272 Ga0466966_0004686
1273 Ga0466966_0014630
1274 Ga0466966_0020702
1275 Ga0466961_0000967
1276 Ga0466961_0013541
1277 Ga0466961_0017074
1278 Ga0466961_0028265
1279 Ga0466963_0174554
1280 Ga0466971_0022747
1281 Ga0466971_0027748
1282 Ga0466968_0002450
1283 Ga0466968_0013890
1284 Ga0466970_0010342
1285 Ga0466957_0047688
1286 Ga0466957_0128323
1287 Ga0466960_0005543
1288 Ga0466959_0000068
1289 Ga0466959_0020265
1290 Ga0466959_0062198
1291 Ga0466958_0049101
1292 Ga0466958_0101272
1293 Ga0466967_0261737
1294 Ga0495617_000117
1295 Ga0495638_0000007
1296 Ga0495638_0000899
1297 Ga0495638_0001952
1298 Ga0495638_0001995
1299 Ga0495638_0018140
1300 Ga0495650_0000497
1301 Ga0495650_0000585
1302 Ga0495650_0003111
1303 Ga0495582_0055392
1304 Ga0495584_0003980
1305 Ga0495585_0008658
1306 Ga0495585_0013229
1307 Ga0495607_0000088
1308 Ga0495607_0000122
1309 Ga0495606_0000298
1310 Ga0495606_0001210
1311 Ga0495606_0004779
1312 Ga0495606_0078069
1313 Ga0495606_0089144
1314 Ga0495610_0004565
1315 Ga0495610_0015527
1316 Ga0495616_0000565
1317 Ga0495620_0005019
1318 Ga0495631_0001445
1319 Ga0495631_0003807
1320 Ga0495632_0000004
1321 Ga0495632_0038310
1322 Ga0495632_0052398
1323 Ga0495632_0113406
1324 Ga0495632_0176962
1325 Ga0495648_0005079
1326 Ga0495648_0009504
1327 Ga0495665_0085971
1328 Ga0495586_0117970
1329 Ga0495609_0003579
1330 Ga0495597_0104277
1331 Ga0495622_0012969
1332 Ga0495668_0012112
1333 Ga0495611_0000001
1334 Ga0495611_0000060
1335 Ga0495625_0000022
1336 Ga0495625_0016189
1337 Ga0495625_0022701
1338 Ga0495625_0097090
1339 Ga0495661_0003615
1340 Ga0495670_0007331
1341 Ga0495671_0004741
1342 Ga0495649_0013114
1343 Ga0495589_0000137
1344 Ga0495660_0000728
1345 Ga0495660_0003021
1346 Ga0495672_0081196
1347 Ga0495683_0006531
1348 Ga0495679_000004
1349 Ga0495673_0000202
1350 Ga0495673_0000749
1351 Ga0495681_0070594
1352 Ga0495686_0000017
1353 Ga0495686_0001035
1354 Ga0495686_0002896
1355 Ga0495686_0024798
1356 Ga0495626_0153914
1357 Ga0496100_0001258
1358 Ga0496101_0000491
1359 Ga0496102_0032706
1360 Ga0496102_0083022
1361 Ga0496102_0228311
1362 Ga0496103_0032821
1363 Ga0496104_0000016
1364 Ga0496104_0669353
1365 Ga0496105_0000010
1366 Ga0496105_0000871
1367 Ga0496106_0005789
1368 Ga0496115_0000025
1369 Ga0496115_0013784
1370 Ga0496115_0029462
1371 Ga0496115_0037030
1372 Ga0496115_0251320
1373 Ga0496116_0079482
1374 Ga0496117_0004951
1375 Ga0496117_0011610
1376 Ga0496118_0000429
1377 Ga0496118_0002079
1378 Ga0496118_0002476
1379 Ga0496118_0006655
1380 Ga0496118_0015454
1381 Ga0496118_0034247
1382 Ga0496118_0053587
1383 Ga0496118_0060887
1384 Ga0496118_0242450
1385 Ga0496119_0000058
1386 Ga0496119_0039545
1387 Ga0496120_0001252
1388 Ga0496120_0001892
1389 Ga0496121_0000045
1390 Ga0496121_0000401
1391 Ga0496121_0002752
1392 Ga0496121_0009537
1393 Ga0496121_0028054
1394 Ga0496121_0034962
1395 Ga0496121_0037826
1396 Ga0496121_0046023
1397 Ga0496121_0115688
1398 Ga0496121_0117684
1399 Ga0496121_0179141
1400 Ga0496122_0000759
1401 Ga0496122_0017227
1402 Ga0496122_0067213
1403 Ga0496123_0001142
1404 Ga0496123_0003690
1405 Ga0496123_0016381
1406 Ga0496123_0030669
1407 Ga0496124_0028363
1408 Ga0496124_0057811
1409 Ga0496125_0000137
1410 Ga0496125_0018170
1411 Ga0496126_0001102
1412 Ga0496126_0047577
1413 Ga0496126_0069008
1414 Ga0496126_0121900
1415 Ga0496126_0242597
1416 Ga0496126_0349516
1417 Ga0495678_000099
1418 Ga0495678_041137
1419 Ga0495682_0032976
1420 Ga0501031_0005632
1421 Ga0501032_0001939
1422 Ga0501032_0014972
1423 Ga0501033_0005614
1424 Ga0501033_0007452
1425 Ga0501033_0025649
1426 Ga0501033_0079699
1427 Ga0501034_0000605
1428 Ga0501034_0003067
1429 Ga0501034_0004478
1430 Ga0501034_0017499
1431 Ga0501034_0021485
1432 Ga0501036_0015834
1433 Ga0501036_0056431
1434 Ga0501036_0523104
1435 Ga0501037_0001394
1436 Ga0501037_0015899
1437 Ga0501037_0039752
1438 Ga0501037_0362493
1439 Ga0501038_0000141
1440 Ga0501038_0009677
1441 Ga0501038_0069413
1442 Ga0501038_0103298
1443 Ga0501039_0010357
1444 Ga0501039_0087333
1445 Ga0501042_0104785
1446 Ga0501043_0000840
1447 Ga0501043_0005095
1448 Ga0501043_0013050
1449 Ga0501043_0025582
1450 Ga0501043_0071548
1451 Ga0501043_0138949
1452 Ga0501043_0436075
1453 Ga0501046_0012566
1454 Ga0501046_0014090
1455 Ga0501046_0115571
1456 Ga0501046_0116612
1457 Ga0501046_0141965
1458 Ga0501047_0002983
1459 Ga0501047_0004063
1460 Ga0501047_0008730
1461 Ga0501047_0010205
1462 Ga0501047_0011872
1463 Ga0501047_0025393
1464 Ga0501047_0085696
1465 Ga0501047_0251583
1466 Ga0501047_0292364
1467 Ga0501047_0300140
1468 Ga0501047_0364304
1469 Ga0501048_0025027
1470 Ga0501048_0075485
1471 Ga0501067_0003110
1472 Ga0501068_0001426
1473 Ga0501068_0129083
1474 Ga0501069_0003434
1475 Ga0501069_0035758
1476 Ga0501069_0152380
1477 Ga0501070_0003984
1478 Ga0501070_0005506
1479 Ga0501070_0013239
1480 Ga0501070_0016391
1481 Ga0501070_0042286
1482 Ga0501070_0080309
1483 Ga0501071_0026570
1484 Ga0501072_0007222
1485 Ga0501072_0087685
1486 Ga0501073_0000072
1487 Ga0501073_0012859
1488 Ga0501073_0014820
1489 Ga0501073_0022162
1490 Ga0501073_0074253
1491 Ga0501073_0086040
1492 Ga0501074_0002293
1493 Ga0501074_0011165
1494 Ga0501074_0017385
1495 Ga0501074_0019544
1496 Ga0501074_0029972
1497 Ga0501079_0039248
1498 Ga0501079_0044763
1499 Ga0501079_0254786
1500 Ga0501080_0000097
1501 Ga0501080_0000554
1502 Ga0501080_0003092
1503 Ga0501080_0012182
1504 Ga0501080_0027360
1505 Ga0501080_0105298
1506 Ga0501080_0121722
1507 Ga0501083_0000128
1508 Ga0501083_0305659
1509 Ga0501035_0001437
1510 Ga0501035_0003810
1511 Ga0501035_0021748
1512 Ga0501035_0035960
1513 Ga0501035_0043309
1514 Ga0501035_0050847
1515 Ga0501035_0074266
1516 Ga0501035_0174472
1517 Ga0501035_0198430
1518 Ga0501044_0003555
1519 Ga0501044_0003906
1520 Ga0501044_0005029
1521 Ga0501044_0012166
1522 Ga0501044_0013452
1523 Ga0501044_0015582
1524 Ga0501044_0038033
1525 Ga0501044_0044762
1526 Ga0501044_0084014
1527 Ga0501044_0203046
1528 Ga0501044_0319870
1529 nmdc:mga0sz30_64337_c1
1530 Ga0500610_0003839
1531 Ga0500643_000118
1532 Ga0500643_003789
1533 Ga0500651_0000245
1534 Ga0500651_0042127
1535 Ga0500555_001900
1536 Ga0500597_000179
1537 Ga0500633_0003671
1538 Ga0500645_001641
1539 Ga0501082_0057705
1540 Ga0466962_0003530
1541 Ga0466962_0007751
1542 2525555823
1543 2538833033
1544 2595446722
1545 2595451777
1546 2630650837
1547 2643830895
1548 2643894163
1549 2644476365
1550 2721026632
1551 2735833375
1552 2739229372
1553 2739731932
1554 2819563813
1555 2842917886
1556 2842919754
1557 2884341368
1558 2884413337
1559 2895396919
1560 2904463876
1561 2919087608
1562 2919404858
1563 2928964630
1564 2939614278
1565 2941472826
1566 2953995055

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02548

Pantoate_transf

Ketopantoate hydroxymethyltransferase

33

291

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vav-assembly1.cif.gz_J crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia thailandensis 0.9526 29 260
1o68-assembly1.cif.gz_B crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase 0.9502 30 260
1m3u-assembly1.cif.gz_I crystal structure of ketopantoate hydroxymethyltransferase complexed the product ketopantoate 0.9463 31 261
3vav-assembly1.cif.gz_A crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia thailandensis 0.9423 29 260
3vav-assembly1.cif.gz_B crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia thailandensis 0.9409 29 260
ID Description Score Start End Superfamily
3vavB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9409 29 260 3.20.20.60
af_A0A1D6NS82_272_361_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8612 120 175 3.20.20.70
3vavB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8389 29 260 3.20.20.60
af_Q9AWZ7_81_360_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8238 30 258 3.20.20.60
af_A0A0R0J726_27_197_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8209 30 161 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A7C5N9A7-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) 0.9675 120 260 GO:0000287
GO:0003864
GO:0005737
GO:0015940
AF-A0A831RG02-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) 0.9673 135 261 GO:0000287
GO:0003864
GO:0005737
GO:0015940
AF-A0A1A9UKG6-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) 0.9635 120 261 GO:0003864
GO:0008168
GO:0015940
AF-A0A3B9L557-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) 0.9619 120 260 GO:0000287
GO:0003864
GO:0005737
GO:0008168
GO:0015940
GO:0032259
AF-A0A2E8GWJ6-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) (Ketopantoate hydroxymethyltransferase) (KPHMT) 0.9613 32 260 GO:0000287
GO:0003864
GO:0005737
GO:0008168
GO:0015940
GO:0032259

Map