F480668
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 783 | 322 | 1566 | 266 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0021621|Ga0395899_0021621_1684_2574 |
| Length | 296 |
| Sequence | LAFEACGPDNRLLAHPRGTAVYVDNASVPARKPVTVPGLRAMKAQGRKIVMLTAYDASFAWQLEAAGVDVALVGDSLGMVVQGHRSTLPVTLDDMAYHTRAVARGLTSTLLIADLPFMADRDVAHSLEAAARLVGEAGAAAVKIEGAAPHILDAIATLSARAVPVCAHLGLTPQSVHKFGGFRIQGREQEAADRVLSEALAVQSAGADLLVLEGVPSALGDRITRAVQIPVIGIGAGPHCDGQVLVIYDMLGITPGKRPKFSKDFLAGRNAVGEAIAAFAEDVRSGAFPAPEHCFD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 15 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 88 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 89 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 91 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 96 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 106 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 107 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 110 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 158 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 159 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 160 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 161 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 162 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 163 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 165 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 166 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 167 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 169 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 170 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 172 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 174 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 175 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 176 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 177 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 178 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 179 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 180 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 184 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 185 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 186 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 187 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 188 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 189 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 190 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 191 | 3300044661 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E | Metagenome | Unclassified |
| 192 | 3300044663 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR | Metagenome | Unclassified |
| 193 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 194 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 195 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 196 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 197 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 198 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 199 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 200 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 201 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 202 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 203 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 204 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 205 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 206 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 244 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 245 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 246 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 247 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 248 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 249 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 250 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 251 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 252 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 253 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 254 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 255 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 256 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 257 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 258 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 259 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 260 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 289 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 290 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 291 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 292 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 293 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 294 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 295 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 296 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 298 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 299 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 300 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 301 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 302 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 303 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 304 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 305 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 306 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 307 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 308 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 309 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 310 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 311 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 312 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 313 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 314 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 315 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 316 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 317 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 318 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 319 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 320 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 321 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 322 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.27 |
| Metatranscriptomes | 1.53 |
| Isolates | 3.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.41 |
| Nodule | 0 |
| Rhizoplane | 2.55 |
| Rhizosphere | 71.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395899_0021621 | 3300037312 | Bacteria | 4879 |
| 2 | JGI24740J21852_10005728 | 3300001979 | Bacteria | 5226 |
| 3 | JGI24739J22299_10001151 | 3300001989 | Bacteria | 9883 |
| 4 | JGI24739J22299_10012267 | 3300001989 | Bacteria | 3147 |
| 5 | JGI24737J22298_10015018 | 3300001990 | Bacteria | 2508 |
| 6 | JGI24738J21930_10000954 | 3300002075 | Bacteria | 8293 |
| 7 | JGI25156J39149_1004146 | 3300002705 | Bacteria | 4497 |
| 8 | JGI25156J39149_1010840 | 3300002705 | Bacteria | 2109 |
| 9 | JGI25162J39368_1000226 | 3300002737 | Bacteria | 57732 |
| 10 | JGI25162J39368_1000311 | 3300002737 | Bacteria | 43163 |
| 11 | JGI25162J39368_1000790 | 3300002737 | Bacteria | 21152 |
| 12 | JGI25162J39368_1001503 | 3300002737 | Bacteria | 12152 |
| 13 | JGI25162J39368_1004324 | 3300002737 | Bacteria | 3368 |
| 14 | JGI25157J39369_1000345 | 3300002741 | Bacteria | 32775 |
| 15 | JGI25157J39369_1000541 | 3300002741 | Bacteria | 22715 |
| 16 | JGI25157J39369_1001083 | 3300002741 | Bacteria | 12255 |
| 17 | JGI25157J39369_1002119 | 3300002741 | Bacteria | 5579 |
| 18 | JGI25157J39369_1002687 | 3300002741 | Bacteria | 4140 |
| 19 | JGI25163J39215_1000171 | 3300002771 | Bacteria | 25502 |
| 20 | JGI25164J39214_1000035 | 3300002772 | Bacteria | 139987 |
| 21 | JGI25164J39214_1000214 | 3300002772 | Bacteria | 47762 |
| 22 | JGI25164J39214_1000742 | 3300002772 | Bacteria | 12152 |
| 23 | JGI25164J39214_1000752 | 3300002772 | Bacteria | 12009 |
| 24 | JGI25165J46597_1000226 | 3300003214 | Bacteria | 78481 |
| 25 | JGI25165J46597_1000260 | 3300003214 | Bacteria | 70453 |
| 26 | JGI25165J46597_1001473 | 3300003214 | Bacteria | 12149 |
| 27 | JGI25165J46597_1003296 | 3300003214 | Bacteria | 4142 |
| 28 | rootH1_10016990 | 3300003316 | Bacteria | 2562 |
| 29 | rootH2_10004402 | 3300003320 | Bacteria | 19303 |
| 30 | Ga0006562J51391_1022736 | 3300003578 | Bacteria | 5703 |
| 31 | Ga0006562J51391_1022737 | 3300003578 | Bacteria | 3470 |
| 32 | Ga0006562J51391_1106400 | 3300003578 | Bacteria | 3790 |
| 33 | Ga0006562J51391_1106401 | 3300003578 | Bacteria | 3620 |
| 34 | Ga0055538_1002052 | 3300003751 | Bacteria | 3245 |
| 35 | Ga0055539_1003463 | 3300003752 | Bacteria | 2206 |
| 36 | Ga0055533_1002036 | 3300003756 | Bacteria | 4902 |
| 37 | Ga0055525_1000452 | 3300003759 | Bacteria | 23636 |
| 38 | Ga0055527_1000082 | 3300003760 | Bacteria | 75048 |
| 39 | Ga0055527_1000907 | 3300003760 | Bacteria | 7517 |
| 40 | Ga0055535_1000143 | 3300003761 | Bacteria | 75049 |
| 41 | Ga0055535_1000323 | 3300003761 | Bacteria | 48370 |
| 42 | Ga0055535_1000593 | 3300003761 | Bacteria | 29891 |
| 43 | Ga0055535_1002180 | 3300003761 | Bacteria | 7513 |
| 44 | Ga0055535_1002438 | 3300003761 | Bacteria | 6511 |
| 45 | Ga0055542_1000067 | 3300003762 | Bacteria | 154585 |
| 46 | Ga0055542_1000190 | 3300003762 | Bacteria | 75049 |
| 47 | Ga0055542_1000275 | 3300003762 | Bacteria | 57732 |
| 48 | Ga0055542_1000622 | 3300003762 | Bacteria | 29891 |
| 49 | Ga0055542_1002065 | 3300003762 | Bacteria | 7517 |
| 50 | Ga0055542_1002332 | 3300003762 | Bacteria | 6511 |
| 51 | Ga0055529_1000217 | 3300003763 | Bacteria | 75049 |
| 52 | Ga0055529_1000233 | 3300003763 | Bacteria | 70453 |
| 53 | Ga0055529_1000367 | 3300003763 | Bacteria | 48920 |
| 54 | Ga0055529_1001133 | 3300003763 | Bacteria | 11354 |
| 55 | Ga0055543_1020812 | 3300004625 | Bacteria | 1201 |
| 56 | Ga0065165_1000028 | 3300005262 | Bacteria | 224430 |
| 57 | Ga0065165_1001244 | 3300005262 | Bacteria | 29035 |
| 58 | Ga0070658_10001605 | 3300005327 | Bacteria | 19114 |
| 59 | Ga0070683_100168976 | 3300005329 | Bacteria | 2075 |
| 60 | Ga0068869_100004548 | 3300005334 | Bacteria | 8636 |
| 61 | Ga0070666_10000012 | 3300005335 | Bacteria | 244720 |
| 62 | Ga0070666_10168093 | 3300005335 | Bacteria | 1535 |
| 63 | Ga0070680_100295793 | 3300005336 | Bacteria | 1372 |
| 64 | Ga0070680_100332401 | 3300005336 | Bacteria | 1291 |
| 65 | Ga0070682_100001599 | 3300005337 | Bacteria | 12628 |
| 66 | Ga0070682_100005594 | 3300005337 | Bacteria | 7003 |
| 67 | Ga0070660_100016387 | 3300005339 | Bacteria | 5378 |
| 68 | Ga0070689_100010606 | 3300005340 | Bacteria | 6570 |
| 69 | Ga0070691_10040331 | 3300005341 | Bacteria | 2206 |
| 70 | Ga0070661_100042502 | 3300005344 | Bacteria | 3318 |
| 71 | Ga0070661_100050352 | 3300005344 | Bacteria | 3047 |
| 72 | Ga0070661_100050468 | 3300005344 | Bacteria | 3044 |
| 73 | Ga0070661_100072708 | 3300005344 | Bacteria | 2531 |
| 74 | Ga0070692_10045384 | 3300005345 | Bacteria | 2266 |
| 75 | Ga0070692_10153602 | 3300005345 | Bacteria | 1313 |
| 76 | Ga0070668_100103313 | 3300005347 | Bacteria | 2261 |
| 77 | Ga0070659_100043525 | 3300005366 | Bacteria | 3511 |
| 78 | Ga0070659_100118427 | 3300005366 | Bacteria | 2142 |
| 79 | Ga0070667_100000041 | 3300005367 | Bacteria | 170008 |
| 80 | Ga0070667_100013273 | 3300005367 | Bacteria | 6805 |
| 81 | Ga0070667_100122410 | 3300005367 | Bacteria | 2264 |
| 82 | Ga0070667_100485351 | 3300005367 | Bacteria | 1131 |
| 83 | Ga0070714_100000650 | 3300005435 | Bacteria | 24670 |
| 84 | Ga0070713_100000697 | 3300005436 | Bacteria | 21613 |
| 85 | Ga0070663_100000080 | 3300005455 | Bacteria | 42856 |
| 86 | Ga0070663_100043617 | 3300005455 | Bacteria | 3157 |
| 87 | Ga0070681_10000422 | 3300005458 | Bacteria | 34427 |
| 88 | Ga0070681_10004784 | 3300005458 | Bacteria | 12975 |
| 89 | Ga0070685_10007572 | 3300005466 | Bacteria | 5557 |
| 90 | Ga0070685_10115922 | 3300005466 | Bacteria | 1657 |
| 91 | Ga0070679_100008773 | 3300005530 | Bacteria | 9536 |
| 92 | Ga0070679_100033998 | 3300005530 | Bacteria | 5050 |
| 93 | Ga0070679_100035082 | 3300005530 | Bacteria | 4975 |
| 94 | Ga0070679_100136895 | 3300005530 | Bacteria | 2430 |
| 95 | Ga0070679_100269264 | 3300005530 | Bacteria | 1658 |
| 96 | Ga0068853_100006935 | 3300005539 | Bacteria | 9045 |
| 97 | Ga0068853_100013978 | 3300005539 | Bacteria | 6566 |
| 98 | Ga0068853_100036801 | 3300005539 | Bacteria | 4162 |
| 99 | Ga0068853_100059765 | 3300005539 | Bacteria | 3293 |
| 100 | Ga0068853_100165200 | 3300005539 | Bacteria | 2000 |
| 101 | Ga0068853_100174863 | 3300005539 | Bacteria | 1944 |
| 102 | Ga0068853_100286720 | 3300005539 | Bacteria | 1519 |
| 103 | Ga0070672_100000967 | 3300005543 | Bacteria | 17369 |
| 104 | Ga0070696_100006770 | 3300005546 | Bacteria | 7651 |
| 105 | Ga0070693_100002525 | 3300005547 | Bacteria | 8435 |
| 106 | Ga0070665_100000062 | 3300005548 | Bacteria | 220304 |
| 107 | Ga0070665_100011046 | 3300005548 | Bacteria | 9126 |
| 108 | Ga0070665_100012001 | 3300005548 | Bacteria | 8741 |
| 109 | Ga0070665_100015833 | 3300005548 | Bacteria | 7571 |
| 110 | Ga0068855_100000186 | 3300005563 | Bacteria | 79655 |
| 111 | Ga0068855_100003219 | 3300005563 | Bacteria | 19978 |
| 112 | Ga0068855_100035273 | 3300005563 | Bacteria | 5958 |
| 113 | Ga0068855_100055852 | 3300005563 | Bacteria | 4635 |
| 114 | Ga0068855_100068209 | 3300005563 | Bacteria | 4141 |
| 115 | Ga0068855_100151751 | 3300005563 | Bacteria | 2634 |
| 116 | Ga0068855_100434603 | 3300005563 | Bacteria | 1434 |
| 117 | Ga0068857_100002448 | 3300005577 | Bacteria | 15165 |
| 118 | Ga0068857_100012794 | 3300005577 | Bacteria | 7313 |
| 119 | Ga0068857_100024073 | 3300005577 | Bacteria | 5360 |
| 120 | Ga0068857_100309750 | 3300005577 | Bacteria | 1456 |
| 121 | Ga0068854_100000486 | 3300005578 | Bacteria | 24257 |
| 122 | Ga0068854_100010548 | 3300005578 | Bacteria | 5994 |
| 123 | Ga0068854_100040225 | 3300005578 | Bacteria | 3298 |
| 124 | Ga0068854_100307736 | 3300005578 | Bacteria | 1284 |
| 125 | Ga0068856_100002830 | 3300005614 | Bacteria | 17768 |
| 126 | Ga0068856_100011894 | 3300005614 | Bacteria | 8427 |
| 127 | Ga0068856_100137208 | 3300005614 | Bacteria | 2452 |
| 128 | Ga0068856_100259666 | 3300005614 | Bacteria | 1752 |
| 129 | Ga0068852_100024421 | 3300005616 | Bacteria | 4884 |
| 130 | Ga0068852_100095568 | 3300005616 | Bacteria | 2669 |
| 131 | Ga0068852_100109245 | 3300005616 | Bacteria | 2511 |
| 132 | Ga0068852_100309565 | 3300005616 | Bacteria | 1531 |
| 133 | Ga0068852_100371509 | 3300005616 | Bacteria | 1401 |
| 134 | Ga0068859_100000704 | 3300005617 | Bacteria | 33583 |
| 135 | Ga0068861_100071323 | 3300005719 | Bacteria | 2693 |
| 136 | Ga0068851_10001144 | 3300005834 | Bacteria | 11493 |
| 137 | Ga0068851_10022152 | 3300005834 | Bacteria | 3092 |
| 138 | Ga0068858_100399759 | 3300005842 | Bacteria | 1320 |
| 139 | Ga0068860_100250787 | 3300005843 | Bacteria | 1724 |
| 140 | Ga0068860_100386975 | 3300005843 | Bacteria | 1381 |
| 141 | Ga0068862_100001686 | 3300005844 | Bacteria | 20019 |
| 142 | Ga0075369_10034813 | 3300006186 | Bacteria | 2138 |
| 143 | Ga0075369_10043586 | 3300006186 | Bacteria | 1926 |
| 144 | Ga0097621_100034797 | 3300006237 | Bacteria | 4021 |
| 145 | Ga0097621_100499297 | 3300006237 | Bacteria | 1102 |
| 146 | Ga0068865_100001033 | 3300006881 | Bacteria | 16026 |
| 147 | Ga0097620_100000704 | 3300006931 | Bacteria | 33583 |
| 148 | Ga0105240_10003480 | 3300009093 | Bacteria | 24428 |
| 149 | Ga0105240_10005037 | 3300009093 | Bacteria | 19823 |
| 150 | Ga0105240_10014526 | 3300009093 | Bacteria | 10749 |
| 151 | Ga0105240_10018376 | 3300009093 | Bacteria | 9389 |
| 152 | Ga0105240_10112732 | 3300009093 | Bacteria | 3287 |
| 153 | Ga0105240_10280220 | 3300009093 | Bacteria | 1915 |
| 154 | Ga0105247_10018982 | 3300009101 | Bacteria | 4130 |
| 155 | Ga0105241_10041060 | 3300009174 | Bacteria | 3494 |
| 156 | Ga0105241_10178303 | 3300009174 | Bacteria | 1760 |
| 157 | Ga0105241_10560220 | 3300009174 | Bacteria | 1027 |
| 158 | Ga0105242_10002687 | 3300009176 | Bacteria | 13910 |
| 159 | Ga0105248_10010085 | 3300009177 | Bacteria | 10402 |
| 160 | Ga0105248_10125934 | 3300009177 | Bacteria | 2890 |
| 161 | Ga0105237_10000152 | 3300009545 | Bacteria | 96802 |
| 162 | Ga0105237_10054848 | 3300009545 | Bacteria | 3993 |
| 163 | Ga0105237_10055379 | 3300009545 | Bacteria | 3972 |
| 164 | Ga0105237_10059438 | 3300009545 | Bacteria | 3824 |
| 165 | Ga0105237_10101582 | 3300009545 | Bacteria | 2868 |
| 166 | Ga0105238_10000540 | 3300009551 | Bacteria | 39588 |
| 167 | Ga0105238_10014166 | 3300009551 | Bacteria | 8064 |
| 168 | Ga0105238_10051996 | 3300009551 | Bacteria | 4119 |
| 169 | Ga0105238_10062921 | 3300009551 | Bacteria | 3711 |
| 170 | Ga0105238_10106626 | 3300009551 | Bacteria | 2783 |
| 171 | Ga0105238_10113358 | 3300009551 | Bacteria | 2691 |
| 172 | Ga0105238_10150423 | 3300009551 | Bacteria | 2303 |
| 173 | Ga0105249_10000397 | 3300009553 | Bacteria | 41963 |
| 174 | Ga0105239_10000020 | 3300010375 | Bacteria | 264435 |
| 175 | Ga0105239_10002067 | 3300010375 | Bacteria | 26031 |
| 176 | Ga0105239_10018443 | 3300010375 | Bacteria | 7707 |
| 177 | Ga0105239_10021926 | 3300010375 | Bacteria | 7041 |
| 178 | Ga0105239_10065757 | 3300010375 | Bacteria | 3983 |
| 179 | Ga0105239_10074051 | 3300010375 | Bacteria | 3744 |
| 180 | Ga0105239_10092121 | 3300010375 | Bacteria | 3345 |
| 181 | Ga0105239_10160733 | 3300010375 | Bacteria | 2509 |
| 182 | Ga0105239_10207563 | 3300010375 | Bacteria | 2195 |
| 183 | Ga0157314_1000632 | 3300012500 | Bacteria | 3166 |
| 184 | Ga0157373_10004922 | 3300013100 | Bacteria | 10056 |
| 185 | Ga0157373_10014435 | 3300013100 | Bacteria | 5791 |
| 186 | Ga0157373_10083316 | 3300013100 | Bacteria | 2254 |
| 187 | Ga0157371_10004575 | 3300013102 | Bacteria | 12028 |
| 188 | Ga0157371_10009024 | 3300013102 | Bacteria | 7882 |
| 189 | Ga0157371_10108571 | 3300013102 | Bacteria | 1969 |
| 190 | Ga0157370_10002917 | 3300013104 | Bacteria | 20365 |
| 191 | Ga0157370_10006899 | 3300013104 | Bacteria | 12425 |
| 192 | Ga0157370_10019459 | 3300013104 | Bacteria | 6809 |
| 193 | Ga0157370_10029301 | 3300013104 | Bacteria | 5405 |
| 194 | Ga0157370_10186698 | 3300013104 | Bacteria | 1924 |
| 195 | Ga0157370_10191511 | 3300013104 | Bacteria | 1898 |
| 196 | Ga0157370_10387572 | 3300013104 | Bacteria | 1287 |
| 197 | Ga0157369_10000025 | 3300013105 | Bacteria | 225515 |
| 198 | Ga0157369_10010299 | 3300013105 | Bacteria | 10664 |
| 199 | Ga0157369_10015839 | 3300013105 | Bacteria | 8493 |
| 200 | Ga0157369_10035517 | 3300013105 | Bacteria | 5464 |
| 201 | Ga0157369_10218828 | 3300013105 | Bacteria | 1994 |
| 202 | Ga0157369_10322123 | 3300013105 | Bacteria | 1607 |
| 203 | Ga0157374_10099188 | 3300013296 | Bacteria | 2790 |
| 204 | Ga0157378_10000130 | 3300013297 | Bacteria | 72949 |
| 205 | Ga0157378_10607040 | 3300013297 | Bacteria | 1106 |
| 206 | Ga0163162_10000015 | 3300013306 | Bacteria | 261996 |
| 207 | Ga0163162_10006135 | 3300013306 | Bacteria | 11637 |
| 208 | Ga0163162_10006951 | 3300013306 | Bacteria | 10972 |
| 209 | Ga0163162_10164229 | 3300013306 | Bacteria | 2344 |
| 210 | Ga0157372_10004575 | 3300013307 | Bacteria | 14715 |
| 211 | Ga0157372_10007258 | 3300013307 | Bacteria | 11800 |
| 212 | Ga0157372_10007377 | 3300013307 | Bacteria | 11699 |
| 213 | Ga0157372_10050828 | 3300013307 | Bacteria | 4611 |
| 214 | Ga0157372_10062380 | 3300013307 | Bacteria | 4176 |
| 215 | Ga0157372_10076003 | 3300013307 | Bacteria | 3791 |
| 216 | Ga0157372_10906394 | 3300013307 | Bacteria | 1023 |
| 217 | Ga0157375_10001402 | 3300013308 | Bacteria | 20789 |
| 218 | Ga0157375_10004646 | 3300013308 | Bacteria | 11935 |
| 219 | Ga0157375_10093170 | 3300013308 | Bacteria | 3078 |
| 220 | Ga0163163_10000143 | 3300014325 | Bacteria | 74622 |
| 221 | Ga0182008_10000899 | 3300014497 | Bacteria | 20662 |
| 222 | Ga0182008_10018678 | 3300014497 | Bacteria | 3588 |
| 223 | Ga0182008_10037194 | 3300014497 | Bacteria | 2435 |
| 224 | Ga0157376_10036909 | 3300014969 | Bacteria | 3962 |
| 225 | Ga0157376_10195451 | 3300014969 | Bacteria | 1858 |
| 226 | Ga0157376_10310487 | 3300014969 | Bacteria | 1496 |
| 227 | Ga0182006_1000072 | 3300015261 | Bacteria | 133681 |
| 228 | Ga0182006_1001852 | 3300015261 | Bacteria | 12129 |
| 229 | Ga0182006_1091044 | 3300015261 | Bacteria | 1098 |
| 230 | Ga0182007_10011710 | 3300015262 | Bacteria | 3405 |
| 231 | Ga0182007_10012397 | 3300015262 | Bacteria | 3279 |
| 232 | Ga0182007_10026592 | 3300015262 | Bacteria | 2003 |
| 233 | Ga0182005_1000080 | 3300015265 | Bacteria | 76011 |
| 234 | Ga0182005_1000551 | 3300015265 | Bacteria | 18847 |
| 235 | Ga0182005_1004616 | 3300015265 | Bacteria | 4417 |
| 236 | Ga0182005_1020416 | 3300015265 | Bacteria | 1823 |
| 237 | Ga0183369_1006 | 3300015685 | Bacteria | 449058 |
| 238 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 239 | Ga0163161_10005653 | 3300017792 | Bacteria | 8670 |
| 240 | Ga0206354_10548849 | 3300020081 | Bacteria | 2935 |
| 241 | Ga0206354_11478949 | 3300020081 | Bacteria | 939 |
| 242 | Ga0206353_10099980 | 3300020082 | Bacteria | 1533 |
| 243 | Ga0206353_11983330 | 3300020082 | Bacteria | 1882 |
| 244 | Ga0209435_104917 | 3300025206 | Bacteria | 1501 |
| 245 | Ga0209435_104988 | 3300025206 | Bacteria | 1490 |
| 246 | Ga0209760_100210 | 3300025207 | Bacteria | 26868 |
| 247 | Ga0209784_100068 | 3300025224 | Bacteria | 152526 |
| 248 | Ga0209566_102599 | 3300025225 | Bacteria | 3216 |
| 249 | Ga0209674_100012 | 3300025226 | Bacteria | 950162 |
| 250 | Ga0209674_100119 | 3300025226 | Bacteria | 135468 |
| 251 | Ga0209674_100514 | 3300025226 | Bacteria | 15759 |
| 252 | Ga0209674_101641 | 3300025226 | Bacteria | 5600 |
| 253 | Ga0209674_102919 | 3300025226 | Bacteria | 3377 |
| 254 | Ga0209672_100007 | 3300025228 | Bacteria | 959482 |
| 255 | Ga0209672_100016 | 3300025228 | Bacteria | 522604 |
| 256 | Ga0209672_100058 | 3300025228 | Bacteria | 211992 |
| 257 | Ga0209672_100357 | 3300025228 | Bacteria | 28997 |
| 258 | Ga0209672_100963 | 3300025228 | Bacteria | 12793 |
| 259 | Ga0209563_100051 | 3300025230 | Bacteria | 340545 |
| 260 | Ga0207427_100033 | 3300025231 | Bacteria | 338459 |
| 261 | Ga0207427_100156 | 3300025231 | Bacteria | 77311 |
| 262 | Ga0207427_100312 | 3300025231 | Bacteria | 33663 |
| 263 | Ga0207427_100334 | 3300025231 | Bacteria | 31251 |
| 264 | Ga0209437_100105 | 3300025233 | Bacteria | 220034 |
| 265 | Ga0209437_100126 | 3300025233 | Bacteria | 192521 |
| 266 | Ga0209437_100139 | 3300025233 | Bacteria | 172506 |
| 267 | Ga0209437_100147 | 3300025233 | Bacteria | 161997 |
| 268 | Ga0209437_100154 | 3300025233 | Bacteria | 153383 |
| 269 | Ga0209437_102097 | 3300025233 | Bacteria | 4040 |
| 270 | Ga0209437_110221 | 3300025233 | Bacteria | 1441 |
| 271 | Ga0209258_100012 | 3300025242 | Bacteria | 825544 |
| 272 | Ga0209258_100046 | 3300025242 | Bacteria | 369794 |
| 273 | Ga0209258_100049 | 3300025242 | Bacteria | 358328 |
| 274 | Ga0209258_100095 | 3300025242 | Bacteria | 223270 |
| 275 | Ga0209258_100245 | 3300025242 | Bacteria | 100255 |
| 276 | Ga0209258_107072 | 3300025242 | Bacteria | 1695 |
| 277 | Ga0209646_1000517 | 3300025246 | Bacteria | 17280 |
| 278 | Ga0209646_1001172 | 3300025246 | Bacteria | 7615 |
| 279 | Ga0209646_1004456 | 3300025246 | Bacteria | 2550 |
| 280 | Ga0209026_1000099 | 3300025250 | Bacteria | 161750 |
| 281 | Ga0209026_1000140 | 3300025250 | Bacteria | 115081 |
| 282 | Ga0209026_1000405 | 3300025250 | Bacteria | 38212 |
| 283 | Ga0209026_1000726 | 3300025250 | Bacteria | 19324 |
| 284 | Ga0209026_1002617 | 3300025250 | Bacteria | 6580 |
| 285 | Ga0209677_101338 | 3300025253 | Bacteria | 10832 |
| 286 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 287 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 288 | Ga0209148_1000014 | 3300025254 | Bacteria | 925277 |
| 289 | Ga0209148_1000039 | 3300025254 | Bacteria | 482479 |
| 290 | Ga0209148_1000087 | 3300025254 | Bacteria | 260905 |
| 291 | Ga0209148_1000098 | 3300025254 | Bacteria | 233172 |
| 292 | Ga0209148_1002333 | 3300025254 | Bacteria | 6746 |
| 293 | Ga0209759_1000316 | 3300025256 | Bacteria | 64846 |
| 294 | Ga0209759_1000338 | 3300025256 | Bacteria | 61744 |
| 295 | Ga0209759_1001070 | 3300025256 | Bacteria | 17937 |
| 296 | Ga0209759_1006753 | 3300025256 | Bacteria | 3804 |
| 297 | Ga0209129_1001605 | 3300025258 | Bacteria | 12325 |
| 298 | Ga0209129_1002940 | 3300025258 | Bacteria | 7790 |
| 299 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 300 | Ga0209233_1000080 | 3300025261 | Bacteria | 338459 |
| 301 | Ga0209233_1000083 | 3300025261 | Bacteria | 336016 |
| 302 | Ga0209233_1000092 | 3300025261 | Bacteria | 308668 |
| 303 | Ga0209233_1000191 | 3300025261 | Bacteria | 127938 |
| 304 | Ga0209233_1025825 | 3300025261 | Bacteria | 1447 |
| 305 | Ga0209455_1000010 | 3300025272 | Bacteria | 959482 |
| 306 | Ga0209455_1000014 | 3300025272 | Bacteria | 806601 |
| 307 | Ga0209455_1000034 | 3300025272 | Bacteria | 483129 |
| 308 | Ga0209455_1000086 | 3300025272 | Bacteria | 244650 |
| 309 | Ga0209455_1015163 | 3300025272 | Bacteria | 1707 |
| 310 | Ga0209758_1004110 | 3300025297 | Bacteria | 12469 |
| 311 | Ga0209758_1018206 | 3300025297 | Bacteria | 3456 |
| 312 | Ga0209758_1023053 | 3300025297 | Bacteria | 2830 |
| 313 | Ga0207656_10000907 | 3300025321 | Bacteria | 9634 |
| 314 | Ga0207692_10036344 | 3300025898 | Bacteria | 2401 |
| 315 | Ga0207680_10000013 | 3300025903 | Bacteria | 244716 |
| 316 | Ga0207680_10072556 | 3300025903 | Bacteria | 2138 |
| 317 | Ga0207647_10000029 | 3300025904 | Bacteria | 109732 |
| 318 | Ga0207647_10001225 | 3300025904 | Bacteria | 19750 |
| 319 | Ga0207647_10037439 | 3300025904 | Bacteria | 3076 |
| 320 | Ga0207699_10152455 | 3300025906 | Bacteria | 1531 |
| 321 | Ga0207705_10002035 | 3300025909 | Bacteria | 15735 |
| 322 | Ga0207705_10005361 | 3300025909 | Bacteria | 9587 |
| 323 | Ga0207705_10006840 | 3300025909 | Bacteria | 8426 |
| 324 | Ga0207654_10000423 | 3300025911 | Bacteria | 24217 |
| 325 | Ga0207707_10000380 | 3300025912 | Bacteria | 46409 |
| 326 | Ga0207707_10014646 | 3300025912 | Bacteria | 6833 |
| 327 | Ga0207707_10017519 | 3300025912 | Bacteria | 6246 |
| 328 | Ga0207707_10032583 | 3300025912 | Bacteria | 4561 |
| 329 | Ga0207707_10038162 | 3300025912 | Bacteria | 4198 |
| 330 | Ga0207695_10001325 | 3300025913 | Bacteria | 41991 |
| 331 | Ga0207695_10001580 | 3300025913 | Bacteria | 37116 |
| 332 | Ga0207695_10005282 | 3300025913 | Bacteria | 17221 |
| 333 | Ga0207695_10005709 | 3300025913 | Bacteria | 16406 |
| 334 | Ga0207695_10007938 | 3300025913 | Bacteria | 13392 |
| 335 | Ga0207695_10019900 | 3300025913 | Bacteria | 7713 |
| 336 | Ga0207695_10036678 | 3300025913 | Bacteria | 5296 |
| 337 | Ga0207695_10104456 | 3300025913 | Bacteria | 2822 |
| 338 | Ga0207671_10000031 | 3300025914 | Bacteria | 247030 |
| 339 | Ga0207671_10001506 | 3300025914 | Bacteria | 26857 |
| 340 | Ga0207671_10018608 | 3300025914 | Bacteria | 5323 |
| 341 | Ga0207671_10215670 | 3300025914 | Bacteria | 1502 |
| 342 | Ga0207671_10385931 | 3300025914 | Bacteria | 1113 |
| 343 | Ga0207693_10282053 | 3300025915 | Bacteria | 1302 |
| 344 | Ga0207660_10111100 | 3300025917 | Bacteria | 2063 |
| 345 | Ga0207657_10008885 | 3300025919 | Bacteria | 10164 |
| 346 | Ga0207649_10006996 | 3300025920 | Bacteria | 6127 |
| 347 | Ga0207649_10017262 | 3300025920 | Bacteria | 4090 |
| 348 | Ga0207649_10047431 | 3300025920 | Bacteria | 2644 |
| 349 | Ga0207649_10050424 | 3300025920 | Bacteria | 2574 |
| 350 | Ga0207649_10059528 | 3300025920 | Bacteria | 2397 |
| 351 | Ga0207652_10005420 | 3300025921 | Bacteria | 10349 |
| 352 | Ga0207652_10098739 | 3300025921 | Bacteria | 2576 |
| 353 | Ga0207694_10002048 | 3300025924 | Bacteria | 16672 |
| 354 | Ga0207694_10002295 | 3300025924 | Bacteria | 15650 |
| 355 | Ga0207694_10006873 | 3300025924 | Bacteria | 8642 |
| 356 | Ga0207694_10057567 | 3300025924 | Bacteria | 3022 |
| 357 | Ga0207650_10606128 | 3300025925 | Bacteria | 921 |
| 358 | Ga0207700_10000795 | 3300025928 | Bacteria | 18225 |
| 359 | Ga0207664_10000239 | 3300025929 | Bacteria | 41739 |
| 360 | Ga0207664_10095942 | 3300025929 | Bacteria | 2440 |
| 361 | Ga0207690_10000586 | 3300025932 | Bacteria | 23543 |
| 362 | Ga0207690_10000992 | 3300025932 | Bacteria | 18165 |
| 363 | Ga0207690_10034557 | 3300025932 | Bacteria | 3258 |
| 364 | Ga0207690_10064484 | 3300025932 | Bacteria | 2501 |
| 365 | Ga0207690_10082299 | 3300025932 | Bacteria | 2251 |
| 366 | Ga0207706_10052307 | 3300025933 | Bacteria | 3606 |
| 367 | Ga0207686_10003899 | 3300025934 | Bacteria | 8000 |
| 368 | Ga0207670_10003200 | 3300025936 | Bacteria | 8671 |
| 369 | Ga0207669_10505496 | 3300025937 | Bacteria | 968 |
| 370 | Ga0207704_10000937 | 3300025938 | Bacteria | 12919 |
| 371 | Ga0207691_10002689 | 3300025940 | Bacteria | 17383 |
| 372 | Ga0207711_10037344 | 3300025941 | Bacteria | 4125 |
| 373 | Ga0207689_10016448 | 3300025942 | Bacteria | 6260 |
| 374 | Ga0207667_10001044 | 3300025949 | Bacteria | 35297 |
| 375 | Ga0207667_10001074 | 3300025949 | Bacteria | 34666 |
| 376 | Ga0207667_10002386 | 3300025949 | Bacteria | 23502 |
| 377 | Ga0207667_10005225 | 3300025949 | Bacteria | 15835 |
| 378 | Ga0207667_10007269 | 3300025949 | Bacteria | 13354 |
| 379 | Ga0207667_10007692 | 3300025949 | Bacteria | 12899 |
| 380 | Ga0207667_10273056 | 3300025949 | Bacteria | 1728 |
| 381 | Ga0207712_10000843 | 3300025961 | Bacteria | 22439 |
| 382 | Ga0207640_10000485 | 3300025981 | Bacteria | 24115 |
| 383 | Ga0207640_10002635 | 3300025981 | Bacteria | 9610 |
| 384 | Ga0207640_10019244 | 3300025981 | Bacteria | 4030 |
| 385 | Ga0207640_10298746 | 3300025981 | Bacteria | 1273 |
| 386 | Ga0207658_10000028 | 3300025986 | Bacteria | 174550 |
| 387 | Ga0207658_10080038 | 3300025986 | Bacteria | 2501 |
| 388 | Ga0207639_10000315 | 3300026041 | Bacteria | 34209 |
| 389 | Ga0207639_10003518 | 3300026041 | Bacteria | 10530 |
| 390 | Ga0207639_10007989 | 3300026041 | Bacteria | 7227 |
| 391 | Ga0207639_10089944 | 3300026041 | Bacteria | 2454 |
| 392 | Ga0207639_10170293 | 3300026041 | Bacteria | 1844 |
| 393 | Ga0207639_10245351 | 3300026041 | Bacteria | 1559 |
| 394 | Ga0207678_10000112 | 3300026067 | Bacteria | 67012 |
| 395 | Ga0207678_10004531 | 3300026067 | Bacteria | 12493 |
| 396 | Ga0207678_10024343 | 3300026067 | Bacteria | 5288 |
| 397 | Ga0207678_10055903 | 3300026067 | Bacteria | 3399 |
| 398 | Ga0207678_10141476 | 3300026067 | Bacteria | 2053 |
| 399 | Ga0207702_10001547 | 3300026078 | Bacteria | 22753 |
| 400 | Ga0207702_10006560 | 3300026078 | Bacteria | 10013 |
| 401 | Ga0207641_10229369 | 3300026088 | Bacteria | 1725 |
| 402 | Ga0207648_10156589 | 3300026089 | Bacteria | 2011 |
| 403 | Ga0207674_10000685 | 3300026116 | Bacteria | 44017 |
| 404 | Ga0207674_10050096 | 3300026116 | Bacteria | 4268 |
| 405 | Ga0207674_10176265 | 3300026116 | Bacteria | 2090 |
| 406 | Ga0207675_100141217 | 3300026118 | Bacteria | 2288 |
| 407 | Ga0207698_10012151 | 3300026142 | Bacteria | 5620 |
| 408 | Ga0207698_10015607 | 3300026142 | Bacteria | 5092 |
| 409 | Ga0207698_10071842 | 3300026142 | Bacteria | 2748 |
| 410 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 411 | Ga0268266_10000021 | 3300028379 | Bacteria | 522453 |
| 412 | Ga0268266_10280941 | 3300028379 | Bacteria | 1548 |
| 413 | Ga0268265_10000131 | 3300028380 | Bacteria | 95615 |
| 414 | Ga0268264_10003643 | 3300028381 | Bacteria | 13255 |
| 415 | Ga0268264_10484936 | 3300028381 | Bacteria | 1203 |
| 416 | Ga0268264_10548486 | 3300028381 | Bacteria | 1133 |
| 417 | Ga0307508_10014069 | 3300031616 | Bacteria | 7303 |
| 418 | Ga0316575_10001810 | 3300031665 | Bacteria | 7011 |
| 419 | Ga0316575_10020315 | 3300031665 | Bacteria | 2547 |
| 420 | Ga0316575_10120670 | 3300031665 | Bacteria | 1072 |
| 421 | Ga0316579_10000114 | 3300031691 | Bacteria | 21604 |
| 422 | Ga0316576_10124892 | 3300031727 | Bacteria | 1933 |
| 423 | Ga0316576_10195644 | 3300031727 | Bacteria | 1523 |
| 424 | Ga0307516_10062132 | 3300031730 | Bacteria | 3621 |
| 425 | Ga0316577_10038005 | 3300031733 | Bacteria | 2691 |
| 426 | Ga0316577_10047768 | 3300031733 | Bacteria | 2390 |
| 427 | Ga0307412_10000917 | 3300031911 | Bacteria | 16854 |
| 428 | Ga0307409_100197930 | 3300031995 | Bacteria | 1795 |
| 429 | Ga0316585_10003820 | 3300032137 | Bacteria | 4166 |
| 430 | Ga0316580_10007241 | 3300032139 | Bacteria | 3298 |
| 431 | Ga0316580_10011121 | 3300032139 | Bacteria | 2727 |
| 432 | Ga0316593_10002104 | 3300032168 | Bacteria | 4627 |
| 433 | Ga0316593_10002604 | 3300032168 | Bacteria | 4319 |
| 434 | Ga0307507_10015315 | 3300033179 | Bacteria | 9033 |
| 435 | Ga0307510_10000977 | 3300033180 | Bacteria | 30289 |
| 436 | Ga0307510_10159835 | 3300033180 | Bacteria | 1852 |
| 437 | Ga0316596_1001142 | 3300033541 | Bacteria | 5192 |
| 438 | Ga0316596_1001867 | 3300033541 | Bacteria | 4393 |
| 439 | Ga0316574_0000172 | 3300035398 | Bacteria | 21532 |
| 440 | Ga0373937_0306011 | 3300036401 | Bacteria | 1503 |
| 441 | Ga0316582_0010909 | 3300036647 | Bacteria | 5001 |
| 442 | Ga0316584_0044035 | 3300036712 | Bacteria | 3328 |
| 443 | Ga0395899_0000175 | 3300037312 | Bacteria | 95781 |
| 444 | Ga0395899_0007904 | 3300037312 | Bacteria | 8192 |
| 445 | Ga0395899_0030704 | 3300037312 | Bacteria | 4040 |
| 446 | Ga0395899_0090203 | 3300037312 | Bacteria | 2222 |
| 447 | Ga0395899_0156999 | 3300037312 | Bacteria | 1609 |
| 448 | Ga0395900_0000012 | 3300037418 | Bacteria | 401198 |
| 449 | Ga0395900_0000059 | 3300037418 | Bacteria | 205996 |
| 450 | Ga0395900_0004207 | 3300037418 | Bacteria | 15274 |
| 451 | Ga0395900_0004359 | 3300037418 | Bacteria | 15007 |
| 452 | Ga0395900_0030705 | 3300037418 | Bacteria | 5518 |
| 453 | Ga0395898_0000034 | 3300037466 | Bacteria | 356745 |
| 454 | Ga0395898_0001311 | 3300037466 | Bacteria | 36213 |
| 455 | Ga0395898_0006426 | 3300037466 | Bacteria | 12553 |
| 456 | Ga0395898_0008278 | 3300037466 | Bacteria | 11000 |
| 457 | Ga0395898_0074040 | 3300037466 | Bacteria | 3290 |
| 458 | Ga0395898_0367324 | 3300037466 | Bacteria | 1372 |
| 459 | Ga0395901_0000816 | 3300038443 | Bacteria | 34537 |
| 460 | Ga0395901_0006163 | 3300038443 | Bacteria | 12151 |
| 461 | Ga0395901_0009331 | 3300038443 | Bacteria | 9946 |
| 462 | Ga0395901_0010234 | 3300038443 | Bacteria | 9501 |
| 463 | Ga0395901_0050339 | 3300038443 | Bacteria | 4329 |
| 464 | Ga0395901_0185453 | 3300038443 | Bacteria | 2182 |
| 465 | Ga0395901_0329463 | 3300038443 | Bacteria | 1579 |
| 466 | Ga0395901_0432333 | 3300038443 | Bacteria | 1348 |
| 467 | Ga0439436_0000067 | 3300041404 | Bacteria | 29364 |
| 468 | Ga0439465_0001040 | 3300041413 | Bacteria | 8836 |
| 469 | Ga0451793_0739495 | 3300041452 | Bacteria | 3120 |
| 470 | Ga0451797_0261258 | 3300041453 | Bacteria | 1237 |
| 471 | Ga0451807_0171222 | 3300041486 | Bacteria | 4674 |
| 472 | Ga0451807_0309039 | 3300041486 | Bacteria | 1028 |
| 473 | Ga0451833_0446148 | 3300041491 | Bacteria | 1288 |
| 474 | Ga0451853_0953777 | 3300041512 | Bacteria | 2888 |
| 475 | Ga0451853_1433675 | 3300041512 | Bacteria | 1121 |
| 476 | Ga0439437_001633 | 3300042000 | Bacteria | 2371 |
| 477 | Ga0450908_001144 | 3300042184 | Bacteria | 5143 |
| 478 | Ga0439459_0000055 | 3300042438 | Bacteria | 9345 |
| 479 | Ga0451577_0204182 | 3300042876 | Bacteria | 1784 |
| 480 | Ga0466969_0011574 | 3300044656 | Bacteria | 4669 |
| 481 | Ga0466969_0020653 | 3300044656 | Bacteria | 3408 |
| 482 | Ga0466972_0005739 | 3300044658 | Bacteria | 6219 |
| 483 | Ga0466972_0047788 | 3300044658 | Bacteria | 2068 |
| 484 | Ga0466975_0180042 | 3300044661 | Bacteria | 1449 |
| 485 | Ga0466989_0018571 | 3300044663 | Bacteria | 3964 |
| 486 | Ga0466982_0000013 | 3300044672 | Bacteria | 136227 |
| 487 | Ga0466965_0002807 | 3300044683 | Bacteria | 7503 |
| 488 | Ga0466965_0117981 | 3300044683 | Bacteria | 1368 |
| 489 | Ga0466966_0004686 | 3300044684 | Bacteria | 8999 |
| 490 | Ga0466966_0014630 | 3300044684 | Bacteria | 5193 |
| 491 | Ga0466966_0020702 | 3300044684 | Bacteria | 4322 |
| 492 | Ga0466961_0000967 | 3300044693 | Bacteria | 17790 |
| 493 | Ga0466961_0013541 | 3300044693 | Bacteria | 5223 |
| 494 | Ga0466961_0017074 | 3300044693 | Bacteria | 4661 |
| 495 | Ga0466961_0028265 | 3300044693 | Bacteria | 3605 |
| 496 | Ga0466963_0174554 | 3300044694 | Bacteria | 1499 |
| 497 | Ga0466971_0022747 | 3300044719 | Bacteria | 2793 |
| 498 | Ga0466971_0027748 | 3300044719 | Bacteria | 2535 |
| 499 | Ga0466968_0002450 | 3300044735 | Bacteria | 6806 |
| 500 | Ga0466968_0013890 | 3300044735 | Bacteria | 3173 |
| 501 | Ga0466970_0010342 | 3300044765 | Bacteria | 4734 |
| 502 | Ga0466957_0047688 | 3300044842 | Bacteria | 2603 |
| 503 | Ga0466957_0128323 | 3300044842 | Bacteria | 1622 |
| 504 | Ga0466960_0005543 | 3300044901 | Bacteria | 5004 |
| 505 | Ga0466959_0000068 | 3300045049 | Bacteria | 73132 |
| 506 | Ga0466959_0020265 | 3300045049 | Bacteria | 4897 |
| 507 | Ga0466959_0062198 | 3300045049 | Bacteria | 2713 |
| 508 | Ga0466958_0049101 | 3300045836 | Bacteria | 2552 |
| 509 | Ga0466958_0101272 | 3300045836 | Bacteria | 1791 |
| 510 | Ga0466967_0261737 | 3300045976 | Bacteria | 1655 |
| 511 | Ga0495617_000117 | 3300046452 | Bacteria | 54105 |
| 512 | Ga0495638_0000007 | 3300046460 | Bacteria | 602783 |
| 513 | Ga0495638_0000899 | 3300046460 | Bacteria | 30415 |
| 514 | Ga0495638_0001952 | 3300046460 | Bacteria | 17692 |
| 515 | Ga0495638_0001995 | 3300046460 | Bacteria | 17416 |
| 516 | Ga0495638_0018140 | 3300046460 | Bacteria | 4677 |
| 517 | Ga0495650_0000497 | 3300046471 | Bacteria | 59612 |
| 518 | Ga0495650_0000585 | 3300046471 | Bacteria | 50650 |
| 519 | Ga0495650_0003111 | 3300046471 | Bacteria | 12451 |
| 520 | Ga0495582_0055392 | 3300046473 | Bacteria | 2186 |
| 521 | Ga0495584_0003980 | 3300046491 | Bacteria | 7970 |
| 522 | Ga0495585_0008658 | 3300046492 | Bacteria | 6153 |
| 523 | Ga0495585_0013229 | 3300046492 | Bacteria | 4834 |
| 524 | Ga0495607_0000088 | 3300046501 | Bacteria | 95203 |
| 525 | Ga0495607_0000122 | 3300046501 | Bacteria | 81489 |
| 526 | Ga0495606_0000298 | 3300046507 | Bacteria | 85739 |
| 527 | Ga0495606_0001210 | 3300046507 | Bacteria | 36218 |
| 528 | Ga0495606_0004779 | 3300046507 | Bacteria | 13320 |
| 529 | Ga0495606_0078069 | 3300046507 | Bacteria | 2066 |
| 530 | Ga0495606_0089144 | 3300046507 | Bacteria | 1900 |
| 531 | Ga0495610_0004565 | 3300046512 | Bacteria | 10178 |
| 532 | Ga0495610_0015527 | 3300046512 | Bacteria | 4420 |
| 533 | Ga0495616_0000565 | 3300046513 | Bacteria | 28011 |
| 534 | Ga0495620_0005019 | 3300046515 | Bacteria | 7416 |
| 535 | Ga0495631_0001445 | 3300046518 | Bacteria | 14425 |
| 536 | Ga0495631_0003807 | 3300046518 | Bacteria | 8199 |
| 537 | Ga0495632_0000004 | 3300046519 | Bacteria | 381372 |
| 538 | Ga0495632_0038310 | 3300046519 | Bacteria | 2428 |
| 539 | Ga0495632_0052398 | 3300046519 | Bacteria | 2006 |
| 540 | Ga0495632_0113406 | 3300046519 | Bacteria | 1271 |
| 541 | Ga0495632_0176962 | 3300046519 | Bacteria | 978 |
| 542 | Ga0495648_0005079 | 3300046524 | Bacteria | 11041 |
| 543 | Ga0495648_0009504 | 3300046524 | Bacteria | 7516 |
| 544 | Ga0495665_0085971 | 3300046531 | Bacteria | 1653 |
| 545 | Ga0495586_0117970 | 3300046535 | Bacteria | 1481 |
| 546 | Ga0495609_0003579 | 3300046538 | Bacteria | 8834 |
| 547 | Ga0495597_0104277 | 3300046542 | Bacteria | 1193 |
| 548 | Ga0495622_0012969 | 3300046557 | Bacteria | 3867 |
| 549 | Ga0495668_0012112 | 3300046616 | Bacteria | 5130 |
| 550 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 551 | Ga0495611_0000060 | 3300046648 | Bacteria | 77971 |
| 552 | Ga0495625_0000022 | 3300046660 | Bacteria | 278823 |
| 553 | Ga0495625_0016189 | 3300046660 | Bacteria | 5873 |
| 554 | Ga0495625_0022701 | 3300046660 | Bacteria | 4806 |
| 555 | Ga0495625_0097090 | 3300046660 | Bacteria | 2028 |
| 556 | Ga0495661_0003615 | 3300046665 | Bacteria | 11388 |
| 557 | Ga0495670_0007331 | 3300046691 | Bacteria | 5422 |
| 558 | Ga0495671_0004741 | 3300046692 | Bacteria | 8031 |
| 559 | Ga0495649_0013114 | 3300046694 | Bacteria | 4790 |
| 560 | Ga0495589_0000137 | 3300046794 | Bacteria | 67614 |
| 561 | Ga0495660_0000728 | 3300046810 | Bacteria | 25032 |
| 562 | Ga0495660_0003021 | 3300046810 | Bacteria | 10492 |
| 563 | Ga0495672_0081196 | 3300047320 | Bacteria | 1806 |
| 564 | Ga0495683_0006531 | 3300047323 | Bacteria | 6367 |
| 565 | Ga0495679_000004 | 3300047446 | Bacteria | 748056 |
| 566 | Ga0495673_0000202 | 3300047469 | Bacteria | 90523 |
| 567 | Ga0495673_0000749 | 3300047469 | Bacteria | 30861 |
| 568 | Ga0495681_0070594 | 3300047470 | Bacteria | 1583 |
| 569 | Ga0495686_0000017 | 3300047472 | Bacteria | 435554 |
| 570 | Ga0495686_0001035 | 3300047472 | Bacteria | 33368 |
| 571 | Ga0495686_0002896 | 3300047472 | Bacteria | 15405 |
| 572 | Ga0495686_0024798 | 3300047472 | Bacteria | 3935 |
| 573 | Ga0495626_0153914 | 3300048091 | Bacteria | 967 |
| 574 | Ga0496100_0001258 | 3300048903 | Bacteria | 12356 |
| 575 | Ga0496101_0000491 | 3300048904 | Bacteria | 24921 |
| 576 | Ga0496102_0032706 | 3300048905 | Bacteria | 4674 |
| 577 | Ga0496102_0083022 | 3300048905 | Bacteria | 2956 |
| 578 | Ga0496102_0228311 | 3300048905 | Bacteria | 1755 |
| 579 | Ga0496103_0032821 | 3300048906 | Bacteria | 3170 |
| 580 | Ga0496104_0000016 | 3300048907 | Bacteria | 335025 |
| 581 | Ga0496104_0669353 | 3300048907 | Bacteria | 946 |
| 582 | Ga0496105_0000010 | 3300048908 | Bacteria | 309880 |
| 583 | Ga0496105_0000871 | 3300048908 | Bacteria | 20658 |
| 584 | Ga0496106_0005789 | 3300048909 | Bacteria | 9139 |
| 585 | Ga0496115_0000025 | 3300048918 | Bacteria | 151658 |
| 586 | Ga0496115_0013784 | 3300048918 | Bacteria | 6121 |
| 587 | Ga0496115_0029462 | 3300048918 | Bacteria | 4311 |
| 588 | Ga0496115_0037030 | 3300048918 | Bacteria | 3865 |
| 589 | Ga0496115_0251320 | 3300048918 | Bacteria | 1455 |
| 590 | Ga0496116_0079482 | 3300048919 | Bacteria | 2041 |
| 591 | Ga0496117_0004951 | 3300048920 | Bacteria | 14305 |
| 592 | Ga0496117_0011610 | 3300048920 | Bacteria | 7872 |
| 593 | Ga0496118_0000429 | 3300048921 | Bacteria | 69699 |
| 594 | Ga0496118_0002079 | 3300048921 | Bacteria | 28158 |
| 595 | Ga0496118_0002476 | 3300048921 | Bacteria | 24790 |
| 596 | Ga0496118_0006655 | 3300048921 | Bacteria | 12612 |
| 597 | Ga0496118_0015454 | 3300048921 | Bacteria | 7065 |
| 598 | Ga0496118_0034247 | 3300048921 | Bacteria | 4148 |
| 599 | Ga0496118_0053587 | 3300048921 | Bacteria | 3064 |
| 600 | Ga0496118_0060887 | 3300048921 | Bacteria | 2800 |
| 601 | Ga0496118_0242450 | 3300048921 | Bacteria | 1031 |
| 602 | Ga0496119_0000058 | 3300048922 | Bacteria | 173131 |
| 603 | Ga0496119_0039545 | 3300048922 | Bacteria | 3029 |
| 604 | Ga0496120_0001252 | 3300048923 | Bacteria | 31938 |
| 605 | Ga0496120_0001892 | 3300048923 | Bacteria | 23232 |
| 606 | Ga0496121_0000045 | 3300048924 | Bacteria | 336130 |
| 607 | Ga0496121_0000401 | 3300048924 | Bacteria | 86663 |
| 608 | Ga0496121_0002752 | 3300048924 | Bacteria | 26142 |
| 609 | Ga0496121_0009537 | 3300048924 | Bacteria | 11121 |
| 610 | Ga0496121_0028054 | 3300048924 | Bacteria | 5250 |
| 611 | Ga0496121_0034962 | 3300048924 | Bacteria | 4510 |
| 612 | Ga0496121_0037826 | 3300048924 | Bacteria | 4281 |
| 613 | Ga0496121_0046023 | 3300048924 | Bacteria | 3740 |
| 614 | Ga0496121_0115688 | 3300048924 | Bacteria | 2036 |
| 615 | Ga0496121_0117684 | 3300048924 | Bacteria | 2013 |
| 616 | Ga0496121_0179141 | 3300048924 | Bacteria | 1531 |
| 617 | Ga0496122_0000759 | 3300048925 | Bacteria | 62531 |
| 618 | Ga0496122_0017227 | 3300048925 | Bacteria | 6770 |
| 619 | Ga0496122_0067213 | 3300048925 | Bacteria | 2583 |
| 620 | Ga0496123_0001142 | 3300048926 | Bacteria | 39631 |
| 621 | Ga0496123_0003690 | 3300048926 | Bacteria | 16866 |
| 622 | Ga0496123_0016381 | 3300048926 | Bacteria | 6023 |
| 623 | Ga0496123_0030669 | 3300048926 | Bacteria | 3931 |
| 624 | Ga0496124_0028363 | 3300048927 | Bacteria | 5008 |
| 625 | Ga0496124_0057811 | 3300048927 | Bacteria | 3266 |
| 626 | Ga0496125_0000137 | 3300048928 | Bacteria | 160328 |
| 627 | Ga0496125_0018170 | 3300048928 | Bacteria | 6683 |
| 628 | Ga0496126_0001102 | 3300048929 | Bacteria | 45348 |
| 629 | Ga0496126_0047577 | 3300048929 | Bacteria | 3926 |
| 630 | Ga0496126_0069008 | 3300048929 | Bacteria | 3154 |
| 631 | Ga0496126_0121900 | 3300048929 | Bacteria | 2260 |
| 632 | Ga0496126_0242597 | 3300048929 | Bacteria | 1505 |
| 633 | Ga0496126_0349516 | 3300048929 | Bacteria | 1209 |
| 634 | Ga0495678_000099 | 3300049459 | Bacteria | 106223 |
| 635 | Ga0495678_041137 | 3300049459 | Bacteria | 1852 |
| 636 | Ga0495682_0032976 | 3300049460 | Bacteria | 1912 |
| 637 | Ga0501031_0005632 | 3300049568 | Bacteria | 8162 |
| 638 | Ga0501032_0001939 | 3300049569 | Bacteria | 16291 |
| 639 | Ga0501032_0014972 | 3300049569 | Bacteria | 5485 |
| 640 | Ga0501033_0005614 | 3300049570 | Bacteria | 9913 |
| 641 | Ga0501033_0007452 | 3300049570 | Bacteria | 8523 |
| 642 | Ga0501033_0025649 | 3300049570 | Bacteria | 4440 |
| 643 | Ga0501033_0079699 | 3300049570 | Bacteria | 2403 |
| 644 | Ga0501034_0000605 | 3300049571 | Bacteria | 56544 |
| 645 | Ga0501034_0003067 | 3300049571 | Bacteria | 19272 |
| 646 | Ga0501034_0004478 | 3300049571 | Bacteria | 15529 |
| 647 | Ga0501034_0017499 | 3300049571 | Bacteria | 7351 |
| 648 | Ga0501034_0021485 | 3300049571 | Bacteria | 6579 |
| 649 | Ga0501036_0015834 | 3300049572 | Bacteria | 6297 |
| 650 | Ga0501036_0056431 | 3300049572 | Bacteria | 3328 |
| 651 | Ga0501036_0523104 | 3300049572 | Bacteria | 986 |
| 652 | Ga0501037_0001394 | 3300049573 | Bacteria | 17733 |
| 653 | Ga0501037_0015899 | 3300049573 | Bacteria | 5541 |
| 654 | Ga0501037_0039752 | 3300049573 | Bacteria | 3462 |
| 655 | Ga0501037_0362493 | 3300049573 | Bacteria | 998 |
| 656 | Ga0501038_0000141 | 3300049574 | Bacteria | 61476 |
| 657 | Ga0501038_0009677 | 3300049574 | Bacteria | 8840 |
| 658 | Ga0501038_0069413 | 3300049574 | Bacteria | 2993 |
| 659 | Ga0501038_0103298 | 3300049574 | Bacteria | 2370 |
| 660 | Ga0501039_0010357 | 3300049575 | Bacteria | 7111 |
| 661 | Ga0501039_0087333 | 3300049575 | Bacteria | 2429 |
| 662 | Ga0501042_0104785 | 3300049578 | Bacteria | 2035 |
| 663 | Ga0501043_0000840 | 3300049579 | Bacteria | 27302 |
| 664 | Ga0501043_0005095 | 3300049579 | Bacteria | 10636 |
| 665 | Ga0501043_0013050 | 3300049579 | Bacteria | 6494 |
| 666 | Ga0501043_0025582 | 3300049579 | Bacteria | 4631 |
| 667 | Ga0501043_0071548 | 3300049579 | Bacteria | 2724 |
| 668 | Ga0501043_0138949 | 3300049579 | Bacteria | 1903 |
| 669 | Ga0501043_0436075 | 3300049579 | Bacteria | 986 |
| 670 | Ga0501046_0012566 | 3300049580 | Bacteria | 7200 |
| 671 | Ga0501046_0014090 | 3300049580 | Bacteria | 6752 |
| 672 | Ga0501046_0115571 | 3300049580 | Bacteria | 2046 |
| 673 | Ga0501046_0116612 | 3300049580 | Bacteria | 2035 |
| 674 | Ga0501046_0141965 | 3300049580 | Bacteria | 1817 |
| 675 | Ga0501047_0002983 | 3300049581 | Bacteria | 16053 |
| 676 | Ga0501047_0004063 | 3300049581 | Bacteria | 13761 |
| 677 | Ga0501047_0008730 | 3300049581 | Bacteria | 9564 |
| 678 | Ga0501047_0010205 | 3300049581 | Bacteria | 8883 |
| 679 | Ga0501047_0011872 | 3300049581 | Bacteria | 8240 |
| 680 | Ga0501047_0025393 | 3300049581 | Bacteria | 5695 |
| 681 | Ga0501047_0085696 | 3300049581 | Bacteria | 3027 |
| 682 | Ga0501047_0251583 | 3300049581 | Bacteria | 1615 |
| 683 | Ga0501047_0292364 | 3300049581 | Bacteria | 1473 |
| 684 | Ga0501047_0300140 | 3300049581 | Bacteria | 1449 |
| 685 | Ga0501047_0364304 | 3300049581 | Bacteria | 1281 |
| 686 | Ga0501048_0025027 | 3300049582 | Bacteria | 4353 |
| 687 | Ga0501048_0075485 | 3300049582 | Bacteria | 2378 |
| 688 | Ga0501067_0003110 | 3300049583 | Bacteria | 9161 |
| 689 | Ga0501068_0001426 | 3300049584 | Bacteria | 12696 |
| 690 | Ga0501068_0129083 | 3300049584 | Bacteria | 1580 |
| 691 | Ga0501069_0003434 | 3300049585 | Bacteria | 8142 |
| 692 | Ga0501069_0035758 | 3300049585 | Bacteria | 2737 |
| 693 | Ga0501069_0152380 | 3300049585 | Bacteria | 1329 |
| 694 | Ga0501070_0003984 | 3300049586 | Bacteria | 12700 |
| 695 | Ga0501070_0005506 | 3300049586 | Bacteria | 10802 |
| 696 | Ga0501070_0013239 | 3300049586 | Bacteria | 6953 |
| 697 | Ga0501070_0016391 | 3300049586 | Bacteria | 6225 |
| 698 | Ga0501070_0042286 | 3300049586 | Bacteria | 3795 |
| 699 | Ga0501070_0080309 | 3300049586 | Bacteria | 2698 |
| 700 | Ga0501071_0026570 | 3300049587 | Bacteria | 4065 |
| 701 | Ga0501072_0007222 | 3300049588 | Bacteria | 8432 |
| 702 | Ga0501072_0087685 | 3300049588 | Bacteria | 2470 |
| 703 | Ga0501073_0000072 | 3300049589 | Bacteria | 62953 |
| 704 | Ga0501073_0012859 | 3300049589 | Bacteria | 6101 |
| 705 | Ga0501073_0014820 | 3300049589 | Bacteria | 5658 |
| 706 | Ga0501073_0022162 | 3300049589 | Bacteria | 4577 |
| 707 | Ga0501073_0074253 | 3300049589 | Bacteria | 2368 |
| 708 | Ga0501073_0086040 | 3300049589 | Bacteria | 2186 |
| 709 | Ga0501074_0002293 | 3300049590 | Bacteria | 13304 |
| 710 | Ga0501074_0011165 | 3300049590 | Bacteria | 6525 |
| 711 | Ga0501074_0017385 | 3300049590 | Bacteria | 5217 |
| 712 | Ga0501074_0019544 | 3300049590 | Bacteria | 4917 |
| 713 | Ga0501074_0029972 | 3300049590 | Bacteria | 3943 |
| 714 | Ga0501079_0039248 | 3300049741 | Bacteria | 3652 |
| 715 | Ga0501079_0044763 | 3300049741 | Bacteria | 3415 |
| 716 | Ga0501079_0254786 | 3300049741 | Bacteria | 1372 |
| 717 | Ga0501080_0000097 | 3300049742 | Bacteria | 59356 |
| 718 | Ga0501080_0000554 | 3300049742 | Bacteria | 29568 |
| 719 | Ga0501080_0003092 | 3300049742 | Bacteria | 14701 |
| 720 | Ga0501080_0012182 | 3300049742 | Bacteria | 7878 |
| 721 | Ga0501080_0027360 | 3300049742 | Bacteria | 5301 |
| 722 | Ga0501080_0105298 | 3300049742 | Bacteria | 2615 |
| 723 | Ga0501080_0121722 | 3300049742 | Bacteria | 2418 |
| 724 | Ga0501083_0000128 | 3300049744 | Bacteria | 51820 |
| 725 | Ga0501083_0305659 | 3300049744 | Bacteria | 1034 |
| 726 | Ga0501035_0001437 | 3300049822 | Bacteria | 24424 |
| 727 | Ga0501035_0003810 | 3300049822 | Bacteria | 14372 |
| 728 | Ga0501035_0021748 | 3300049822 | Bacteria | 5897 |
| 729 | Ga0501035_0035960 | 3300049822 | Bacteria | 4492 |
| 730 | Ga0501035_0043309 | 3300049822 | Bacteria | 4057 |
| 731 | Ga0501035_0050847 | 3300049822 | Bacteria | 3712 |
| 732 | Ga0501035_0074266 | 3300049822 | Bacteria | 3008 |
| 733 | Ga0501035_0174472 | 3300049822 | Bacteria | 1855 |
| 734 | Ga0501035_0198430 | 3300049822 | Bacteria | 1722 |
| 735 | Ga0501044_0003555 | 3300049823 | Bacteria | 17539 |
| 736 | Ga0501044_0003906 | 3300049823 | Bacteria | 16710 |
| 737 | Ga0501044_0005029 | 3300049823 | Bacteria | 14761 |
| 738 | Ga0501044_0012166 | 3300049823 | Bacteria | 9317 |
| 739 | Ga0501044_0013452 | 3300049823 | Bacteria | 8850 |
| 740 | Ga0501044_0015582 | 3300049823 | Bacteria | 8190 |
| 741 | Ga0501044_0038033 | 3300049823 | Bacteria | 5026 |
| 742 | Ga0501044_0044762 | 3300049823 | Bacteria | 4590 |
| 743 | Ga0501044_0084014 | 3300049823 | Bacteria | 3218 |
| 744 | Ga0501044_0203046 | 3300049823 | Bacteria | 1940 |
| 745 | Ga0501044_0319870 | 3300049823 | Bacteria | 1476 |
| 746 | nmdc:mga0sz30_64337_c1 | 3300050516 | Bacteria | 1571 |
| 747 | Ga0500610_0003839 | 3300053079 | Bacteria | 5849 |
| 748 | Ga0500643_000118 | 3300053087 | Bacteria | 82138 |
| 749 | Ga0500643_003789 | 3300053087 | Bacteria | 7077 |
| 750 | Ga0500651_0000245 | 3300053093 | Bacteria | 33226 |
| 751 | Ga0500651_0042127 | 3300053093 | Bacteria | 2877 |
| 752 | Ga0500555_001900 | 3300053103 | Bacteria | 6201 |
| 753 | Ga0500597_000179 | 3300053120 | Bacteria | 13013 |
| 754 | Ga0500633_0003671 | 3300053160 | Bacteria | 3392 |
| 755 | Ga0500645_001641 | 3300053730 | Bacteria | 11022 |
| 756 | Ga0501082_0057705 | 3300060353 | Bacteria | 3344 |
| 757 | Ga0466962_0003530 | 3300061719 | Bacteria | 7453 |
| 758 | Ga0466962_0007751 | 3300061719 | Bacteria | 5145 |
| 759 | 2525555823 | 2524614729 | Bacteria | 3091755 |
| 760 | 2538833033 | 2537561836 | Bacteria | 3910579 |
| 761 | 2595446722 | 2593339238 | Bacteria | 4182970 |
| 762 | 2595451777 | 2593339239 | Bacteria | 4124669 |
| 763 | 2630650837 | 2627854209 | Bacteria | 3093011 |
| 764 | 2643830895 | 2643221562 | Bacteria | 4048635 |
| 765 | 2643894163 | 2643221577 | Bacteria | 3710843 |
| 766 | 2644476365 | 2643221685 | Bacteria | 3673288 |
| 767 | 2721026632 | 2718218334 | Bacteria | 4765486 |
| 768 | 2735833375 | 2734482264 | Unclassified | 5014763 |
| 769 | 2739229372 | 2738543009 | Bacteria | 4944499 |
| 770 | 2739731932 | 2739367700 | Bacteria | 4747630 |
| 771 | 2819563813 | 2818991440 | Bacteria | 4774720 |
| 772 | 2842917886 | 2842914999 | Bacteria | 4419378 |
| 773 | 2842919754 | 2842918807 | Bacteria | 4289178 |
| 774 | 2884341368 | 2884338543 | Bacteria | 4610696 |
| 775 | 2884413337 | 2884411467 | Bacteria | 5246714 |
| 776 | 2895396919 | 2895395659 | Bacteria | 3983269 |
| 777 | 2904463876 | 2904463128 | Bacteria | 4775606 |
| 778 | 2919087608 | 2919085039 | Bacteria | 4532964 |
| 779 | 2919404858 | 2919404418 | Bacteria | 4232372 |
| 780 | 2928964630 | 2928963466 | Bacteria | 5165703 |
| 781 | 2939614278 | 2939611941 | Bacteria | 3892017 |
| 782 | 2941472826 | 2941471342 | Bacteria | 5018624 |
| 783 | 2953995055 | 2953994433 | Bacteria | 4303959 |
| 784 | Ga0395899_0021621 | |||
| 785 | JGI24740J21852_10005728 | |||
| 786 | JGI24739J22299_10001151 | |||
| 787 | JGI24739J22299_10012267 | |||
| 788 | JGI24737J22298_10015018 | |||
| 789 | JGI24738J21930_10000954 | |||
| 790 | JGI25156J39149_1004146 | |||
| 791 | JGI25156J39149_1010840 | |||
| 792 | JGI25162J39368_1000226 | |||
| 793 | JGI25162J39368_1000311 | |||
| 794 | JGI25162J39368_1000790 | |||
| 795 | JGI25162J39368_1001503 | |||
| 796 | JGI25162J39368_1004324 | |||
| 797 | JGI25157J39369_1000345 | |||
| 798 | JGI25157J39369_1000541 | |||
| 799 | JGI25157J39369_1001083 | |||
| 800 | JGI25157J39369_1002119 | |||
| 801 | JGI25157J39369_1002687 | |||
| 802 | JGI25163J39215_1000171 | |||
| 803 | JGI25164J39214_1000035 | |||
| 804 | JGI25164J39214_1000214 | |||
| 805 | JGI25164J39214_1000742 | |||
| 806 | JGI25164J39214_1000752 | |||
| 807 | JGI25165J46597_1000226 | |||
| 808 | JGI25165J46597_1000260 | |||
| 809 | JGI25165J46597_1001473 | |||
| 810 | JGI25165J46597_1003296 | |||
| 811 | rootH1_10016990 | |||
| 812 | rootH2_10004402 | |||
| 813 | Ga0006562J51391_1022736 | |||
| 814 | Ga0006562J51391_1022737 | |||
| 815 | Ga0006562J51391_1106400 | |||
| 816 | Ga0006562J51391_1106401 | |||
| 817 | Ga0055538_1002052 | |||
| 818 | Ga0055539_1003463 | |||
| 819 | Ga0055533_1002036 | |||
| 820 | Ga0055525_1000452 | |||
| 821 | Ga0055527_1000082 | |||
| 822 | Ga0055527_1000907 | |||
| 823 | Ga0055535_1000143 | |||
| 824 | Ga0055535_1000323 | |||
| 825 | Ga0055535_1000593 | |||
| 826 | Ga0055535_1002180 | |||
| 827 | Ga0055535_1002438 | |||
| 828 | Ga0055542_1000067 | |||
| 829 | Ga0055542_1000190 | |||
| 830 | Ga0055542_1000275 | |||
| 831 | Ga0055542_1000622 | |||
| 832 | Ga0055542_1002065 | |||
| 833 | Ga0055542_1002332 | |||
| 834 | Ga0055529_1000217 | |||
| 835 | Ga0055529_1000233 | |||
| 836 | Ga0055529_1000367 | |||
| 837 | Ga0055529_1001133 | |||
| 838 | Ga0055543_1020812 | |||
| 839 | Ga0065165_1000028 | |||
| 840 | Ga0065165_1001244 | |||
| 841 | Ga0070658_10001605 | |||
| 842 | Ga0070683_100168976 | |||
| 843 | Ga0068869_100004548 | |||
| 844 | Ga0070666_10000012 | |||
| 845 | Ga0070666_10168093 | |||
| 846 | Ga0070680_100295793 | |||
| 847 | Ga0070680_100332401 | |||
| 848 | Ga0070682_100001599 | |||
| 849 | Ga0070682_100005594 | |||
| 850 | Ga0070660_100016387 | |||
| 851 | Ga0070689_100010606 | |||
| 852 | Ga0070691_10040331 | |||
| 853 | Ga0070661_100042502 | |||
| 854 | Ga0070661_100050352 | |||
| 855 | Ga0070661_100050468 | |||
| 856 | Ga0070661_100072708 | |||
| 857 | Ga0070692_10045384 | |||
| 858 | Ga0070692_10153602 | |||
| 859 | Ga0070668_100103313 | |||
| 860 | Ga0070659_100043525 | |||
| 861 | Ga0070659_100118427 | |||
| 862 | Ga0070667_100000041 | |||
| 863 | Ga0070667_100013273 | |||
| 864 | Ga0070667_100122410 | |||
| 865 | Ga0070667_100485351 | |||
| 866 | Ga0070714_100000650 | |||
| 867 | Ga0070713_100000697 | |||
| 868 | Ga0070663_100000080 | |||
| 869 | Ga0070663_100043617 | |||
| 870 | Ga0070681_10000422 | |||
| 871 | Ga0070681_10004784 | |||
| 872 | Ga0070685_10007572 | |||
| 873 | Ga0070685_10115922 | |||
| 874 | Ga0070679_100008773 | |||
| 875 | Ga0070679_100033998 | |||
| 876 | Ga0070679_100035082 | |||
| 877 | Ga0070679_100136895 | |||
| 878 | Ga0070679_100269264 | |||
| 879 | Ga0068853_100006935 | |||
| 880 | Ga0068853_100013978 | |||
| 881 | Ga0068853_100036801 | |||
| 882 | Ga0068853_100059765 | |||
| 883 | Ga0068853_100165200 | |||
| 884 | Ga0068853_100174863 | |||
| 885 | Ga0068853_100286720 | |||
| 886 | Ga0070672_100000967 | |||
| 887 | Ga0070696_100006770 | |||
| 888 | Ga0070693_100002525 | |||
| 889 | Ga0070665_100000062 | |||
| 890 | Ga0070665_100011046 | |||
| 891 | Ga0070665_100012001 | |||
| 892 | Ga0070665_100015833 | |||
| 893 | Ga0068855_100000186 | |||
| 894 | Ga0068855_100003219 | |||
| 895 | Ga0068855_100035273 | |||
| 896 | Ga0068855_100055852 | |||
| 897 | Ga0068855_100068209 | |||
| 898 | Ga0068855_100151751 | |||
| 899 | Ga0068855_100434603 | |||
| 900 | Ga0068857_100002448 | |||
| 901 | Ga0068857_100012794 | |||
| 902 | Ga0068857_100024073 | |||
| 903 | Ga0068857_100309750 | |||
| 904 | Ga0068854_100000486 | |||
| 905 | Ga0068854_100010548 | |||
| 906 | Ga0068854_100040225 | |||
| 907 | Ga0068854_100307736 | |||
| 908 | Ga0068856_100002830 | |||
| 909 | Ga0068856_100011894 | |||
| 910 | Ga0068856_100137208 | |||
| 911 | Ga0068856_100259666 | |||
| 912 | Ga0068852_100024421 | |||
| 913 | Ga0068852_100095568 | |||
| 914 | Ga0068852_100109245 | |||
| 915 | Ga0068852_100309565 | |||
| 916 | Ga0068852_100371509 | |||
| 917 | Ga0068859_100000704 | |||
| 918 | Ga0068861_100071323 | |||
| 919 | Ga0068851_10001144 | |||
| 920 | Ga0068851_10022152 | |||
| 921 | Ga0068858_100399759 | |||
| 922 | Ga0068860_100250787 | |||
| 923 | Ga0068860_100386975 | |||
| 924 | Ga0068862_100001686 | |||
| 925 | Ga0075369_10034813 | |||
| 926 | Ga0075369_10043586 | |||
| 927 | Ga0097621_100034797 | |||
| 928 | Ga0097621_100499297 | |||
| 929 | Ga0068865_100001033 | |||
| 930 | Ga0097620_100000704 | |||
| 931 | Ga0105240_10003480 | |||
| 932 | Ga0105240_10005037 | |||
| 933 | Ga0105240_10014526 | |||
| 934 | Ga0105240_10018376 | |||
| 935 | Ga0105240_10112732 | |||
| 936 | Ga0105240_10280220 | |||
| 937 | Ga0105247_10018982 | |||
| 938 | Ga0105241_10041060 | |||
| 939 | Ga0105241_10178303 | |||
| 940 | Ga0105241_10560220 | |||
| 941 | Ga0105242_10002687 | |||
| 942 | Ga0105248_10010085 | |||
| 943 | Ga0105248_10125934 | |||
| 944 | Ga0105237_10000152 | |||
| 945 | Ga0105237_10054848 | |||
| 946 | Ga0105237_10055379 | |||
| 947 | Ga0105237_10059438 | |||
| 948 | Ga0105237_10101582 | |||
| 949 | Ga0105238_10000540 | |||
| 950 | Ga0105238_10014166 | |||
| 951 | Ga0105238_10051996 | |||
| 952 | Ga0105238_10062921 | |||
| 953 | Ga0105238_10106626 | |||
| 954 | Ga0105238_10113358 | |||
| 955 | Ga0105238_10150423 | |||
| 956 | Ga0105249_10000397 | |||
| 957 | Ga0105239_10000020 | |||
| 958 | Ga0105239_10002067 | |||
| 959 | Ga0105239_10018443 | |||
| 960 | Ga0105239_10021926 | |||
| 961 | Ga0105239_10065757 | |||
| 962 | Ga0105239_10074051 | |||
| 963 | Ga0105239_10092121 | |||
| 964 | Ga0105239_10160733 | |||
| 965 | Ga0105239_10207563 | |||
| 966 | Ga0157314_1000632 | |||
| 967 | Ga0157373_10004922 | |||
| 968 | Ga0157373_10014435 | |||
| 969 | Ga0157373_10083316 | |||
| 970 | Ga0157371_10004575 | |||
| 971 | Ga0157371_10009024 | |||
| 972 | Ga0157371_10108571 | |||
| 973 | Ga0157370_10002917 | |||
| 974 | Ga0157370_10006899 | |||
| 975 | Ga0157370_10019459 | |||
| 976 | Ga0157370_10029301 | |||
| 977 | Ga0157370_10186698 | |||
| 978 | Ga0157370_10191511 | |||
| 979 | Ga0157370_10387572 | |||
| 980 | Ga0157369_10000025 | |||
| 981 | Ga0157369_10010299 | |||
| 982 | Ga0157369_10015839 | |||
| 983 | Ga0157369_10035517 | |||
| 984 | Ga0157369_10218828 | |||
| 985 | Ga0157369_10322123 | |||
| 986 | Ga0157374_10099188 | |||
| 987 | Ga0157378_10000130 | |||
| 988 | Ga0157378_10607040 | |||
| 989 | Ga0163162_10000015 | |||
| 990 | Ga0163162_10006135 | |||
| 991 | Ga0163162_10006951 | |||
| 992 | Ga0163162_10164229 | |||
| 993 | Ga0157372_10004575 | |||
| 994 | Ga0157372_10007258 | |||
| 995 | Ga0157372_10007377 | |||
| 996 | Ga0157372_10050828 | |||
| 997 | Ga0157372_10062380 | |||
| 998 | Ga0157372_10076003 | |||
| 999 | Ga0157372_10906394 | |||
| 1000 | Ga0157375_10001402 | |||
| 1001 | Ga0157375_10004646 | |||
| 1002 | Ga0157375_10093170 | |||
| 1003 | Ga0163163_10000143 | |||
| 1004 | Ga0182008_10000899 | |||
| 1005 | Ga0182008_10018678 | |||
| 1006 | Ga0182008_10037194 | |||
| 1007 | Ga0157376_10036909 | |||
| 1008 | Ga0157376_10195451 | |||
| 1009 | Ga0157376_10310487 | |||
| 1010 | Ga0182006_1000072 | |||
| 1011 | Ga0182006_1001852 | |||
| 1012 | Ga0182006_1091044 | |||
| 1013 | Ga0182007_10011710 | |||
| 1014 | Ga0182007_10012397 | |||
| 1015 | Ga0182007_10026592 | |||
| 1016 | Ga0182005_1000080 | |||
| 1017 | Ga0182005_1000551 | |||
| 1018 | Ga0182005_1004616 | |||
| 1019 | Ga0182005_1020416 | |||
| 1020 | Ga0183369_1006 | |||
| 1021 | Ga0183368_1003 | |||
| 1022 | Ga0163161_10005653 | |||
| 1023 | Ga0206354_10548849 | |||
| 1024 | Ga0206354_11478949 | |||
| 1025 | Ga0206353_10099980 | |||
| 1026 | Ga0206353_11983330 | |||
| 1027 | Ga0209435_104917 | |||
| 1028 | Ga0209435_104988 | |||
| 1029 | Ga0209760_100210 | |||
| 1030 | Ga0209784_100068 | |||
| 1031 | Ga0209566_102599 | |||
| 1032 | Ga0209674_100012 | |||
| 1033 | Ga0209674_100119 | |||
| 1034 | Ga0209674_100514 | |||
| 1035 | Ga0209674_101641 | |||
| 1036 | Ga0209674_102919 | |||
| 1037 | Ga0209672_100007 | |||
| 1038 | Ga0209672_100016 | |||
| 1039 | Ga0209672_100058 | |||
| 1040 | Ga0209672_100357 | |||
| 1041 | Ga0209672_100963 | |||
| 1042 | Ga0209563_100051 | |||
| 1043 | Ga0207427_100033 | |||
| 1044 | Ga0207427_100156 | |||
| 1045 | Ga0207427_100312 | |||
| 1046 | Ga0207427_100334 | |||
| 1047 | Ga0209437_100105 | |||
| 1048 | Ga0209437_100126 | |||
| 1049 | Ga0209437_100139 | |||
| 1050 | Ga0209437_100147 | |||
| 1051 | Ga0209437_100154 | |||
| 1052 | Ga0209437_102097 | |||
| 1053 | Ga0209437_110221 | |||
| 1054 | Ga0209258_100012 | |||
| 1055 | Ga0209258_100046 | |||
| 1056 | Ga0209258_100049 | |||
| 1057 | Ga0209258_100095 | |||
| 1058 | Ga0209258_100245 | |||
| 1059 | Ga0209258_107072 | |||
| 1060 | Ga0209646_1000517 | |||
| 1061 | Ga0209646_1001172 | |||
| 1062 | Ga0209646_1004456 | |||
| 1063 | Ga0209026_1000099 | |||
| 1064 | Ga0209026_1000140 | |||
| 1065 | Ga0209026_1000405 | |||
| 1066 | Ga0209026_1000726 | |||
| 1067 | Ga0209026_1002617 | |||
| 1068 | Ga0209677_101338 | |||
| 1069 | Ga0209148_1000002 | |||
| 1070 | Ga0209148_1000010 | |||
| 1071 | Ga0209148_1000014 | |||
| 1072 | Ga0209148_1000039 | |||
| 1073 | Ga0209148_1000087 | |||
| 1074 | Ga0209148_1000098 | |||
| 1075 | Ga0209148_1002333 | |||
| 1076 | Ga0209759_1000316 | |||
| 1077 | Ga0209759_1000338 | |||
| 1078 | Ga0209759_1001070 | |||
| 1079 | Ga0209759_1006753 | |||
| 1080 | Ga0209129_1001605 | |||
| 1081 | Ga0209129_1002940 | |||
| 1082 | Ga0209233_1000009 | |||
| 1083 | Ga0209233_1000080 | |||
| 1084 | Ga0209233_1000083 | |||
| 1085 | Ga0209233_1000092 | |||
| 1086 | Ga0209233_1000191 | |||
| 1087 | Ga0209233_1025825 | |||
| 1088 | Ga0209455_1000010 | |||
| 1089 | Ga0209455_1000014 | |||
| 1090 | Ga0209455_1000034 | |||
| 1091 | Ga0209455_1000086 | |||
| 1092 | Ga0209455_1015163 | |||
| 1093 | Ga0209758_1004110 | |||
| 1094 | Ga0209758_1018206 | |||
| 1095 | Ga0209758_1023053 | |||
| 1096 | Ga0207656_10000907 | |||
| 1097 | Ga0207692_10036344 | |||
| 1098 | Ga0207680_10000013 | |||
| 1099 | Ga0207680_10072556 | |||
| 1100 | Ga0207647_10000029 | |||
| 1101 | Ga0207647_10001225 | |||
| 1102 | Ga0207647_10037439 | |||
| 1103 | Ga0207699_10152455 | |||
| 1104 | Ga0207705_10002035 | |||
| 1105 | Ga0207705_10005361 | |||
| 1106 | Ga0207705_10006840 | |||
| 1107 | Ga0207654_10000423 | |||
| 1108 | Ga0207707_10000380 | |||
| 1109 | Ga0207707_10014646 | |||
| 1110 | Ga0207707_10017519 | |||
| 1111 | Ga0207707_10032583 | |||
| 1112 | Ga0207707_10038162 | |||
| 1113 | Ga0207695_10001325 | |||
| 1114 | Ga0207695_10001580 | |||
| 1115 | Ga0207695_10005282 | |||
| 1116 | Ga0207695_10005709 | |||
| 1117 | Ga0207695_10007938 | |||
| 1118 | Ga0207695_10019900 | |||
| 1119 | Ga0207695_10036678 | |||
| 1120 | Ga0207695_10104456 | |||
| 1121 | Ga0207671_10000031 | |||
| 1122 | Ga0207671_10001506 | |||
| 1123 | Ga0207671_10018608 | |||
| 1124 | Ga0207671_10215670 | |||
| 1125 | Ga0207671_10385931 | |||
| 1126 | Ga0207693_10282053 | |||
| 1127 | Ga0207660_10111100 | |||
| 1128 | Ga0207657_10008885 | |||
| 1129 | Ga0207649_10006996 | |||
| 1130 | Ga0207649_10017262 | |||
| 1131 | Ga0207649_10047431 | |||
| 1132 | Ga0207649_10050424 | |||
| 1133 | Ga0207649_10059528 | |||
| 1134 | Ga0207652_10005420 | |||
| 1135 | Ga0207652_10098739 | |||
| 1136 | Ga0207694_10002048 | |||
| 1137 | Ga0207694_10002295 | |||
| 1138 | Ga0207694_10006873 | |||
| 1139 | Ga0207694_10057567 | |||
| 1140 | Ga0207650_10606128 | |||
| 1141 | Ga0207700_10000795 | |||
| 1142 | Ga0207664_10000239 | |||
| 1143 | Ga0207664_10095942 | |||
| 1144 | Ga0207690_10000586 | |||
| 1145 | Ga0207690_10000992 | |||
| 1146 | Ga0207690_10034557 | |||
| 1147 | Ga0207690_10064484 | |||
| 1148 | Ga0207690_10082299 | |||
| 1149 | Ga0207706_10052307 | |||
| 1150 | Ga0207686_10003899 | |||
| 1151 | Ga0207670_10003200 | |||
| 1152 | Ga0207669_10505496 | |||
| 1153 | Ga0207704_10000937 | |||
| 1154 | Ga0207691_10002689 | |||
| 1155 | Ga0207711_10037344 | |||
| 1156 | Ga0207689_10016448 | |||
| 1157 | Ga0207667_10001044 | |||
| 1158 | Ga0207667_10001074 | |||
| 1159 | Ga0207667_10002386 | |||
| 1160 | Ga0207667_10005225 | |||
| 1161 | Ga0207667_10007269 | |||
| 1162 | Ga0207667_10007692 | |||
| 1163 | Ga0207667_10273056 | |||
| 1164 | Ga0207712_10000843 | |||
| 1165 | Ga0207640_10000485 | |||
| 1166 | Ga0207640_10002635 | |||
| 1167 | Ga0207640_10019244 | |||
| 1168 | Ga0207640_10298746 | |||
| 1169 | Ga0207658_10000028 | |||
| 1170 | Ga0207658_10080038 | |||
| 1171 | Ga0207639_10000315 | |||
| 1172 | Ga0207639_10003518 | |||
| 1173 | Ga0207639_10007989 | |||
| 1174 | Ga0207639_10089944 | |||
| 1175 | Ga0207639_10170293 | |||
| 1176 | Ga0207639_10245351 | |||
| 1177 | Ga0207678_10000112 | |||
| 1178 | Ga0207678_10004531 | |||
| 1179 | Ga0207678_10024343 | |||
| 1180 | Ga0207678_10055903 | |||
| 1181 | Ga0207678_10141476 | |||
| 1182 | Ga0207702_10001547 | |||
| 1183 | Ga0207702_10006560 | |||
| 1184 | Ga0207641_10229369 | |||
| 1185 | Ga0207648_10156589 | |||
| 1186 | Ga0207674_10000685 | |||
| 1187 | Ga0207674_10050096 | |||
| 1188 | Ga0207674_10176265 | |||
| 1189 | Ga0207675_100141217 | |||
| 1190 | Ga0207698_10012151 | |||
| 1191 | Ga0207698_10015607 | |||
| 1192 | Ga0207698_10071842 | |||
| 1193 | Ga0268266_10000001 | |||
| 1194 | Ga0268266_10000021 | |||
| 1195 | Ga0268266_10280941 | |||
| 1196 | Ga0268265_10000131 | |||
| 1197 | Ga0268264_10003643 | |||
| 1198 | Ga0268264_10484936 | |||
| 1199 | Ga0268264_10548486 | |||
| 1200 | Ga0307508_10014069 | |||
| 1201 | Ga0316575_10001810 | |||
| 1202 | Ga0316575_10020315 | |||
| 1203 | Ga0316575_10120670 | |||
| 1204 | Ga0316579_10000114 | |||
| 1205 | Ga0316576_10124892 | |||
| 1206 | Ga0316576_10195644 | |||
| 1207 | Ga0307516_10062132 | |||
| 1208 | Ga0316577_10038005 | |||
| 1209 | Ga0316577_10047768 | |||
| 1210 | Ga0307412_10000917 | |||
| 1211 | Ga0307409_100197930 | |||
| 1212 | Ga0316585_10003820 | |||
| 1213 | Ga0316580_10007241 | |||
| 1214 | Ga0316580_10011121 | |||
| 1215 | Ga0316593_10002104 | |||
| 1216 | Ga0316593_10002604 | |||
| 1217 | Ga0307507_10015315 | |||
| 1218 | Ga0307510_10000977 | |||
| 1219 | Ga0307510_10159835 | |||
| 1220 | Ga0316596_1001142 | |||
| 1221 | Ga0316596_1001867 | |||
| 1222 | Ga0316574_0000172 | |||
| 1223 | Ga0373937_0306011 | |||
| 1224 | Ga0316582_0010909 | |||
| 1225 | Ga0316584_0044035 | |||
| 1226 | Ga0395899_0000175 | |||
| 1227 | Ga0395899_0007904 | |||
| 1228 | Ga0395899_0030704 | |||
| 1229 | Ga0395899_0090203 | |||
| 1230 | Ga0395899_0156999 | |||
| 1231 | Ga0395900_0000012 | |||
| 1232 | Ga0395900_0000059 | |||
| 1233 | Ga0395900_0004207 | |||
| 1234 | Ga0395900_0004359 | |||
| 1235 | Ga0395900_0030705 | |||
| 1236 | Ga0395898_0000034 | |||
| 1237 | Ga0395898_0001311 | |||
| 1238 | Ga0395898_0006426 | |||
| 1239 | Ga0395898_0008278 | |||
| 1240 | Ga0395898_0074040 | |||
| 1241 | Ga0395898_0367324 | |||
| 1242 | Ga0395901_0000816 | |||
| 1243 | Ga0395901_0006163 | |||
| 1244 | Ga0395901_0009331 | |||
| 1245 | Ga0395901_0010234 | |||
| 1246 | Ga0395901_0050339 | |||
| 1247 | Ga0395901_0185453 | |||
| 1248 | Ga0395901_0329463 | |||
| 1249 | Ga0395901_0432333 | |||
| 1250 | Ga0439436_0000067 | |||
| 1251 | Ga0439465_0001040 | |||
| 1252 | Ga0451793_0739495 | |||
| 1253 | Ga0451797_0261258 | |||
| 1254 | Ga0451807_0171222 | |||
| 1255 | Ga0451807_0309039 | |||
| 1256 | Ga0451833_0446148 | |||
| 1257 | Ga0451853_0953777 | |||
| 1258 | Ga0451853_1433675 | |||
| 1259 | Ga0439437_001633 | |||
| 1260 | Ga0450908_001144 | |||
| 1261 | Ga0439459_0000055 | |||
| 1262 | Ga0451577_0204182 | |||
| 1263 | Ga0466969_0011574 | |||
| 1264 | Ga0466969_0020653 | |||
| 1265 | Ga0466972_0005739 | |||
| 1266 | Ga0466972_0047788 | |||
| 1267 | Ga0466975_0180042 | |||
| 1268 | Ga0466989_0018571 | |||
| 1269 | Ga0466982_0000013 | |||
| 1270 | Ga0466965_0002807 | |||
| 1271 | Ga0466965_0117981 | |||
| 1272 | Ga0466966_0004686 | |||
| 1273 | Ga0466966_0014630 | |||
| 1274 | Ga0466966_0020702 | |||
| 1275 | Ga0466961_0000967 | |||
| 1276 | Ga0466961_0013541 | |||
| 1277 | Ga0466961_0017074 | |||
| 1278 | Ga0466961_0028265 | |||
| 1279 | Ga0466963_0174554 | |||
| 1280 | Ga0466971_0022747 | |||
| 1281 | Ga0466971_0027748 | |||
| 1282 | Ga0466968_0002450 | |||
| 1283 | Ga0466968_0013890 | |||
| 1284 | Ga0466970_0010342 | |||
| 1285 | Ga0466957_0047688 | |||
| 1286 | Ga0466957_0128323 | |||
| 1287 | Ga0466960_0005543 | |||
| 1288 | Ga0466959_0000068 | |||
| 1289 | Ga0466959_0020265 | |||
| 1290 | Ga0466959_0062198 | |||
| 1291 | Ga0466958_0049101 | |||
| 1292 | Ga0466958_0101272 | |||
| 1293 | Ga0466967_0261737 | |||
| 1294 | Ga0495617_000117 | |||
| 1295 | Ga0495638_0000007 | |||
| 1296 | Ga0495638_0000899 | |||
| 1297 | Ga0495638_0001952 | |||
| 1298 | Ga0495638_0001995 | |||
| 1299 | Ga0495638_0018140 | |||
| 1300 | Ga0495650_0000497 | |||
| 1301 | Ga0495650_0000585 | |||
| 1302 | Ga0495650_0003111 | |||
| 1303 | Ga0495582_0055392 | |||
| 1304 | Ga0495584_0003980 | |||
| 1305 | Ga0495585_0008658 | |||
| 1306 | Ga0495585_0013229 | |||
| 1307 | Ga0495607_0000088 | |||
| 1308 | Ga0495607_0000122 | |||
| 1309 | Ga0495606_0000298 | |||
| 1310 | Ga0495606_0001210 | |||
| 1311 | Ga0495606_0004779 | |||
| 1312 | Ga0495606_0078069 | |||
| 1313 | Ga0495606_0089144 | |||
| 1314 | Ga0495610_0004565 | |||
| 1315 | Ga0495610_0015527 | |||
| 1316 | Ga0495616_0000565 | |||
| 1317 | Ga0495620_0005019 | |||
| 1318 | Ga0495631_0001445 | |||
| 1319 | Ga0495631_0003807 | |||
| 1320 | Ga0495632_0000004 | |||
| 1321 | Ga0495632_0038310 | |||
| 1322 | Ga0495632_0052398 | |||
| 1323 | Ga0495632_0113406 | |||
| 1324 | Ga0495632_0176962 | |||
| 1325 | Ga0495648_0005079 | |||
| 1326 | Ga0495648_0009504 | |||
| 1327 | Ga0495665_0085971 | |||
| 1328 | Ga0495586_0117970 | |||
| 1329 | Ga0495609_0003579 | |||
| 1330 | Ga0495597_0104277 | |||
| 1331 | Ga0495622_0012969 | |||
| 1332 | Ga0495668_0012112 | |||
| 1333 | Ga0495611_0000001 | |||
| 1334 | Ga0495611_0000060 | |||
| 1335 | Ga0495625_0000022 | |||
| 1336 | Ga0495625_0016189 | |||
| 1337 | Ga0495625_0022701 | |||
| 1338 | Ga0495625_0097090 | |||
| 1339 | Ga0495661_0003615 | |||
| 1340 | Ga0495670_0007331 | |||
| 1341 | Ga0495671_0004741 | |||
| 1342 | Ga0495649_0013114 | |||
| 1343 | Ga0495589_0000137 | |||
| 1344 | Ga0495660_0000728 | |||
| 1345 | Ga0495660_0003021 | |||
| 1346 | Ga0495672_0081196 | |||
| 1347 | Ga0495683_0006531 | |||
| 1348 | Ga0495679_000004 | |||
| 1349 | Ga0495673_0000202 | |||
| 1350 | Ga0495673_0000749 | |||
| 1351 | Ga0495681_0070594 | |||
| 1352 | Ga0495686_0000017 | |||
| 1353 | Ga0495686_0001035 | |||
| 1354 | Ga0495686_0002896 | |||
| 1355 | Ga0495686_0024798 | |||
| 1356 | Ga0495626_0153914 | |||
| 1357 | Ga0496100_0001258 | |||
| 1358 | Ga0496101_0000491 | |||
| 1359 | Ga0496102_0032706 | |||
| 1360 | Ga0496102_0083022 | |||
| 1361 | Ga0496102_0228311 | |||
| 1362 | Ga0496103_0032821 | |||
| 1363 | Ga0496104_0000016 | |||
| 1364 | Ga0496104_0669353 | |||
| 1365 | Ga0496105_0000010 | |||
| 1366 | Ga0496105_0000871 | |||
| 1367 | Ga0496106_0005789 | |||
| 1368 | Ga0496115_0000025 | |||
| 1369 | Ga0496115_0013784 | |||
| 1370 | Ga0496115_0029462 | |||
| 1371 | Ga0496115_0037030 | |||
| 1372 | Ga0496115_0251320 | |||
| 1373 | Ga0496116_0079482 | |||
| 1374 | Ga0496117_0004951 | |||
| 1375 | Ga0496117_0011610 | |||
| 1376 | Ga0496118_0000429 | |||
| 1377 | Ga0496118_0002079 | |||
| 1378 | Ga0496118_0002476 | |||
| 1379 | Ga0496118_0006655 | |||
| 1380 | Ga0496118_0015454 | |||
| 1381 | Ga0496118_0034247 | |||
| 1382 | Ga0496118_0053587 | |||
| 1383 | Ga0496118_0060887 | |||
| 1384 | Ga0496118_0242450 | |||
| 1385 | Ga0496119_0000058 | |||
| 1386 | Ga0496119_0039545 | |||
| 1387 | Ga0496120_0001252 | |||
| 1388 | Ga0496120_0001892 | |||
| 1389 | Ga0496121_0000045 | |||
| 1390 | Ga0496121_0000401 | |||
| 1391 | Ga0496121_0002752 | |||
| 1392 | Ga0496121_0009537 | |||
| 1393 | Ga0496121_0028054 | |||
| 1394 | Ga0496121_0034962 | |||
| 1395 | Ga0496121_0037826 | |||
| 1396 | Ga0496121_0046023 | |||
| 1397 | Ga0496121_0115688 | |||
| 1398 | Ga0496121_0117684 | |||
| 1399 | Ga0496121_0179141 | |||
| 1400 | Ga0496122_0000759 | |||
| 1401 | Ga0496122_0017227 | |||
| 1402 | Ga0496122_0067213 | |||
| 1403 | Ga0496123_0001142 | |||
| 1404 | Ga0496123_0003690 | |||
| 1405 | Ga0496123_0016381 | |||
| 1406 | Ga0496123_0030669 | |||
| 1407 | Ga0496124_0028363 | |||
| 1408 | Ga0496124_0057811 | |||
| 1409 | Ga0496125_0000137 | |||
| 1410 | Ga0496125_0018170 | |||
| 1411 | Ga0496126_0001102 | |||
| 1412 | Ga0496126_0047577 | |||
| 1413 | Ga0496126_0069008 | |||
| 1414 | Ga0496126_0121900 | |||
| 1415 | Ga0496126_0242597 | |||
| 1416 | Ga0496126_0349516 | |||
| 1417 | Ga0495678_000099 | |||
| 1418 | Ga0495678_041137 | |||
| 1419 | Ga0495682_0032976 | |||
| 1420 | Ga0501031_0005632 | |||
| 1421 | Ga0501032_0001939 | |||
| 1422 | Ga0501032_0014972 | |||
| 1423 | Ga0501033_0005614 | |||
| 1424 | Ga0501033_0007452 | |||
| 1425 | Ga0501033_0025649 | |||
| 1426 | Ga0501033_0079699 | |||
| 1427 | Ga0501034_0000605 | |||
| 1428 | Ga0501034_0003067 | |||
| 1429 | Ga0501034_0004478 | |||
| 1430 | Ga0501034_0017499 | |||
| 1431 | Ga0501034_0021485 | |||
| 1432 | Ga0501036_0015834 | |||
| 1433 | Ga0501036_0056431 | |||
| 1434 | Ga0501036_0523104 | |||
| 1435 | Ga0501037_0001394 | |||
| 1436 | Ga0501037_0015899 | |||
| 1437 | Ga0501037_0039752 | |||
| 1438 | Ga0501037_0362493 | |||
| 1439 | Ga0501038_0000141 | |||
| 1440 | Ga0501038_0009677 | |||
| 1441 | Ga0501038_0069413 | |||
| 1442 | Ga0501038_0103298 | |||
| 1443 | Ga0501039_0010357 | |||
| 1444 | Ga0501039_0087333 | |||
| 1445 | Ga0501042_0104785 | |||
| 1446 | Ga0501043_0000840 | |||
| 1447 | Ga0501043_0005095 | |||
| 1448 | Ga0501043_0013050 | |||
| 1449 | Ga0501043_0025582 | |||
| 1450 | Ga0501043_0071548 | |||
| 1451 | Ga0501043_0138949 | |||
| 1452 | Ga0501043_0436075 | |||
| 1453 | Ga0501046_0012566 | |||
| 1454 | Ga0501046_0014090 | |||
| 1455 | Ga0501046_0115571 | |||
| 1456 | Ga0501046_0116612 | |||
| 1457 | Ga0501046_0141965 | |||
| 1458 | Ga0501047_0002983 | |||
| 1459 | Ga0501047_0004063 | |||
| 1460 | Ga0501047_0008730 | |||
| 1461 | Ga0501047_0010205 | |||
| 1462 | Ga0501047_0011872 | |||
| 1463 | Ga0501047_0025393 | |||
| 1464 | Ga0501047_0085696 | |||
| 1465 | Ga0501047_0251583 | |||
| 1466 | Ga0501047_0292364 | |||
| 1467 | Ga0501047_0300140 | |||
| 1468 | Ga0501047_0364304 | |||
| 1469 | Ga0501048_0025027 | |||
| 1470 | Ga0501048_0075485 | |||
| 1471 | Ga0501067_0003110 | |||
| 1472 | Ga0501068_0001426 | |||
| 1473 | Ga0501068_0129083 | |||
| 1474 | Ga0501069_0003434 | |||
| 1475 | Ga0501069_0035758 | |||
| 1476 | Ga0501069_0152380 | |||
| 1477 | Ga0501070_0003984 | |||
| 1478 | Ga0501070_0005506 | |||
| 1479 | Ga0501070_0013239 | |||
| 1480 | Ga0501070_0016391 | |||
| 1481 | Ga0501070_0042286 | |||
| 1482 | Ga0501070_0080309 | |||
| 1483 | Ga0501071_0026570 | |||
| 1484 | Ga0501072_0007222 | |||
| 1485 | Ga0501072_0087685 | |||
| 1486 | Ga0501073_0000072 | |||
| 1487 | Ga0501073_0012859 | |||
| 1488 | Ga0501073_0014820 | |||
| 1489 | Ga0501073_0022162 | |||
| 1490 | Ga0501073_0074253 | |||
| 1491 | Ga0501073_0086040 | |||
| 1492 | Ga0501074_0002293 | |||
| 1493 | Ga0501074_0011165 | |||
| 1494 | Ga0501074_0017385 | |||
| 1495 | Ga0501074_0019544 | |||
| 1496 | Ga0501074_0029972 | |||
| 1497 | Ga0501079_0039248 | |||
| 1498 | Ga0501079_0044763 | |||
| 1499 | Ga0501079_0254786 | |||
| 1500 | Ga0501080_0000097 | |||
| 1501 | Ga0501080_0000554 | |||
| 1502 | Ga0501080_0003092 | |||
| 1503 | Ga0501080_0012182 | |||
| 1504 | Ga0501080_0027360 | |||
| 1505 | Ga0501080_0105298 | |||
| 1506 | Ga0501080_0121722 | |||
| 1507 | Ga0501083_0000128 | |||
| 1508 | Ga0501083_0305659 | |||
| 1509 | Ga0501035_0001437 | |||
| 1510 | Ga0501035_0003810 | |||
| 1511 | Ga0501035_0021748 | |||
| 1512 | Ga0501035_0035960 | |||
| 1513 | Ga0501035_0043309 | |||
| 1514 | Ga0501035_0050847 | |||
| 1515 | Ga0501035_0074266 | |||
| 1516 | Ga0501035_0174472 | |||
| 1517 | Ga0501035_0198430 | |||
| 1518 | Ga0501044_0003555 | |||
| 1519 | Ga0501044_0003906 | |||
| 1520 | Ga0501044_0005029 | |||
| 1521 | Ga0501044_0012166 | |||
| 1522 | Ga0501044_0013452 | |||
| 1523 | Ga0501044_0015582 | |||
| 1524 | Ga0501044_0038033 | |||
| 1525 | Ga0501044_0044762 | |||
| 1526 | Ga0501044_0084014 | |||
| 1527 | Ga0501044_0203046 | |||
| 1528 | Ga0501044_0319870 | |||
| 1529 | nmdc:mga0sz30_64337_c1 | |||
| 1530 | Ga0500610_0003839 | |||
| 1531 | Ga0500643_000118 | |||
| 1532 | Ga0500643_003789 | |||
| 1533 | Ga0500651_0000245 | |||
| 1534 | Ga0500651_0042127 | |||
| 1535 | Ga0500555_001900 | |||
| 1536 | Ga0500597_000179 | |||
| 1537 | Ga0500633_0003671 | |||
| 1538 | Ga0500645_001641 | |||
| 1539 | Ga0501082_0057705 | |||
| 1540 | Ga0466962_0003530 | |||
| 1541 | Ga0466962_0007751 | |||
| 1542 | 2525555823 | |||
| 1543 | 2538833033 | |||
| 1544 | 2595446722 | |||
| 1545 | 2595451777 | |||
| 1546 | 2630650837 | |||
| 1547 | 2643830895 | |||
| 1548 | 2643894163 | |||
| 1549 | 2644476365 | |||
| 1550 | 2721026632 | |||
| 1551 | 2735833375 | |||
| 1552 | 2739229372 | |||
| 1553 | 2739731932 | |||
| 1554 | 2819563813 | |||
| 1555 | 2842917886 | |||
| 1556 | 2842919754 | |||
| 1557 | 2884341368 | |||
| 1558 | 2884413337 | |||
| 1559 | 2895396919 | |||
| 1560 | 2904463876 | |||
| 1561 | 2919087608 | |||
| 1562 | 2919404858 | |||
| 1563 | 2928964630 | |||
| 1564 | 2939614278 | |||
| 1565 | 2941472826 | |||
| 1566 | 2953995055 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3vav-assembly1.cif.gz_J | crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia thailandensis | 0.9526 | 29 | 260 |
| 1o68-assembly1.cif.gz_B | crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase | 0.9502 | 30 | 260 |
| 1m3u-assembly1.cif.gz_I | crystal structure of ketopantoate hydroxymethyltransferase complexed the product ketopantoate | 0.9463 | 31 | 261 |
| 3vav-assembly1.cif.gz_A | crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia thailandensis | 0.9423 | 29 | 260 |
| 3vav-assembly1.cif.gz_B | crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia thailandensis | 0.9409 | 29 | 260 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3vavB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9409 | 29 | 260 | 3.20.20.60 |
| af_A0A1D6NS82_272_361_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8612 | 120 | 175 | 3.20.20.70 |
| 3vavB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.8389 | 29 | 260 | 3.20.20.60 |
| af_Q9AWZ7_81_360_3.20.20.60 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.8238 | 30 | 258 | 3.20.20.60 |
| af_A0A0R0J726_27_197_3.20.20.60 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.8209 | 30 | 161 | 3.20.20.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C5N9A7-F1-model_v4 | 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) | 0.9675 | 120 | 260 |
GO:0000287
GO:0003864 GO:0005737 GO:0015940 |
| AF-A0A831RG02-F1-model_v4 | 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) | 0.9673 | 135 | 261 |
GO:0000287
GO:0003864 GO:0005737 GO:0015940 |
| AF-A0A1A9UKG6-F1-model_v4 | 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) | 0.9635 | 120 | 261 |
GO:0003864
GO:0008168 GO:0015940 |
| AF-A0A3B9L557-F1-model_v4 | 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) | 0.9619 | 120 | 260 |
GO:0000287
GO:0003864 GO:0005737 GO:0008168 GO:0015940 GO:0032259 |
| AF-A0A2E8GWJ6-F1-model_v4 | 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) (Ketopantoate hydroxymethyltransferase) (KPHMT) | 0.9613 | 32 | 260 |
GO:0000287
GO:0003864 GO:0005737 GO:0008168 GO:0015940 GO:0032259 |