F480673

General Info

Members Datasets Scaffolds Average Seq Length
783 435 1566 514

Family's Representative Sequence

Representative Sequence 3300046675|Ga0495657_0078484|Ga0495657_0078484_477_2102
Length 509
Sequence MNGIDGGIGVVELSRLQFALTALYHFLFVPLTLGLSVILAIMESVYVMTGRRIWRDITMFWGILFTMEFQFGTNWSYYSHYVGDVFGAPLAIEGLMAFFLEATFIGLFFFGWDRLSKPGHLAVTWCVAFGSNFSALWILIANAWMQHPVGSRFNPETMRMEVTDFFAVLFNPVAQSKFVHTVSAGYVTGSVFVLAISAWYLLRGRHLEIARRSMTVAASFGLASALSVVVLGDESGYETTQNQKMKLAAMEAMWHTEPAPAPFTIFGLPDQKERVTHARIQIPWALGLIATRSISQPVPGISELVEQAKGRIRQGIEAYTAVQQLRRNPKDDAARRALDARQDDLGYAMLLRRYVDDPAKATEPQIEQAATLFWSFRLMVGLGFYFIALFAVMFYVAARRQLDRRRWLLRLAFYSLPLPWIRQPWIIEGVLPTFLAASPVPVWNVWISLLGFVLFYTVLLVVDLYLMIKYARLGPTETWEVPDMATRHAPPGGMVVDRETLHPHPRPAE

Samples

Sample ID Description Type Environment
1 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
60 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
82 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
83 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
84 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
85 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
86 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
95 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
98 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
127 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
131 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
134 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
135 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
139 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
140 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
150 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
151 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
152 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
154 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
166 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
170 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
171 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
172 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
173 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
174 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
175 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
178 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
179 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
180 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
181 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
182 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
183 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
184 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
185 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
189 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
190 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
191 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
194 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
195 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
196 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
197 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
198 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
199 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
200 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
201 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
202 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
203 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
204 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
205 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
206 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
209 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
214 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
217 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
218 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
219 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
223 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
224 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
225 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
226 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
227 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
228 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
248 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
251 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
252 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
256 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
268 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
272 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
273 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
283 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
284 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
288 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
289 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
290 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
291 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
292 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
293 2547132181 Kosakonia sacchari SP1 Isolate Stem
294 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
295 2561511199 Enterobacter sp. R4-368 Isolate Nodule
296 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
297 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
298 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
299 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
300 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
301 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
302 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
303 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
304 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
305 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
306 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
307 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
308 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
309 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
310 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
311 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
312 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
313 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
314 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
315 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
316 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
317 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
318 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
319 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
320 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
321 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
322 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
323 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
324 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
325 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
326 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
327 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
328 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
329 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
330 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
331 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
332 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
333 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
334 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
335 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
336 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
337 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
338 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
339 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
340 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
341 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
342 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
343 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
344 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
345 2636415599 Klebsiella variicola DX120E Isolate Unclassified
346 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
347 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
348 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
349 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
350 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
351 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
352 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
353 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
354 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
355 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
356 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
357 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
358 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
359 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
360 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
361 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
362 2751185917 Enterobacter sp. HK169 Isolate Unclassified
363 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
364 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
365 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
366 2775507074 Klebsiella sp. D5A Isolate Unclassified
367 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
368 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
369 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
370 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
371 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
372 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
373 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
374 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
375 2821118458 Enterobacter asburiae 609 Isolate Unclassified
376 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
377 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
378 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
379 2847085930 Erwinia persicina B64 Isolate Bulb
380 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
381 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
382 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
383 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
384 2865014394 Pantoea sp. R-71966 Isolate Unclassified
385 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
386 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
387 2876601092 Pantoea endophytica 596 Isolate Unclassified
388 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
389 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
390 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
391 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
392 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
393 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
394 2904504865 Serratia marcescens 1822 Isolate Unclassified
395 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
396 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
397 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
398 2919150387 Rahnella aceris 1817 Isolate Unclassified
399 2919675420 Luteimonas terrae 4099 Isolate Unclassified
400 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
401 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
402 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
403 2927143783 Rahnella sp. 2050 Isolate Unclassified
404 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
405 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
406 2937539931 Pantoea sp. LS15 Isolate Unclassified
407 2937967321 Serratia sp. YC16 Isolate Unclassified
408 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
409 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
410 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
411 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
412 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
413 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
414 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
415 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
416 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
417 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
418 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
419 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
420 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
421 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
422 640753048 Serratia proteamaculans 568 Isolate Endosphere
423 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
424 8004592986 Serratia sp. S119 Isolate Unclassified
425 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
426 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
427 8018221730 Enterobacter sp. CM29 Isolate Unclassified
428 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
429 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
430 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
431 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
432 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
433 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
434 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
435 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.95
Metatranscriptomes 0.64
Isolates 19.41

Biome Distribution

Category Percentage (%)
Aerial Root 0.51
Bulb 0.13
Endosphere 4.34
Nodule 1.15
Rhizoplane 10.6
Rhizosphere 63.35
Stem 0.13
Stem Tuber 0.77
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495657_0078484 3300046675 Bacteria 2140
2 RicEn_C5844 2010549000 Bacteria 1941
3 JGI25162J39368_1000003 3300002737 Bacteria 575218
4 JGI25163J39215_1000007 3300002771 Bacteria 113612
5 JGI25164J39214_1000014 3300002772 Bacteria 219691
6 JGI25152J39213_1000329 3300002773 Bacteria 30338
7 JGI25153J46596_10003384 3300003215 Bacteria 8945
8 rootH2_10019625 3300003320 Bacteria 6208
9 Ga0055538_1000005 3300003751 Bacteria 575218
10 Ga0055539_1000007 3300003752 Bacteria 575218
11 Ga0055533_1000009 3300003756 Bacteria 575218
12 Ga0055525_1000010 3300003759 Bacteria 575218
13 Ga0055541_1000005 3300003841 Bacteria 575218
14 Ga0058692_1000808 3300003856 Bacteria 12462
15 Ga0058692_1003490 3300003856 Bacteria 4847
16 Ga0065704_10001970 3300005289 Bacteria 12114
17 Ga0065704_10002600 3300005289 Bacteria 4957
18 Ga0065707_10082478 3300005295 Bacteria 14636
19 Ga0070690_100019111 3300005330 Bacteria 4153
20 Ga0070670_100028503 3300005331 Bacteria 4806
21 Ga0070666_10027464 3300005335 Bacteria 3728
22 Ga0070666_10030479 3300005335 Bacteria 3554
23 Ga0070680_100000408 3300005336 Bacteria 29300
24 Ga0070689_100066496 3300005340 Bacteria 2808
25 Ga0070668_100009230 3300005347 Bacteria 7314
26 Ga0070671_100002529 3300005355 Bacteria 14159
27 Ga0070671_100047551 3300005355 Bacteria 3567
28 Ga0070659_100007694 3300005366 Bacteria 7836
29 Ga0070659_100121494 3300005366 Bacteria 2116
30 Ga0070667_100000043 3300005367 Bacteria 167034
31 Ga0070667_100019370 3300005367 Bacteria 5645
32 Ga0070667_100069642 3300005367 Bacteria 2994
33 Ga0070709_10000184 3300005434 Bacteria 39762
34 Ga0070709_10108031 3300005434 Bacteria 1866
35 Ga0070713_100000882 3300005436 Bacteria 19204
36 Ga0070678_100002323 3300005456 Bacteria 10385
37 Ga0070681_10000003 3300005458 Bacteria 252785
38 Ga0070685_10061141 3300005466 Bacteria 2205
39 Ga0070679_100000541 3300005530 Bacteria 32093
40 Ga0070684_100036941 3300005535 Bacteria 4188
41 Ga0068853_100002126 3300005539 Bacteria 14738
42 Ga0070686_100007898 3300005544 Bacteria 5949
43 Ga0070665_100000199 3300005548 Bacteria 105924
44 Ga0070665_100010430 3300005548 Bacteria 9401
45 Ga0070665_100015224 3300005548 Bacteria 7721
46 Ga0068855_100000006 3300005563 Bacteria 298092
47 Ga0068855_100021482 3300005563 Bacteria 7741
48 Ga0068855_100233370 3300005563 Bacteria 2059
49 Ga0070664_100001502 3300005564 Bacteria 18596
50 Ga0068857_100106500 3300005577 Bacteria 2518
51 Ga0068856_100000182 3300005614 Bacteria 65421
52 Ga0068856_100000276 3300005614 Bacteria 55917
53 Ga0068852_100020529 3300005616 Bacteria 5254
54 Ga0068859_100027497 3300005617 Bacteria 5705
55 Ga0068864_100038174 3300005618 Bacteria 4100
56 Ga0068863_100001860 3300005841 Bacteria 20979
57 Ga0068858_100009966 3300005842 Bacteria 9022
58 Ga0068858_100107818 3300005842 Bacteria 2600
59 Ga0068860_100000185 3300005843 Bacteria 99579
60 Ga0068860_100004398 3300005843 Bacteria 14394
61 Ga0068860_100037638 3300005843 Bacteria 4631
62 Ga0068860_100160076 3300005843 Bacteria 2170
63 Ga0075364_10023775 3300006051 Bacteria 3882
64 Ga0075364_10034360 3300006051 Bacteria 3270
65 Ga0070715_10002694 3300006163 Bacteria 5506
66 Ga0070715_10043688 3300006163 Bacteria 1891
67 Ga0070712_100000026 3300006175 Bacteria 77190
68 Ga0070712_100020697 3300006175 Bacteria 4307
69 Ga0075366_10004030 3300006195 Bacteria 7854
70 Ga0097621_100008048 3300006237 Bacteria 7567
71 Ga0068871_100056797 3300006358 Bacteria 3183
72 Ga0075434_100072903 3300006871 Bacteria 3426
73 Ga0068865_100016921 3300006881 Bacteria 4678
74 Ga0075436_100000063 3300006914 Bacteria 64417
75 Ga0075436_100055880 3300006914 Bacteria 2727
76 Ga0097620_100027497 3300006931 Bacteria 5705
77 Ga0079104_1001292 3300006946 Bacteria 17270
78 Ga0079104_1019879 3300006946 Bacteria 1864
79 Ga0075435_100126749 3300007076 Bacteria 2134
80 Ga0105251_10001518 3300009011 Bacteria 19945
81 Ga0105251_10038629 3300009011 Bacteria 2338
82 Ga0105251_10066205 3300009011 Bacteria 1689
83 Ga0105244_10000006 3300009036 Bacteria 357997
84 Ga0105244_10002108 3300009036 Bacteria 15294
85 Ga0105244_10005410 3300009036 Bacteria 8495
86 Ga0105244_10050345 3300009036 Bacteria 2125
87 Ga0105250_10000003 3300009092 Bacteria 547770
88 Ga0105250_10000026 3300009092 Bacteria 213233
89 Ga0105250_10000861 3300009092 Bacteria 17902
90 Ga0105250_10000873 3300009092 Bacteria 17814
91 Ga0105250_10002960 3300009092 Bacteria 8266
92 Ga0105250_10015489 3300009092 Bacteria 3122
93 Ga0105250_10017877 3300009092 Bacteria 2879
94 Ga0105250_10038056 3300009092 Bacteria 1930
95 Ga0105240_10000287 3300009093 Bacteria 98443
96 Ga0105240_10000357 3300009093 Bacteria 85936
97 Ga0105240_10005351 3300009093 Bacteria 19146
98 Ga0105240_10015450 3300009093 Bacteria 10381
99 Ga0105240_10021990 3300009093 Bacteria 8472
100 Ga0105245_10005574 3300009098 Bacteria 11064
101 Ga0105245_10011980 3300009098 Bacteria 7540
102 Ga0105247_10001108 3300009101 Bacteria 20064
103 Ga0105247_10005233 3300009101 Bacteria 8192
104 Ga0105241_10025051 3300009174 Bacteria 4433
105 Ga0105241_10078213 3300009174 Bacteria 2584
106 Ga0105242_10026325 3300009176 Bacteria 4609
107 Ga0105242_10090268 3300009176 Bacteria 2577
108 Ga0105248_10021653 3300009177 Bacteria 7120
109 Ga0105248_10071852 3300009177 Bacteria 3888
110 Ga0105237_10154950 3300009545 Bacteria 2288
111 Ga0105238_10014086 3300009551 Bacteria 8085
112 Ga0105238_10018343 3300009551 Bacteria 7121
113 Ga0105238_10027731 3300009551 Bacteria 5773
114 Ga0105239_10012041 3300010375 Bacteria 9644
115 Ga0105239_10027113 3300010375 Bacteria 6307
116 Ga0105246_10002049 3300011119 Bacteria 12146
117 Ga0105246_10007027 3300011119 Bacteria 6890
118 Ga0157373_10001277 3300013100 Bacteria 19254
119 Ga0157373_10002523 3300013100 Bacteria 13935
120 Ga0157373_10003329 3300013100 Bacteria 12140
121 Ga0157373_10016116 3300013100 Bacteria 5455
122 Ga0157371_10000167 3300013102 Bacteria 95585
123 Ga0157371_10001411 3300013102 Bacteria 25041
124 Ga0157371_10001794 3300013102 Bacteria 21713
125 Ga0157371_10004005 3300013102 Bacteria 13051
126 Ga0157370_10000093 3300013104 Bacteria 101308
127 Ga0157370_10003123 3300013104 Bacteria 19615
128 Ga0157370_10008772 3300013104 Bacteria 10869
129 Ga0157370_10029417 3300013104 Bacteria 5391
130 Ga0157369_10001855 3300013105 Bacteria 25533
131 Ga0157369_10082534 3300013105 Bacteria 3438
132 Ga0157374_10005805 3300013296 Bacteria 10426
133 Ga0163162_10012254 3300013306 Bacteria 8367
134 Ga0163162_10064722 3300013306 Bacteria 3701
135 Ga0163162_10099014 3300013306 Bacteria 3006
136 Ga0163162_10108326 3300013306 Bacteria 2874
137 Ga0157372_10006015 3300013307 Bacteria 12885
138 Ga0157372_10008044 3300013307 Bacteria 11213
139 Ga0157372_10068022 3300013307 Bacteria 4004
140 Ga0157372_10074215 3300013307 Bacteria 3835
141 Ga0157372_10092567 3300013307 Bacteria 3439
142 Ga0157375_10021458 3300013308 Bacteria 5923
143 Ga0163163_10076754 3300014325 Bacteria 3337
144 Ga0157379_10009588 3300014968 Bacteria 8433
145 Ga0157379_10010119 3300014968 Bacteria 8224
146 Ga0157379_10012676 3300014968 Bacteria 7368
147 Ga0157379_10015107 3300014968 Bacteria 6772
148 Ga0157379_10045788 3300014968 Bacteria 3905
149 Ga0182006_1000063 3300015261 Bacteria 154042
150 Ga0182005_1014557 3300015265 Bacteria 2200
151 Ga0183366_1001 3300015679 Bacteria 2743932
152 Ga0183370_1001 3300015680 Bacteria 2743932
153 Ga0183369_1001 3300015685 Bacteria 2743932
154 Ga0183368_1001 3300015687 Bacteria 2743932
155 Ga0213876_10000095 3300021384 Bacteria 99902
156 Ga0209760_100001 3300025207 Bacteria 348781
157 Ga0209784_100001 3300025224 Bacteria 3600592
158 Ga0209566_100001 3300025225 Bacteria 3600765
159 Ga0209674_100002 3300025226 Bacteria 3600592
160 Ga0209563_100008 3300025230 Bacteria 1554545
161 Ga0207427_100002 3300025231 Bacteria 1355321
162 Ga0209437_100007 3300025233 Bacteria 938377
163 Ga0209437_100185 3300025233 Bacteria 126819
164 Ga0209677_100004 3300025253 Bacteria 1554545
165 Ga0209129_1000015 3300025258 Bacteria 487967
166 Ga0209233_1015805 3300025261 Bacteria 2092
167 Ga0209025_1000585 3300025294 Bacteria 66076
168 Ga0209758_1000036 3300025297 Bacteria 441671
169 Ga0209758_1003539 3300025297 Bacteria 14062
170 Ga0207696_1000003 3300025711 Bacteria 860639
171 Ga0207696_1000004 3300025711 Bacteria 671626
172 Ga0207696_1000059 3300025711 Bacteria 245763
173 Ga0207696_1000328 3300025711 Bacteria 50336
174 Ga0207696_1000489 3300025711 Bacteria 33338
175 Ga0207696_1000746 3300025711 Bacteria 21687
176 Ga0207696_1000997 3300025711 Bacteria 17032
177 Ga0207696_1001808 3300025711 Bacteria 11035
178 Ga0207655_1000001 3300025728 Bacteria 1866413
179 Ga0207655_1000023 3300025728 Bacteria 467070
180 Ga0207655_1000032 3300025728 Bacteria 391253
181 Ga0207655_1000042 3300025728 Bacteria 333039
182 Ga0207655_1000105 3300025728 Bacteria 182927
183 Ga0207655_1000157 3300025728 Bacteria 124885
184 Ga0207655_1003248 3300025728 Bacteria 12205
185 Ga0207655_1016317 3300025728 Bacteria 4071
186 Ga0207713_1000001 3300025735 Bacteria 2295391
187 Ga0207713_1000005 3300025735 Bacteria 649958
188 Ga0207713_1000006 3300025735 Bacteria 586163
189 Ga0207713_1000021 3300025735 Bacteria 353108
190 Ga0207713_1003470 3300025735 Bacteria 10734
191 Ga0207713_1004111 3300025735 Bacteria 9588
192 Ga0207713_1006063 3300025735 Bacteria 7452
193 Ga0207713_1013428 3300025735 Bacteria 4316
194 Ga0207710_10005583 3300025900 Bacteria 5412
195 Ga0207680_10000006 3300025903 Bacteria 635950
196 Ga0207680_10002749 3300025903 Bacteria 8227
197 Ga0207680_10043528 3300025903 Bacteria 2634
198 Ga0207699_10000223 3300025906 Bacteria 32867
199 Ga0207707_10000001 3300025912 Bacteria 1212482
200 Ga0207695_10000004 3300025913 Bacteria 1288665
201 Ga0207695_10001005 3300025913 Bacteria 49964
202 Ga0207695_10004444 3300025913 Bacteria 19118
203 Ga0207695_10081311 3300025913 Bacteria 3279
204 Ga0207693_10000099 3300025915 Bacteria 77197
205 Ga0207693_10000334 3300025915 Bacteria 43371
206 Ga0207660_10001780 3300025917 Bacteria 14415
207 Ga0207652_10000736 3300025921 Bacteria 31695
208 Ga0207694_10000014 3300025924 Bacteria 374435
209 Ga0207644_10058010 3300025931 Bacteria 2796
210 Ga0207690_10091469 3300025932 Bacteria 2151
211 Ga0207709_10012460 3300025935 Bacteria 4683
212 Ga0207711_10008066 3300025941 Bacteria 8814
213 Ga0207711_10041351 3300025941 Bacteria 3925
214 Ga0207689_10096362 3300025942 Bacteria 2430
215 Ga0207667_10000051 3300025949 Bacteria 233836
216 Ga0207667_10027232 3300025949 Bacteria 6227
217 Ga0207667_10112822 3300025949 Bacteria 2803
218 Ga0207658_10000192 3300025986 Bacteria 65509
219 Ga0207658_10033089 3300025986 Bacteria 3685
220 Ga0207658_10066340 3300025986 Bacteria 2714
221 Ga0207703_10051597 3300026035 Bacteria 3334
222 Ga0207703_10077994 3300026035 Bacteria 2751
223 Ga0207639_10001724 3300026041 Bacteria 14726
224 Ga0207639_10014959 3300026041 Bacteria 5467
225 Ga0207702_10000148 3300026078 Bacteria 81831
226 Ga0207702_10004501 3300026078 Bacteria 12371
227 Ga0207702_10036005 3300026078 Bacteria 4139
228 Ga0207641_10000177 3300026088 Bacteria 88140
229 Ga0207641_10067045 3300026088 Bacteria 3073
230 Ga0207676_10008293 3300026095 Bacteria 7385
231 Ga0207674_10002213 3300026116 Bacteria 24638
232 Ga0207683_10034312 3300026121 Bacteria 4409
233 Ga0209281_1000021 3300027111 Bacteria 541033
234 Ga0209281_1000041 3300027111 Bacteria 347825
235 Ga0209281_1000085 3300027111 Bacteria 252561
236 Ga0209281_1000291 3300027111 Bacteria 91918
237 Ga0209281_1000817 3300027111 Bacteria 28172
238 Ga0209371_1000001 3300027312 Bacteria 2771503
239 Ga0209371_1000010 3300027312 Bacteria 922021
240 Ga0209371_1000047 3300027312 Bacteria 304732
241 Ga0209371_1000590 3300027312 Bacteria 32510
242 Ga0209371_1000803 3300027312 Bacteria 25942
243 Ga0209371_1001366 3300027312 Bacteria 16868
244 Ga0209371_1001830 3300027312 Bacteria 13172
245 Ga0209371_1011312 3300027312 Bacteria 2659
246 Ga0268266_10006560 3300028379 Bacteria 10639
247 Ga0268264_10000088 3300028381 Bacteria 235344
248 Ga0265334_10002838 3300028573 Bacteria 7977
249 Ga0265318_10000031 3300028577 Bacteria 146035
250 Ga0265318_10006809 3300028577 Bacteria 5226
251 Ga0265318_10009576 3300028577 Bacteria 4252
252 Ga0265338_10000006 3300028800 Bacteria 570804
253 Ga0265338_10005866 3300028800 Bacteria 15841
254 Ga0265338_10013556 3300028800 Bacteria 9186
255 Ga0265338_10015294 3300028800 Bacteria 8445
256 Ga0268256_1000001 3300030500 Bacteria 2771065
257 Ga0268256_1000022 3300030500 Bacteria 531115
258 Ga0268256_1000270 3300030500 Bacteria 53886
259 Ga0268256_1000514 3300030500 Bacteria 32518
260 Ga0268256_1000671 3300030500 Bacteria 25942
261 Ga0268256_1001116 3300030500 Bacteria 17468
262 Ga0268256_1001173 3300030500 Bacteria 16868
263 Ga0265330_10004426 3300031235 Bacteria 7132
264 Ga0265328_10008679 3300031239 Bacteria 4174
265 Ga0265328_10011367 3300031239 Bacteria 3559
266 Ga0265328_10011823 3300031239 Bacteria 3482
267 Ga0265320_10001142 3300031240 Bacteria 19529
268 Ga0265325_10000003 3300031241 Bacteria 370490
269 Ga0265325_10003681 3300031241 Bacteria 9926
270 Ga0265325_10005413 3300031241 Bacteria 7882
271 Ga0265325_10007971 3300031241 Bacteria 6287
272 Ga0265329_10005285 3300031242 Bacteria 5238
273 Ga0265340_10002162 3300031247 Bacteria 11273
274 Ga0265340_10022680 3300031247 Bacteria 3208
275 Ga0265339_10001397 3300031249 Bacteria 17979
276 Ga0265339_10012298 3300031249 Bacteria 5229
277 Ga0265339_10017287 3300031249 Bacteria 4276
278 Ga0265339_10024291 3300031249 Bacteria 3494
279 Ga0265339_10049844 3300031249 Bacteria 2291
280 Ga0265331_10000141 3300031250 Bacteria 94896
281 Ga0265331_10001884 3300031250 Bacteria 14788
282 Ga0265331_10002109 3300031250 Bacteria 13711
283 Ga0265331_10005803 3300031250 Bacteria 7396
284 Ga0265331_10007523 3300031250 Bacteria 6295
285 Ga0265331_10012128 3300031250 Bacteria 4684
286 Ga0265327_10000076 3300031251 Bacteria 212272
287 Ga0265316_10011748 3300031344 Bacteria 7876
288 Ga0265316_10151872 3300031344 Bacteria 1734
289 Ga0307513_10084284 3300031456 Bacteria 3265
290 Ga0307509_10000022 3300031507 Bacteria 247822
291 Ga0307509_10145012 3300031507 Bacteria 2302
292 Ga0265313_10000365 3300031595 Bacteria 49111
293 Ga0265313_10000745 3300031595 Bacteria 33374
294 Ga0265313_10001646 3300031595 Bacteria 20705
295 Ga0265313_10003952 3300031595 Bacteria 11666
296 Ga0265313_10004103 3300031595 Bacteria 11341
297 Ga0265313_10005442 3300031595 Bacteria 9371
298 Ga0265313_10014638 3300031595 Bacteria 4622
299 Ga0265313_10040965 3300031595 Bacteria 2285
300 Ga0265314_10004456 3300031711 Bacteria 12996
301 Ga0265314_10010811 3300031711 Bacteria 7589
302 Ga0265314_10056460 3300031711 Bacteria 2702
303 Ga0265342_10003917 3300031712 Bacteria 11954
304 Ga0265342_10005490 3300031712 Bacteria 9645
305 Ga0265342_10006956 3300031712 Bacteria 8359
306 Ga0265342_10008325 3300031712 Bacteria 7456
307 Ga0265342_10029181 3300031712 Bacteria 3428
308 Ga0316576_10010831 3300031727 Bacteria 5944
309 Ga0316578_10000385 3300031728 Bacteria 14147
310 Ga0316578_10032280 3300031728 Bacteria 2990
311 Ga0316577_10014017 3300031733 Bacteria 4396
312 Ga0316577_10018169 3300031733 Bacteria 3886
313 Ga0316577_10043630 3300031733 Bacteria 2509
314 Ga0316593_10005918 3300032168 Bacteria 3266
315 Ga0307510_10000008 3300033180 Bacteria 433990
316 Ga0316592_1006238 3300033524 Bacteria 2290
317 Ga0316588_1003379 3300033528 Bacteria 2905
318 Ga0316596_1000856 3300033541 Bacteria 5700
319 Ga0316596_1021055 3300033541 Bacteria 1660
320 Ga0373934_0009038 3300035086 Bacteria 3726
321 Ga0373936_0011864 3300035113 Bacteria 3306
322 Ga0316574_0008426 3300035398 Bacteria 5723
323 Ga0316574_0014416 3300035398 Bacteria 4568
324 Ga0316574_0033639 3300035398 Bacteria 3120
325 Ga0316574_0044886 3300035398 Bacteria 2735
326 Ga0373931_0014449 3300035691 Bacteria 3860
327 Ga0373935_0106960 3300035692 Bacteria 1852
328 Ga0373927_0015239 3300035695 Bacteria 5080
329 Ga0373933_0134836 3300035724 Bacteria 1555
330 Ga0373937_0059076 3300036401 Bacteria 3524
331 Ga0316582_0017269 3300036647 Bacteria 4171
332 Ga0316582_0017380 3300036647 Bacteria 4161
333 Ga0316582_0049709 3300036647 Bacteria 2653
334 Ga0316584_0000079 3300036712 Bacteria 38059
335 Ga0316584_0016210 3300036712 Bacteria 5342
336 Ga0316584_0092213 3300036712 Bacteria 2268
337 Ga0395899_0010808 3300037312 Bacteria 6998
338 Ga0395905_0002859 3300037471 Bacteria 18881
339 Ga0400490_11094 3300038726 Bacteria 62810
340 Ga0400490_17222 3300038726 Bacteria 34532
341 Ga0400491_21474 3300038727 Bacteria 6670
342 Ga0400485_04923 3300038735 Bacteria 131311
343 Ga0400485_15585 3300038735 Bacteria 12852
344 Ga0400488_22325 3300038741 Bacteria 3722
345 Ga0400488_32056 3300038741 Bacteria 1770
346 Ga0400488_49339 3300038741 Bacteria 2420
347 Ga0400486_08699 3300038742 Bacteria 7367
348 Ga0400486_17653 3300038742 Bacteria 15574
349 Ga0400486_22493 3300038742 Bacteria 147980
350 Ga0400483_044668 3300039062 Bacteria 5549
351 Ga0400483_059624 3300039062 Bacteria 2119
352 Ga0400483_139193 3300039062 Bacteria 15235
353 Ga0400483_145468 3300039062 Bacteria 4222
354 Ga0400483_171382 3300039062 Bacteria 12054
355 Ga0400483_195420 3300039062 Bacteria 7506
356 Ga0400483_239719 3300039062 Bacteria 8876
357 Ga0400483_269989 3300039062 Bacteria 6782
358 Ga0400487_27800 3300039110 Bacteria 73851
359 Ga0400487_54161 3300039110 Bacteria 50571
360 Ga0436365_0727636 3300039437 Bacteria 99848
361 Ga0439438_000001 3300041405 Bacteria 1263568
362 Ga0439447_000496 3300041407 Bacteria 14645
363 Ga0439447_008932 3300041407 Bacteria 3073
364 Ga0439466_0000003 3300041411 Bacteria 486229
365 Ga0451853_3565153 3300041512 Bacteria 3395
366 Ga0439432_001341 3300042006 Bacteria 9318
367 Ga0439432_012730 3300042006 Bacteria 2871
368 Ga0439452_000001 3300042010 Bacteria 1725439
369 Ga0439452_000003 3300042010 Bacteria 942815
370 Ga0439452_000924 3300042010 Bacteria 13287
371 Ga0439463_001202 3300042016 Bacteria 6912
372 Ga0439463_002195 3300042016 Bacteria 5030
373 Ga0450907_002033 3300042146 Bacteria 4030
374 Ga0466981_0000098 3300044669 Bacteria 21564
375 Ga0453684_0000136 3300044712 Bacteria 323402
376 Ga0451576_0000025 3300045051 Bacteria 427980
377 Ga0495627_010254 3300046453 Bacteria 3413
378 Ga0495591_000009 3300046458 Bacteria 331626
379 Ga0495591_000011 3300046458 Bacteria 309685
380 Ga0495591_000080 3300046458 Bacteria 107876
381 Ga0495591_002337 3300046458 Bacteria 10682
382 Ga0495591_004267 3300046458 Bacteria 7075
383 Ga0495591_004770 3300046458 Bacteria 6487
384 Ga0495653_0013811 3300046463 Bacteria 6580
385 Ga0495650_0000016 3300046471 Bacteria 554693
386 Ga0495650_0000033 3300046471 Bacteria 412188
387 Ga0495650_0000153 3300046471 Bacteria 156161
388 Ga0495650_0000581 3300046471 Bacteria 51097
389 Ga0495650_0002020 3300046471 Bacteria 17796
390 Ga0495580_0002303 3300046472 Bacteria 16664
391 Ga0495605_0000142 3300046474 Bacteria 92755
392 Ga0495605_0001220 3300046474 Bacteria 17115
393 Ga0495605_0008951 3300046474 Bacteria 5640
394 Ga0495584_0017970 3300046491 Bacteria 3595
395 Ga0495585_0003413 3300046492 Bacteria 10750
396 Ga0495585_0012507 3300046492 Bacteria 4999
397 Ga0495596_0001342 3300046500 Bacteria 14166
398 Ga0495607_0000105 3300046501 Bacteria 88629
399 Ga0495607_0000677 3300046501 Bacteria 32941
400 Ga0495607_0010742 3300046501 Bacteria 6133
401 Ga0495583_0000322 3300046506 Bacteria 75510
402 Ga0495583_0000499 3300046506 Bacteria 56843
403 Ga0495583_0001458 3300046506 Bacteria 23876
404 Ga0495583_0001787 3300046506 Bacteria 20439
405 Ga0495606_0000206 3300046507 Bacteria 103708
406 Ga0495606_0000325 3300046507 Bacteria 82283
407 Ga0495606_0007320 3300046507 Bacteria 9929
408 Ga0495606_0013109 3300046507 Bacteria 6582
409 Ga0495606_0021350 3300046507 Bacteria 4743
410 Ga0495620_0000737 3300046515 Bacteria 20139
411 Ga0495620_0000959 3300046515 Bacteria 17764
412 Ga0495632_0000190 3300046519 Bacteria 62298
413 Ga0495632_0004112 3300046519 Bacteria 10020
414 Ga0495632_0006621 3300046519 Bacteria 7411
415 Ga0495632_0038297 3300046519 Bacteria 2429
416 Ga0495637_0000055 3300046520 Bacteria 99324
417 Ga0495637_0000591 3300046520 Bacteria 25893
418 Ga0495643_0007219 3300046522 Bacteria 7201
419 Ga0495644_0000933 3300046523 Bacteria 12146
420 Ga0495644_0005099 3300046523 Bacteria 5140
421 Ga0495648_0000219 3300046524 Bacteria 65619
422 Ga0495648_0004944 3300046524 Bacteria 11205
423 Ga0495648_0021358 3300046524 Bacteria 4484
424 Ga0495654_0000125 3300046530 Bacteria 85809
425 Ga0495654_0000493 3300046530 Bacteria 32495
426 Ga0495654_0000599 3300046530 Bacteria 28667
427 Ga0495654_0005581 3300046530 Bacteria 7283
428 Ga0495654_0031797 3300046530 Bacteria 2677
429 Ga0495587_0047848 3300046536 Bacteria 2535
430 Ga0495609_0000090 3300046538 Bacteria 106600
431 Ga0495597_0001470 3300046542 Bacteria 16895
432 Ga0495668_0010851 3300046616 Bacteria 5486
433 Ga0495668_0035552 3300046616 Bacteria 2792
434 Ga0495611_0000801 3300046648 Bacteria 17446
435 Ga0495611_0009172 3300046648 Bacteria 4178
436 Ga0495625_0000062 3300046660 Bacteria 176748
437 Ga0495625_0043223 3300046660 Bacteria 3269
438 Ga0495661_0000061 3300046665 Bacteria 130811
439 Ga0495661_0000123 3300046665 Bacteria 93482
440 Ga0495661_0003364 3300046665 Bacteria 11849
441 Ga0495661_0004215 3300046665 Bacteria 10445
442 Ga0495588_0010188 3300046674 Bacteria 4362
443 Ga0495623_0026402 3300046679 Bacteria 3739
444 Ga0495671_0005016 3300046692 Bacteria 7798
445 Ga0495649_0004050 3300046694 Bacteria 9650
446 Ga0495649_0006368 3300046694 Bacteria 7346
447 Ga0495589_0004048 3300046794 Bacteria 7857
448 Ga0495660_0000007 3300046810 Bacteria 485295
449 Ga0495660_0000074 3300046810 Bacteria 108390
450 Ga0495660_0001740 3300046810 Bacteria 14519
451 Ga0495660_0047695 3300046810 Bacteria 2344
452 Ga0495674_0243851 3300047319 Bacteria 1480
453 Ga0495672_0000004 3300047320 Bacteria 631810
454 Ga0495672_0000012 3300047320 Bacteria 519975
455 Ga0495672_0007348 3300047320 Bacteria 8305
456 Ga0495676_0000042 3300047321 Bacteria 103741
457 Ga0495676_0030843 3300047321 Bacteria 4542
458 Ga0495683_0000194 3300047323 Bacteria 57773
459 Ga0495679_000027 3300047446 Bacteria 193794
460 Ga0495679_000032 3300047446 Bacteria 171636
461 Ga0495673_0000022 3300047469 Bacteria 544086
462 Ga0495673_0000023 3300047469 Bacteria 539904
463 Ga0495673_0000227 3300047469 Bacteria 83114
464 Ga0495673_0000813 3300047469 Bacteria 29294
465 Ga0495673_0001429 3300047469 Bacteria 19118
466 Ga0495673_0027138 3300047469 Bacteria 2729
467 Ga0495681_0000845 3300047470 Bacteria 23614
468 Ga0495686_0008307 3300047472 Bacteria 7634
469 Ga0495626_0000062 3300048091 Bacteria 143269
470 Ga0496100_0044163 3300048903 Bacteria 2853
471 Ga0496100_0069901 3300048903 Bacteria 2339
472 Ga0496100_0078246 3300048903 Bacteria 2226
473 Ga0496101_0000029 3300048904 Bacteria 198515
474 Ga0496101_0042580 3300048904 Bacteria 3241
475 Ga0496102_0016198 3300048905 Bacteria 6514
476 Ga0496102_0032078 3300048905 Bacteria 4718
477 Ga0496102_0093401 3300048905 Bacteria 2787
478 Ga0496103_0013659 3300048906 Bacteria 4817
479 Ga0496104_0001318 3300048907 Bacteria 21417
480 Ga0496104_0006179 3300048907 Bacteria 10518
481 Ga0496104_0043968 3300048907 Bacteria 4197
482 Ga0496104_0076869 3300048907 Bacteria 3180
483 Ga0496105_0011013 3300048908 Bacteria 7128
484 Ga0496105_0083802 3300048908 Bacteria 2633
485 Ga0496106_0102750 3300048909 Bacteria 2218
486 Ga0496107_0009155 3300048910 Bacteria 6865
487 Ga0496108_0012408 3300048911 Bacteria 6934
488 Ga0496108_0143290 3300048911 Bacteria 2059
489 Ga0496110_0020876 3300048913 Bacteria 5534
490 Ga0496111_0003616 3300048914 Bacteria 9585
491 Ga0496112_0017773 3300048915 Bacteria 6692
492 Ga0496112_0051738 3300048915 Bacteria 4029
493 Ga0496113_0015943 3300048916 Bacteria 5181
494 Ga0496113_0114002 3300048916 Bacteria 2107
495 Ga0496114_0004914 3300048917 Bacteria 10412
496 Ga0496114_0107403 3300048917 Bacteria 2388
497 Ga0496115_0015702 3300048918 Bacteria 5750
498 Ga0496115_0057491 3300048918 Bacteria 3129
499 Ga0496116_0000127 3300048919 Bacteria 158773
500 Ga0496116_0000226 3300048919 Bacteria 104792
501 Ga0496116_0000572 3300048919 Bacteria 49208
502 Ga0496116_0008821 3300048919 Bacteria 8686
503 Ga0496116_0014235 3300048919 Bacteria 6365
504 Ga0496116_0026596 3300048919 Bacteria 4227
505 Ga0496116_0057812 3300048919 Bacteria 2532
506 Ga0496117_0000004 3300048920 Bacteria 877131
507 Ga0496117_0000156 3300048920 Bacteria 145285
508 Ga0496117_0000180 3300048920 Bacteria 128746
509 Ga0496117_0005651 3300048920 Bacteria 13047
510 Ga0496117_0014392 3300048920 Bacteria 6819
511 Ga0496117_0020878 3300048920 Bacteria 5325
512 Ga0496118_0000005 3300048921 Bacteria 697350
513 Ga0496118_0000024 3300048921 Bacteria 385236
514 Ga0496118_0004392 3300048921 Bacteria 16755
515 Ga0496118_0007231 3300048921 Bacteria 11845
516 Ga0496118_0018065 3300048921 Bacteria 6382
517 Ga0496118_0072355 3300048921 Bacteria 2476
518 Ga0496118_0128651 3300048921 Bacteria 1631
519 Ga0496118_0140812 3300048921 Bacteria 1529
520 Ga0496119_0000524 3300048922 Bacteria 52149
521 Ga0496119_0002597 3300048922 Bacteria 19610
522 Ga0496119_0007945 3300048922 Bacteria 9439
523 Ga0496119_0016218 3300048922 Bacteria 5687
524 Ga0496119_0020185 3300048922 Bacteria 4868
525 Ga0496119_0057976 3300048922 Bacteria 2337
526 Ga0496120_0000009 3300048923 Bacteria 386727
527 Ga0496120_0000014 3300048923 Bacteria 323163
528 Ga0496120_0000043 3300048923 Bacteria 195584
529 Ga0496120_0001541 3300048923 Bacteria 27015
530 Ga0496120_0003009 3300048923 Bacteria 15982
531 Ga0496120_0003653 3300048923 Bacteria 13782
532 Ga0496120_0006066 3300048923 Bacteria 9389
533 Ga0496120_0008215 3300048923 Bacteria 7637
534 Ga0496120_0015232 3300048923 Bacteria 5082
535 Ga0496120_0027574 3300048923 Bacteria 3490
536 Ga0496120_0053641 3300048923 Bacteria 2289
537 Ga0496121_0000185 3300048924 Bacteria 138586
538 Ga0496121_0002628 3300048924 Bacteria 27099
539 Ga0496121_0002922 3300048924 Bacteria 25030
540 Ga0496121_0009103 3300048924 Bacteria 11490
541 Ga0496121_0015706 3300048924 Bacteria 7892
542 Ga0496121_0032053 3300048924 Bacteria 4785
543 Ga0496121_0110086 3300048924 Bacteria 2102
544 Ga0496122_0000013 3300048925 Bacteria 501039
545 Ga0496122_0000026 3300048925 Bacteria 360871
546 Ga0496122_0000667 3300048925 Bacteria 69054
547 Ga0496122_0000796 3300048925 Bacteria 60440
548 Ga0496122_0006414 3300048925 Bacteria 13516
549 Ga0496122_0010913 3300048925 Bacteria 9291
550 Ga0496122_0012528 3300048925 Bacteria 8429
551 Ga0496123_0000005 3300048926 Bacteria 658131
552 Ga0496123_0000010 3300048926 Bacteria 501039
553 Ga0496123_0000163 3300048926 Bacteria 133536
554 Ga0496123_0000599 3300048926 Bacteria 61266
555 Ga0496123_0000621 3300048926 Bacteria 59502
556 Ga0496123_0004145 3300048926 Bacteria 15498
557 Ga0496123_0004462 3300048926 Bacteria 14683
558 Ga0496123_0010990 3300048926 Bacteria 7912
559 Ga0496123_0018984 3300048926 Bacteria 5435
560 Ga0496123_0026914 3300048926 Bacteria 4296
561 Ga0496124_0000224 3300048927 Bacteria 110603
562 Ga0496124_0000259 3300048927 Bacteria 101764
563 Ga0496124_0002320 3300048927 Bacteria 25093
564 Ga0496124_0002333 3300048927 Bacteria 25044
565 Ga0496124_0004077 3300048927 Bacteria 17299
566 Ga0496124_0005214 3300048927 Bacteria 14755
567 Ga0496124_0010575 3300048927 Bacteria 9331
568 Ga0496124_0016619 3300048927 Bacteria 6983
569 Ga0496124_0047403 3300048927 Bacteria 3677
570 Ga0496124_0097027 3300048927 Bacteria 2393
571 Ga0496124_0097802 3300048927 Bacteria 2382
572 Ga0496125_0000016 3300048928 Bacteria 512512
573 Ga0496125_0000019 3300048928 Bacteria 474989
574 Ga0496126_0000680 3300048929 Bacteria 62501
575 Ga0496126_0002546 3300048929 Bacteria 24392
576 Ga0496126_0028193 3300048929 Bacteria 5353
577 Ga0496126_0052308 3300048929 Bacteria 3713
578 Ga0496126_0072648 3300048929 Bacteria 3059
579 Ga0495678_000043 3300049459 Bacteria 172593
580 Ga0495678_000828 3300049459 Bacteria 27727
581 Ga0495678_005192 3300049459 Bacteria 7281
582 Ga0495682_0000026 3300049460 Bacteria 144529
583 Ga0495682_0000096 3300049460 Bacteria 77498
584 Ga0495682_0009796 3300049460 Bacteria 3730
585 Ga0501032_0053161 3300049569 Bacteria 2728
586 Ga0501033_0009400 3300049570 Bacteria 7528
587 Ga0501033_0035651 3300049570 Bacteria 3729
588 Ga0501034_0217223 3300049571 Bacteria 1865
589 Ga0501036_0005174 3300049572 Bacteria 10546
590 Ga0501037_0091553 3300049573 Bacteria 2199
591 Ga0501038_0002891 3300049574 Bacteria 16020
592 Ga0501038_0007559 3300049574 Bacteria 10019
593 Ga0501039_0008375 3300049575 Bacteria 7878
594 Ga0501046_0000911 3300049580 Bacteria 28909
595 Ga0501047_0003232 3300049581 Bacteria 15448
596 Ga0501047_0007271 3300049581 Bacteria 10407
597 Ga0501047_0023442 3300049581 Bacteria 5925
598 Ga0501047_0033222 3300049581 Bacteria 4980
599 Ga0501048_0020709 3300049582 Bacteria 4821
600 Ga0501048_0045342 3300049582 Bacteria 3140
601 Ga0501067_0001068 3300049583 Bacteria 14777
602 Ga0501069_0002056 3300049585 Bacteria 10108
603 Ga0501069_0012736 3300049585 Bacteria 4477
604 Ga0501070_0000110 3300049586 Bacteria 72071
605 Ga0501070_0003063 3300049586 Bacteria 14557
606 Ga0501073_0067640 3300049589 Bacteria 2490
607 Ga0501074_0096593 3300049590 Bacteria 2115
608 Ga0501077_0066101 3300049593 Bacteria 2294
609 Ga0501079_0005199 3300049741 Bacteria 9673
610 Ga0501080_0064253 3300049742 Bacteria 3414
611 Ga0501080_0073449 3300049742 Bacteria 3182
612 Ga0501080_0188888 3300049742 Bacteria 1893
613 Ga0501083_0002409 3300049744 Bacteria 12787
614 Ga0501083_0020350 3300049744 Bacteria 4616
615 Ga0501035_0002718 3300049822 Bacteria 17190
616 Ga0501044_0001134 3300049823 Bacteria 31657
617 Ga0501044_0071185 3300049823 Bacteria 3536
618 Ga0501044_0150755 3300049823 Bacteria 2307
619 Ga0501044_0164241 3300049823 Bacteria 2195
620 nmdc:mga00v17_29080_c1 3300050491 Bacteria 3241
621 nmdc:mga00v17_5777_c1 3300050491 Bacteria 6536
622 nmdc:mga0n895_62253_c1 3300050512 Bacteria 3687
623 nmdc:mga08x19_26679_c1 3300050514 Bacteria 3605
624 nmdc:mga08x19_80_c1 3300050514 Bacteria 87696
625 Ga0495601_0036273 3300053077 Bacteria 3078
626 Ga0500583_0027435 3300053092 Bacteria 2458
627 Ga0500621_000001 3300053126 Bacteria 1049698
628 Ga0500637_0023296 3300053178 Bacteria 3384
629 Ga0501084_0052916 3300054114 Bacteria 3396
630 Ga0501082_0016188 3300060353 Bacteria 6418
631 Ga0501082_0050459 3300060353 Bacteria 3588
632 2508851225 2508501071 Bacteria 5454741
633 2511381174 2511231025 Bacteria 5324661
634 2511436093 2511231035 Bacteria 5341610
635 2523106204 2522572158 Bacteria 6514390
636 2523468584 2523231067 Bacteria 5230452
637 2538427348 2537561728 Bacteria 5149301
638 2547694521 2547132181 Bacteria 4945084
639 2555258980 2554235234 Bacteria 5762085
640 2562466596 2561511199 Bacteria 5155034
641 2566036998 2565956521 Bacteria 4468993
642 2585826935 2585427591 Bacteria 5482980
643 2585831106 2585427592 Bacteria 5370892
644 2599410499 2599185169 Bacteria 5441380
645 2599927277 2599185299 Bacteria 4854625
646 2599973577 2599185307 Bacteria 6194719
647 2601523865 2600255254 Bacteria 5281859
648 2601529016 2600255255 Bacteria 5282785
649 2601532106 2600255256 Bacteria 5597742
650 2601537477 2600255257 Bacteria 5597196
651 2601615850 2600255280 Bacteria 5292309
652 2601620422 2600255281 Bacteria 5288753
653 2601645870 2600255287 Bacteria 5210468
654 2601648824 2600255288 Bacteria 5282738
655 2601653900 2600255289 Bacteria 5281907
656 2601659327 2600255290 Bacteria 5282218
657 2601665317 2600255291 Bacteria 5217298
658 2601698179 2600255298 Bacteria 5215185
659 2601703328 2600255299 Bacteria 5218662
660 2601708517 2600255300 Bacteria 5287774
661 2601713630 2600255301 Bacteria 5280532
662 2601717161 2600255302 Bacteria 5288235
663 2601722054 2600255303 Bacteria 5219315
664 2601724678 2600255304 Bacteria 5283973
665 2601731959 2600255305 Bacteria 5282329
666 2601738410 2600255306 Bacteria 5281613
667 2601742741 2600255307 Bacteria 5439064
668 2601751885 2600255309 Bacteria 5431045
669 2601755824 2600255310 Bacteria 5600903
670 2601761192 2600255311 Bacteria 5598766
671 2602020216 2600255392 Bacteria 5437392
672 2603638782 2602042046 Bacteria 5483348
673 2603643312 2602042047 Bacteria 4697674
674 2603663441 2602042052 Bacteria 5215873
675 2603668051 2602042053 Bacteria 5214361
676 2603699910 2602042066 Bacteria 4423871
677 2603703890 2602042067 Bacteria 4863713
678 2603839513 2602042103 Bacteria 5284714
679 2603844438 2602042104 Bacteria 5281639
680 2603849665 2602042105 Bacteria 5282303
681 2603854731 2602042106 Bacteria 5282744
682 2603869857 2602042110 Bacteria 5283285
683 2603878968 2602042111 Bacteria 5212080
684 2606047042 2603880178 Bacteria 5283018
685 2606072474 2603880184 Bacteria 5217896
686 2606146452 2603880202 Bacteria 5284684
687 2606177377 2603880211 Bacteria 5284226
688 2608668694 2608642108 Bacteria 4104624
689 2609913860 2609459761 Bacteria 5513740
690 2637226402 2636415599 Bacteria 5718434
691 2649119765 2648501241 Bacteria 5312320
692 2649121071 2648501241 Bacteria 5312320
693 2650896622 2648501693 Bacteria 5069560
694 2652973233 2651869818 Bacteria 5864031
695 2652974604 2651869818 Bacteria 5864031
696 2671102528 2667528172 Bacteria 5170840
697 2671108222 2667528173 Bacteria 5375747
698 2671586553 2671180115 Bacteria 5353919
699 2676407440 2675903046 Bacteria 5451247
700 2681995650 2681812866 Bacteria 4552357
701 2682007445 2681812869 Bacteria 5014465
702 2686352618 2684622997 Bacteria 4624240
703 2691331244 2690315857 Bacteria 4396207
704 2707099815 2706794495 Bacteria 4536932
705 2728748887 2728368998 Bacteria 8720350
706 2738688729 2738541271 Bacteria 5657310
707 2739264960 2738543016 Bacteria 5657564
708 2739352060 2738543031 Bacteria 5769731
709 2753855168 2751185917 Bacteria 4551186
710 2765588104 2765235842 Bacteria 4799256
711 2772437791 2772190666 Bacteria 5117644
712 2775541572 2775506706 Bacteria 4873073
713 2777020281 2775507074 Bacteria 5532402
714 2791923226 2791354903 Bacteria 4937680
715 2792312400 2791355010 Bacteria 4864581
716 2793406238 2791355275 Bacteria 4429597
717 2807180477 2806310673 Bacteria 4801221
718 2809124820 2808606414 Bacteria 4917181
719 2812370426 2811994881 Bacteria 6298475
720 2813729844 2811995292 Bacteria 5303342
721 2814697338 2814123068 Bacteria 5687681
722 2821118942 2821118458 Bacteria 4714306
723 2823376808 2823373977 Bacteria 4779415
724 2844426701 2844425489 Bacteria 4854065
725 2844532180 2844528606 Bacteria 4733806
726 2847088505 2847085930 Bacteria 5070450
727 2847800704 2847797336 Bacteria 5176640
728 2852103805 2852103415 Bacteria 5193810
729 2855198723 2855195626 Bacteria 4927512
730 2858470105 2858466076 Bacteria 4722413
731 2865017723 2865014394 Bacteria 4764573
732 2871277166 2871272651 Bacteria 5042015
733 2871286678 2871282230 Bacteria 4917173
734 2876602709 2876601092 Bacteria 5114497
735 2884089830 2884086401 Bacteria 5005459
736 2888367781 2888366609 Bacteria 5155009
737 2888374529 2888373701 Bacteria 5098052
738 2891672319 2891670763 Bacteria 4967099
739 2900054077 2900051742 Bacteria 4985156
740 2900055743 2900051742 Bacteria 4985156
741 2904475106 2904474040 Bacteria 5504324
742 2904505486 2904504865 Bacteria 5152820
743 2904517405 2904513164 Bacteria 5476410
744 2908670983 2908669403 Bacteria 5740494
745 2919109463 2919108558 Bacteria 5897419
746 2919151452 2919150387 Bacteria 5500879
747 2919678551 2919675420 Bacteria 3969095
748 2919691617 2919688452 Bacteria 4595932
749 2923524517 2923519811 Bacteria 6298479
750 2923638592 2923634449 Bacteria 4753480
751 2927146326 2927143783 Bacteria 5504251
752 2927834909 2927833300 Bacteria 4923934
753 2935627457 2935625433 Bacteria 5042964
754 2937543461 2937539931 Bacteria 4639830
755 2937969069 2937967321 Bacteria 5094075
756 2939602871 2939602548 Bacteria 4950493
757 2939608337 2939607340 Bacteria 4719256
758 2939621477 2939617950 Bacteria 4820956
759 2945878940 2945874760 Bacteria 5527237
760 2945953796 2945951305 Bacteria 4918162
761 2969083384 2969079654 Bacteria 5439582
762 2971824815 2971820967 Bacteria 5823634
763 2974312975 2974310843 Bacteria 4947816
764 2974437618 2974435778 Bacteria 4876478
765 2984495837 2984494565 Bacteria 5000175
766 2984560401 2984559226 Bacteria 5683096
767 2984598478 2984595703 Bacteria 5682994
768 2990262525 2990261002 Bacteria 4919493
769 3000379919 3000376612 Bacteria 4705565
770 640936798 640753048 Bacteria 5495657
771 8002749738 8002745576 Bacteria 4840272
772 8004595001 8004592986 Bacteria 5122074
773 8015399161 8015394850 Bacteria 5064660
774 8016736701 8016733728 Bacteria 5274317
775 8018225304 8018221730 Bacteria 4616064
776 8018408109 8018405270 Bacteria 4978981
777 8019501935 8019499862 Bacteria 5169538
778 8019508381 8019504834 Bacteria 4819156
779 8054847080 8054844752 Bacteria 4450330
780 8055088849 8055087960 Bacteria 4784273
781 8055093805 8055092621 Bacteria 4873875
782 8055102157 8055097453 Bacteria 4865496
783 8057305901 8057304971 Bacteria 4649742
784 Ga0495657_0078484
785 RicEn_C5844
786 JGI25162J39368_1000003
787 JGI25163J39215_1000007
788 JGI25164J39214_1000014
789 JGI25152J39213_1000329
790 JGI25153J46596_10003384
791 rootH2_10019625
792 Ga0055538_1000005
793 Ga0055539_1000007
794 Ga0055533_1000009
795 Ga0055525_1000010
796 Ga0055541_1000005
797 Ga0058692_1000808
798 Ga0058692_1003490
799 Ga0065704_10001970
800 Ga0065704_10002600
801 Ga0065707_10082478
802 Ga0070690_100019111
803 Ga0070670_100028503
804 Ga0070666_10027464
805 Ga0070666_10030479
806 Ga0070680_100000408
807 Ga0070689_100066496
808 Ga0070668_100009230
809 Ga0070671_100002529
810 Ga0070671_100047551
811 Ga0070659_100007694
812 Ga0070659_100121494
813 Ga0070667_100000043
814 Ga0070667_100019370
815 Ga0070667_100069642
816 Ga0070709_10000184
817 Ga0070709_10108031
818 Ga0070713_100000882
819 Ga0070678_100002323
820 Ga0070681_10000003
821 Ga0070685_10061141
822 Ga0070679_100000541
823 Ga0070684_100036941
824 Ga0068853_100002126
825 Ga0070686_100007898
826 Ga0070665_100000199
827 Ga0070665_100010430
828 Ga0070665_100015224
829 Ga0068855_100000006
830 Ga0068855_100021482
831 Ga0068855_100233370
832 Ga0070664_100001502
833 Ga0068857_100106500
834 Ga0068856_100000182
835 Ga0068856_100000276
836 Ga0068852_100020529
837 Ga0068859_100027497
838 Ga0068864_100038174
839 Ga0068863_100001860
840 Ga0068858_100009966
841 Ga0068858_100107818
842 Ga0068860_100000185
843 Ga0068860_100004398
844 Ga0068860_100037638
845 Ga0068860_100160076
846 Ga0075364_10023775
847 Ga0075364_10034360
848 Ga0070715_10002694
849 Ga0070715_10043688
850 Ga0070712_100000026
851 Ga0070712_100020697
852 Ga0075366_10004030
853 Ga0097621_100008048
854 Ga0068871_100056797
855 Ga0075434_100072903
856 Ga0068865_100016921
857 Ga0075436_100000063
858 Ga0075436_100055880
859 Ga0097620_100027497
860 Ga0079104_1001292
861 Ga0079104_1019879
862 Ga0075435_100126749
863 Ga0105251_10001518
864 Ga0105251_10038629
865 Ga0105251_10066205
866 Ga0105244_10000006
867 Ga0105244_10002108
868 Ga0105244_10005410
869 Ga0105244_10050345
870 Ga0105250_10000003
871 Ga0105250_10000026
872 Ga0105250_10000861
873 Ga0105250_10000873
874 Ga0105250_10002960
875 Ga0105250_10015489
876 Ga0105250_10017877
877 Ga0105250_10038056
878 Ga0105240_10000287
879 Ga0105240_10000357
880 Ga0105240_10005351
881 Ga0105240_10015450
882 Ga0105240_10021990
883 Ga0105245_10005574
884 Ga0105245_10011980
885 Ga0105247_10001108
886 Ga0105247_10005233
887 Ga0105241_10025051
888 Ga0105241_10078213
889 Ga0105242_10026325
890 Ga0105242_10090268
891 Ga0105248_10021653
892 Ga0105248_10071852
893 Ga0105237_10154950
894 Ga0105238_10014086
895 Ga0105238_10018343
896 Ga0105238_10027731
897 Ga0105239_10012041
898 Ga0105239_10027113
899 Ga0105246_10002049
900 Ga0105246_10007027
901 Ga0157373_10001277
902 Ga0157373_10002523
903 Ga0157373_10003329
904 Ga0157373_10016116
905 Ga0157371_10000167
906 Ga0157371_10001411
907 Ga0157371_10001794
908 Ga0157371_10004005
909 Ga0157370_10000093
910 Ga0157370_10003123
911 Ga0157370_10008772
912 Ga0157370_10029417
913 Ga0157369_10001855
914 Ga0157369_10082534
915 Ga0157374_10005805
916 Ga0163162_10012254
917 Ga0163162_10064722
918 Ga0163162_10099014
919 Ga0163162_10108326
920 Ga0157372_10006015
921 Ga0157372_10008044
922 Ga0157372_10068022
923 Ga0157372_10074215
924 Ga0157372_10092567
925 Ga0157375_10021458
926 Ga0163163_10076754
927 Ga0157379_10009588
928 Ga0157379_10010119
929 Ga0157379_10012676
930 Ga0157379_10015107
931 Ga0157379_10045788
932 Ga0182006_1000063
933 Ga0182005_1014557
934 Ga0183366_1001
935 Ga0183370_1001
936 Ga0183369_1001
937 Ga0183368_1001
938 Ga0213876_10000095
939 Ga0209760_100001
940 Ga0209784_100001
941 Ga0209566_100001
942 Ga0209674_100002
943 Ga0209563_100008
944 Ga0207427_100002
945 Ga0209437_100007
946 Ga0209437_100185
947 Ga0209677_100004
948 Ga0209129_1000015
949 Ga0209233_1015805
950 Ga0209025_1000585
951 Ga0209758_1000036
952 Ga0209758_1003539
953 Ga0207696_1000003
954 Ga0207696_1000004
955 Ga0207696_1000059
956 Ga0207696_1000328
957 Ga0207696_1000489
958 Ga0207696_1000746
959 Ga0207696_1000997
960 Ga0207696_1001808
961 Ga0207655_1000001
962 Ga0207655_1000023
963 Ga0207655_1000032
964 Ga0207655_1000042
965 Ga0207655_1000105
966 Ga0207655_1000157
967 Ga0207655_1003248
968 Ga0207655_1016317
969 Ga0207713_1000001
970 Ga0207713_1000005
971 Ga0207713_1000006
972 Ga0207713_1000021
973 Ga0207713_1003470
974 Ga0207713_1004111
975 Ga0207713_1006063
976 Ga0207713_1013428
977 Ga0207710_10005583
978 Ga0207680_10000006
979 Ga0207680_10002749
980 Ga0207680_10043528
981 Ga0207699_10000223
982 Ga0207707_10000001
983 Ga0207695_10000004
984 Ga0207695_10001005
985 Ga0207695_10004444
986 Ga0207695_10081311
987 Ga0207693_10000099
988 Ga0207693_10000334
989 Ga0207660_10001780
990 Ga0207652_10000736
991 Ga0207694_10000014
992 Ga0207644_10058010
993 Ga0207690_10091469
994 Ga0207709_10012460
995 Ga0207711_10008066
996 Ga0207711_10041351
997 Ga0207689_10096362
998 Ga0207667_10000051
999 Ga0207667_10027232
1000 Ga0207667_10112822
1001 Ga0207658_10000192
1002 Ga0207658_10033089
1003 Ga0207658_10066340
1004 Ga0207703_10051597
1005 Ga0207703_10077994
1006 Ga0207639_10001724
1007 Ga0207639_10014959
1008 Ga0207702_10000148
1009 Ga0207702_10004501
1010 Ga0207702_10036005
1011 Ga0207641_10000177
1012 Ga0207641_10067045
1013 Ga0207676_10008293
1014 Ga0207674_10002213
1015 Ga0207683_10034312
1016 Ga0209281_1000021
1017 Ga0209281_1000041
1018 Ga0209281_1000085
1019 Ga0209281_1000291
1020 Ga0209281_1000817
1021 Ga0209371_1000001
1022 Ga0209371_1000010
1023 Ga0209371_1000047
1024 Ga0209371_1000590
1025 Ga0209371_1000803
1026 Ga0209371_1001366
1027 Ga0209371_1001830
1028 Ga0209371_1011312
1029 Ga0268266_10006560
1030 Ga0268264_10000088
1031 Ga0265334_10002838
1032 Ga0265318_10000031
1033 Ga0265318_10006809
1034 Ga0265318_10009576
1035 Ga0265338_10000006
1036 Ga0265338_10005866
1037 Ga0265338_10013556
1038 Ga0265338_10015294
1039 Ga0268256_1000001
1040 Ga0268256_1000022
1041 Ga0268256_1000270
1042 Ga0268256_1000514
1043 Ga0268256_1000671
1044 Ga0268256_1001116
1045 Ga0268256_1001173
1046 Ga0265330_10004426
1047 Ga0265328_10008679
1048 Ga0265328_10011367
1049 Ga0265328_10011823
1050 Ga0265320_10001142
1051 Ga0265325_10000003
1052 Ga0265325_10003681
1053 Ga0265325_10005413
1054 Ga0265325_10007971
1055 Ga0265329_10005285
1056 Ga0265340_10002162
1057 Ga0265340_10022680
1058 Ga0265339_10001397
1059 Ga0265339_10012298
1060 Ga0265339_10017287
1061 Ga0265339_10024291
1062 Ga0265339_10049844
1063 Ga0265331_10000141
1064 Ga0265331_10001884
1065 Ga0265331_10002109
1066 Ga0265331_10005803
1067 Ga0265331_10007523
1068 Ga0265331_10012128
1069 Ga0265327_10000076
1070 Ga0265316_10011748
1071 Ga0265316_10151872
1072 Ga0307513_10084284
1073 Ga0307509_10000022
1074 Ga0307509_10145012
1075 Ga0265313_10000365
1076 Ga0265313_10000745
1077 Ga0265313_10001646
1078 Ga0265313_10003952
1079 Ga0265313_10004103
1080 Ga0265313_10005442
1081 Ga0265313_10014638
1082 Ga0265313_10040965
1083 Ga0265314_10004456
1084 Ga0265314_10010811
1085 Ga0265314_10056460
1086 Ga0265342_10003917
1087 Ga0265342_10005490
1088 Ga0265342_10006956
1089 Ga0265342_10008325
1090 Ga0265342_10029181
1091 Ga0316576_10010831
1092 Ga0316578_10000385
1093 Ga0316578_10032280
1094 Ga0316577_10014017
1095 Ga0316577_10018169
1096 Ga0316577_10043630
1097 Ga0316593_10005918
1098 Ga0307510_10000008
1099 Ga0316592_1006238
1100 Ga0316588_1003379
1101 Ga0316596_1000856
1102 Ga0316596_1021055
1103 Ga0373934_0009038
1104 Ga0373936_0011864
1105 Ga0316574_0008426
1106 Ga0316574_0014416
1107 Ga0316574_0033639
1108 Ga0316574_0044886
1109 Ga0373931_0014449
1110 Ga0373935_0106960
1111 Ga0373927_0015239
1112 Ga0373933_0134836
1113 Ga0373937_0059076
1114 Ga0316582_0017269
1115 Ga0316582_0017380
1116 Ga0316582_0049709
1117 Ga0316584_0000079
1118 Ga0316584_0016210
1119 Ga0316584_0092213
1120 Ga0395899_0010808
1121 Ga0395905_0002859
1122 Ga0400490_11094
1123 Ga0400490_17222
1124 Ga0400491_21474
1125 Ga0400485_04923
1126 Ga0400485_15585
1127 Ga0400488_22325
1128 Ga0400488_32056
1129 Ga0400488_49339
1130 Ga0400486_08699
1131 Ga0400486_17653
1132 Ga0400486_22493
1133 Ga0400483_044668
1134 Ga0400483_059624
1135 Ga0400483_139193
1136 Ga0400483_145468
1137 Ga0400483_171382
1138 Ga0400483_195420
1139 Ga0400483_239719
1140 Ga0400483_269989
1141 Ga0400487_27800
1142 Ga0400487_54161
1143 Ga0436365_0727636
1144 Ga0439438_000001
1145 Ga0439447_000496
1146 Ga0439447_008932
1147 Ga0439466_0000003
1148 Ga0451853_3565153
1149 Ga0439432_001341
1150 Ga0439432_012730
1151 Ga0439452_000001
1152 Ga0439452_000003
1153 Ga0439452_000924
1154 Ga0439463_001202
1155 Ga0439463_002195
1156 Ga0450907_002033
1157 Ga0466981_0000098
1158 Ga0453684_0000136
1159 Ga0451576_0000025
1160 Ga0495627_010254
1161 Ga0495591_000009
1162 Ga0495591_000011
1163 Ga0495591_000080
1164 Ga0495591_002337
1165 Ga0495591_004267
1166 Ga0495591_004770
1167 Ga0495653_0013811
1168 Ga0495650_0000016
1169 Ga0495650_0000033
1170 Ga0495650_0000153
1171 Ga0495650_0000581
1172 Ga0495650_0002020
1173 Ga0495580_0002303
1174 Ga0495605_0000142
1175 Ga0495605_0001220
1176 Ga0495605_0008951
1177 Ga0495584_0017970
1178 Ga0495585_0003413
1179 Ga0495585_0012507
1180 Ga0495596_0001342
1181 Ga0495607_0000105
1182 Ga0495607_0000677
1183 Ga0495607_0010742
1184 Ga0495583_0000322
1185 Ga0495583_0000499
1186 Ga0495583_0001458
1187 Ga0495583_0001787
1188 Ga0495606_0000206
1189 Ga0495606_0000325
1190 Ga0495606_0007320
1191 Ga0495606_0013109
1192 Ga0495606_0021350
1193 Ga0495620_0000737
1194 Ga0495620_0000959
1195 Ga0495632_0000190
1196 Ga0495632_0004112
1197 Ga0495632_0006621
1198 Ga0495632_0038297
1199 Ga0495637_0000055
1200 Ga0495637_0000591
1201 Ga0495643_0007219
1202 Ga0495644_0000933
1203 Ga0495644_0005099
1204 Ga0495648_0000219
1205 Ga0495648_0004944
1206 Ga0495648_0021358
1207 Ga0495654_0000125
1208 Ga0495654_0000493
1209 Ga0495654_0000599
1210 Ga0495654_0005581
1211 Ga0495654_0031797
1212 Ga0495587_0047848
1213 Ga0495609_0000090
1214 Ga0495597_0001470
1215 Ga0495668_0010851
1216 Ga0495668_0035552
1217 Ga0495611_0000801
1218 Ga0495611_0009172
1219 Ga0495625_0000062
1220 Ga0495625_0043223
1221 Ga0495661_0000061
1222 Ga0495661_0000123
1223 Ga0495661_0003364
1224 Ga0495661_0004215
1225 Ga0495588_0010188
1226 Ga0495623_0026402
1227 Ga0495671_0005016
1228 Ga0495649_0004050
1229 Ga0495649_0006368
1230 Ga0495589_0004048
1231 Ga0495660_0000007
1232 Ga0495660_0000074
1233 Ga0495660_0001740
1234 Ga0495660_0047695
1235 Ga0495674_0243851
1236 Ga0495672_0000004
1237 Ga0495672_0000012
1238 Ga0495672_0007348
1239 Ga0495676_0000042
1240 Ga0495676_0030843
1241 Ga0495683_0000194
1242 Ga0495679_000027
1243 Ga0495679_000032
1244 Ga0495673_0000022
1245 Ga0495673_0000023
1246 Ga0495673_0000227
1247 Ga0495673_0000813
1248 Ga0495673_0001429
1249 Ga0495673_0027138
1250 Ga0495681_0000845
1251 Ga0495686_0008307
1252 Ga0495626_0000062
1253 Ga0496100_0044163
1254 Ga0496100_0069901
1255 Ga0496100_0078246
1256 Ga0496101_0000029
1257 Ga0496101_0042580
1258 Ga0496102_0016198
1259 Ga0496102_0032078
1260 Ga0496102_0093401
1261 Ga0496103_0013659
1262 Ga0496104_0001318
1263 Ga0496104_0006179
1264 Ga0496104_0043968
1265 Ga0496104_0076869
1266 Ga0496105_0011013
1267 Ga0496105_0083802
1268 Ga0496106_0102750
1269 Ga0496107_0009155
1270 Ga0496108_0012408
1271 Ga0496108_0143290
1272 Ga0496110_0020876
1273 Ga0496111_0003616
1274 Ga0496112_0017773
1275 Ga0496112_0051738
1276 Ga0496113_0015943
1277 Ga0496113_0114002
1278 Ga0496114_0004914
1279 Ga0496114_0107403
1280 Ga0496115_0015702
1281 Ga0496115_0057491
1282 Ga0496116_0000127
1283 Ga0496116_0000226
1284 Ga0496116_0000572
1285 Ga0496116_0008821
1286 Ga0496116_0014235
1287 Ga0496116_0026596
1288 Ga0496116_0057812
1289 Ga0496117_0000004
1290 Ga0496117_0000156
1291 Ga0496117_0000180
1292 Ga0496117_0005651
1293 Ga0496117_0014392
1294 Ga0496117_0020878
1295 Ga0496118_0000005
1296 Ga0496118_0000024
1297 Ga0496118_0004392
1298 Ga0496118_0007231
1299 Ga0496118_0018065
1300 Ga0496118_0072355
1301 Ga0496118_0128651
1302 Ga0496118_0140812
1303 Ga0496119_0000524
1304 Ga0496119_0002597
1305 Ga0496119_0007945
1306 Ga0496119_0016218
1307 Ga0496119_0020185
1308 Ga0496119_0057976
1309 Ga0496120_0000009
1310 Ga0496120_0000014
1311 Ga0496120_0000043
1312 Ga0496120_0001541
1313 Ga0496120_0003009
1314 Ga0496120_0003653
1315 Ga0496120_0006066
1316 Ga0496120_0008215
1317 Ga0496120_0015232
1318 Ga0496120_0027574
1319 Ga0496120_0053641
1320 Ga0496121_0000185
1321 Ga0496121_0002628
1322 Ga0496121_0002922
1323 Ga0496121_0009103
1324 Ga0496121_0015706
1325 Ga0496121_0032053
1326 Ga0496121_0110086
1327 Ga0496122_0000013
1328 Ga0496122_0000026
1329 Ga0496122_0000667
1330 Ga0496122_0000796
1331 Ga0496122_0006414
1332 Ga0496122_0010913
1333 Ga0496122_0012528
1334 Ga0496123_0000005
1335 Ga0496123_0000010
1336 Ga0496123_0000163
1337 Ga0496123_0000599
1338 Ga0496123_0000621
1339 Ga0496123_0004145
1340 Ga0496123_0004462
1341 Ga0496123_0010990
1342 Ga0496123_0018984
1343 Ga0496123_0026914
1344 Ga0496124_0000224
1345 Ga0496124_0000259
1346 Ga0496124_0002320
1347 Ga0496124_0002333
1348 Ga0496124_0004077
1349 Ga0496124_0005214
1350 Ga0496124_0010575
1351 Ga0496124_0016619
1352 Ga0496124_0047403
1353 Ga0496124_0097027
1354 Ga0496124_0097802
1355 Ga0496125_0000016
1356 Ga0496125_0000019
1357 Ga0496126_0000680
1358 Ga0496126_0002546
1359 Ga0496126_0028193
1360 Ga0496126_0052308
1361 Ga0496126_0072648
1362 Ga0495678_000043
1363 Ga0495678_000828
1364 Ga0495678_005192
1365 Ga0495682_0000026
1366 Ga0495682_0000096
1367 Ga0495682_0009796
1368 Ga0501032_0053161
1369 Ga0501033_0009400
1370 Ga0501033_0035651
1371 Ga0501034_0217223
1372 Ga0501036_0005174
1373 Ga0501037_0091553
1374 Ga0501038_0002891
1375 Ga0501038_0007559
1376 Ga0501039_0008375
1377 Ga0501046_0000911
1378 Ga0501047_0003232
1379 Ga0501047_0007271
1380 Ga0501047_0023442
1381 Ga0501047_0033222
1382 Ga0501048_0020709
1383 Ga0501048_0045342
1384 Ga0501067_0001068
1385 Ga0501069_0002056
1386 Ga0501069_0012736
1387 Ga0501070_0000110
1388 Ga0501070_0003063
1389 Ga0501073_0067640
1390 Ga0501074_0096593
1391 Ga0501077_0066101
1392 Ga0501079_0005199
1393 Ga0501080_0064253
1394 Ga0501080_0073449
1395 Ga0501080_0188888
1396 Ga0501083_0002409
1397 Ga0501083_0020350
1398 Ga0501035_0002718
1399 Ga0501044_0001134
1400 Ga0501044_0071185
1401 Ga0501044_0150755
1402 Ga0501044_0164241
1403 nmdc:mga00v17_29080_c1
1404 nmdc:mga00v17_5777_c1
1405 nmdc:mga0n895_62253_c1
1406 nmdc:mga08x19_26679_c1
1407 nmdc:mga08x19_80_c1
1408 Ga0495601_0036273
1409 Ga0500583_0027435
1410 Ga0500621_000001
1411 Ga0500637_0023296
1412 Ga0501084_0052916
1413 Ga0501082_0016188
1414 Ga0501082_0050459
1415 2508851225
1416 2511381174
1417 2511436093
1418 2523106204
1419 2523468584
1420 2538427348
1421 2547694521
1422 2555258980
1423 2562466596
1424 2566036998
1425 2585826935
1426 2585831106
1427 2599410499
1428 2599927277
1429 2599973577
1430 2601523865
1431 2601529016
1432 2601532106
1433 2601537477
1434 2601615850
1435 2601620422
1436 2601645870
1437 2601648824
1438 2601653900
1439 2601659327
1440 2601665317
1441 2601698179
1442 2601703328
1443 2601708517
1444 2601713630
1445 2601717161
1446 2601722054
1447 2601724678
1448 2601731959
1449 2601738410
1450 2601742741
1451 2601751885
1452 2601755824
1453 2601761192
1454 2602020216
1455 2603638782
1456 2603643312
1457 2603663441
1458 2603668051
1459 2603699910
1460 2603703890
1461 2603839513
1462 2603844438
1463 2603849665
1464 2603854731
1465 2603869857
1466 2603878968
1467 2606047042
1468 2606072474
1469 2606146452
1470 2606177377
1471 2608668694
1472 2609913860
1473 2637226402
1474 2649119765
1475 2649121071
1476 2650896622
1477 2652973233
1478 2652974604
1479 2671102528
1480 2671108222
1481 2671586553
1482 2676407440
1483 2681995650
1484 2682007445
1485 2686352618
1486 2691331244
1487 2707099815
1488 2728748887
1489 2738688729
1490 2739264960
1491 2739352060
1492 2753855168
1493 2765588104
1494 2772437791
1495 2775541572
1496 2777020281
1497 2791923226
1498 2792312400
1499 2793406238
1500 2807180477
1501 2809124820
1502 2812370426
1503 2813729844
1504 2814697338
1505 2821118942
1506 2823376808
1507 2844426701
1508 2844532180
1509 2847088505
1510 2847800704
1511 2852103805
1512 2855198723
1513 2858470105
1514 2865017723
1515 2871277166
1516 2871286678
1517 2876602709
1518 2884089830
1519 2888367781
1520 2888374529
1521 2891672319
1522 2900054077
1523 2900055743
1524 2904475106
1525 2904505486
1526 2904517405
1527 2908670983
1528 2919109463
1529 2919151452
1530 2919678551
1531 2919691617
1532 2923524517
1533 2923638592
1534 2927146326
1535 2927834909
1536 2935627457
1537 2937543461
1538 2937969069
1539 2939602871
1540 2939608337
1541 2939621477
1542 2945878940
1543 2945953796
1544 2969083384
1545 2971824815
1546 2974312975
1547 2974437618
1548 2984495837
1549 2984560401
1550 2984598478
1551 2990262525
1552 3000379919
1553 640936798
1554 8002749738
1555 8004595001
1556 8015399161
1557 8016736701
1558 8018225304
1559 8018408109
1560 8019501935
1561 8019508381
1562 8054847080
1563 8055088849
1564 8055093805
1565 8055102157
1566 8057305901

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01654

Cyt_bd_oxida_I

Cytochrome bd terminal oxidase subunit I

13

475

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rko-assembly1.cif.gz_A cryo-em structure of the e. coli cytochrome bd-i oxidase at 2.68 a resolution 0.9745 2 513
6rko-assembly1.cif.gz_A cryo-em structure of the e. coli cytochrome bd-i oxidase at 2.68 a resolution 0.9724 2 513
6rx4-assembly1.cif.gz_A the structure of bd oxidase from escherichia coli 0.968 2 515
7oy2-assembly1.cif.gz_C high resolution structure of cytochrome bd-ii oxidase from e. coli 0.9662 3 503
6rx4-assembly1.cif.gz_A the structure of bd oxidase from escherichia coli 0.9661 2 515
ID Description Score Start End Superfamily
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.5657 12 441 1.20.1630.10
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.5528 12 441 1.20.1630.10
af_I1KZ04_198_383_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.4439 12 236 1.20.120.1770
af_I1KZ04_198_383_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.407 12 236 1.20.120.1770
af_A0A1D8PLM4_14_243_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4055 20 234 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A376UDY2-F1-model_v4 Cytochrome d ubiquinol oxidase subunit 1 (EC 1.10.3.-) 0.9846 128 238 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A7Y7DJR0-F1-model_v4 Cytochrome ubiquinol oxidase subunit I 0.9783 4 504 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A6N3U8U7-F1-model_v4 deleted 0.9781 11 514
AF-A0A7Z8G990-F1-model_v4 deleted 0.9777 148 515
AF-A0A6M1DKR8-F1-model_v4 Cytochrome bd-I ubiquinol oxidase subunit CydA 0.9773 311 451 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069

Map