F480680
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 783 | 337 | 1566 | 92 |
Family's Representative Sequence
| Representative Sequence | 3300050491|nmdc:mga00v17_848936_c1|nmdc:mga00v17_848936_c1_26_358 |
| Length | 110 |
| Sequence | MGSHHKRAIRAAAAGDIRMSTMLLWSITAAQILLCVSMACAIFRILWGPRAQDRIVGFDCLYVNAMLLLLAFGIRSGSTLYFEAALMVSLLGFVSTVALAKFLLRGEVIE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 179 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 181 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 182 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 183 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 184 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 186 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 187 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 188 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 189 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 190 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 191 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 192 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 197 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 198 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 199 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 200 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 201 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 204 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 210 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 211 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 212 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 213 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 214 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 215 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 216 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 217 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 218 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 219 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 220 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 221 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 222 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 223 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 224 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 225 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 235 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 236 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 237 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 238 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 239 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 240 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 243 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 244 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 245 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 246 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 247 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 248 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 249 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 250 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 251 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 252 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 253 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 254 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 255 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 256 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 257 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 258 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 288 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 289 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 293 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 294 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 295 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 296 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 297 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 298 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 299 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 305 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 306 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 307 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 308 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 309 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 310 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 313 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 314 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 315 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 316 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 317 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 318 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 319 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 320 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 321 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 322 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 323 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 324 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 325 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 326 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 327 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 328 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 329 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 330 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 331 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 332 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 333 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 334 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 335 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 336 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 337 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.68 |
| Metatranscriptomes | 0.13 |
| Isolates | 3.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.13 |
| Bulb | 0 |
| Endosphere | 6.9 |
| Nodule | 0.51 |
| Rhizoplane | 7.02 |
| Rhizosphere | 78.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga00v17_848936_c1 | 3300050491 | Unclassified | 580 |
| 2 | rootL2_10338223 | 3300003322 | Bacteria | 1700 |
| 3 | rootH1_10265339 | 3300003323 | Bacteria | 1967 |
| 4 | rootH1_10398603 | 3300003323 | Bacteria | 1204 |
| 5 | Ga0006562J51391_1006409 | 3300003578 | Bacteria | 5212 |
| 6 | Ga0070658_10003488 | 3300005327 | Bacteria | 12921 |
| 7 | Ga0070658_10165025 | 3300005327 | Bacteria | 1859 |
| 8 | Ga0070658_11344707 | 3300005327 | Bacteria | 620 |
| 9 | Ga0070676_10676252 | 3300005328 | Bacteria | 752 |
| 10 | Ga0070676_11116586 | 3300005328 | Bacteria | 596 |
| 11 | Ga0070676_11125842 | 3300005328 | Bacteria | 594 |
| 12 | Ga0070683_100164491 | 3300005329 | Bacteria | 2105 |
| 13 | Ga0070683_100352283 | 3300005329 | Unclassified | 1402 |
| 14 | Ga0070683_100778266 | 3300005329 | Bacteria | 917 |
| 15 | Ga0070683_101269707 | 3300005329 | Bacteria | 708 |
| 16 | Ga0070670_100159351 | 3300005331 | Bacteria | 1956 |
| 17 | Ga0070670_101666295 | 3300005331 | Bacteria | 587 |
| 18 | Ga0070677_10568362 | 3300005333 | Bacteria | 624 |
| 19 | Ga0068869_100014018 | 3300005334 | Bacteria | 5348 |
| 20 | Ga0068869_100092905 | 3300005334 | Bacteria | 2272 |
| 21 | Ga0068869_100398628 | 3300005334 | Bacteria | 1131 |
| 22 | Ga0068869_100469553 | 3300005334 | Bacteria | 1046 |
| 23 | Ga0070680_100014420 | 3300005336 | Bacteria | 6177 |
| 24 | Ga0070680_100020613 | 3300005336 | Bacteria | 5235 |
| 25 | Ga0070680_100135813 | 3300005336 | Bacteria | 2060 |
| 26 | Ga0070680_100491888 | 3300005336 | Bacteria | 1049 |
| 27 | Ga0070682_100072965 | 3300005337 | Bacteria | 2201 |
| 28 | Ga0068868_101181358 | 3300005338 | Bacteria | 707 |
| 29 | Ga0068868_101457717 | 3300005338 | Bacteria | 640 |
| 30 | Ga0070660_100392741 | 3300005339 | Bacteria | 1146 |
| 31 | Ga0070660_100943870 | 3300005339 | Unclassified | 728 |
| 32 | Ga0070660_100951606 | 3300005339 | Bacteria | 725 |
| 33 | Ga0070689_100830760 | 3300005340 | Bacteria | 814 |
| 34 | Ga0070689_100919737 | 3300005340 | Unclassified | 775 |
| 35 | Ga0070689_101184725 | 3300005340 | Bacteria | 685 |
| 36 | Ga0070691_10289947 | 3300005341 | Bacteria | 890 |
| 37 | Ga0070691_10307286 | 3300005341 | Bacteria | 868 |
| 38 | Ga0070687_100100854 | 3300005343 | Bacteria | 1616 |
| 39 | Ga0070687_100422112 | 3300005343 | Bacteria | 880 |
| 40 | Ga0070661_100010269 | 3300005344 | Bacteria | 6506 |
| 41 | Ga0070692_10022193 | 3300005345 | Bacteria | 3098 |
| 42 | Ga0070692_10371920 | 3300005345 | Bacteria | 894 |
| 43 | Ga0070668_100076893 | 3300005347 | Bacteria | 2608 |
| 44 | Ga0070668_100256201 | 3300005347 | Bacteria | 1454 |
| 45 | Ga0070668_101099378 | 3300005347 | Bacteria | 717 |
| 46 | Ga0070668_101347115 | 3300005347 | Bacteria | 650 |
| 47 | Ga0070668_102052173 | 3300005347 | Bacteria | 528 |
| 48 | Ga0070669_100089827 | 3300005353 | Bacteria | 2302 |
| 49 | Ga0070669_101686263 | 3300005353 | Bacteria | 552 |
| 50 | Ga0070675_100641029 | 3300005354 | Unclassified | 965 |
| 51 | Ga0070671_100359625 | 3300005355 | Bacteria | 1243 |
| 52 | Ga0070671_100942040 | 3300005355 | Bacteria | 755 |
| 53 | Ga0070674_100490005 | 3300005356 | Bacteria | 1022 |
| 54 | Ga0070674_100581297 | 3300005356 | Bacteria | 944 |
| 55 | Ga0070674_100994053 | 3300005356 | Unclassified | 736 |
| 56 | Ga0070673_101641297 | 3300005364 | Bacteria | 608 |
| 57 | Ga0070659_100127702 | 3300005366 | Bacteria | 2063 |
| 58 | Ga0070667_100101024 | 3300005367 | Bacteria | 2491 |
| 59 | Ga0070667_101721521 | 3300005367 | Bacteria | 590 |
| 60 | Ga0070703_10019779 | 3300005406 | Bacteria | 1954 |
| 61 | Ga0070701_10674312 | 3300005438 | Bacteria | 693 |
| 62 | Ga0070705_100000901 | 3300005440 | Bacteria | 16586 |
| 63 | Ga0070705_100124782 | 3300005440 | Bacteria | 1669 |
| 64 | Ga0070700_100001924 | 3300005441 | Bacteria | 10504 |
| 65 | Ga0070700_100417194 | 3300005441 | Bacteria | 1013 |
| 66 | Ga0070700_100500283 | 3300005441 | Bacteria | 935 |
| 67 | Ga0070700_101890338 | 3300005441 | Bacteria | 516 |
| 68 | Ga0070694_100001405 | 3300005444 | Bacteria | 14089 |
| 69 | Ga0070694_100173731 | 3300005444 | Bacteria | 1589 |
| 70 | Ga0070708_100016481 | 3300005445 | Bacteria | 6134 |
| 71 | Ga0070663_100038744 | 3300005455 | Bacteria | 3326 |
| 72 | Ga0070663_100065164 | 3300005455 | Bacteria | 2636 |
| 73 | Ga0070663_100198443 | 3300005455 | Bacteria | 1565 |
| 74 | Ga0070663_100260723 | 3300005455 | Bacteria | 1375 |
| 75 | Ga0070663_100274613 | 3300005455 | Unclassified | 1341 |
| 76 | Ga0070663_100716772 | 3300005455 | Unclassified | 851 |
| 77 | Ga0070663_101582407 | 3300005455 | Bacteria | 584 |
| 78 | Ga0070663_101624389 | 3300005455 | Unclassified | 577 |
| 79 | Ga0070678_100054493 | 3300005456 | Bacteria | 2914 |
| 80 | Ga0070678_100078226 | 3300005456 | Bacteria | 2498 |
| 81 | Ga0070678_100574215 | 3300005456 | Bacteria | 1004 |
| 82 | Ga0070678_100738069 | 3300005456 | Bacteria | 890 |
| 83 | Ga0070678_101125785 | 3300005456 | Bacteria | 726 |
| 84 | Ga0070662_100300943 | 3300005457 | Bacteria | 1303 |
| 85 | Ga0070662_101456942 | 3300005457 | Bacteria | 590 |
| 86 | Ga0070681_10006828 | 3300005458 | Bacteria | 11113 |
| 87 | Ga0070681_10013475 | 3300005458 | Bacteria | 8124 |
| 88 | Ga0070681_10106659 | 3300005458 | Bacteria | 2743 |
| 89 | Ga0070681_10174999 | 3300005458 | Bacteria | 2068 |
| 90 | Ga0070681_10477645 | 3300005458 | Bacteria | 1159 |
| 91 | Ga0070681_10583248 | 3300005458 | Unclassified | 1032 |
| 92 | Ga0070681_10587353 | 3300005458 | Bacteria | 1028 |
| 93 | Ga0068867_100072516 | 3300005459 | Bacteria | 2578 |
| 94 | Ga0068867_101643178 | 3300005459 | Bacteria | 601 |
| 95 | Ga0070685_10416578 | 3300005466 | Unclassified | 934 |
| 96 | Ga0070685_11444812 | 3300005466 | Bacteria | 529 |
| 97 | Ga0070706_100029463 | 3300005467 | Bacteria | 5057 |
| 98 | Ga0070707_100525423 | 3300005468 | Bacteria | 1145 |
| 99 | Ga0070698_100017908 | 3300005471 | Bacteria | 7463 |
| 100 | Ga0070699_100015194 | 3300005518 | Bacteria | 6615 |
| 101 | Ga0070679_100028734 | 3300005530 | Bacteria | 5485 |
| 102 | Ga0070679_100338546 | 3300005530 | Bacteria | 1452 |
| 103 | Ga0070679_100680238 | 3300005530 | Unclassified | 972 |
| 104 | Ga0070679_100918268 | 3300005530 | Unclassified | 819 |
| 105 | Ga0070679_101653465 | 3300005530 | Bacteria | 588 |
| 106 | Ga0070679_101717838 | 3300005530 | Bacteria | 576 |
| 107 | Ga0070684_100189099 | 3300005535 | Bacteria | 1873 |
| 108 | Ga0070684_101079299 | 3300005535 | Bacteria | 754 |
| 109 | Ga0070697_100009532 | 3300005536 | Bacteria | 7588 |
| 110 | Ga0068853_100242692 | 3300005539 | Bacteria | 1652 |
| 111 | Ga0070672_100098034 | 3300005543 | Bacteria | 2374 |
| 112 | Ga0070672_100152234 | 3300005543 | Bacteria | 1914 |
| 113 | Ga0070672_101619603 | 3300005543 | Bacteria | 581 |
| 114 | Ga0070672_101910417 | 3300005543 | Bacteria | 534 |
| 115 | Ga0070686_101345841 | 3300005544 | Bacteria | 598 |
| 116 | Ga0070695_100000158 | 3300005545 | Bacteria | 32227 |
| 117 | Ga0070696_100233450 | 3300005546 | Bacteria | 1385 |
| 118 | Ga0070693_100356129 | 3300005547 | Bacteria | 1003 |
| 119 | Ga0070693_100486276 | 3300005547 | Unclassified | 873 |
| 120 | Ga0070693_100815878 | 3300005547 | Bacteria | 693 |
| 121 | Ga0070693_101005415 | 3300005547 | Bacteria | 631 |
| 122 | Ga0070665_100010765 | 3300005548 | Bacteria | 9253 |
| 123 | Ga0070665_100081964 | 3300005548 | Bacteria | 3231 |
| 124 | Ga0070665_100388894 | 3300005548 | Bacteria | 1402 |
| 125 | Ga0070704_100008256 | 3300005549 | Bacteria | 6233 |
| 126 | Ga0070704_100086648 | 3300005549 | Bacteria | 2322 |
| 127 | Ga0068855_100067522 | 3300005563 | Bacteria | 4165 |
| 128 | Ga0068855_100139229 | 3300005563 | Bacteria | 2768 |
| 129 | Ga0068855_100408200 | 3300005563 | Bacteria | 1487 |
| 130 | Ga0068855_100597169 | 3300005563 | Bacteria | 1191 |
| 131 | Ga0068855_101111531 | 3300005563 | Unclassified | 826 |
| 132 | Ga0068855_101135554 | 3300005563 | Bacteria | 815 |
| 133 | Ga0068855_101216124 | 3300005563 | Bacteria | 783 |
| 134 | Ga0068855_102125797 | 3300005563 | Bacteria | 565 |
| 135 | Ga0070664_100118502 | 3300005564 | Bacteria | 2316 |
| 136 | Ga0070664_100571187 | 3300005564 | Bacteria | 1047 |
| 137 | Ga0070664_101117158 | 3300005564 | Unclassified | 743 |
| 138 | Ga0070664_101540017 | 3300005564 | Unclassified | 629 |
| 139 | Ga0068857_100009560 | 3300005577 | Bacteria | 8420 |
| 140 | Ga0068857_100548081 | 3300005577 | Unclassified | 1089 |
| 141 | Ga0068854_100509208 | 3300005578 | Bacteria | 1015 |
| 142 | Ga0068856_101363028 | 3300005614 | Bacteria | 724 |
| 143 | Ga0070702_100016066 | 3300005615 | Bacteria | 3834 |
| 144 | Ga0070702_101697119 | 3300005615 | Bacteria | 525 |
| 145 | Ga0068852_100392752 | 3300005616 | Bacteria | 1363 |
| 146 | Ga0068852_100681505 | 3300005616 | Bacteria | 1037 |
| 147 | Ga0068852_101875297 | 3300005616 | Bacteria | 622 |
| 148 | Ga0068859_100003502 | 3300005617 | Bacteria | 15988 |
| 149 | Ga0068859_100194379 | 3300005617 | Bacteria | 2113 |
| 150 | Ga0068859_102532578 | 3300005617 | Bacteria | 565 |
| 151 | Ga0068864_100025178 | 3300005618 | Bacteria | 5009 |
| 152 | Ga0068864_100540208 | 3300005618 | Bacteria | 1125 |
| 153 | Ga0068866_10721483 | 3300005718 | Bacteria | 686 |
| 154 | Ga0068866_10845806 | 3300005718 | Bacteria | 639 |
| 155 | Ga0068861_100023390 | 3300005719 | Bacteria | 4456 |
| 156 | Ga0068861_100042905 | 3300005719 | Bacteria | 3392 |
| 157 | Ga0068861_100221668 | 3300005719 | Bacteria | 1599 |
| 158 | Ga0068870_10120828 | 3300005840 | Bacteria | 1509 |
| 159 | Ga0068870_10159334 | 3300005840 | Bacteria | 1337 |
| 160 | Ga0068870_10591421 | 3300005840 | Unclassified | 753 |
| 161 | Ga0068863_100107338 | 3300005841 | Bacteria | 2657 |
| 162 | Ga0068863_100250601 | 3300005841 | Bacteria | 1710 |
| 163 | Ga0068863_100329608 | 3300005841 | Bacteria | 1484 |
| 164 | Ga0068858_100488445 | 3300005842 | Unclassified | 1189 |
| 165 | Ga0068858_102056274 | 3300005842 | Bacteria | 565 |
| 166 | Ga0068860_100001841 | 3300005843 | Bacteria | 22590 |
| 167 | Ga0068860_100080379 | 3300005843 | Bacteria | 3100 |
| 168 | Ga0068862_100002731 | 3300005844 | Bacteria | 15492 |
| 169 | Ga0068862_100017501 | 3300005844 | Bacteria | 5970 |
| 170 | Ga0068862_100296142 | 3300005844 | Bacteria | 1487 |
| 171 | Ga0068862_101976356 | 3300005844 | Unclassified | 594 |
| 172 | Ga0075365_10045106 | 3300006038 | Bacteria | 2891 |
| 173 | Ga0075365_10076577 | 3300006038 | Bacteria | 2259 |
| 174 | Ga0075365_10176951 | 3300006038 | Bacteria | 1491 |
| 175 | Ga0075365_10448618 | 3300006038 | Bacteria | 911 |
| 176 | Ga0075365_10627213 | 3300006038 | Bacteria | 760 |
| 177 | Ga0075363_100114453 | 3300006048 | Bacteria | 1502 |
| 178 | Ga0075363_100474799 | 3300006048 | Bacteria | 741 |
| 179 | Ga0075364_10016127 | 3300006051 | Bacteria | 4644 |
| 180 | Ga0075364_10030113 | 3300006051 | Unclassified | 3483 |
| 181 | Ga0075432_10059355 | 3300006058 | Bacteria | 1360 |
| 182 | Ga0070715_10267802 | 3300006163 | Bacteria | 900 |
| 183 | Ga0075362_10045679 | 3300006177 | Unclassified | 1946 |
| 184 | Ga0075362_10652552 | 3300006177 | Unclassified | 547 |
| 185 | Ga0075367_10030475 | 3300006178 | Bacteria | 3093 |
| 186 | Ga0075367_10098355 | 3300006178 | Unclassified | 1786 |
| 187 | Ga0075367_10933851 | 3300006178 | Unclassified | 553 |
| 188 | Ga0075369_10304711 | 3300006186 | Bacteria | 744 |
| 189 | Ga0075366_10021454 | 3300006195 | Bacteria | 3753 |
| 190 | Ga0075366_11010888 | 3300006195 | Bacteria | 519 |
| 191 | Ga0097621_100330182 | 3300006237 | Unclassified | 1352 |
| 192 | Ga0097621_101146284 | 3300006237 | Bacteria | 731 |
| 193 | Ga0097621_101272882 | 3300006237 | Bacteria | 694 |
| 194 | Ga0075370_10060801 | 3300006353 | Bacteria | 2152 |
| 195 | Ga0075370_10335264 | 3300006353 | Bacteria | 902 |
| 196 | Ga0075370_10476437 | 3300006353 | Bacteria | 752 |
| 197 | Ga0068871_100358514 | 3300006358 | Bacteria | 1291 |
| 198 | Ga0068871_100614064 | 3300006358 | Bacteria | 990 |
| 199 | Ga0068871_100806206 | 3300006358 | Unclassified | 866 |
| 200 | Ga0068871_101692096 | 3300006358 | Bacteria | 600 |
| 201 | Ga0075428_100251939 | 3300006844 | Bacteria | 1903 |
| 202 | Ga0075428_101471530 | 3300006844 | Bacteria | 714 |
| 203 | Ga0075430_100009987 | 3300006846 | Bacteria | 8031 |
| 204 | Ga0075430_100484328 | 3300006846 | Bacteria | 1021 |
| 205 | Ga0075430_101409045 | 3300006846 | Bacteria | 573 |
| 206 | Ga0075431_100856752 | 3300006847 | Bacteria | 880 |
| 207 | Ga0075433_10018253 | 3300006852 | Bacteria | 5826 |
| 208 | Ga0075434_100004344 | 3300006871 | Bacteria | 12753 |
| 209 | Ga0075429_100744713 | 3300006880 | Unclassified | 858 |
| 210 | Ga0068865_100296126 | 3300006881 | Bacteria | 1293 |
| 211 | Ga0068865_100340032 | 3300006881 | Unclassified | 1213 |
| 212 | Ga0097620_100003500 | 3300006931 | Bacteria | 15988 |
| 213 | Ga0097620_100194396 | 3300006931 | Bacteria | 2113 |
| 214 | Ga0097620_102532335 | 3300006931 | Bacteria | 565 |
| 215 | Ga0075435_100198189 | 3300007076 | Unclassified | 1701 |
| 216 | Ga0105244_10260307 | 3300009036 | Unclassified | 807 |
| 217 | Ga0105244_10340994 | 3300009036 | Bacteria | 691 |
| 218 | Ga0105240_10080457 | 3300009093 | Bacteria | 4007 |
| 219 | Ga0105240_11077991 | 3300009093 | Unclassified | 856 |
| 220 | Ga0105240_11867774 | 3300009093 | Bacteria | 625 |
| 221 | Ga0105240_11927442 | 3300009093 | Unclassified | 615 |
| 222 | Ga0111539_10158996 | 3300009094 | Bacteria | 2643 |
| 223 | Ga0111539_11939178 | 3300009094 | Bacteria | 683 |
| 224 | Ga0105245_10067879 | 3300009098 | Bacteria | 3230 |
| 225 | Ga0105245_10703437 | 3300009098 | Bacteria | 1044 |
| 226 | Ga0105245_11771471 | 3300009098 | Bacteria | 670 |
| 227 | Ga0105245_13110375 | 3300009098 | Bacteria | 514 |
| 228 | Ga0105247_10129646 | 3300009101 | Bacteria | 1642 |
| 229 | Ga0105247_10515956 | 3300009101 | Bacteria | 873 |
| 230 | Ga0105243_10056569 | 3300009148 | Bacteria | 3120 |
| 231 | Ga0105243_10204910 | 3300009148 | Bacteria | 1733 |
| 232 | Ga0105243_11520150 | 3300009148 | Bacteria | 694 |
| 233 | Ga0105241_10023704 | 3300009174 | Bacteria | 4553 |
| 234 | Ga0105241_10990175 | 3300009174 | Bacteria | 786 |
| 235 | Ga0105241_11441256 | 3300009174 | Bacteria | 661 |
| 236 | Ga0105242_10205554 | 3300009176 | Bacteria | 1751 |
| 237 | Ga0105242_12505360 | 3300009176 | Unclassified | 564 |
| 238 | Ga0105248_10555022 | 3300009177 | Bacteria | 1296 |
| 239 | Ga0105248_11451535 | 3300009177 | Bacteria | 776 |
| 240 | Ga0105237_10130058 | 3300009545 | Bacteria | 2512 |
| 241 | Ga0105237_11127746 | 3300009545 | Bacteria | 791 |
| 242 | Ga0105237_12454848 | 3300009545 | Bacteria | 532 |
| 243 | Ga0105238_10075653 | 3300009551 | Bacteria | 3358 |
| 244 | Ga0105238_10317910 | 3300009551 | Bacteria | 1542 |
| 245 | Ga0105238_10589408 | 3300009551 | Unclassified | 1119 |
| 246 | Ga0105238_12751765 | 3300009551 | Bacteria | 528 |
| 247 | Ga0105249_10046892 | 3300009553 | Bacteria | 3935 |
| 248 | Ga0105249_10710686 | 3300009553 | Bacteria | 1065 |
| 249 | Ga0105249_11170778 | 3300009553 | Unclassified | 840 |
| 250 | Ga0105035_105373 | 3300009988 | Unclassified | 1038 |
| 251 | Ga0105239_10053150 | 3300010375 | Bacteria | 4444 |
| 252 | Ga0105239_10346368 | 3300010375 | Bacteria | 1677 |
| 253 | Ga0105239_11216887 | 3300010375 | Bacteria | 868 |
| 254 | Ga0105239_12198351 | 3300010375 | Bacteria | 641 |
| 255 | Ga0105239_12536316 | 3300010375 | Unclassified | 598 |
| 256 | Ga0105246_10012864 | 3300011119 | Bacteria | 5234 |
| 257 | Ga0105246_10040416 | 3300011119 | Bacteria | 3147 |
| 258 | Ga0105246_10162168 | 3300011119 | Bacteria | 1704 |
| 259 | Ga0157371_10027723 | 3300013102 | Bacteria | 4106 |
| 260 | Ga0157370_10025664 | 3300013104 | Bacteria | 5830 |
| 261 | Ga0157370_10205779 | 3300013104 | Bacteria | 1825 |
| 262 | Ga0157369_10069466 | 3300013105 | Bacteria | 3784 |
| 263 | Ga0157369_10148213 | 3300013105 | Bacteria | 2481 |
| 264 | Ga0157369_12121682 | 3300013105 | Bacteria | 570 |
| 265 | Ga0157374_12211206 | 3300013296 | Bacteria | 577 |
| 266 | Ga0157378_10099522 | 3300013297 | Bacteria | 2653 |
| 267 | Ga0157378_12670550 | 3300013297 | Bacteria | 552 |
| 268 | Ga0163162_10214861 | 3300013306 | Bacteria | 2053 |
| 269 | Ga0163162_10354739 | 3300013306 | Bacteria | 1599 |
| 270 | Ga0163162_10528127 | 3300013306 | Bacteria | 1309 |
| 271 | Ga0157372_10051543 | 3300013307 | Bacteria | 4581 |
| 272 | Ga0157372_10729895 | 3300013307 | Bacteria | 1152 |
| 273 | Ga0157375_10306008 | 3300013308 | Unclassified | 1753 |
| 274 | Ga0157375_10565070 | 3300013308 | Bacteria | 1298 |
| 275 | Ga0157375_11999221 | 3300013308 | Bacteria | 689 |
| 276 | Ga0157375_12313859 | 3300013308 | Bacteria | 641 |
| 277 | Ga0157375_13330215 | 3300013308 | Bacteria | 535 |
| 278 | Ga0163163_10051486 | 3300014325 | Bacteria | 4060 |
| 279 | Ga0163163_12341025 | 3300014325 | Unclassified | 593 |
| 280 | Ga0157380_10059377 | 3300014326 | Bacteria | 3052 |
| 281 | Ga0157380_10144692 | 3300014326 | Bacteria | 2047 |
| 282 | Ga0157380_10238703 | 3300014326 | Bacteria | 1637 |
| 283 | Ga0157380_10888827 | 3300014326 | Bacteria | 916 |
| 284 | Ga0157380_11899401 | 3300014326 | Bacteria | 656 |
| 285 | Ga0182008_10278474 | 3300014497 | Bacteria | 870 |
| 286 | Ga0157377_10640670 | 3300014745 | Bacteria | 763 |
| 287 | Ga0157376_10222379 | 3300014969 | Bacteria | 1749 |
| 288 | Ga0157376_11054875 | 3300014969 | Bacteria | 837 |
| 289 | Ga0157376_12607770 | 3300014969 | Unclassified | 545 |
| 290 | Ga0163161_10170332 | 3300017792 | Bacteria | 1665 |
| 291 | Ga0207653_10102885 | 3300025885 | Bacteria | 1012 |
| 292 | Ga0207682_10264184 | 3300025893 | Bacteria | 803 |
| 293 | Ga0207642_11064305 | 3300025899 | Unclassified | 522 |
| 294 | Ga0207710_10679884 | 3300025900 | Bacteria | 540 |
| 295 | Ga0207688_10030603 | 3300025901 | Bacteria | 2969 |
| 296 | Ga0207688_10270634 | 3300025901 | Bacteria | 1033 |
| 297 | Ga0207647_10567915 | 3300025904 | Bacteria | 628 |
| 298 | Ga0207643_10015598 | 3300025908 | Bacteria | 4136 |
| 299 | Ga0207643_10094685 | 3300025908 | Bacteria | 1745 |
| 300 | Ga0207643_10383986 | 3300025908 | Bacteria | 886 |
| 301 | Ga0207705_10033509 | 3300025909 | Bacteria | 3670 |
| 302 | Ga0207654_10048191 | 3300025911 | Bacteria | 2437 |
| 303 | Ga0207654_11433403 | 3300025911 | Bacteria | 504 |
| 304 | Ga0207707_10000582 | 3300025912 | Bacteria | 37091 |
| 305 | Ga0207707_10030337 | 3300025912 | Bacteria | 4730 |
| 306 | Ga0207707_10104342 | 3300025912 | Bacteria | 2477 |
| 307 | Ga0207707_10141199 | 3300025912 | Bacteria | 2106 |
| 308 | Ga0207707_10191415 | 3300025912 | Bacteria | 1785 |
| 309 | Ga0207707_10323175 | 3300025912 | Bacteria | 1332 |
| 310 | Ga0207707_10371165 | 3300025912 | Unclassified | 1231 |
| 311 | Ga0207707_10990929 | 3300025912 | Bacteria | 690 |
| 312 | Ga0207707_11009592 | 3300025912 | Unclassified | 682 |
| 313 | Ga0207660_10012873 | 3300025917 | Bacteria | 5477 |
| 314 | Ga0207660_10015931 | 3300025917 | Bacteria | 4970 |
| 315 | Ga0207660_10064435 | 3300025917 | Bacteria | 2645 |
| 316 | Ga0207660_10510124 | 3300025917 | Bacteria | 976 |
| 317 | Ga0207660_11316053 | 3300025917 | Bacteria | 587 |
| 318 | Ga0207662_10116595 | 3300025918 | Bacteria | 1670 |
| 319 | Ga0207657_10021633 | 3300025919 | Bacteria | 6046 |
| 320 | Ga0207657_10135285 | 3300025919 | Bacteria | 2017 |
| 321 | Ga0207657_10644674 | 3300025919 | Unclassified | 825 |
| 322 | Ga0207657_10682167 | 3300025919 | Bacteria | 799 |
| 323 | Ga0207652_10004959 | 3300025921 | Bacteria | 10782 |
| 324 | Ga0207652_10837897 | 3300025921 | Unclassified | 815 |
| 325 | Ga0207681_10055802 | 3300025923 | Bacteria | 2693 |
| 326 | Ga0207681_10958824 | 3300025923 | Bacteria | 717 |
| 327 | Ga0207681_11697489 | 3300025923 | Bacteria | 528 |
| 328 | Ga0207694_10063948 | 3300025924 | Bacteria | 2867 |
| 329 | Ga0207694_10343267 | 3300025924 | Unclassified | 1235 |
| 330 | Ga0207694_10507525 | 3300025924 | Bacteria | 1010 |
| 331 | Ga0207694_11700437 | 3300025924 | Bacteria | 531 |
| 332 | Ga0207650_10934547 | 3300025925 | Bacteria | 737 |
| 333 | Ga0207659_10412969 | 3300025926 | Bacteria | 1131 |
| 334 | Ga0207659_11004091 | 3300025926 | Bacteria | 718 |
| 335 | Ga0207687_10096947 | 3300025927 | Bacteria | 2162 |
| 336 | Ga0207687_11691348 | 3300025927 | Bacteria | 542 |
| 337 | Ga0207644_10535143 | 3300025931 | Bacteria | 969 |
| 338 | Ga0207690_10615816 | 3300025932 | Bacteria | 887 |
| 339 | Ga0207690_10631317 | 3300025932 | Bacteria | 876 |
| 340 | Ga0207706_10036082 | 3300025933 | Bacteria | 4393 |
| 341 | Ga0207706_10150165 | 3300025933 | Bacteria | 2049 |
| 342 | Ga0207686_10213002 | 3300025934 | Bacteria | 1390 |
| 343 | Ga0207686_11530481 | 3300025934 | Bacteria | 550 |
| 344 | Ga0207709_10097817 | 3300025935 | Bacteria | 1934 |
| 345 | Ga0207709_10122331 | 3300025935 | Bacteria | 1759 |
| 346 | Ga0207709_10204763 | 3300025935 | Bacteria | 1412 |
| 347 | Ga0207709_11009493 | 3300025935 | Bacteria | 680 |
| 348 | Ga0207709_11344699 | 3300025935 | Bacteria | 591 |
| 349 | Ga0207670_11151847 | 3300025936 | Unclassified | 656 |
| 350 | Ga0207670_11295079 | 3300025936 | Bacteria | 618 |
| 351 | Ga0207669_10028127 | 3300025937 | Bacteria | 3089 |
| 352 | Ga0207669_10141941 | 3300025937 | Bacteria | 1669 |
| 353 | Ga0207669_10383372 | 3300025937 | Bacteria | 1096 |
| 354 | Ga0207669_10414842 | 3300025937 | Bacteria | 1058 |
| 355 | Ga0207669_11428380 | 3300025937 | Bacteria | 589 |
| 356 | Ga0207669_11652370 | 3300025937 | Bacteria | 547 |
| 357 | Ga0207704_10191751 | 3300025938 | Bacteria | 1487 |
| 358 | Ga0207691_10068902 | 3300025940 | Bacteria | 3196 |
| 359 | Ga0207691_10125677 | 3300025940 | Bacteria | 2270 |
| 360 | Ga0207711_10557441 | 3300025941 | Bacteria | 1069 |
| 361 | Ga0207711_11712006 | 3300025941 | Bacteria | 572 |
| 362 | Ga0207689_10089709 | 3300025942 | Bacteria | 2525 |
| 363 | Ga0207689_10239819 | 3300025942 | Bacteria | 1499 |
| 364 | Ga0207689_10613256 | 3300025942 | Bacteria | 916 |
| 365 | Ga0207689_10854579 | 3300025942 | Bacteria | 768 |
| 366 | Ga0207661_10168132 | 3300025944 | Bacteria | 1907 |
| 367 | Ga0207661_11070446 | 3300025944 | Bacteria | 743 |
| 368 | Ga0207661_11837484 | 3300025944 | Unclassified | 551 |
| 369 | Ga0207679_10167946 | 3300025945 | Bacteria | 1803 |
| 370 | Ga0207679_10218784 | 3300025945 | Bacteria | 1601 |
| 371 | Ga0207679_10445218 | 3300025945 | Bacteria | 1148 |
| 372 | Ga0207679_11371176 | 3300025945 | Unclassified | 649 |
| 373 | Ga0207667_10901174 | 3300025949 | Unclassified | 876 |
| 374 | Ga0207667_10913870 | 3300025949 | Bacteria | 869 |
| 375 | Ga0207667_11076569 | 3300025949 | Bacteria | 788 |
| 376 | Ga0207651_10338271 | 3300025960 | Bacteria | 1264 |
| 377 | Ga0207712_10023018 | 3300025961 | Bacteria | 4108 |
| 378 | Ga0207712_10961598 | 3300025961 | Unclassified | 757 |
| 379 | Ga0207668_10024309 | 3300025972 | Bacteria | 3908 |
| 380 | Ga0207668_10063083 | 3300025972 | Bacteria | 2613 |
| 381 | Ga0207668_10100363 | 3300025972 | Bacteria | 2149 |
| 382 | Ga0207668_10609292 | 3300025972 | Bacteria | 952 |
| 383 | Ga0207640_11282329 | 3300025981 | Bacteria | 653 |
| 384 | Ga0207640_11409018 | 3300025981 | Bacteria | 624 |
| 385 | Ga0207658_10484723 | 3300025986 | Bacteria | 1099 |
| 386 | Ga0207677_10127328 | 3300026023 | Bacteria | 1927 |
| 387 | Ga0207677_10145170 | 3300026023 | Bacteria | 1822 |
| 388 | Ga0207677_11012158 | 3300026023 | Bacteria | 754 |
| 389 | Ga0207703_10949219 | 3300026035 | Bacteria | 824 |
| 390 | Ga0207639_10024518 | 3300026041 | Bacteria | 4366 |
| 391 | Ga0207639_10348575 | 3300026041 | Bacteria | 1322 |
| 392 | Ga0207639_10432801 | 3300026041 | Bacteria | 1191 |
| 393 | Ga0207639_10748999 | 3300026041 | Bacteria | 908 |
| 394 | Ga0207678_10044918 | 3300026067 | Bacteria | 3821 |
| 395 | Ga0207678_10183237 | 3300026067 | Bacteria | 1788 |
| 396 | Ga0207678_10234417 | 3300026067 | Bacteria | 1572 |
| 397 | Ga0207678_10574323 | 3300026067 | Bacteria | 987 |
| 398 | Ga0207678_10763050 | 3300026067 | Bacteria | 853 |
| 399 | Ga0207678_10910281 | 3300026067 | Unclassified | 778 |
| 400 | Ga0207678_11372633 | 3300026067 | Bacteria | 625 |
| 401 | Ga0207708_10001399 | 3300026075 | Bacteria | 18108 |
| 402 | Ga0207708_10087186 | 3300026075 | Bacteria | 2403 |
| 403 | Ga0207708_10103918 | 3300026075 | Bacteria | 2201 |
| 404 | Ga0207708_10251993 | 3300026075 | Bacteria | 1423 |
| 405 | Ga0207708_10608897 | 3300026075 | Bacteria | 926 |
| 406 | Ga0207708_11203057 | 3300026075 | Bacteria | 662 |
| 407 | Ga0207702_10052860 | 3300026078 | Bacteria | 3439 |
| 408 | Ga0207702_10299496 | 3300026078 | Bacteria | 1526 |
| 409 | Ga0207641_10131630 | 3300026088 | Bacteria | 2247 |
| 410 | Ga0207641_10164075 | 3300026088 | Bacteria | 2022 |
| 411 | Ga0207641_11717776 | 3300026088 | Bacteria | 630 |
| 412 | Ga0207648_10635847 | 3300026089 | Bacteria | 985 |
| 413 | Ga0207676_10003912 | 3300026095 | Bacteria | 10515 |
| 414 | Ga0207676_10080910 | 3300026095 | Bacteria | 2638 |
| 415 | Ga0207674_10001143 | 3300026116 | Bacteria | 34428 |
| 416 | Ga0207675_100041267 | 3300026118 | Bacteria | 4309 |
| 417 | Ga0207675_100048221 | 3300026118 | Bacteria | 3977 |
| 418 | Ga0207675_100135123 | 3300026118 | Unclassified | 2339 |
| 419 | Ga0207675_101488178 | 3300026118 | Unclassified | 698 |
| 420 | Ga0207683_10053612 | 3300026121 | Bacteria | 3537 |
| 421 | Ga0207683_10168119 | 3300026121 | Bacteria | 1985 |
| 422 | Ga0207683_10362701 | 3300026121 | Bacteria | 1331 |
| 423 | Ga0207683_10880818 | 3300026121 | Bacteria | 831 |
| 424 | Ga0207698_10319495 | 3300026142 | Bacteria | 1453 |
| 425 | Ga0207698_11032649 | 3300026142 | Bacteria | 833 |
| 426 | Ga0209371_1088252 | 3300027312 | Bacteria | 526 |
| 427 | Ga0209813_10013463 | 3300027866 | Unclassified | 2184 |
| 428 | Ga0209813_10228284 | 3300027866 | Bacteria | 699 |
| 429 | Ga0268266_10008617 | 3300028379 | Bacteria | 9057 |
| 430 | Ga0268266_10119099 | 3300028379 | Bacteria | 2348 |
| 431 | Ga0268266_10494045 | 3300028379 | Bacteria | 1168 |
| 432 | Ga0268265_10000626 | 3300028380 | Bacteria | 35203 |
| 433 | Ga0268265_10036784 | 3300028380 | Bacteria | 3588 |
| 434 | Ga0268265_11065293 | 3300028380 | Bacteria | 801 |
| 435 | Ga0268265_11425059 | 3300028380 | Bacteria | 695 |
| 436 | Ga0268264_10003320 | 3300028381 | Bacteria | 13903 |
| 437 | Ga0268264_11778713 | 3300028381 | Bacteria | 626 |
| 438 | Ga0268256_1097476 | 3300030500 | Bacteria | 526 |
| 439 | Ga0307408_101340466 | 3300031548 | Bacteria | 672 |
| 440 | Ga0307405_10723144 | 3300031731 | Bacteria | 827 |
| 441 | Ga0307413_10325848 | 3300031824 | Bacteria | 1175 |
| 442 | Ga0307413_11901714 | 3300031824 | Bacteria | 534 |
| 443 | Ga0307410_10055976 | 3300031852 | Bacteria | 2680 |
| 444 | Ga0307410_10531599 | 3300031852 | Bacteria | 972 |
| 445 | Ga0307410_11210545 | 3300031852 | Bacteria | 658 |
| 446 | Ga0307406_10007814 | 3300031901 | Bacteria | 5949 |
| 447 | Ga0307406_10118690 | 3300031901 | Bacteria | 1835 |
| 448 | Ga0307407_10265865 | 3300031903 | Bacteria | 1182 |
| 449 | Ga0307407_10567894 | 3300031903 | Bacteria | 841 |
| 450 | Ga0307412_11399774 | 3300031911 | Bacteria | 633 |
| 451 | Ga0307409_100003248 | 3300031995 | Bacteria | 8767 |
| 452 | Ga0307409_100027346 | 3300031995 | Bacteria | 4040 |
| 453 | Ga0307409_101467771 | 3300031995 | Bacteria | 709 |
| 454 | Ga0307416_102331309 | 3300032002 | Bacteria | 635 |
| 455 | Ga0307414_10412783 | 3300032004 | Bacteria | 1175 |
| 456 | Ga0307411_11457571 | 3300032005 | Bacteria | 628 |
| 457 | Ga0307411_11945905 | 3300032005 | Bacteria | 548 |
| 458 | Ga0307415_100012409 | 3300032126 | Bacteria | 4926 |
| 459 | Ga0307415_100071786 | 3300032126 | Bacteria | 2436 |
| 460 | Ga0307415_100209505 | 3300032126 | Bacteria | 1554 |
| 461 | Ga0373936_0360103 | 3300035113 | Bacteria | 663 |
| 462 | Ga0373939_0455072 | 3300035114 | Unclassified | 539 |
| 463 | Ga0373941_0168862 | 3300035115 | Unclassified | 814 |
| 464 | Ga0373961_0012192 | 3300035241 | Bacteria | 2147 |
| 465 | Ga0373961_0294112 | 3300035241 | Bacteria | 599 |
| 466 | Ga0373931_0000324 | 3300035691 | Bacteria | 20133 |
| 467 | Ga0373925_0135394 | 3300037068 | Bacteria | 1925 |
| 468 | Ga0395899_0060742 | 3300037312 | Bacteria | 2784 |
| 469 | Ga0395900_0020727 | 3300037418 | Bacteria | 6718 |
| 470 | Ga0395900_0346047 | 3300037418 | Bacteria | 1461 |
| 471 | Ga0395898_0003674 | 3300037466 | Bacteria | 17038 |
| 472 | Ga0395905_0133717 | 3300037471 | Bacteria | 2333 |
| 473 | Ga0395905_0465636 | 3300037471 | Bacteria | 1163 |
| 474 | Ga0395905_1165290 | 3300037471 | Bacteria | 674 |
| 475 | Ga0395901_0270420 | 3300038443 | Bacteria | 1768 |
| 476 | Ga0395901_0339236 | 3300038443 | Bacteria | 1553 |
| 477 | Ga0395901_0854541 | 3300038443 | Bacteria | 895 |
| 478 | Ga0395901_1483482 | 3300038443 | Bacteria | 634 |
| 479 | Ga0451787_007409 | 3300041441 | Bacteria | 567 |
| 480 | Ga0451789_0738026 | 3300041443 | Bacteria | 627 |
| 481 | Ga0451789_0923876 | 3300041443 | Bacteria | 599 |
| 482 | Ga0451793_1234692 | 3300041452 | Bacteria | 1329 |
| 483 | Ga0451797_1299792 | 3300041453 | Bacteria | 501 |
| 484 | Ga0451795_0299550 | 3300041456 | Bacteria | 559 |
| 485 | Ga0451798_1123436 | 3300041458 | Unclassified | 517 |
| 486 | Ga0451802_2128099 | 3300041460 | Bacteria | 708 |
| 487 | Ga0451807_0571173 | 3300041486 | Bacteria | 635 |
| 488 | Ga0451807_1294539 | 3300041486 | Bacteria | 589 |
| 489 | Ga0451807_1494924 | 3300041486 | Bacteria | 607 |
| 490 | Ga0451807_2155322 | 3300041486 | Bacteria | 503 |
| 491 | Ga0451807_2693519 | 3300041486 | Unclassified | 814 |
| 492 | Ga0451833_0416748 | 3300041491 | Bacteria | 557 |
| 493 | Ga0451837_0650742 | 3300041494 | Bacteria | 622 |
| 494 | Ga0451841_1348048 | 3300041498 | Unclassified | 648 |
| 495 | Ga0451845_0436157 | 3300041501 | Bacteria | 651 |
| 496 | Ga0451843_1116658 | 3300041509 | Bacteria | 713 |
| 497 | Ga0451853_2901402 | 3300041512 | Bacteria | 1043 |
| 498 | Ga0439448_0303566 | 3300042005 | Bacteria | 567 |
| 499 | Ga0439432_243951 | 3300042006 | Bacteria | 516 |
| 500 | Ga0450894_015381 | 3300042131 | Bacteria | 1013 |
| 501 | Ga0439446_0024012 | 3300042156 | Bacteria | 1737 |
| 502 | Ga0439434_0360652 | 3300042435 | Bacteria | 508 |
| 503 | Ga0453683_0379638 | 3300044673 | Bacteria | 910 |
| 504 | Ga0466965_0058514 | 3300044683 | Bacteria | 1922 |
| 505 | Ga0466957_0117044 | 3300044842 | Bacteria | 1696 |
| 506 | Ga0466960_0217108 | 3300044901 | Bacteria | 1051 |
| 507 | Ga0466967_0036885 | 3300045976 | Bacteria | 4178 |
| 508 | Ga0495629_0217343 | 3300046459 | Bacteria | 1319 |
| 509 | Ga0495632_0364017 | 3300046519 | Bacteria | 635 |
| 510 | Ga0495587_0568915 | 3300046536 | Bacteria | 625 |
| 511 | Ga0495635_0548676 | 3300046663 | Bacteria | 758 |
| 512 | Ga0495600_0699478 | 3300046809 | Bacteria | 610 |
| 513 | Ga0495581_0363512 | 3300047315 | Bacteria | 845 |
| 514 | Ga0495604_0426369 | 3300047317 | Bacteria | 870 |
| 515 | Ga0496100_0796125 | 3300048903 | Bacteria | 740 |
| 516 | Ga0496100_1376768 | 3300048903 | Bacteria | 557 |
| 517 | Ga0496101_0109131 | 3300048904 | Bacteria | 2081 |
| 518 | Ga0496101_0291161 | 3300048904 | Bacteria | 1278 |
| 519 | Ga0496102_0009559 | 3300048905 | Bacteria | 8340 |
| 520 | Ga0496102_0039333 | 3300048905 | Bacteria | 4273 |
| 521 | Ga0496102_0251716 | 3300048905 | Bacteria | 1666 |
| 522 | Ga0496102_0848433 | 3300048905 | Bacteria | 836 |
| 523 | Ga0496102_1295703 | 3300048905 | Unclassified | 648 |
| 524 | Ga0496102_1756408 | 3300048905 | Bacteria | 538 |
| 525 | Ga0496103_0036330 | 3300048906 | Bacteria | 3017 |
| 526 | Ga0496103_0098712 | 3300048906 | Unclassified | 1847 |
| 527 | Ga0496103_0161053 | 3300048906 | Bacteria | 1439 |
| 528 | Ga0496103_0953668 | 3300048906 | Bacteria | 536 |
| 529 | Ga0496104_0132289 | 3300048907 | Bacteria | 2396 |
| 530 | Ga0496104_0659058 | 3300048907 | Bacteria | 955 |
| 531 | Ga0496104_1091422 | 3300048907 | Bacteria | 702 |
| 532 | Ga0496105_0052219 | 3300048908 | Bacteria | 3376 |
| 533 | Ga0496105_0121824 | 3300048908 | Bacteria | 2151 |
| 534 | Ga0496106_0042073 | 3300048909 | Bacteria | 3425 |
| 535 | Ga0496106_0438092 | 3300048909 | Bacteria | 1050 |
| 536 | Ga0496106_0723222 | 3300048909 | Bacteria | 793 |
| 537 | Ga0496107_0011296 | 3300048910 | Bacteria | 6217 |
| 538 | Ga0496107_0067379 | 3300048910 | Bacteria | 2597 |
| 539 | Ga0496107_1094858 | 3300048910 | Bacteria | 576 |
| 540 | Ga0496108_0040335 | 3300048911 | Bacteria | 3891 |
| 541 | Ga0496108_1311453 | 3300048911 | Unclassified | 608 |
| 542 | Ga0496109_0039540 | 3300048912 | Bacteria | 4269 |
| 543 | Ga0496109_0336834 | 3300048912 | Bacteria | 1425 |
| 544 | Ga0496109_0874317 | 3300048912 | Bacteria | 837 |
| 545 | Ga0496109_1102814 | 3300048912 | Bacteria | 731 |
| 546 | Ga0496109_1790395 | 3300048912 | Bacteria | 547 |
| 547 | Ga0496110_0017647 | 3300048913 | Bacteria | 5967 |
| 548 | Ga0496111_0307412 | 3300048914 | Bacteria | 1175 |
| 549 | Ga0496112_0015803 | 3300048915 | Bacteria | 7052 |
| 550 | Ga0496112_0016184 | 3300048915 | Bacteria | 6978 |
| 551 | Ga0496114_0008572 | 3300048917 | Bacteria | 8102 |
| 552 | Ga0496114_0040997 | 3300048917 | Bacteria | 3836 |
| 553 | Ga0496114_1256416 | 3300048917 | Bacteria | 627 |
| 554 | Ga0496114_1782755 | 3300048917 | Bacteria | 504 |
| 555 | Ga0496115_0345469 | 3300048918 | Bacteria | 1214 |
| 556 | Ga0496115_0549615 | 3300048918 | Bacteria | 923 |
| 557 | Ga0496116_0000100 | 3300048919 | Bacteria | 194740 |
| 558 | Ga0496116_0043510 | 3300048919 | Bacteria | 3058 |
| 559 | Ga0496118_0059604 | 3300048921 | Bacteria | 2840 |
| 560 | Ga0496119_0019768 | 3300048922 | Bacteria | 4940 |
| 561 | Ga0496119_0585542 | 3300048922 | Bacteria | 509 |
| 562 | Ga0496120_0052116 | 3300048923 | Bacteria | 2332 |
| 563 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 564 | Ga0496121_0358017 | 3300048924 | Bacteria | 970 |
| 565 | Ga0496121_0678993 | 3300048924 | Bacteria | 623 |
| 566 | Ga0496122_0003647 | 3300048925 | Bacteria | 20021 |
| 567 | Ga0496122_0008413 | 3300048925 | Bacteria | 11146 |
| 568 | Ga0496122_0158319 | 3300048925 | Bacteria | 1385 |
| 569 | Ga0496122_0164361 | 3300048925 | Bacteria | 1348 |
| 570 | Ga0496122_0314577 | 3300048925 | Bacteria | 836 |
| 571 | Ga0496123_0000517 | 3300048926 | Bacteria | 67322 |
| 572 | Ga0496123_0076793 | 3300048926 | Bacteria | 2054 |
| 573 | Ga0496123_0226076 | 3300048926 | Bacteria | 940 |
| 574 | Ga0496124_0015675 | 3300048927 | Bacteria | 7250 |
| 575 | Ga0496124_0107810 | 3300048927 | Bacteria | 2247 |
| 576 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 577 | Ga0496125_0000713 | 3300048928 | Bacteria | 54953 |
| 578 | Ga0496126_0000094 | 3300048929 | Bacteria | 208184 |
| 579 | Ga0496126_0561186 | 3300048929 | Bacteria | 904 |
| 580 | Ga0496126_0628342 | 3300048929 | Bacteria | 843 |
| 581 | Ga0501300_023806 | 3300049523 | Bacteria | 896 |
| 582 | Ga0501031_0000010 | 3300049568 | Bacteria | 146435 |
| 583 | Ga0501031_0002408 | 3300049568 | Bacteria | 11893 |
| 584 | Ga0501031_0006171 | 3300049568 | Bacteria | 7824 |
| 585 | Ga0501031_0093978 | 3300049568 | Bacteria | 1957 |
| 586 | Ga0501031_0121925 | 3300049568 | Bacteria | 1703 |
| 587 | Ga0501032_0000023 | 3300049569 | Bacteria | 146435 |
| 588 | Ga0501032_0038284 | 3300049569 | Bacteria | 3267 |
| 589 | Ga0501032_0038787 | 3300049569 | Bacteria | 3242 |
| 590 | Ga0501032_0082015 | 3300049569 | Bacteria | 2146 |
| 591 | Ga0501033_0000104 | 3300049570 | Bacteria | 81029 |
| 592 | Ga0501033_0004294 | 3300049570 | Bacteria | 11449 |
| 593 | Ga0501033_0007428 | 3300049570 | Bacteria | 8537 |
| 594 | Ga0501033_0214291 | 3300049570 | Bacteria | 1373 |
| 595 | Ga0501033_0237615 | 3300049570 | Bacteria | 1293 |
| 596 | Ga0501033_0364429 | 3300049570 | Bacteria | 1011 |
| 597 | Ga0501033_0434097 | 3300049570 | Bacteria | 914 |
| 598 | Ga0501034_0000116 | 3300049571 | Bacteria | 146442 |
| 599 | Ga0501034_0073146 | 3300049571 | Bacteria | 3436 |
| 600 | Ga0501034_0076906 | 3300049571 | Bacteria | 3344 |
| 601 | Ga0501034_0139192 | 3300049571 | Bacteria | 2407 |
| 602 | Ga0501034_0194349 | 3300049571 | Bacteria | 1990 |
| 603 | Ga0501034_0204182 | 3300049571 | Bacteria | 1933 |
| 604 | Ga0501034_0208416 | 3300049571 | Bacteria | 1910 |
| 605 | Ga0501034_0407536 | 3300049571 | Bacteria | 1282 |
| 606 | Ga0501036_0000015 | 3300049572 | Bacteria | 146442 |
| 607 | Ga0501036_0039590 | 3300049572 | Bacteria | 3988 |
| 608 | Ga0501036_0043249 | 3300049572 | Bacteria | 3814 |
| 609 | Ga0501036_0206600 | 3300049572 | Bacteria | 1651 |
| 610 | Ga0501036_0522077 | 3300049572 | Bacteria | 987 |
| 611 | Ga0501037_0000023 | 3300049573 | Bacteria | 146542 |
| 612 | Ga0501037_0004454 | 3300049573 | Bacteria | 10172 |
| 613 | Ga0501037_0015413 | 3300049573 | Bacteria | 5624 |
| 614 | Ga0501037_0029303 | 3300049573 | Bacteria | 4067 |
| 615 | Ga0501037_0349858 | 3300049573 | Bacteria | 1020 |
| 616 | Ga0501038_0000025 | 3300049574 | Bacteria | 146542 |
| 617 | Ga0501038_0023114 | 3300049574 | Bacteria | 5562 |
| 618 | Ga0501038_0087169 | 3300049574 | Bacteria | 2621 |
| 619 | Ga0501038_0095352 | 3300049574 | Bacteria | 2485 |
| 620 | Ga0501038_0134187 | 3300049574 | Bacteria | 2030 |
| 621 | Ga0501038_0208276 | 3300049574 | Bacteria | 1566 |
| 622 | Ga0501039_0000037 | 3300049575 | Bacteria | 122286 |
| 623 | Ga0501039_0053240 | 3300049575 | Bacteria | 3131 |
| 624 | Ga0501039_0266770 | 3300049575 | Bacteria | 1346 |
| 625 | Ga0501039_0740038 | 3300049575 | Bacteria | 768 |
| 626 | Ga0501040_0005598 | 3300049576 | Bacteria | 8116 |
| 627 | Ga0501040_0389412 | 3300049576 | Bacteria | 1000 |
| 628 | Ga0501041_0137308 | 3300049577 | Bacteria | 1524 |
| 629 | Ga0501041_0260106 | 3300049577 | Bacteria | 1091 |
| 630 | Ga0501042_0006985 | 3300049578 | Bacteria | 7369 |
| 631 | Ga0501042_0226930 | 3300049578 | Bacteria | 1347 |
| 632 | Ga0501042_0333915 | 3300049578 | Bacteria | 1096 |
| 633 | Ga0501042_1124383 | 3300049578 | Bacteria | 573 |
| 634 | Ga0501043_0000070 | 3300049579 | Bacteria | 89839 |
| 635 | Ga0501043_0017343 | 3300049579 | Bacteria | 5647 |
| 636 | Ga0501043_0083685 | 3300049579 | Bacteria | 2508 |
| 637 | Ga0501043_0398702 | 3300049579 | Bacteria | 1040 |
| 638 | Ga0501043_0414385 | 3300049579 | Bacteria | 1016 |
| 639 | Ga0501043_0498715 | 3300049579 | Bacteria | 910 |
| 640 | Ga0501043_0592366 | 3300049579 | Bacteria | 820 |
| 641 | Ga0501046_0039644 | 3300049580 | Bacteria | 3770 |
| 642 | Ga0501046_0103078 | 3300049580 | Bacteria | 2187 |
| 643 | Ga0501046_0116579 | 3300049580 | Bacteria | 2035 |
| 644 | Ga0501046_0478553 | 3300049580 | Bacteria | 893 |
| 645 | Ga0501047_0001244 | 3300049581 | Bacteria | 25242 |
| 646 | Ga0501047_0025205 | 3300049581 | Bacteria | 5714 |
| 647 | Ga0501047_0122146 | 3300049581 | Bacteria | 2486 |
| 648 | Ga0501047_0284741 | 3300049581 | Bacteria | 1497 |
| 649 | Ga0501047_0452411 | 3300049581 | Bacteria | 1113 |
| 650 | Ga0501047_0512479 | 3300049581 | Bacteria | 1026 |
| 651 | Ga0501048_1044042 | 3300049582 | Bacteria | 588 |
| 652 | Ga0501048_1079766 | 3300049582 | Bacteria | 577 |
| 653 | Ga0501067_0424955 | 3300049583 | Bacteria | 742 |
| 654 | Ga0501068_0023785 | 3300049584 | Bacteria | 3593 |
| 655 | Ga0501068_0528692 | 3300049584 | Bacteria | 766 |
| 656 | Ga0501069_0080090 | 3300049585 | Bacteria | 1839 |
| 657 | Ga0501070_0047983 | 3300049586 | Bacteria | 3548 |
| 658 | Ga0501070_0073374 | 3300049586 | Bacteria | 2831 |
| 659 | Ga0501070_0076324 | 3300049586 | Bacteria | 2774 |
| 660 | Ga0501070_0186288 | 3300049586 | Bacteria | 1707 |
| 661 | Ga0501070_0803663 | 3300049586 | Bacteria | 738 |
| 662 | Ga0501070_1134270 | 3300049586 | Bacteria | 602 |
| 663 | Ga0501071_0031594 | 3300049587 | Bacteria | 3755 |
| 664 | Ga0501071_0083056 | 3300049587 | Bacteria | 2347 |
| 665 | Ga0501071_1196037 | 3300049587 | Bacteria | 587 |
| 666 | Ga0501073_0201448 | 3300049589 | Bacteria | 1376 |
| 667 | Ga0501074_0245860 | 3300049590 | Bacteria | 1272 |
| 668 | Ga0501074_0394119 | 3300049590 | Bacteria | 982 |
| 669 | Ga0501074_0421783 | 3300049590 | Bacteria | 946 |
| 670 | Ga0501074_0482451 | 3300049590 | Bacteria | 879 |
| 671 | Ga0501075_0243164 | 3300049591 | Bacteria | 1372 |
| 672 | Ga0501076_0093445 | 3300049592 | Bacteria | 2420 |
| 673 | Ga0501076_0176205 | 3300049592 | Bacteria | 1743 |
| 674 | Ga0501077_0407783 | 3300049593 | Bacteria | 869 |
| 675 | Ga0501077_0744717 | 3300049593 | Bacteria | 630 |
| 676 | Ga0501077_0918813 | 3300049593 | Bacteria | 563 |
| 677 | Ga0501079_0183477 | 3300049741 | Bacteria | 1633 |
| 678 | Ga0501080_0084392 | 3300049742 | Bacteria | 2951 |
| 679 | Ga0501080_0110362 | 3300049742 | Bacteria | 2549 |
| 680 | Ga0501080_0187004 | 3300049742 | Bacteria | 1904 |
| 681 | Ga0501080_0891638 | 3300049742 | Bacteria | 776 |
| 682 | Ga0501080_0985345 | 3300049742 | Bacteria | 732 |
| 683 | Ga0501080_1000669 | 3300049742 | Bacteria | 725 |
| 684 | Ga0501080_1037235 | 3300049742 | Bacteria | 710 |
| 685 | Ga0501080_1212241 | 3300049742 | Bacteria | 648 |
| 686 | Ga0501081_0089620 | 3300049743 | Bacteria | 2162 |
| 687 | Ga0501081_0252915 | 3300049743 | Bacteria | 1287 |
| 688 | Ga0501083_0347970 | 3300049744 | Bacteria | 964 |
| 689 | Ga0501083_0428470 | 3300049744 | Bacteria | 861 |
| 690 | Ga0501083_0570771 | 3300049744 | Bacteria | 736 |
| 691 | Ga0501083_0847682 | 3300049744 | Bacteria | 595 |
| 692 | Ga0501280_001054 | 3300049776 | Bacteria | 5606 |
| 693 | Ga0501280_112724 | 3300049776 | Bacteria | 533 |
| 694 | Ga0501282_003196 | 3300049778 | Bacteria | 1768 |
| 695 | Ga0501035_0000074 | 3300049822 | Bacteria | 122269 |
| 696 | Ga0501035_0008072 | 3300049822 | Bacteria | 9810 |
| 697 | Ga0501035_0054537 | 3300049822 | Bacteria | 3572 |
| 698 | Ga0501035_0066879 | 3300049822 | Bacteria | 3189 |
| 699 | Ga0501035_0230153 | 3300049822 | Bacteria | 1580 |
| 700 | Ga0501035_0265749 | 3300049822 | Bacteria | 1453 |
| 701 | Ga0501044_0000069 | 3300049823 | Bacteria | 125974 |
| 702 | Ga0501044_0030874 | 3300049823 | Bacteria | 5643 |
| 703 | Ga0501044_0099811 | 3300049823 | Bacteria | 2921 |
| 704 | Ga0501044_0108035 | 3300049823 | Bacteria | 2793 |
| 705 | Ga0501044_0192500 | 3300049823 | Bacteria | 2001 |
| 706 | Ga0501044_0202925 | 3300049823 | Bacteria | 1940 |
| 707 | Ga0501044_0509090 | 3300049823 | Bacteria | 1104 |
| 708 | Ga0501044_0836155 | 3300049823 | Bacteria | 798 |
| 709 | Ga0501044_0931967 | 3300049823 | Bacteria | 742 |
| 710 | Ga0501045_0103639 | 3300049824 | Bacteria | 2107 |
| 711 | Ga0501045_0164076 | 3300049824 | Bacteria | 1654 |
| 712 | Ga0501045_0438656 | 3300049824 | Bacteria | 971 |
| 713 | nmdc:mga03683_30478_c1 | 3300050489 | Unclassified | 2158 |
| 714 | nmdc:mga03n38_157042_c1 | 3300050490 | Bacteria | 1149 |
| 715 | nmdc:mga03n38_24061_c1 | 3300050490 | Unclassified | 2486 |
| 716 | nmdc:mga00v17_5790_c1 | 3300050491 | Bacteria | 6527 |
| 717 | nmdc:mga0yw44_138138_c1 | 3300050492 | Bacteria | 1582 |
| 718 | nmdc:mga0yw44_169194_c1 | 3300050492 | Bacteria | 1434 |
| 719 | nmdc:mga0yw44_224437_c1 | 3300050492 | Unclassified | 1246 |
| 720 | nmdc:mga0yw44_4246_c1 | 3300050492 | Bacteria | 4153 |
| 721 | nmdc:mga0yw44_583868_c1 | 3300050492 | Bacteria | 759 |
| 722 | nmdc:mga0yw44_696899_c1 | 3300050492 | Bacteria | 690 |
| 723 | nmdc:mga0yw44_828363_c1 | 3300050492 | Bacteria | 628 |
| 724 | nmdc:mga0k408_148904_c1 | 3300050493 | Bacteria | 1393 |
| 725 | nmdc:mga0k408_220406_c1 | 3300050493 | Bacteria | 1132 |
| 726 | nmdc:mga06z11_110892_c1 | 3300050494 | Bacteria | 1519 |
| 727 | nmdc:mga06z11_341823_c1 | 3300050494 | Bacteria | 895 |
| 728 | nmdc:mga06z11_883595_c1 | 3300050494 | Bacteria | 545 |
| 729 | nmdc:mga06z11_9784_c1 | 3300050494 | Bacteria | 4053 |
| 730 | nmdc:mga04h51_10906_c1 | 3300050495 | Unclassified | 2509 |
| 731 | nmdc:mga04h51_259831_c1 | 3300050495 | Bacteria | 698 |
| 732 | nmdc:mga07m45_27801_c2 | 3300050496 | Bacteria | 1355 |
| 733 | nmdc:mga07m45_37513_c1 | 3300050496 | Unclassified | 2703 |
| 734 | nmdc:mga07m45_590160_c1 | 3300050496 | Bacteria | 642 |
| 735 | nmdc:mga07m45_904608_c1 | 3300050496 | Unclassified | 505 |
| 736 | nmdc:mga0qj67_1199774_c1 | 3300050509 | Bacteria | 590 |
| 737 | nmdc:mga0qj67_26058_c1 | 3300050509 | Bacteria | 4525 |
| 738 | nmdc:mga0qj67_354997_c1 | 3300050509 | Bacteria | 1185 |
| 739 | nmdc:mga06r32_26679_c1 | 3300050510 | Bacteria | 5389 |
| 740 | nmdc:mga06r32_946660_c1 | 3300050510 | Bacteria | 816 |
| 741 | nmdc:mga0n895_39998_c1 | 3300050512 | Bacteria | 4554 |
| 742 | nmdc:mga08x19_1190915_c1 | 3300050514 | Unclassified | 540 |
| 743 | nmdc:mga0a205_18086_c1 | 3300050515 | Bacteria | 6621 |
| 744 | nmdc:mga0sz30_330859_c1 | 3300050516 | Bacteria | 680 |
| 745 | nmdc:mga0sz30_80476_c1 | 3300050516 | Unclassified | 1409 |
| 746 | Ga0500641_0016481 | 3300053096 | Bacteria | 2752 |
| 747 | Ga0500556_0000039 | 3300053104 | Bacteria | 138158 |
| 748 | Ga0500572_020801 | 3300053111 | Bacteria | 1731 |
| 749 | Ga0500603_238306 | 3300053150 | Bacteria | 583 |
| 750 | Ga0500636_0000006 | 3300053177 | Bacteria | 183899 |
| 751 | Ga0500636_0129561 | 3300053177 | Bacteria | 1407 |
| 752 | Ga0501084_1246404 | 3300054114 | Bacteria | 624 |
| 753 | Ga0501082_0000006 | 3300060353 | Bacteria | 127786 |
| 754 | Ga0501082_0080879 | 3300060353 | Bacteria | 2804 |
| 755 | Ga0501082_0385566 | 3300060353 | Bacteria | 1223 |
| 756 | Ga0530510_0062570 | 3300061734 | Bacteria | 2694 |
| 757 | Ga0530510_0849547 | 3300061734 | Bacteria | 697 |
| 758 | Ga0530510_1044026 | 3300061734 | Unclassified | 626 |
| 759 | 2508731125 | 2508501050 | Bacteria | 9633614 |
| 760 | 2535486473 | 2534681786 | Bacteria | 3308809 |
| 761 | 2599104605 | 2597490356 | Bacteria | 7030811 |
| 762 | 2643837794 | 2643221564 | Bacteria | 4193379 |
| 763 | 2643855215 | 2643221568 | Bacteria | 5187270 |
| 764 | 2644133095 | 2643221623 | Bacteria | 5239945 |
| 765 | 2739305873 | 2738543024 | Bacteria | 5603683 |
| 766 | 2757569368 | 2757320392 | Bacteria | 3737298 |
| 767 | 2842719657 | 2842718218 | Bacteria | 4560148 |
| 768 | 2844004668 | 2844002411 | Bacteria | 7168230 |
| 769 | 2846955462 | 2846952575 | Bacteria | 6587527 |
| 770 | 2848862659 | 2848858292 | Bacteria | 7391279 |
| 771 | 2854916674 | 2854911287 | Bacteria | 5582813 |
| 772 | 2894777199 | 2894772417 | Bacteria | 5305674 |
| 773 | 2915652453 | 2915650412 | Bacteria | 4288180 |
| 774 | 2919166786 | 2919166419 | Bacteria | 4952238 |
| 775 | 2919451995 | 2919450847 | Bacteria | 5631160 |
| 776 | 2929138719 | 2929138655 | Bacteria | 5810547 |
| 777 | 2974323725 | 2974320154 | Bacteria | 4571377 |
| 778 | 2977959128 | 2977957713 | Bacteria | 6877875 |
| 779 | 2978973202 | 2978969890 | Bacteria | 5400756 |
| 780 | 2984591450 | 2984587000 | Bacteria | 5263363 |
| 781 | 2996314958 | 2996310559 | Bacteria | 6357320 |
| 782 | 8001849919 | 8001845381 | Bacteria | 5804942 |
| 783 | 8054461231 | 8054460903 | Bacteria | 4872905 |
| 784 | nmdc:mga00v17_848936_c1 | |||
| 785 | rootL2_10338223 | |||
| 786 | rootH1_10265339 | |||
| 787 | rootH1_10398603 | |||
| 788 | Ga0006562J51391_1006409 | |||
| 789 | Ga0070658_10003488 | |||
| 790 | Ga0070658_10165025 | |||
| 791 | Ga0070658_11344707 | |||
| 792 | Ga0070676_10676252 | |||
| 793 | Ga0070676_11116586 | |||
| 794 | Ga0070676_11125842 | |||
| 795 | Ga0070683_100164491 | |||
| 796 | Ga0070683_100352283 | |||
| 797 | Ga0070683_100778266 | |||
| 798 | Ga0070683_101269707 | |||
| 799 | Ga0070670_100159351 | |||
| 800 | Ga0070670_101666295 | |||
| 801 | Ga0070677_10568362 | |||
| 802 | Ga0068869_100014018 | |||
| 803 | Ga0068869_100092905 | |||
| 804 | Ga0068869_100398628 | |||
| 805 | Ga0068869_100469553 | |||
| 806 | Ga0070680_100014420 | |||
| 807 | Ga0070680_100020613 | |||
| 808 | Ga0070680_100135813 | |||
| 809 | Ga0070680_100491888 | |||
| 810 | Ga0070682_100072965 | |||
| 811 | Ga0068868_101181358 | |||
| 812 | Ga0068868_101457717 | |||
| 813 | Ga0070660_100392741 | |||
| 814 | Ga0070660_100943870 | |||
| 815 | Ga0070660_100951606 | |||
| 816 | Ga0070689_100830760 | |||
| 817 | Ga0070689_100919737 | |||
| 818 | Ga0070689_101184725 | |||
| 819 | Ga0070691_10289947 | |||
| 820 | Ga0070691_10307286 | |||
| 821 | Ga0070687_100100854 | |||
| 822 | Ga0070687_100422112 | |||
| 823 | Ga0070661_100010269 | |||
| 824 | Ga0070692_10022193 | |||
| 825 | Ga0070692_10371920 | |||
| 826 | Ga0070668_100076893 | |||
| 827 | Ga0070668_100256201 | |||
| 828 | Ga0070668_101099378 | |||
| 829 | Ga0070668_101347115 | |||
| 830 | Ga0070668_102052173 | |||
| 831 | Ga0070669_100089827 | |||
| 832 | Ga0070669_101686263 | |||
| 833 | Ga0070675_100641029 | |||
| 834 | Ga0070671_100359625 | |||
| 835 | Ga0070671_100942040 | |||
| 836 | Ga0070674_100490005 | |||
| 837 | Ga0070674_100581297 | |||
| 838 | Ga0070674_100994053 | |||
| 839 | Ga0070673_101641297 | |||
| 840 | Ga0070659_100127702 | |||
| 841 | Ga0070667_100101024 | |||
| 842 | Ga0070667_101721521 | |||
| 843 | Ga0070703_10019779 | |||
| 844 | Ga0070701_10674312 | |||
| 845 | Ga0070705_100000901 | |||
| 846 | Ga0070705_100124782 | |||
| 847 | Ga0070700_100001924 | |||
| 848 | Ga0070700_100417194 | |||
| 849 | Ga0070700_100500283 | |||
| 850 | Ga0070700_101890338 | |||
| 851 | Ga0070694_100001405 | |||
| 852 | Ga0070694_100173731 | |||
| 853 | Ga0070708_100016481 | |||
| 854 | Ga0070663_100038744 | |||
| 855 | Ga0070663_100065164 | |||
| 856 | Ga0070663_100198443 | |||
| 857 | Ga0070663_100260723 | |||
| 858 | Ga0070663_100274613 | |||
| 859 | Ga0070663_100716772 | |||
| 860 | Ga0070663_101582407 | |||
| 861 | Ga0070663_101624389 | |||
| 862 | Ga0070678_100054493 | |||
| 863 | Ga0070678_100078226 | |||
| 864 | Ga0070678_100574215 | |||
| 865 | Ga0070678_100738069 | |||
| 866 | Ga0070678_101125785 | |||
| 867 | Ga0070662_100300943 | |||
| 868 | Ga0070662_101456942 | |||
| 869 | Ga0070681_10006828 | |||
| 870 | Ga0070681_10013475 | |||
| 871 | Ga0070681_10106659 | |||
| 872 | Ga0070681_10174999 | |||
| 873 | Ga0070681_10477645 | |||
| 874 | Ga0070681_10583248 | |||
| 875 | Ga0070681_10587353 | |||
| 876 | Ga0068867_100072516 | |||
| 877 | Ga0068867_101643178 | |||
| 878 | Ga0070685_10416578 | |||
| 879 | Ga0070685_11444812 | |||
| 880 | Ga0070706_100029463 | |||
| 881 | Ga0070707_100525423 | |||
| 882 | Ga0070698_100017908 | |||
| 883 | Ga0070699_100015194 | |||
| 884 | Ga0070679_100028734 | |||
| 885 | Ga0070679_100338546 | |||
| 886 | Ga0070679_100680238 | |||
| 887 | Ga0070679_100918268 | |||
| 888 | Ga0070679_101653465 | |||
| 889 | Ga0070679_101717838 | |||
| 890 | Ga0070684_100189099 | |||
| 891 | Ga0070684_101079299 | |||
| 892 | Ga0070697_100009532 | |||
| 893 | Ga0068853_100242692 | |||
| 894 | Ga0070672_100098034 | |||
| 895 | Ga0070672_100152234 | |||
| 896 | Ga0070672_101619603 | |||
| 897 | Ga0070672_101910417 | |||
| 898 | Ga0070686_101345841 | |||
| 899 | Ga0070695_100000158 | |||
| 900 | Ga0070696_100233450 | |||
| 901 | Ga0070693_100356129 | |||
| 902 | Ga0070693_100486276 | |||
| 903 | Ga0070693_100815878 | |||
| 904 | Ga0070693_101005415 | |||
| 905 | Ga0070665_100010765 | |||
| 906 | Ga0070665_100081964 | |||
| 907 | Ga0070665_100388894 | |||
| 908 | Ga0070704_100008256 | |||
| 909 | Ga0070704_100086648 | |||
| 910 | Ga0068855_100067522 | |||
| 911 | Ga0068855_100139229 | |||
| 912 | Ga0068855_100408200 | |||
| 913 | Ga0068855_100597169 | |||
| 914 | Ga0068855_101111531 | |||
| 915 | Ga0068855_101135554 | |||
| 916 | Ga0068855_101216124 | |||
| 917 | Ga0068855_102125797 | |||
| 918 | Ga0070664_100118502 | |||
| 919 | Ga0070664_100571187 | |||
| 920 | Ga0070664_101117158 | |||
| 921 | Ga0070664_101540017 | |||
| 922 | Ga0068857_100009560 | |||
| 923 | Ga0068857_100548081 | |||
| 924 | Ga0068854_100509208 | |||
| 925 | Ga0068856_101363028 | |||
| 926 | Ga0070702_100016066 | |||
| 927 | Ga0070702_101697119 | |||
| 928 | Ga0068852_100392752 | |||
| 929 | Ga0068852_100681505 | |||
| 930 | Ga0068852_101875297 | |||
| 931 | Ga0068859_100003502 | |||
| 932 | Ga0068859_100194379 | |||
| 933 | Ga0068859_102532578 | |||
| 934 | Ga0068864_100025178 | |||
| 935 | Ga0068864_100540208 | |||
| 936 | Ga0068866_10721483 | |||
| 937 | Ga0068866_10845806 | |||
| 938 | Ga0068861_100023390 | |||
| 939 | Ga0068861_100042905 | |||
| 940 | Ga0068861_100221668 | |||
| 941 | Ga0068870_10120828 | |||
| 942 | Ga0068870_10159334 | |||
| 943 | Ga0068870_10591421 | |||
| 944 | Ga0068863_100107338 | |||
| 945 | Ga0068863_100250601 | |||
| 946 | Ga0068863_100329608 | |||
| 947 | Ga0068858_100488445 | |||
| 948 | Ga0068858_102056274 | |||
| 949 | Ga0068860_100001841 | |||
| 950 | Ga0068860_100080379 | |||
| 951 | Ga0068862_100002731 | |||
| 952 | Ga0068862_100017501 | |||
| 953 | Ga0068862_100296142 | |||
| 954 | Ga0068862_101976356 | |||
| 955 | Ga0075365_10045106 | |||
| 956 | Ga0075365_10076577 | |||
| 957 | Ga0075365_10176951 | |||
| 958 | Ga0075365_10448618 | |||
| 959 | Ga0075365_10627213 | |||
| 960 | Ga0075363_100114453 | |||
| 961 | Ga0075363_100474799 | |||
| 962 | Ga0075364_10016127 | |||
| 963 | Ga0075364_10030113 | |||
| 964 | Ga0075432_10059355 | |||
| 965 | Ga0070715_10267802 | |||
| 966 | Ga0075362_10045679 | |||
| 967 | Ga0075362_10652552 | |||
| 968 | Ga0075367_10030475 | |||
| 969 | Ga0075367_10098355 | |||
| 970 | Ga0075367_10933851 | |||
| 971 | Ga0075369_10304711 | |||
| 972 | Ga0075366_10021454 | |||
| 973 | Ga0075366_11010888 | |||
| 974 | Ga0097621_100330182 | |||
| 975 | Ga0097621_101146284 | |||
| 976 | Ga0097621_101272882 | |||
| 977 | Ga0075370_10060801 | |||
| 978 | Ga0075370_10335264 | |||
| 979 | Ga0075370_10476437 | |||
| 980 | Ga0068871_100358514 | |||
| 981 | Ga0068871_100614064 | |||
| 982 | Ga0068871_100806206 | |||
| 983 | Ga0068871_101692096 | |||
| 984 | Ga0075428_100251939 | |||
| 985 | Ga0075428_101471530 | |||
| 986 | Ga0075430_100009987 | |||
| 987 | Ga0075430_100484328 | |||
| 988 | Ga0075430_101409045 | |||
| 989 | Ga0075431_100856752 | |||
| 990 | Ga0075433_10018253 | |||
| 991 | Ga0075434_100004344 | |||
| 992 | Ga0075429_100744713 | |||
| 993 | Ga0068865_100296126 | |||
| 994 | Ga0068865_100340032 | |||
| 995 | Ga0097620_100003500 | |||
| 996 | Ga0097620_100194396 | |||
| 997 | Ga0097620_102532335 | |||
| 998 | Ga0075435_100198189 | |||
| 999 | Ga0105244_10260307 | |||
| 1000 | Ga0105244_10340994 | |||
| 1001 | Ga0105240_10080457 | |||
| 1002 | Ga0105240_11077991 | |||
| 1003 | Ga0105240_11867774 | |||
| 1004 | Ga0105240_11927442 | |||
| 1005 | Ga0111539_10158996 | |||
| 1006 | Ga0111539_11939178 | |||
| 1007 | Ga0105245_10067879 | |||
| 1008 | Ga0105245_10703437 | |||
| 1009 | Ga0105245_11771471 | |||
| 1010 | Ga0105245_13110375 | |||
| 1011 | Ga0105247_10129646 | |||
| 1012 | Ga0105247_10515956 | |||
| 1013 | Ga0105243_10056569 | |||
| 1014 | Ga0105243_10204910 | |||
| 1015 | Ga0105243_11520150 | |||
| 1016 | Ga0105241_10023704 | |||
| 1017 | Ga0105241_10990175 | |||
| 1018 | Ga0105241_11441256 | |||
| 1019 | Ga0105242_10205554 | |||
| 1020 | Ga0105242_12505360 | |||
| 1021 | Ga0105248_10555022 | |||
| 1022 | Ga0105248_11451535 | |||
| 1023 | Ga0105237_10130058 | |||
| 1024 | Ga0105237_11127746 | |||
| 1025 | Ga0105237_12454848 | |||
| 1026 | Ga0105238_10075653 | |||
| 1027 | Ga0105238_10317910 | |||
| 1028 | Ga0105238_10589408 | |||
| 1029 | Ga0105238_12751765 | |||
| 1030 | Ga0105249_10046892 | |||
| 1031 | Ga0105249_10710686 | |||
| 1032 | Ga0105249_11170778 | |||
| 1033 | Ga0105035_105373 | |||
| 1034 | Ga0105239_10053150 | |||
| 1035 | Ga0105239_10346368 | |||
| 1036 | Ga0105239_11216887 | |||
| 1037 | Ga0105239_12198351 | |||
| 1038 | Ga0105239_12536316 | |||
| 1039 | Ga0105246_10012864 | |||
| 1040 | Ga0105246_10040416 | |||
| 1041 | Ga0105246_10162168 | |||
| 1042 | Ga0157371_10027723 | |||
| 1043 | Ga0157370_10025664 | |||
| 1044 | Ga0157370_10205779 | |||
| 1045 | Ga0157369_10069466 | |||
| 1046 | Ga0157369_10148213 | |||
| 1047 | Ga0157369_12121682 | |||
| 1048 | Ga0157374_12211206 | |||
| 1049 | Ga0157378_10099522 | |||
| 1050 | Ga0157378_12670550 | |||
| 1051 | Ga0163162_10214861 | |||
| 1052 | Ga0163162_10354739 | |||
| 1053 | Ga0163162_10528127 | |||
| 1054 | Ga0157372_10051543 | |||
| 1055 | Ga0157372_10729895 | |||
| 1056 | Ga0157375_10306008 | |||
| 1057 | Ga0157375_10565070 | |||
| 1058 | Ga0157375_11999221 | |||
| 1059 | Ga0157375_12313859 | |||
| 1060 | Ga0157375_13330215 | |||
| 1061 | Ga0163163_10051486 | |||
| 1062 | Ga0163163_12341025 | |||
| 1063 | Ga0157380_10059377 | |||
| 1064 | Ga0157380_10144692 | |||
| 1065 | Ga0157380_10238703 | |||
| 1066 | Ga0157380_10888827 | |||
| 1067 | Ga0157380_11899401 | |||
| 1068 | Ga0182008_10278474 | |||
| 1069 | Ga0157377_10640670 | |||
| 1070 | Ga0157376_10222379 | |||
| 1071 | Ga0157376_11054875 | |||
| 1072 | Ga0157376_12607770 | |||
| 1073 | Ga0163161_10170332 | |||
| 1074 | Ga0207653_10102885 | |||
| 1075 | Ga0207682_10264184 | |||
| 1076 | Ga0207642_11064305 | |||
| 1077 | Ga0207710_10679884 | |||
| 1078 | Ga0207688_10030603 | |||
| 1079 | Ga0207688_10270634 | |||
| 1080 | Ga0207647_10567915 | |||
| 1081 | Ga0207643_10015598 | |||
| 1082 | Ga0207643_10094685 | |||
| 1083 | Ga0207643_10383986 | |||
| 1084 | Ga0207705_10033509 | |||
| 1085 | Ga0207654_10048191 | |||
| 1086 | Ga0207654_11433403 | |||
| 1087 | Ga0207707_10000582 | |||
| 1088 | Ga0207707_10030337 | |||
| 1089 | Ga0207707_10104342 | |||
| 1090 | Ga0207707_10141199 | |||
| 1091 | Ga0207707_10191415 | |||
| 1092 | Ga0207707_10323175 | |||
| 1093 | Ga0207707_10371165 | |||
| 1094 | Ga0207707_10990929 | |||
| 1095 | Ga0207707_11009592 | |||
| 1096 | Ga0207660_10012873 | |||
| 1097 | Ga0207660_10015931 | |||
| 1098 | Ga0207660_10064435 | |||
| 1099 | Ga0207660_10510124 | |||
| 1100 | Ga0207660_11316053 | |||
| 1101 | Ga0207662_10116595 | |||
| 1102 | Ga0207657_10021633 | |||
| 1103 | Ga0207657_10135285 | |||
| 1104 | Ga0207657_10644674 | |||
| 1105 | Ga0207657_10682167 | |||
| 1106 | Ga0207652_10004959 | |||
| 1107 | Ga0207652_10837897 | |||
| 1108 | Ga0207681_10055802 | |||
| 1109 | Ga0207681_10958824 | |||
| 1110 | Ga0207681_11697489 | |||
| 1111 | Ga0207694_10063948 | |||
| 1112 | Ga0207694_10343267 | |||
| 1113 | Ga0207694_10507525 | |||
| 1114 | Ga0207694_11700437 | |||
| 1115 | Ga0207650_10934547 | |||
| 1116 | Ga0207659_10412969 | |||
| 1117 | Ga0207659_11004091 | |||
| 1118 | Ga0207687_10096947 | |||
| 1119 | Ga0207687_11691348 | |||
| 1120 | Ga0207644_10535143 | |||
| 1121 | Ga0207690_10615816 | |||
| 1122 | Ga0207690_10631317 | |||
| 1123 | Ga0207706_10036082 | |||
| 1124 | Ga0207706_10150165 | |||
| 1125 | Ga0207686_10213002 | |||
| 1126 | Ga0207686_11530481 | |||
| 1127 | Ga0207709_10097817 | |||
| 1128 | Ga0207709_10122331 | |||
| 1129 | Ga0207709_10204763 | |||
| 1130 | Ga0207709_11009493 | |||
| 1131 | Ga0207709_11344699 | |||
| 1132 | Ga0207670_11151847 | |||
| 1133 | Ga0207670_11295079 | |||
| 1134 | Ga0207669_10028127 | |||
| 1135 | Ga0207669_10141941 | |||
| 1136 | Ga0207669_10383372 | |||
| 1137 | Ga0207669_10414842 | |||
| 1138 | Ga0207669_11428380 | |||
| 1139 | Ga0207669_11652370 | |||
| 1140 | Ga0207704_10191751 | |||
| 1141 | Ga0207691_10068902 | |||
| 1142 | Ga0207691_10125677 | |||
| 1143 | Ga0207711_10557441 | |||
| 1144 | Ga0207711_11712006 | |||
| 1145 | Ga0207689_10089709 | |||
| 1146 | Ga0207689_10239819 | |||
| 1147 | Ga0207689_10613256 | |||
| 1148 | Ga0207689_10854579 | |||
| 1149 | Ga0207661_10168132 | |||
| 1150 | Ga0207661_11070446 | |||
| 1151 | Ga0207661_11837484 | |||
| 1152 | Ga0207679_10167946 | |||
| 1153 | Ga0207679_10218784 | |||
| 1154 | Ga0207679_10445218 | |||
| 1155 | Ga0207679_11371176 | |||
| 1156 | Ga0207667_10901174 | |||
| 1157 | Ga0207667_10913870 | |||
| 1158 | Ga0207667_11076569 | |||
| 1159 | Ga0207651_10338271 | |||
| 1160 | Ga0207712_10023018 | |||
| 1161 | Ga0207712_10961598 | |||
| 1162 | Ga0207668_10024309 | |||
| 1163 | Ga0207668_10063083 | |||
| 1164 | Ga0207668_10100363 | |||
| 1165 | Ga0207668_10609292 | |||
| 1166 | Ga0207640_11282329 | |||
| 1167 | Ga0207640_11409018 | |||
| 1168 | Ga0207658_10484723 | |||
| 1169 | Ga0207677_10127328 | |||
| 1170 | Ga0207677_10145170 | |||
| 1171 | Ga0207677_11012158 | |||
| 1172 | Ga0207703_10949219 | |||
| 1173 | Ga0207639_10024518 | |||
| 1174 | Ga0207639_10348575 | |||
| 1175 | Ga0207639_10432801 | |||
| 1176 | Ga0207639_10748999 | |||
| 1177 | Ga0207678_10044918 | |||
| 1178 | Ga0207678_10183237 | |||
| 1179 | Ga0207678_10234417 | |||
| 1180 | Ga0207678_10574323 | |||
| 1181 | Ga0207678_10763050 | |||
| 1182 | Ga0207678_10910281 | |||
| 1183 | Ga0207678_11372633 | |||
| 1184 | Ga0207708_10001399 | |||
| 1185 | Ga0207708_10087186 | |||
| 1186 | Ga0207708_10103918 | |||
| 1187 | Ga0207708_10251993 | |||
| 1188 | Ga0207708_10608897 | |||
| 1189 | Ga0207708_11203057 | |||
| 1190 | Ga0207702_10052860 | |||
| 1191 | Ga0207702_10299496 | |||
| 1192 | Ga0207641_10131630 | |||
| 1193 | Ga0207641_10164075 | |||
| 1194 | Ga0207641_11717776 | |||
| 1195 | Ga0207648_10635847 | |||
| 1196 | Ga0207676_10003912 | |||
| 1197 | Ga0207676_10080910 | |||
| 1198 | Ga0207674_10001143 | |||
| 1199 | Ga0207675_100041267 | |||
| 1200 | Ga0207675_100048221 | |||
| 1201 | Ga0207675_100135123 | |||
| 1202 | Ga0207675_101488178 | |||
| 1203 | Ga0207683_10053612 | |||
| 1204 | Ga0207683_10168119 | |||
| 1205 | Ga0207683_10362701 | |||
| 1206 | Ga0207683_10880818 | |||
| 1207 | Ga0207698_10319495 | |||
| 1208 | Ga0207698_11032649 | |||
| 1209 | Ga0209371_1088252 | |||
| 1210 | Ga0209813_10013463 | |||
| 1211 | Ga0209813_10228284 | |||
| 1212 | Ga0268266_10008617 | |||
| 1213 | Ga0268266_10119099 | |||
| 1214 | Ga0268266_10494045 | |||
| 1215 | Ga0268265_10000626 | |||
| 1216 | Ga0268265_10036784 | |||
| 1217 | Ga0268265_11065293 | |||
| 1218 | Ga0268265_11425059 | |||
| 1219 | Ga0268264_10003320 | |||
| 1220 | Ga0268264_11778713 | |||
| 1221 | Ga0268256_1097476 | |||
| 1222 | Ga0307408_101340466 | |||
| 1223 | Ga0307405_10723144 | |||
| 1224 | Ga0307413_10325848 | |||
| 1225 | Ga0307413_11901714 | |||
| 1226 | Ga0307410_10055976 | |||
| 1227 | Ga0307410_10531599 | |||
| 1228 | Ga0307410_11210545 | |||
| 1229 | Ga0307406_10007814 | |||
| 1230 | Ga0307406_10118690 | |||
| 1231 | Ga0307407_10265865 | |||
| 1232 | Ga0307407_10567894 | |||
| 1233 | Ga0307412_11399774 | |||
| 1234 | Ga0307409_100003248 | |||
| 1235 | Ga0307409_100027346 | |||
| 1236 | Ga0307409_101467771 | |||
| 1237 | Ga0307416_102331309 | |||
| 1238 | Ga0307414_10412783 | |||
| 1239 | Ga0307411_11457571 | |||
| 1240 | Ga0307411_11945905 | |||
| 1241 | Ga0307415_100012409 | |||
| 1242 | Ga0307415_100071786 | |||
| 1243 | Ga0307415_100209505 | |||
| 1244 | Ga0373936_0360103 | |||
| 1245 | Ga0373939_0455072 | |||
| 1246 | Ga0373941_0168862 | |||
| 1247 | Ga0373961_0012192 | |||
| 1248 | Ga0373961_0294112 | |||
| 1249 | Ga0373931_0000324 | |||
| 1250 | Ga0373925_0135394 | |||
| 1251 | Ga0395899_0060742 | |||
| 1252 | Ga0395900_0020727 | |||
| 1253 | Ga0395900_0346047 | |||
| 1254 | Ga0395898_0003674 | |||
| 1255 | Ga0395905_0133717 | |||
| 1256 | Ga0395905_0465636 | |||
| 1257 | Ga0395905_1165290 | |||
| 1258 | Ga0395901_0270420 | |||
| 1259 | Ga0395901_0339236 | |||
| 1260 | Ga0395901_0854541 | |||
| 1261 | Ga0395901_1483482 | |||
| 1262 | Ga0451787_007409 | |||
| 1263 | Ga0451789_0738026 | |||
| 1264 | Ga0451789_0923876 | |||
| 1265 | Ga0451793_1234692 | |||
| 1266 | Ga0451797_1299792 | |||
| 1267 | Ga0451795_0299550 | |||
| 1268 | Ga0451798_1123436 | |||
| 1269 | Ga0451802_2128099 | |||
| 1270 | Ga0451807_0571173 | |||
| 1271 | Ga0451807_1294539 | |||
| 1272 | Ga0451807_1494924 | |||
| 1273 | Ga0451807_2155322 | |||
| 1274 | Ga0451807_2693519 | |||
| 1275 | Ga0451833_0416748 | |||
| 1276 | Ga0451837_0650742 | |||
| 1277 | Ga0451841_1348048 | |||
| 1278 | Ga0451845_0436157 | |||
| 1279 | Ga0451843_1116658 | |||
| 1280 | Ga0451853_2901402 | |||
| 1281 | Ga0439448_0303566 | |||
| 1282 | Ga0439432_243951 | |||
| 1283 | Ga0450894_015381 | |||
| 1284 | Ga0439446_0024012 | |||
| 1285 | Ga0439434_0360652 | |||
| 1286 | Ga0453683_0379638 | |||
| 1287 | Ga0466965_0058514 | |||
| 1288 | Ga0466957_0117044 | |||
| 1289 | Ga0466960_0217108 | |||
| 1290 | Ga0466967_0036885 | |||
| 1291 | Ga0495629_0217343 | |||
| 1292 | Ga0495632_0364017 | |||
| 1293 | Ga0495587_0568915 | |||
| 1294 | Ga0495635_0548676 | |||
| 1295 | Ga0495600_0699478 | |||
| 1296 | Ga0495581_0363512 | |||
| 1297 | Ga0495604_0426369 | |||
| 1298 | Ga0496100_0796125 | |||
| 1299 | Ga0496100_1376768 | |||
| 1300 | Ga0496101_0109131 | |||
| 1301 | Ga0496101_0291161 | |||
| 1302 | Ga0496102_0009559 | |||
| 1303 | Ga0496102_0039333 | |||
| 1304 | Ga0496102_0251716 | |||
| 1305 | Ga0496102_0848433 | |||
| 1306 | Ga0496102_1295703 | |||
| 1307 | Ga0496102_1756408 | |||
| 1308 | Ga0496103_0036330 | |||
| 1309 | Ga0496103_0098712 | |||
| 1310 | Ga0496103_0161053 | |||
| 1311 | Ga0496103_0953668 | |||
| 1312 | Ga0496104_0132289 | |||
| 1313 | Ga0496104_0659058 | |||
| 1314 | Ga0496104_1091422 | |||
| 1315 | Ga0496105_0052219 | |||
| 1316 | Ga0496105_0121824 | |||
| 1317 | Ga0496106_0042073 | |||
| 1318 | Ga0496106_0438092 | |||
| 1319 | Ga0496106_0723222 | |||
| 1320 | Ga0496107_0011296 | |||
| 1321 | Ga0496107_0067379 | |||
| 1322 | Ga0496107_1094858 | |||
| 1323 | Ga0496108_0040335 | |||
| 1324 | Ga0496108_1311453 | |||
| 1325 | Ga0496109_0039540 | |||
| 1326 | Ga0496109_0336834 | |||
| 1327 | Ga0496109_0874317 | |||
| 1328 | Ga0496109_1102814 | |||
| 1329 | Ga0496109_1790395 | |||
| 1330 | Ga0496110_0017647 | |||
| 1331 | Ga0496111_0307412 | |||
| 1332 | Ga0496112_0015803 | |||
| 1333 | Ga0496112_0016184 | |||
| 1334 | Ga0496114_0008572 | |||
| 1335 | Ga0496114_0040997 | |||
| 1336 | Ga0496114_1256416 | |||
| 1337 | Ga0496114_1782755 | |||
| 1338 | Ga0496115_0345469 | |||
| 1339 | Ga0496115_0549615 | |||
| 1340 | Ga0496116_0000100 | |||
| 1341 | Ga0496116_0043510 | |||
| 1342 | Ga0496118_0059604 | |||
| 1343 | Ga0496119_0019768 | |||
| 1344 | Ga0496119_0585542 | |||
| 1345 | Ga0496120_0052116 | |||
| 1346 | Ga0496121_0000001 | |||
| 1347 | Ga0496121_0358017 | |||
| 1348 | Ga0496121_0678993 | |||
| 1349 | Ga0496122_0003647 | |||
| 1350 | Ga0496122_0008413 | |||
| 1351 | Ga0496122_0158319 | |||
| 1352 | Ga0496122_0164361 | |||
| 1353 | Ga0496122_0314577 | |||
| 1354 | Ga0496123_0000517 | |||
| 1355 | Ga0496123_0076793 | |||
| 1356 | Ga0496123_0226076 | |||
| 1357 | Ga0496124_0015675 | |||
| 1358 | Ga0496124_0107810 | |||
| 1359 | Ga0496125_0000001 | |||
| 1360 | Ga0496125_0000713 | |||
| 1361 | Ga0496126_0000094 | |||
| 1362 | Ga0496126_0561186 | |||
| 1363 | Ga0496126_0628342 | |||
| 1364 | Ga0501300_023806 | |||
| 1365 | Ga0501031_0000010 | |||
| 1366 | Ga0501031_0002408 | |||
| 1367 | Ga0501031_0006171 | |||
| 1368 | Ga0501031_0093978 | |||
| 1369 | Ga0501031_0121925 | |||
| 1370 | Ga0501032_0000023 | |||
| 1371 | Ga0501032_0038284 | |||
| 1372 | Ga0501032_0038787 | |||
| 1373 | Ga0501032_0082015 | |||
| 1374 | Ga0501033_0000104 | |||
| 1375 | Ga0501033_0004294 | |||
| 1376 | Ga0501033_0007428 | |||
| 1377 | Ga0501033_0214291 | |||
| 1378 | Ga0501033_0237615 | |||
| 1379 | Ga0501033_0364429 | |||
| 1380 | Ga0501033_0434097 | |||
| 1381 | Ga0501034_0000116 | |||
| 1382 | Ga0501034_0073146 | |||
| 1383 | Ga0501034_0076906 | |||
| 1384 | Ga0501034_0139192 | |||
| 1385 | Ga0501034_0194349 | |||
| 1386 | Ga0501034_0204182 | |||
| 1387 | Ga0501034_0208416 | |||
| 1388 | Ga0501034_0407536 | |||
| 1389 | Ga0501036_0000015 | |||
| 1390 | Ga0501036_0039590 | |||
| 1391 | Ga0501036_0043249 | |||
| 1392 | Ga0501036_0206600 | |||
| 1393 | Ga0501036_0522077 | |||
| 1394 | Ga0501037_0000023 | |||
| 1395 | Ga0501037_0004454 | |||
| 1396 | Ga0501037_0015413 | |||
| 1397 | Ga0501037_0029303 | |||
| 1398 | Ga0501037_0349858 | |||
| 1399 | Ga0501038_0000025 | |||
| 1400 | Ga0501038_0023114 | |||
| 1401 | Ga0501038_0087169 | |||
| 1402 | Ga0501038_0095352 | |||
| 1403 | Ga0501038_0134187 | |||
| 1404 | Ga0501038_0208276 | |||
| 1405 | Ga0501039_0000037 | |||
| 1406 | Ga0501039_0053240 | |||
| 1407 | Ga0501039_0266770 | |||
| 1408 | Ga0501039_0740038 | |||
| 1409 | Ga0501040_0005598 | |||
| 1410 | Ga0501040_0389412 | |||
| 1411 | Ga0501041_0137308 | |||
| 1412 | Ga0501041_0260106 | |||
| 1413 | Ga0501042_0006985 | |||
| 1414 | Ga0501042_0226930 | |||
| 1415 | Ga0501042_0333915 | |||
| 1416 | Ga0501042_1124383 | |||
| 1417 | Ga0501043_0000070 | |||
| 1418 | Ga0501043_0017343 | |||
| 1419 | Ga0501043_0083685 | |||
| 1420 | Ga0501043_0398702 | |||
| 1421 | Ga0501043_0414385 | |||
| 1422 | Ga0501043_0498715 | |||
| 1423 | Ga0501043_0592366 | |||
| 1424 | Ga0501046_0039644 | |||
| 1425 | Ga0501046_0103078 | |||
| 1426 | Ga0501046_0116579 | |||
| 1427 | Ga0501046_0478553 | |||
| 1428 | Ga0501047_0001244 | |||
| 1429 | Ga0501047_0025205 | |||
| 1430 | Ga0501047_0122146 | |||
| 1431 | Ga0501047_0284741 | |||
| 1432 | Ga0501047_0452411 | |||
| 1433 | Ga0501047_0512479 | |||
| 1434 | Ga0501048_1044042 | |||
| 1435 | Ga0501048_1079766 | |||
| 1436 | Ga0501067_0424955 | |||
| 1437 | Ga0501068_0023785 | |||
| 1438 | Ga0501068_0528692 | |||
| 1439 | Ga0501069_0080090 | |||
| 1440 | Ga0501070_0047983 | |||
| 1441 | Ga0501070_0073374 | |||
| 1442 | Ga0501070_0076324 | |||
| 1443 | Ga0501070_0186288 | |||
| 1444 | Ga0501070_0803663 | |||
| 1445 | Ga0501070_1134270 | |||
| 1446 | Ga0501071_0031594 | |||
| 1447 | Ga0501071_0083056 | |||
| 1448 | Ga0501071_1196037 | |||
| 1449 | Ga0501073_0201448 | |||
| 1450 | Ga0501074_0245860 | |||
| 1451 | Ga0501074_0394119 | |||
| 1452 | Ga0501074_0421783 | |||
| 1453 | Ga0501074_0482451 | |||
| 1454 | Ga0501075_0243164 | |||
| 1455 | Ga0501076_0093445 | |||
| 1456 | Ga0501076_0176205 | |||
| 1457 | Ga0501077_0407783 | |||
| 1458 | Ga0501077_0744717 | |||
| 1459 | Ga0501077_0918813 | |||
| 1460 | Ga0501079_0183477 | |||
| 1461 | Ga0501080_0084392 | |||
| 1462 | Ga0501080_0110362 | |||
| 1463 | Ga0501080_0187004 | |||
| 1464 | Ga0501080_0891638 | |||
| 1465 | Ga0501080_0985345 | |||
| 1466 | Ga0501080_1000669 | |||
| 1467 | Ga0501080_1037235 | |||
| 1468 | Ga0501080_1212241 | |||
| 1469 | Ga0501081_0089620 | |||
| 1470 | Ga0501081_0252915 | |||
| 1471 | Ga0501083_0347970 | |||
| 1472 | Ga0501083_0428470 | |||
| 1473 | Ga0501083_0570771 | |||
| 1474 | Ga0501083_0847682 | |||
| 1475 | Ga0501280_001054 | |||
| 1476 | Ga0501280_112724 | |||
| 1477 | Ga0501282_003196 | |||
| 1478 | Ga0501035_0000074 | |||
| 1479 | Ga0501035_0008072 | |||
| 1480 | Ga0501035_0054537 | |||
| 1481 | Ga0501035_0066879 | |||
| 1482 | Ga0501035_0230153 | |||
| 1483 | Ga0501035_0265749 | |||
| 1484 | Ga0501044_0000069 | |||
| 1485 | Ga0501044_0030874 | |||
| 1486 | Ga0501044_0099811 | |||
| 1487 | Ga0501044_0108035 | |||
| 1488 | Ga0501044_0192500 | |||
| 1489 | Ga0501044_0202925 | |||
| 1490 | Ga0501044_0509090 | |||
| 1491 | Ga0501044_0836155 | |||
| 1492 | Ga0501044_0931967 | |||
| 1493 | Ga0501045_0103639 | |||
| 1494 | Ga0501045_0164076 | |||
| 1495 | Ga0501045_0438656 | |||
| 1496 | nmdc:mga03683_30478_c1 | |||
| 1497 | nmdc:mga03n38_157042_c1 | |||
| 1498 | nmdc:mga03n38_24061_c1 | |||
| 1499 | nmdc:mga00v17_5790_c1 | |||
| 1500 | nmdc:mga0yw44_138138_c1 | |||
| 1501 | nmdc:mga0yw44_169194_c1 | |||
| 1502 | nmdc:mga0yw44_224437_c1 | |||
| 1503 | nmdc:mga0yw44_4246_c1 | |||
| 1504 | nmdc:mga0yw44_583868_c1 | |||
| 1505 | nmdc:mga0yw44_696899_c1 | |||
| 1506 | nmdc:mga0yw44_828363_c1 | |||
| 1507 | nmdc:mga0k408_148904_c1 | |||
| 1508 | nmdc:mga0k408_220406_c1 | |||
| 1509 | nmdc:mga06z11_110892_c1 | |||
| 1510 | nmdc:mga06z11_341823_c1 | |||
| 1511 | nmdc:mga06z11_883595_c1 | |||
| 1512 | nmdc:mga06z11_9784_c1 | |||
| 1513 | nmdc:mga04h51_10906_c1 | |||
| 1514 | nmdc:mga04h51_259831_c1 | |||
| 1515 | nmdc:mga07m45_27801_c2 | |||
| 1516 | nmdc:mga07m45_37513_c1 | |||
| 1517 | nmdc:mga07m45_590160_c1 | |||
| 1518 | nmdc:mga07m45_904608_c1 | |||
| 1519 | nmdc:mga0qj67_1199774_c1 | |||
| 1520 | nmdc:mga0qj67_26058_c1 | |||
| 1521 | nmdc:mga0qj67_354997_c1 | |||
| 1522 | nmdc:mga06r32_26679_c1 | |||
| 1523 | nmdc:mga06r32_946660_c1 | |||
| 1524 | nmdc:mga0n895_39998_c1 | |||
| 1525 | nmdc:mga08x19_1190915_c1 | |||
| 1526 | nmdc:mga0a205_18086_c1 | |||
| 1527 | nmdc:mga0sz30_330859_c1 | |||
| 1528 | nmdc:mga0sz30_80476_c1 | |||
| 1529 | Ga0500641_0016481 | |||
| 1530 | Ga0500556_0000039 | |||
| 1531 | Ga0500572_020801 | |||
| 1532 | Ga0500603_238306 | |||
| 1533 | Ga0500636_0000006 | |||
| 1534 | Ga0500636_0129561 | |||
| 1535 | Ga0501084_1246404 | |||
| 1536 | Ga0501082_0000006 | |||
| 1537 | Ga0501082_0080879 | |||
| 1538 | Ga0501082_0385566 | |||
| 1539 | Ga0530510_0062570 | |||
| 1540 | Ga0530510_0849547 | |||
| 1541 | Ga0530510_1044026 | |||
| 1542 | 2508731125 | |||
| 1543 | 2535486473 | |||
| 1544 | 2599104605 | |||
| 1545 | 2643837794 | |||
| 1546 | 2643855215 | |||
| 1547 | 2644133095 | |||
| 1548 | 2739305873 | |||
| 1549 | 2757569368 | |||
| 1550 | 2842719657 | |||
| 1551 | 2844004668 | |||
| 1552 | 2846955462 | |||
| 1553 | 2848862659 | |||
| 1554 | 2854916674 | |||
| 1555 | 2894777199 | |||
| 1556 | 2915652453 | |||
| 1557 | 2919166786 | |||
| 1558 | 2919451995 | |||
| 1559 | 2929138719 | |||
| 1560 | 2974323725 | |||
| 1561 | 2977959128 | |||
| 1562 | 2978973202 | |||
| 1563 | 2984591450 | |||
| 1564 | 2996314958 | |||
| 1565 | 8001849919 | |||
| 1566 | 8054461231 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7zme-assembly1.cif.gz_6 | cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 2) - membrane arm | 0.9605 | 11 | 87 |
| 7d3u-assembly1.cif.gz_A | structure of mrp complex from dietzia sp. dq12-45-1b | 0.9565 | 15 | 82 |
| 6cfw-assembly1.cif.gz_D | cryoem structure of a respiratory membrane-bound hydrogenase | 0.9465 | 9 | 74 |
| 7p63-assembly1.cif.gz_J | complex i from e. coli, ddm/lmng-purified, under turnover at ph 6, closed state | 0.9453 | 10 | 87 |
| 7zdh-assembly1.cif.gz_J | complex i from ovis aries at ph7.4, closed state | 0.9408 | 13 | 84 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9XK79_1_97_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9515 | 13 | 84 | 1.10.287.3510 |
| 5xtdk00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9151 | 10 | 80 | 1.10.287.3510 |
| af_P03901_1_98_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9131 | 10 | 89 | 1.10.287.3510 |
| 6g72K00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8907 | 13 | 89 | 1.10.287.3510 |
| 4he8K00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8823 | 12 | 84 | 1.10.287.3510 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A350WPA1-F1-model_v4 | Cation:proton antiporter | 0.9872 | 1 | 84 |
GO:0005886
GO:0015385 |
| AF-A0A4U6R5H1-F1-model_v4 | pH regulation protein F | 0.9809 | 7 | 82 |
GO:0005886
GO:0015385 |
| AF-A0A6B1G8P7-F1-model_v4 | Cation transporter | 0.9789 | 1 | 83 |
GO:0005886
GO:0015385 |
| AF-A0A424YWX2-F1-model_v4 | Cation:proton antiporter | 0.9746 | 8 | 84 |
GO:0005886
GO:0015385 |
| AF-A0A7W1SNR3-F1-model_v4 | K+/H+ antiporter subunit F | 0.9736 | 5 | 78 |
GO:0005886
GO:0015385 |