F480680

General Info

Members Datasets Scaffolds Average Seq Length
783 337 1566 92

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_848936_c1|nmdc:mga00v17_848936_c1_26_358
Length 110
Sequence MGSHHKRAIRAAAAGDIRMSTMLLWSITAAQILLCVSMACAIFRILWGPRAQDRIVGFDCLYVNAMLLLLAFGIRSGSTLYFEAALMVSLLGFVSTVALAKFLLRGEVIE

Samples

Sample ID Description Type Environment
1 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
192 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
193 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
202 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
203 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
204 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
205 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
206 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
207 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
208 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
209 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
210 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
211 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
212 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
213 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
214 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
215 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
216 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
217 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
218 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
219 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
220 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
221 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
222 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
223 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
226 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
227 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
228 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
248 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
249 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
250 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
251 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
252 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
253 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
256 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
257 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
258 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
274 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
275 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
276 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
277 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
281 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
282 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
283 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
286 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
287 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
288 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
292 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
293 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
294 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
295 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
296 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
297 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
298 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
302 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
303 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
304 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
305 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
306 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
307 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
308 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
309 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
313 2508501050 Microvirga lupini Lut6 Isolate Nodule
314 2534681786 Brucella suis 92/29 Isolate Unclassified
315 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
316 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
317 2643221568 Rhizobium sp. Root564 Isolate Unclassified
318 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
319 2738543024 Aminobacter sp. AP02 Isolate Unclassified
320 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
321 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
322 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
323 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
324 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
325 2854911287 Brucella lupini LUP21 Isolate Unclassified
326 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
327 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
328 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
329 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
330 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
331 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
332 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
333 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
334 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
335 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
336 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
337 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.68
Metatranscriptomes 0.13
Isolates 3.19

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 6.9
Nodule 0.51
Rhizoplane 7.02
Rhizosphere 78.93
Stem 0
Stem Tuber 0
Unclassified 9.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga00v17_848936_c1 3300050491 Unclassified 580
2 rootL2_10338223 3300003322 Bacteria 1700
3 rootH1_10265339 3300003323 Bacteria 1967
4 rootH1_10398603 3300003323 Bacteria 1204
5 Ga0006562J51391_1006409 3300003578 Bacteria 5212
6 Ga0070658_10003488 3300005327 Bacteria 12921
7 Ga0070658_10165025 3300005327 Bacteria 1859
8 Ga0070658_11344707 3300005327 Bacteria 620
9 Ga0070676_10676252 3300005328 Bacteria 752
10 Ga0070676_11116586 3300005328 Bacteria 596
11 Ga0070676_11125842 3300005328 Bacteria 594
12 Ga0070683_100164491 3300005329 Bacteria 2105
13 Ga0070683_100352283 3300005329 Unclassified 1402
14 Ga0070683_100778266 3300005329 Bacteria 917
15 Ga0070683_101269707 3300005329 Bacteria 708
16 Ga0070670_100159351 3300005331 Bacteria 1956
17 Ga0070670_101666295 3300005331 Bacteria 587
18 Ga0070677_10568362 3300005333 Bacteria 624
19 Ga0068869_100014018 3300005334 Bacteria 5348
20 Ga0068869_100092905 3300005334 Bacteria 2272
21 Ga0068869_100398628 3300005334 Bacteria 1131
22 Ga0068869_100469553 3300005334 Bacteria 1046
23 Ga0070680_100014420 3300005336 Bacteria 6177
24 Ga0070680_100020613 3300005336 Bacteria 5235
25 Ga0070680_100135813 3300005336 Bacteria 2060
26 Ga0070680_100491888 3300005336 Bacteria 1049
27 Ga0070682_100072965 3300005337 Bacteria 2201
28 Ga0068868_101181358 3300005338 Bacteria 707
29 Ga0068868_101457717 3300005338 Bacteria 640
30 Ga0070660_100392741 3300005339 Bacteria 1146
31 Ga0070660_100943870 3300005339 Unclassified 728
32 Ga0070660_100951606 3300005339 Bacteria 725
33 Ga0070689_100830760 3300005340 Bacteria 814
34 Ga0070689_100919737 3300005340 Unclassified 775
35 Ga0070689_101184725 3300005340 Bacteria 685
36 Ga0070691_10289947 3300005341 Bacteria 890
37 Ga0070691_10307286 3300005341 Bacteria 868
38 Ga0070687_100100854 3300005343 Bacteria 1616
39 Ga0070687_100422112 3300005343 Bacteria 880
40 Ga0070661_100010269 3300005344 Bacteria 6506
41 Ga0070692_10022193 3300005345 Bacteria 3098
42 Ga0070692_10371920 3300005345 Bacteria 894
43 Ga0070668_100076893 3300005347 Bacteria 2608
44 Ga0070668_100256201 3300005347 Bacteria 1454
45 Ga0070668_101099378 3300005347 Bacteria 717
46 Ga0070668_101347115 3300005347 Bacteria 650
47 Ga0070668_102052173 3300005347 Bacteria 528
48 Ga0070669_100089827 3300005353 Bacteria 2302
49 Ga0070669_101686263 3300005353 Bacteria 552
50 Ga0070675_100641029 3300005354 Unclassified 965
51 Ga0070671_100359625 3300005355 Bacteria 1243
52 Ga0070671_100942040 3300005355 Bacteria 755
53 Ga0070674_100490005 3300005356 Bacteria 1022
54 Ga0070674_100581297 3300005356 Bacteria 944
55 Ga0070674_100994053 3300005356 Unclassified 736
56 Ga0070673_101641297 3300005364 Bacteria 608
57 Ga0070659_100127702 3300005366 Bacteria 2063
58 Ga0070667_100101024 3300005367 Bacteria 2491
59 Ga0070667_101721521 3300005367 Bacteria 590
60 Ga0070703_10019779 3300005406 Bacteria 1954
61 Ga0070701_10674312 3300005438 Bacteria 693
62 Ga0070705_100000901 3300005440 Bacteria 16586
63 Ga0070705_100124782 3300005440 Bacteria 1669
64 Ga0070700_100001924 3300005441 Bacteria 10504
65 Ga0070700_100417194 3300005441 Bacteria 1013
66 Ga0070700_100500283 3300005441 Bacteria 935
67 Ga0070700_101890338 3300005441 Bacteria 516
68 Ga0070694_100001405 3300005444 Bacteria 14089
69 Ga0070694_100173731 3300005444 Bacteria 1589
70 Ga0070708_100016481 3300005445 Bacteria 6134
71 Ga0070663_100038744 3300005455 Bacteria 3326
72 Ga0070663_100065164 3300005455 Bacteria 2636
73 Ga0070663_100198443 3300005455 Bacteria 1565
74 Ga0070663_100260723 3300005455 Bacteria 1375
75 Ga0070663_100274613 3300005455 Unclassified 1341
76 Ga0070663_100716772 3300005455 Unclassified 851
77 Ga0070663_101582407 3300005455 Bacteria 584
78 Ga0070663_101624389 3300005455 Unclassified 577
79 Ga0070678_100054493 3300005456 Bacteria 2914
80 Ga0070678_100078226 3300005456 Bacteria 2498
81 Ga0070678_100574215 3300005456 Bacteria 1004
82 Ga0070678_100738069 3300005456 Bacteria 890
83 Ga0070678_101125785 3300005456 Bacteria 726
84 Ga0070662_100300943 3300005457 Bacteria 1303
85 Ga0070662_101456942 3300005457 Bacteria 590
86 Ga0070681_10006828 3300005458 Bacteria 11113
87 Ga0070681_10013475 3300005458 Bacteria 8124
88 Ga0070681_10106659 3300005458 Bacteria 2743
89 Ga0070681_10174999 3300005458 Bacteria 2068
90 Ga0070681_10477645 3300005458 Bacteria 1159
91 Ga0070681_10583248 3300005458 Unclassified 1032
92 Ga0070681_10587353 3300005458 Bacteria 1028
93 Ga0068867_100072516 3300005459 Bacteria 2578
94 Ga0068867_101643178 3300005459 Bacteria 601
95 Ga0070685_10416578 3300005466 Unclassified 934
96 Ga0070685_11444812 3300005466 Bacteria 529
97 Ga0070706_100029463 3300005467 Bacteria 5057
98 Ga0070707_100525423 3300005468 Bacteria 1145
99 Ga0070698_100017908 3300005471 Bacteria 7463
100 Ga0070699_100015194 3300005518 Bacteria 6615
101 Ga0070679_100028734 3300005530 Bacteria 5485
102 Ga0070679_100338546 3300005530 Bacteria 1452
103 Ga0070679_100680238 3300005530 Unclassified 972
104 Ga0070679_100918268 3300005530 Unclassified 819
105 Ga0070679_101653465 3300005530 Bacteria 588
106 Ga0070679_101717838 3300005530 Bacteria 576
107 Ga0070684_100189099 3300005535 Bacteria 1873
108 Ga0070684_101079299 3300005535 Bacteria 754
109 Ga0070697_100009532 3300005536 Bacteria 7588
110 Ga0068853_100242692 3300005539 Bacteria 1652
111 Ga0070672_100098034 3300005543 Bacteria 2374
112 Ga0070672_100152234 3300005543 Bacteria 1914
113 Ga0070672_101619603 3300005543 Bacteria 581
114 Ga0070672_101910417 3300005543 Bacteria 534
115 Ga0070686_101345841 3300005544 Bacteria 598
116 Ga0070695_100000158 3300005545 Bacteria 32227
117 Ga0070696_100233450 3300005546 Bacteria 1385
118 Ga0070693_100356129 3300005547 Bacteria 1003
119 Ga0070693_100486276 3300005547 Unclassified 873
120 Ga0070693_100815878 3300005547 Bacteria 693
121 Ga0070693_101005415 3300005547 Bacteria 631
122 Ga0070665_100010765 3300005548 Bacteria 9253
123 Ga0070665_100081964 3300005548 Bacteria 3231
124 Ga0070665_100388894 3300005548 Bacteria 1402
125 Ga0070704_100008256 3300005549 Bacteria 6233
126 Ga0070704_100086648 3300005549 Bacteria 2322
127 Ga0068855_100067522 3300005563 Bacteria 4165
128 Ga0068855_100139229 3300005563 Bacteria 2768
129 Ga0068855_100408200 3300005563 Bacteria 1487
130 Ga0068855_100597169 3300005563 Bacteria 1191
131 Ga0068855_101111531 3300005563 Unclassified 826
132 Ga0068855_101135554 3300005563 Bacteria 815
133 Ga0068855_101216124 3300005563 Bacteria 783
134 Ga0068855_102125797 3300005563 Bacteria 565
135 Ga0070664_100118502 3300005564 Bacteria 2316
136 Ga0070664_100571187 3300005564 Bacteria 1047
137 Ga0070664_101117158 3300005564 Unclassified 743
138 Ga0070664_101540017 3300005564 Unclassified 629
139 Ga0068857_100009560 3300005577 Bacteria 8420
140 Ga0068857_100548081 3300005577 Unclassified 1089
141 Ga0068854_100509208 3300005578 Bacteria 1015
142 Ga0068856_101363028 3300005614 Bacteria 724
143 Ga0070702_100016066 3300005615 Bacteria 3834
144 Ga0070702_101697119 3300005615 Bacteria 525
145 Ga0068852_100392752 3300005616 Bacteria 1363
146 Ga0068852_100681505 3300005616 Bacteria 1037
147 Ga0068852_101875297 3300005616 Bacteria 622
148 Ga0068859_100003502 3300005617 Bacteria 15988
149 Ga0068859_100194379 3300005617 Bacteria 2113
150 Ga0068859_102532578 3300005617 Bacteria 565
151 Ga0068864_100025178 3300005618 Bacteria 5009
152 Ga0068864_100540208 3300005618 Bacteria 1125
153 Ga0068866_10721483 3300005718 Bacteria 686
154 Ga0068866_10845806 3300005718 Bacteria 639
155 Ga0068861_100023390 3300005719 Bacteria 4456
156 Ga0068861_100042905 3300005719 Bacteria 3392
157 Ga0068861_100221668 3300005719 Bacteria 1599
158 Ga0068870_10120828 3300005840 Bacteria 1509
159 Ga0068870_10159334 3300005840 Bacteria 1337
160 Ga0068870_10591421 3300005840 Unclassified 753
161 Ga0068863_100107338 3300005841 Bacteria 2657
162 Ga0068863_100250601 3300005841 Bacteria 1710
163 Ga0068863_100329608 3300005841 Bacteria 1484
164 Ga0068858_100488445 3300005842 Unclassified 1189
165 Ga0068858_102056274 3300005842 Bacteria 565
166 Ga0068860_100001841 3300005843 Bacteria 22590
167 Ga0068860_100080379 3300005843 Bacteria 3100
168 Ga0068862_100002731 3300005844 Bacteria 15492
169 Ga0068862_100017501 3300005844 Bacteria 5970
170 Ga0068862_100296142 3300005844 Bacteria 1487
171 Ga0068862_101976356 3300005844 Unclassified 594
172 Ga0075365_10045106 3300006038 Bacteria 2891
173 Ga0075365_10076577 3300006038 Bacteria 2259
174 Ga0075365_10176951 3300006038 Bacteria 1491
175 Ga0075365_10448618 3300006038 Bacteria 911
176 Ga0075365_10627213 3300006038 Bacteria 760
177 Ga0075363_100114453 3300006048 Bacteria 1502
178 Ga0075363_100474799 3300006048 Bacteria 741
179 Ga0075364_10016127 3300006051 Bacteria 4644
180 Ga0075364_10030113 3300006051 Unclassified 3483
181 Ga0075432_10059355 3300006058 Bacteria 1360
182 Ga0070715_10267802 3300006163 Bacteria 900
183 Ga0075362_10045679 3300006177 Unclassified 1946
184 Ga0075362_10652552 3300006177 Unclassified 547
185 Ga0075367_10030475 3300006178 Bacteria 3093
186 Ga0075367_10098355 3300006178 Unclassified 1786
187 Ga0075367_10933851 3300006178 Unclassified 553
188 Ga0075369_10304711 3300006186 Bacteria 744
189 Ga0075366_10021454 3300006195 Bacteria 3753
190 Ga0075366_11010888 3300006195 Bacteria 519
191 Ga0097621_100330182 3300006237 Unclassified 1352
192 Ga0097621_101146284 3300006237 Bacteria 731
193 Ga0097621_101272882 3300006237 Bacteria 694
194 Ga0075370_10060801 3300006353 Bacteria 2152
195 Ga0075370_10335264 3300006353 Bacteria 902
196 Ga0075370_10476437 3300006353 Bacteria 752
197 Ga0068871_100358514 3300006358 Bacteria 1291
198 Ga0068871_100614064 3300006358 Bacteria 990
199 Ga0068871_100806206 3300006358 Unclassified 866
200 Ga0068871_101692096 3300006358 Bacteria 600
201 Ga0075428_100251939 3300006844 Bacteria 1903
202 Ga0075428_101471530 3300006844 Bacteria 714
203 Ga0075430_100009987 3300006846 Bacteria 8031
204 Ga0075430_100484328 3300006846 Bacteria 1021
205 Ga0075430_101409045 3300006846 Bacteria 573
206 Ga0075431_100856752 3300006847 Bacteria 880
207 Ga0075433_10018253 3300006852 Bacteria 5826
208 Ga0075434_100004344 3300006871 Bacteria 12753
209 Ga0075429_100744713 3300006880 Unclassified 858
210 Ga0068865_100296126 3300006881 Bacteria 1293
211 Ga0068865_100340032 3300006881 Unclassified 1213
212 Ga0097620_100003500 3300006931 Bacteria 15988
213 Ga0097620_100194396 3300006931 Bacteria 2113
214 Ga0097620_102532335 3300006931 Bacteria 565
215 Ga0075435_100198189 3300007076 Unclassified 1701
216 Ga0105244_10260307 3300009036 Unclassified 807
217 Ga0105244_10340994 3300009036 Bacteria 691
218 Ga0105240_10080457 3300009093 Bacteria 4007
219 Ga0105240_11077991 3300009093 Unclassified 856
220 Ga0105240_11867774 3300009093 Bacteria 625
221 Ga0105240_11927442 3300009093 Unclassified 615
222 Ga0111539_10158996 3300009094 Bacteria 2643
223 Ga0111539_11939178 3300009094 Bacteria 683
224 Ga0105245_10067879 3300009098 Bacteria 3230
225 Ga0105245_10703437 3300009098 Bacteria 1044
226 Ga0105245_11771471 3300009098 Bacteria 670
227 Ga0105245_13110375 3300009098 Bacteria 514
228 Ga0105247_10129646 3300009101 Bacteria 1642
229 Ga0105247_10515956 3300009101 Bacteria 873
230 Ga0105243_10056569 3300009148 Bacteria 3120
231 Ga0105243_10204910 3300009148 Bacteria 1733
232 Ga0105243_11520150 3300009148 Bacteria 694
233 Ga0105241_10023704 3300009174 Bacteria 4553
234 Ga0105241_10990175 3300009174 Bacteria 786
235 Ga0105241_11441256 3300009174 Bacteria 661
236 Ga0105242_10205554 3300009176 Bacteria 1751
237 Ga0105242_12505360 3300009176 Unclassified 564
238 Ga0105248_10555022 3300009177 Bacteria 1296
239 Ga0105248_11451535 3300009177 Bacteria 776
240 Ga0105237_10130058 3300009545 Bacteria 2512
241 Ga0105237_11127746 3300009545 Bacteria 791
242 Ga0105237_12454848 3300009545 Bacteria 532
243 Ga0105238_10075653 3300009551 Bacteria 3358
244 Ga0105238_10317910 3300009551 Bacteria 1542
245 Ga0105238_10589408 3300009551 Unclassified 1119
246 Ga0105238_12751765 3300009551 Bacteria 528
247 Ga0105249_10046892 3300009553 Bacteria 3935
248 Ga0105249_10710686 3300009553 Bacteria 1065
249 Ga0105249_11170778 3300009553 Unclassified 840
250 Ga0105035_105373 3300009988 Unclassified 1038
251 Ga0105239_10053150 3300010375 Bacteria 4444
252 Ga0105239_10346368 3300010375 Bacteria 1677
253 Ga0105239_11216887 3300010375 Bacteria 868
254 Ga0105239_12198351 3300010375 Bacteria 641
255 Ga0105239_12536316 3300010375 Unclassified 598
256 Ga0105246_10012864 3300011119 Bacteria 5234
257 Ga0105246_10040416 3300011119 Bacteria 3147
258 Ga0105246_10162168 3300011119 Bacteria 1704
259 Ga0157371_10027723 3300013102 Bacteria 4106
260 Ga0157370_10025664 3300013104 Bacteria 5830
261 Ga0157370_10205779 3300013104 Bacteria 1825
262 Ga0157369_10069466 3300013105 Bacteria 3784
263 Ga0157369_10148213 3300013105 Bacteria 2481
264 Ga0157369_12121682 3300013105 Bacteria 570
265 Ga0157374_12211206 3300013296 Bacteria 577
266 Ga0157378_10099522 3300013297 Bacteria 2653
267 Ga0157378_12670550 3300013297 Bacteria 552
268 Ga0163162_10214861 3300013306 Bacteria 2053
269 Ga0163162_10354739 3300013306 Bacteria 1599
270 Ga0163162_10528127 3300013306 Bacteria 1309
271 Ga0157372_10051543 3300013307 Bacteria 4581
272 Ga0157372_10729895 3300013307 Bacteria 1152
273 Ga0157375_10306008 3300013308 Unclassified 1753
274 Ga0157375_10565070 3300013308 Bacteria 1298
275 Ga0157375_11999221 3300013308 Bacteria 689
276 Ga0157375_12313859 3300013308 Bacteria 641
277 Ga0157375_13330215 3300013308 Bacteria 535
278 Ga0163163_10051486 3300014325 Bacteria 4060
279 Ga0163163_12341025 3300014325 Unclassified 593
280 Ga0157380_10059377 3300014326 Bacteria 3052
281 Ga0157380_10144692 3300014326 Bacteria 2047
282 Ga0157380_10238703 3300014326 Bacteria 1637
283 Ga0157380_10888827 3300014326 Bacteria 916
284 Ga0157380_11899401 3300014326 Bacteria 656
285 Ga0182008_10278474 3300014497 Bacteria 870
286 Ga0157377_10640670 3300014745 Bacteria 763
287 Ga0157376_10222379 3300014969 Bacteria 1749
288 Ga0157376_11054875 3300014969 Bacteria 837
289 Ga0157376_12607770 3300014969 Unclassified 545
290 Ga0163161_10170332 3300017792 Bacteria 1665
291 Ga0207653_10102885 3300025885 Bacteria 1012
292 Ga0207682_10264184 3300025893 Bacteria 803
293 Ga0207642_11064305 3300025899 Unclassified 522
294 Ga0207710_10679884 3300025900 Bacteria 540
295 Ga0207688_10030603 3300025901 Bacteria 2969
296 Ga0207688_10270634 3300025901 Bacteria 1033
297 Ga0207647_10567915 3300025904 Bacteria 628
298 Ga0207643_10015598 3300025908 Bacteria 4136
299 Ga0207643_10094685 3300025908 Bacteria 1745
300 Ga0207643_10383986 3300025908 Bacteria 886
301 Ga0207705_10033509 3300025909 Bacteria 3670
302 Ga0207654_10048191 3300025911 Bacteria 2437
303 Ga0207654_11433403 3300025911 Bacteria 504
304 Ga0207707_10000582 3300025912 Bacteria 37091
305 Ga0207707_10030337 3300025912 Bacteria 4730
306 Ga0207707_10104342 3300025912 Bacteria 2477
307 Ga0207707_10141199 3300025912 Bacteria 2106
308 Ga0207707_10191415 3300025912 Bacteria 1785
309 Ga0207707_10323175 3300025912 Bacteria 1332
310 Ga0207707_10371165 3300025912 Unclassified 1231
311 Ga0207707_10990929 3300025912 Bacteria 690
312 Ga0207707_11009592 3300025912 Unclassified 682
313 Ga0207660_10012873 3300025917 Bacteria 5477
314 Ga0207660_10015931 3300025917 Bacteria 4970
315 Ga0207660_10064435 3300025917 Bacteria 2645
316 Ga0207660_10510124 3300025917 Bacteria 976
317 Ga0207660_11316053 3300025917 Bacteria 587
318 Ga0207662_10116595 3300025918 Bacteria 1670
319 Ga0207657_10021633 3300025919 Bacteria 6046
320 Ga0207657_10135285 3300025919 Bacteria 2017
321 Ga0207657_10644674 3300025919 Unclassified 825
322 Ga0207657_10682167 3300025919 Bacteria 799
323 Ga0207652_10004959 3300025921 Bacteria 10782
324 Ga0207652_10837897 3300025921 Unclassified 815
325 Ga0207681_10055802 3300025923 Bacteria 2693
326 Ga0207681_10958824 3300025923 Bacteria 717
327 Ga0207681_11697489 3300025923 Bacteria 528
328 Ga0207694_10063948 3300025924 Bacteria 2867
329 Ga0207694_10343267 3300025924 Unclassified 1235
330 Ga0207694_10507525 3300025924 Bacteria 1010
331 Ga0207694_11700437 3300025924 Bacteria 531
332 Ga0207650_10934547 3300025925 Bacteria 737
333 Ga0207659_10412969 3300025926 Bacteria 1131
334 Ga0207659_11004091 3300025926 Bacteria 718
335 Ga0207687_10096947 3300025927 Bacteria 2162
336 Ga0207687_11691348 3300025927 Bacteria 542
337 Ga0207644_10535143 3300025931 Bacteria 969
338 Ga0207690_10615816 3300025932 Bacteria 887
339 Ga0207690_10631317 3300025932 Bacteria 876
340 Ga0207706_10036082 3300025933 Bacteria 4393
341 Ga0207706_10150165 3300025933 Bacteria 2049
342 Ga0207686_10213002 3300025934 Bacteria 1390
343 Ga0207686_11530481 3300025934 Bacteria 550
344 Ga0207709_10097817 3300025935 Bacteria 1934
345 Ga0207709_10122331 3300025935 Bacteria 1759
346 Ga0207709_10204763 3300025935 Bacteria 1412
347 Ga0207709_11009493 3300025935 Bacteria 680
348 Ga0207709_11344699 3300025935 Bacteria 591
349 Ga0207670_11151847 3300025936 Unclassified 656
350 Ga0207670_11295079 3300025936 Bacteria 618
351 Ga0207669_10028127 3300025937 Bacteria 3089
352 Ga0207669_10141941 3300025937 Bacteria 1669
353 Ga0207669_10383372 3300025937 Bacteria 1096
354 Ga0207669_10414842 3300025937 Bacteria 1058
355 Ga0207669_11428380 3300025937 Bacteria 589
356 Ga0207669_11652370 3300025937 Bacteria 547
357 Ga0207704_10191751 3300025938 Bacteria 1487
358 Ga0207691_10068902 3300025940 Bacteria 3196
359 Ga0207691_10125677 3300025940 Bacteria 2270
360 Ga0207711_10557441 3300025941 Bacteria 1069
361 Ga0207711_11712006 3300025941 Bacteria 572
362 Ga0207689_10089709 3300025942 Bacteria 2525
363 Ga0207689_10239819 3300025942 Bacteria 1499
364 Ga0207689_10613256 3300025942 Bacteria 916
365 Ga0207689_10854579 3300025942 Bacteria 768
366 Ga0207661_10168132 3300025944 Bacteria 1907
367 Ga0207661_11070446 3300025944 Bacteria 743
368 Ga0207661_11837484 3300025944 Unclassified 551
369 Ga0207679_10167946 3300025945 Bacteria 1803
370 Ga0207679_10218784 3300025945 Bacteria 1601
371 Ga0207679_10445218 3300025945 Bacteria 1148
372 Ga0207679_11371176 3300025945 Unclassified 649
373 Ga0207667_10901174 3300025949 Unclassified 876
374 Ga0207667_10913870 3300025949 Bacteria 869
375 Ga0207667_11076569 3300025949 Bacteria 788
376 Ga0207651_10338271 3300025960 Bacteria 1264
377 Ga0207712_10023018 3300025961 Bacteria 4108
378 Ga0207712_10961598 3300025961 Unclassified 757
379 Ga0207668_10024309 3300025972 Bacteria 3908
380 Ga0207668_10063083 3300025972 Bacteria 2613
381 Ga0207668_10100363 3300025972 Bacteria 2149
382 Ga0207668_10609292 3300025972 Bacteria 952
383 Ga0207640_11282329 3300025981 Bacteria 653
384 Ga0207640_11409018 3300025981 Bacteria 624
385 Ga0207658_10484723 3300025986 Bacteria 1099
386 Ga0207677_10127328 3300026023 Bacteria 1927
387 Ga0207677_10145170 3300026023 Bacteria 1822
388 Ga0207677_11012158 3300026023 Bacteria 754
389 Ga0207703_10949219 3300026035 Bacteria 824
390 Ga0207639_10024518 3300026041 Bacteria 4366
391 Ga0207639_10348575 3300026041 Bacteria 1322
392 Ga0207639_10432801 3300026041 Bacteria 1191
393 Ga0207639_10748999 3300026041 Bacteria 908
394 Ga0207678_10044918 3300026067 Bacteria 3821
395 Ga0207678_10183237 3300026067 Bacteria 1788
396 Ga0207678_10234417 3300026067 Bacteria 1572
397 Ga0207678_10574323 3300026067 Bacteria 987
398 Ga0207678_10763050 3300026067 Bacteria 853
399 Ga0207678_10910281 3300026067 Unclassified 778
400 Ga0207678_11372633 3300026067 Bacteria 625
401 Ga0207708_10001399 3300026075 Bacteria 18108
402 Ga0207708_10087186 3300026075 Bacteria 2403
403 Ga0207708_10103918 3300026075 Bacteria 2201
404 Ga0207708_10251993 3300026075 Bacteria 1423
405 Ga0207708_10608897 3300026075 Bacteria 926
406 Ga0207708_11203057 3300026075 Bacteria 662
407 Ga0207702_10052860 3300026078 Bacteria 3439
408 Ga0207702_10299496 3300026078 Bacteria 1526
409 Ga0207641_10131630 3300026088 Bacteria 2247
410 Ga0207641_10164075 3300026088 Bacteria 2022
411 Ga0207641_11717776 3300026088 Bacteria 630
412 Ga0207648_10635847 3300026089 Bacteria 985
413 Ga0207676_10003912 3300026095 Bacteria 10515
414 Ga0207676_10080910 3300026095 Bacteria 2638
415 Ga0207674_10001143 3300026116 Bacteria 34428
416 Ga0207675_100041267 3300026118 Bacteria 4309
417 Ga0207675_100048221 3300026118 Bacteria 3977
418 Ga0207675_100135123 3300026118 Unclassified 2339
419 Ga0207675_101488178 3300026118 Unclassified 698
420 Ga0207683_10053612 3300026121 Bacteria 3537
421 Ga0207683_10168119 3300026121 Bacteria 1985
422 Ga0207683_10362701 3300026121 Bacteria 1331
423 Ga0207683_10880818 3300026121 Bacteria 831
424 Ga0207698_10319495 3300026142 Bacteria 1453
425 Ga0207698_11032649 3300026142 Bacteria 833
426 Ga0209371_1088252 3300027312 Bacteria 526
427 Ga0209813_10013463 3300027866 Unclassified 2184
428 Ga0209813_10228284 3300027866 Bacteria 699
429 Ga0268266_10008617 3300028379 Bacteria 9057
430 Ga0268266_10119099 3300028379 Bacteria 2348
431 Ga0268266_10494045 3300028379 Bacteria 1168
432 Ga0268265_10000626 3300028380 Bacteria 35203
433 Ga0268265_10036784 3300028380 Bacteria 3588
434 Ga0268265_11065293 3300028380 Bacteria 801
435 Ga0268265_11425059 3300028380 Bacteria 695
436 Ga0268264_10003320 3300028381 Bacteria 13903
437 Ga0268264_11778713 3300028381 Bacteria 626
438 Ga0268256_1097476 3300030500 Bacteria 526
439 Ga0307408_101340466 3300031548 Bacteria 672
440 Ga0307405_10723144 3300031731 Bacteria 827
441 Ga0307413_10325848 3300031824 Bacteria 1175
442 Ga0307413_11901714 3300031824 Bacteria 534
443 Ga0307410_10055976 3300031852 Bacteria 2680
444 Ga0307410_10531599 3300031852 Bacteria 972
445 Ga0307410_11210545 3300031852 Bacteria 658
446 Ga0307406_10007814 3300031901 Bacteria 5949
447 Ga0307406_10118690 3300031901 Bacteria 1835
448 Ga0307407_10265865 3300031903 Bacteria 1182
449 Ga0307407_10567894 3300031903 Bacteria 841
450 Ga0307412_11399774 3300031911 Bacteria 633
451 Ga0307409_100003248 3300031995 Bacteria 8767
452 Ga0307409_100027346 3300031995 Bacteria 4040
453 Ga0307409_101467771 3300031995 Bacteria 709
454 Ga0307416_102331309 3300032002 Bacteria 635
455 Ga0307414_10412783 3300032004 Bacteria 1175
456 Ga0307411_11457571 3300032005 Bacteria 628
457 Ga0307411_11945905 3300032005 Bacteria 548
458 Ga0307415_100012409 3300032126 Bacteria 4926
459 Ga0307415_100071786 3300032126 Bacteria 2436
460 Ga0307415_100209505 3300032126 Bacteria 1554
461 Ga0373936_0360103 3300035113 Bacteria 663
462 Ga0373939_0455072 3300035114 Unclassified 539
463 Ga0373941_0168862 3300035115 Unclassified 814
464 Ga0373961_0012192 3300035241 Bacteria 2147
465 Ga0373961_0294112 3300035241 Bacteria 599
466 Ga0373931_0000324 3300035691 Bacteria 20133
467 Ga0373925_0135394 3300037068 Bacteria 1925
468 Ga0395899_0060742 3300037312 Bacteria 2784
469 Ga0395900_0020727 3300037418 Bacteria 6718
470 Ga0395900_0346047 3300037418 Bacteria 1461
471 Ga0395898_0003674 3300037466 Bacteria 17038
472 Ga0395905_0133717 3300037471 Bacteria 2333
473 Ga0395905_0465636 3300037471 Bacteria 1163
474 Ga0395905_1165290 3300037471 Bacteria 674
475 Ga0395901_0270420 3300038443 Bacteria 1768
476 Ga0395901_0339236 3300038443 Bacteria 1553
477 Ga0395901_0854541 3300038443 Bacteria 895
478 Ga0395901_1483482 3300038443 Bacteria 634
479 Ga0451787_007409 3300041441 Bacteria 567
480 Ga0451789_0738026 3300041443 Bacteria 627
481 Ga0451789_0923876 3300041443 Bacteria 599
482 Ga0451793_1234692 3300041452 Bacteria 1329
483 Ga0451797_1299792 3300041453 Bacteria 501
484 Ga0451795_0299550 3300041456 Bacteria 559
485 Ga0451798_1123436 3300041458 Unclassified 517
486 Ga0451802_2128099 3300041460 Bacteria 708
487 Ga0451807_0571173 3300041486 Bacteria 635
488 Ga0451807_1294539 3300041486 Bacteria 589
489 Ga0451807_1494924 3300041486 Bacteria 607
490 Ga0451807_2155322 3300041486 Bacteria 503
491 Ga0451807_2693519 3300041486 Unclassified 814
492 Ga0451833_0416748 3300041491 Bacteria 557
493 Ga0451837_0650742 3300041494 Bacteria 622
494 Ga0451841_1348048 3300041498 Unclassified 648
495 Ga0451845_0436157 3300041501 Bacteria 651
496 Ga0451843_1116658 3300041509 Bacteria 713
497 Ga0451853_2901402 3300041512 Bacteria 1043
498 Ga0439448_0303566 3300042005 Bacteria 567
499 Ga0439432_243951 3300042006 Bacteria 516
500 Ga0450894_015381 3300042131 Bacteria 1013
501 Ga0439446_0024012 3300042156 Bacteria 1737
502 Ga0439434_0360652 3300042435 Bacteria 508
503 Ga0453683_0379638 3300044673 Bacteria 910
504 Ga0466965_0058514 3300044683 Bacteria 1922
505 Ga0466957_0117044 3300044842 Bacteria 1696
506 Ga0466960_0217108 3300044901 Bacteria 1051
507 Ga0466967_0036885 3300045976 Bacteria 4178
508 Ga0495629_0217343 3300046459 Bacteria 1319
509 Ga0495632_0364017 3300046519 Bacteria 635
510 Ga0495587_0568915 3300046536 Bacteria 625
511 Ga0495635_0548676 3300046663 Bacteria 758
512 Ga0495600_0699478 3300046809 Bacteria 610
513 Ga0495581_0363512 3300047315 Bacteria 845
514 Ga0495604_0426369 3300047317 Bacteria 870
515 Ga0496100_0796125 3300048903 Bacteria 740
516 Ga0496100_1376768 3300048903 Bacteria 557
517 Ga0496101_0109131 3300048904 Bacteria 2081
518 Ga0496101_0291161 3300048904 Bacteria 1278
519 Ga0496102_0009559 3300048905 Bacteria 8340
520 Ga0496102_0039333 3300048905 Bacteria 4273
521 Ga0496102_0251716 3300048905 Bacteria 1666
522 Ga0496102_0848433 3300048905 Bacteria 836
523 Ga0496102_1295703 3300048905 Unclassified 648
524 Ga0496102_1756408 3300048905 Bacteria 538
525 Ga0496103_0036330 3300048906 Bacteria 3017
526 Ga0496103_0098712 3300048906 Unclassified 1847
527 Ga0496103_0161053 3300048906 Bacteria 1439
528 Ga0496103_0953668 3300048906 Bacteria 536
529 Ga0496104_0132289 3300048907 Bacteria 2396
530 Ga0496104_0659058 3300048907 Bacteria 955
531 Ga0496104_1091422 3300048907 Bacteria 702
532 Ga0496105_0052219 3300048908 Bacteria 3376
533 Ga0496105_0121824 3300048908 Bacteria 2151
534 Ga0496106_0042073 3300048909 Bacteria 3425
535 Ga0496106_0438092 3300048909 Bacteria 1050
536 Ga0496106_0723222 3300048909 Bacteria 793
537 Ga0496107_0011296 3300048910 Bacteria 6217
538 Ga0496107_0067379 3300048910 Bacteria 2597
539 Ga0496107_1094858 3300048910 Bacteria 576
540 Ga0496108_0040335 3300048911 Bacteria 3891
541 Ga0496108_1311453 3300048911 Unclassified 608
542 Ga0496109_0039540 3300048912 Bacteria 4269
543 Ga0496109_0336834 3300048912 Bacteria 1425
544 Ga0496109_0874317 3300048912 Bacteria 837
545 Ga0496109_1102814 3300048912 Bacteria 731
546 Ga0496109_1790395 3300048912 Bacteria 547
547 Ga0496110_0017647 3300048913 Bacteria 5967
548 Ga0496111_0307412 3300048914 Bacteria 1175
549 Ga0496112_0015803 3300048915 Bacteria 7052
550 Ga0496112_0016184 3300048915 Bacteria 6978
551 Ga0496114_0008572 3300048917 Bacteria 8102
552 Ga0496114_0040997 3300048917 Bacteria 3836
553 Ga0496114_1256416 3300048917 Bacteria 627
554 Ga0496114_1782755 3300048917 Bacteria 504
555 Ga0496115_0345469 3300048918 Bacteria 1214
556 Ga0496115_0549615 3300048918 Bacteria 923
557 Ga0496116_0000100 3300048919 Bacteria 194740
558 Ga0496116_0043510 3300048919 Bacteria 3058
559 Ga0496118_0059604 3300048921 Bacteria 2840
560 Ga0496119_0019768 3300048922 Bacteria 4940
561 Ga0496119_0585542 3300048922 Bacteria 509
562 Ga0496120_0052116 3300048923 Bacteria 2332
563 Ga0496121_0000001 3300048924 Bacteria 1830318
564 Ga0496121_0358017 3300048924 Bacteria 970
565 Ga0496121_0678993 3300048924 Bacteria 623
566 Ga0496122_0003647 3300048925 Bacteria 20021
567 Ga0496122_0008413 3300048925 Bacteria 11146
568 Ga0496122_0158319 3300048925 Bacteria 1385
569 Ga0496122_0164361 3300048925 Bacteria 1348
570 Ga0496122_0314577 3300048925 Bacteria 836
571 Ga0496123_0000517 3300048926 Bacteria 67322
572 Ga0496123_0076793 3300048926 Bacteria 2054
573 Ga0496123_0226076 3300048926 Bacteria 940
574 Ga0496124_0015675 3300048927 Bacteria 7250
575 Ga0496124_0107810 3300048927 Bacteria 2247
576 Ga0496125_0000001 3300048928 Bacteria 1766138
577 Ga0496125_0000713 3300048928 Bacteria 54953
578 Ga0496126_0000094 3300048929 Bacteria 208184
579 Ga0496126_0561186 3300048929 Bacteria 904
580 Ga0496126_0628342 3300048929 Bacteria 843
581 Ga0501300_023806 3300049523 Bacteria 896
582 Ga0501031_0000010 3300049568 Bacteria 146435
583 Ga0501031_0002408 3300049568 Bacteria 11893
584 Ga0501031_0006171 3300049568 Bacteria 7824
585 Ga0501031_0093978 3300049568 Bacteria 1957
586 Ga0501031_0121925 3300049568 Bacteria 1703
587 Ga0501032_0000023 3300049569 Bacteria 146435
588 Ga0501032_0038284 3300049569 Bacteria 3267
589 Ga0501032_0038787 3300049569 Bacteria 3242
590 Ga0501032_0082015 3300049569 Bacteria 2146
591 Ga0501033_0000104 3300049570 Bacteria 81029
592 Ga0501033_0004294 3300049570 Bacteria 11449
593 Ga0501033_0007428 3300049570 Bacteria 8537
594 Ga0501033_0214291 3300049570 Bacteria 1373
595 Ga0501033_0237615 3300049570 Bacteria 1293
596 Ga0501033_0364429 3300049570 Bacteria 1011
597 Ga0501033_0434097 3300049570 Bacteria 914
598 Ga0501034_0000116 3300049571 Bacteria 146442
599 Ga0501034_0073146 3300049571 Bacteria 3436
600 Ga0501034_0076906 3300049571 Bacteria 3344
601 Ga0501034_0139192 3300049571 Bacteria 2407
602 Ga0501034_0194349 3300049571 Bacteria 1990
603 Ga0501034_0204182 3300049571 Bacteria 1933
604 Ga0501034_0208416 3300049571 Bacteria 1910
605 Ga0501034_0407536 3300049571 Bacteria 1282
606 Ga0501036_0000015 3300049572 Bacteria 146442
607 Ga0501036_0039590 3300049572 Bacteria 3988
608 Ga0501036_0043249 3300049572 Bacteria 3814
609 Ga0501036_0206600 3300049572 Bacteria 1651
610 Ga0501036_0522077 3300049572 Bacteria 987
611 Ga0501037_0000023 3300049573 Bacteria 146542
612 Ga0501037_0004454 3300049573 Bacteria 10172
613 Ga0501037_0015413 3300049573 Bacteria 5624
614 Ga0501037_0029303 3300049573 Bacteria 4067
615 Ga0501037_0349858 3300049573 Bacteria 1020
616 Ga0501038_0000025 3300049574 Bacteria 146542
617 Ga0501038_0023114 3300049574 Bacteria 5562
618 Ga0501038_0087169 3300049574 Bacteria 2621
619 Ga0501038_0095352 3300049574 Bacteria 2485
620 Ga0501038_0134187 3300049574 Bacteria 2030
621 Ga0501038_0208276 3300049574 Bacteria 1566
622 Ga0501039_0000037 3300049575 Bacteria 122286
623 Ga0501039_0053240 3300049575 Bacteria 3131
624 Ga0501039_0266770 3300049575 Bacteria 1346
625 Ga0501039_0740038 3300049575 Bacteria 768
626 Ga0501040_0005598 3300049576 Bacteria 8116
627 Ga0501040_0389412 3300049576 Bacteria 1000
628 Ga0501041_0137308 3300049577 Bacteria 1524
629 Ga0501041_0260106 3300049577 Bacteria 1091
630 Ga0501042_0006985 3300049578 Bacteria 7369
631 Ga0501042_0226930 3300049578 Bacteria 1347
632 Ga0501042_0333915 3300049578 Bacteria 1096
633 Ga0501042_1124383 3300049578 Bacteria 573
634 Ga0501043_0000070 3300049579 Bacteria 89839
635 Ga0501043_0017343 3300049579 Bacteria 5647
636 Ga0501043_0083685 3300049579 Bacteria 2508
637 Ga0501043_0398702 3300049579 Bacteria 1040
638 Ga0501043_0414385 3300049579 Bacteria 1016
639 Ga0501043_0498715 3300049579 Bacteria 910
640 Ga0501043_0592366 3300049579 Bacteria 820
641 Ga0501046_0039644 3300049580 Bacteria 3770
642 Ga0501046_0103078 3300049580 Bacteria 2187
643 Ga0501046_0116579 3300049580 Bacteria 2035
644 Ga0501046_0478553 3300049580 Bacteria 893
645 Ga0501047_0001244 3300049581 Bacteria 25242
646 Ga0501047_0025205 3300049581 Bacteria 5714
647 Ga0501047_0122146 3300049581 Bacteria 2486
648 Ga0501047_0284741 3300049581 Bacteria 1497
649 Ga0501047_0452411 3300049581 Bacteria 1113
650 Ga0501047_0512479 3300049581 Bacteria 1026
651 Ga0501048_1044042 3300049582 Bacteria 588
652 Ga0501048_1079766 3300049582 Bacteria 577
653 Ga0501067_0424955 3300049583 Bacteria 742
654 Ga0501068_0023785 3300049584 Bacteria 3593
655 Ga0501068_0528692 3300049584 Bacteria 766
656 Ga0501069_0080090 3300049585 Bacteria 1839
657 Ga0501070_0047983 3300049586 Bacteria 3548
658 Ga0501070_0073374 3300049586 Bacteria 2831
659 Ga0501070_0076324 3300049586 Bacteria 2774
660 Ga0501070_0186288 3300049586 Bacteria 1707
661 Ga0501070_0803663 3300049586 Bacteria 738
662 Ga0501070_1134270 3300049586 Bacteria 602
663 Ga0501071_0031594 3300049587 Bacteria 3755
664 Ga0501071_0083056 3300049587 Bacteria 2347
665 Ga0501071_1196037 3300049587 Bacteria 587
666 Ga0501073_0201448 3300049589 Bacteria 1376
667 Ga0501074_0245860 3300049590 Bacteria 1272
668 Ga0501074_0394119 3300049590 Bacteria 982
669 Ga0501074_0421783 3300049590 Bacteria 946
670 Ga0501074_0482451 3300049590 Bacteria 879
671 Ga0501075_0243164 3300049591 Bacteria 1372
672 Ga0501076_0093445 3300049592 Bacteria 2420
673 Ga0501076_0176205 3300049592 Bacteria 1743
674 Ga0501077_0407783 3300049593 Bacteria 869
675 Ga0501077_0744717 3300049593 Bacteria 630
676 Ga0501077_0918813 3300049593 Bacteria 563
677 Ga0501079_0183477 3300049741 Bacteria 1633
678 Ga0501080_0084392 3300049742 Bacteria 2951
679 Ga0501080_0110362 3300049742 Bacteria 2549
680 Ga0501080_0187004 3300049742 Bacteria 1904
681 Ga0501080_0891638 3300049742 Bacteria 776
682 Ga0501080_0985345 3300049742 Bacteria 732
683 Ga0501080_1000669 3300049742 Bacteria 725
684 Ga0501080_1037235 3300049742 Bacteria 710
685 Ga0501080_1212241 3300049742 Bacteria 648
686 Ga0501081_0089620 3300049743 Bacteria 2162
687 Ga0501081_0252915 3300049743 Bacteria 1287
688 Ga0501083_0347970 3300049744 Bacteria 964
689 Ga0501083_0428470 3300049744 Bacteria 861
690 Ga0501083_0570771 3300049744 Bacteria 736
691 Ga0501083_0847682 3300049744 Bacteria 595
692 Ga0501280_001054 3300049776 Bacteria 5606
693 Ga0501280_112724 3300049776 Bacteria 533
694 Ga0501282_003196 3300049778 Bacteria 1768
695 Ga0501035_0000074 3300049822 Bacteria 122269
696 Ga0501035_0008072 3300049822 Bacteria 9810
697 Ga0501035_0054537 3300049822 Bacteria 3572
698 Ga0501035_0066879 3300049822 Bacteria 3189
699 Ga0501035_0230153 3300049822 Bacteria 1580
700 Ga0501035_0265749 3300049822 Bacteria 1453
701 Ga0501044_0000069 3300049823 Bacteria 125974
702 Ga0501044_0030874 3300049823 Bacteria 5643
703 Ga0501044_0099811 3300049823 Bacteria 2921
704 Ga0501044_0108035 3300049823 Bacteria 2793
705 Ga0501044_0192500 3300049823 Bacteria 2001
706 Ga0501044_0202925 3300049823 Bacteria 1940
707 Ga0501044_0509090 3300049823 Bacteria 1104
708 Ga0501044_0836155 3300049823 Bacteria 798
709 Ga0501044_0931967 3300049823 Bacteria 742
710 Ga0501045_0103639 3300049824 Bacteria 2107
711 Ga0501045_0164076 3300049824 Bacteria 1654
712 Ga0501045_0438656 3300049824 Bacteria 971
713 nmdc:mga03683_30478_c1 3300050489 Unclassified 2158
714 nmdc:mga03n38_157042_c1 3300050490 Bacteria 1149
715 nmdc:mga03n38_24061_c1 3300050490 Unclassified 2486
716 nmdc:mga00v17_5790_c1 3300050491 Bacteria 6527
717 nmdc:mga0yw44_138138_c1 3300050492 Bacteria 1582
718 nmdc:mga0yw44_169194_c1 3300050492 Bacteria 1434
719 nmdc:mga0yw44_224437_c1 3300050492 Unclassified 1246
720 nmdc:mga0yw44_4246_c1 3300050492 Bacteria 4153
721 nmdc:mga0yw44_583868_c1 3300050492 Bacteria 759
722 nmdc:mga0yw44_696899_c1 3300050492 Bacteria 690
723 nmdc:mga0yw44_828363_c1 3300050492 Bacteria 628
724 nmdc:mga0k408_148904_c1 3300050493 Bacteria 1393
725 nmdc:mga0k408_220406_c1 3300050493 Bacteria 1132
726 nmdc:mga06z11_110892_c1 3300050494 Bacteria 1519
727 nmdc:mga06z11_341823_c1 3300050494 Bacteria 895
728 nmdc:mga06z11_883595_c1 3300050494 Bacteria 545
729 nmdc:mga06z11_9784_c1 3300050494 Bacteria 4053
730 nmdc:mga04h51_10906_c1 3300050495 Unclassified 2509
731 nmdc:mga04h51_259831_c1 3300050495 Bacteria 698
732 nmdc:mga07m45_27801_c2 3300050496 Bacteria 1355
733 nmdc:mga07m45_37513_c1 3300050496 Unclassified 2703
734 nmdc:mga07m45_590160_c1 3300050496 Bacteria 642
735 nmdc:mga07m45_904608_c1 3300050496 Unclassified 505
736 nmdc:mga0qj67_1199774_c1 3300050509 Bacteria 590
737 nmdc:mga0qj67_26058_c1 3300050509 Bacteria 4525
738 nmdc:mga0qj67_354997_c1 3300050509 Bacteria 1185
739 nmdc:mga06r32_26679_c1 3300050510 Bacteria 5389
740 nmdc:mga06r32_946660_c1 3300050510 Bacteria 816
741 nmdc:mga0n895_39998_c1 3300050512 Bacteria 4554
742 nmdc:mga08x19_1190915_c1 3300050514 Unclassified 540
743 nmdc:mga0a205_18086_c1 3300050515 Bacteria 6621
744 nmdc:mga0sz30_330859_c1 3300050516 Bacteria 680
745 nmdc:mga0sz30_80476_c1 3300050516 Unclassified 1409
746 Ga0500641_0016481 3300053096 Bacteria 2752
747 Ga0500556_0000039 3300053104 Bacteria 138158
748 Ga0500572_020801 3300053111 Bacteria 1731
749 Ga0500603_238306 3300053150 Bacteria 583
750 Ga0500636_0000006 3300053177 Bacteria 183899
751 Ga0500636_0129561 3300053177 Bacteria 1407
752 Ga0501084_1246404 3300054114 Bacteria 624
753 Ga0501082_0000006 3300060353 Bacteria 127786
754 Ga0501082_0080879 3300060353 Bacteria 2804
755 Ga0501082_0385566 3300060353 Bacteria 1223
756 Ga0530510_0062570 3300061734 Bacteria 2694
757 Ga0530510_0849547 3300061734 Bacteria 697
758 Ga0530510_1044026 3300061734 Unclassified 626
759 2508731125 2508501050 Bacteria 9633614
760 2535486473 2534681786 Bacteria 3308809
761 2599104605 2597490356 Bacteria 7030811
762 2643837794 2643221564 Bacteria 4193379
763 2643855215 2643221568 Bacteria 5187270
764 2644133095 2643221623 Bacteria 5239945
765 2739305873 2738543024 Bacteria 5603683
766 2757569368 2757320392 Bacteria 3737298
767 2842719657 2842718218 Bacteria 4560148
768 2844004668 2844002411 Bacteria 7168230
769 2846955462 2846952575 Bacteria 6587527
770 2848862659 2848858292 Bacteria 7391279
771 2854916674 2854911287 Bacteria 5582813
772 2894777199 2894772417 Bacteria 5305674
773 2915652453 2915650412 Bacteria 4288180
774 2919166786 2919166419 Bacteria 4952238
775 2919451995 2919450847 Bacteria 5631160
776 2929138719 2929138655 Bacteria 5810547
777 2974323725 2974320154 Bacteria 4571377
778 2977959128 2977957713 Bacteria 6877875
779 2978973202 2978969890 Bacteria 5400756
780 2984591450 2984587000 Bacteria 5263363
781 2996314958 2996310559 Bacteria 6357320
782 8001849919 8001845381 Bacteria 5804942
783 8054461231 8054460903 Bacteria 4872905
784 nmdc:mga00v17_848936_c1
785 rootL2_10338223
786 rootH1_10265339
787 rootH1_10398603
788 Ga0006562J51391_1006409
789 Ga0070658_10003488
790 Ga0070658_10165025
791 Ga0070658_11344707
792 Ga0070676_10676252
793 Ga0070676_11116586
794 Ga0070676_11125842
795 Ga0070683_100164491
796 Ga0070683_100352283
797 Ga0070683_100778266
798 Ga0070683_101269707
799 Ga0070670_100159351
800 Ga0070670_101666295
801 Ga0070677_10568362
802 Ga0068869_100014018
803 Ga0068869_100092905
804 Ga0068869_100398628
805 Ga0068869_100469553
806 Ga0070680_100014420
807 Ga0070680_100020613
808 Ga0070680_100135813
809 Ga0070680_100491888
810 Ga0070682_100072965
811 Ga0068868_101181358
812 Ga0068868_101457717
813 Ga0070660_100392741
814 Ga0070660_100943870
815 Ga0070660_100951606
816 Ga0070689_100830760
817 Ga0070689_100919737
818 Ga0070689_101184725
819 Ga0070691_10289947
820 Ga0070691_10307286
821 Ga0070687_100100854
822 Ga0070687_100422112
823 Ga0070661_100010269
824 Ga0070692_10022193
825 Ga0070692_10371920
826 Ga0070668_100076893
827 Ga0070668_100256201
828 Ga0070668_101099378
829 Ga0070668_101347115
830 Ga0070668_102052173
831 Ga0070669_100089827
832 Ga0070669_101686263
833 Ga0070675_100641029
834 Ga0070671_100359625
835 Ga0070671_100942040
836 Ga0070674_100490005
837 Ga0070674_100581297
838 Ga0070674_100994053
839 Ga0070673_101641297
840 Ga0070659_100127702
841 Ga0070667_100101024
842 Ga0070667_101721521
843 Ga0070703_10019779
844 Ga0070701_10674312
845 Ga0070705_100000901
846 Ga0070705_100124782
847 Ga0070700_100001924
848 Ga0070700_100417194
849 Ga0070700_100500283
850 Ga0070700_101890338
851 Ga0070694_100001405
852 Ga0070694_100173731
853 Ga0070708_100016481
854 Ga0070663_100038744
855 Ga0070663_100065164
856 Ga0070663_100198443
857 Ga0070663_100260723
858 Ga0070663_100274613
859 Ga0070663_100716772
860 Ga0070663_101582407
861 Ga0070663_101624389
862 Ga0070678_100054493
863 Ga0070678_100078226
864 Ga0070678_100574215
865 Ga0070678_100738069
866 Ga0070678_101125785
867 Ga0070662_100300943
868 Ga0070662_101456942
869 Ga0070681_10006828
870 Ga0070681_10013475
871 Ga0070681_10106659
872 Ga0070681_10174999
873 Ga0070681_10477645
874 Ga0070681_10583248
875 Ga0070681_10587353
876 Ga0068867_100072516
877 Ga0068867_101643178
878 Ga0070685_10416578
879 Ga0070685_11444812
880 Ga0070706_100029463
881 Ga0070707_100525423
882 Ga0070698_100017908
883 Ga0070699_100015194
884 Ga0070679_100028734
885 Ga0070679_100338546
886 Ga0070679_100680238
887 Ga0070679_100918268
888 Ga0070679_101653465
889 Ga0070679_101717838
890 Ga0070684_100189099
891 Ga0070684_101079299
892 Ga0070697_100009532
893 Ga0068853_100242692
894 Ga0070672_100098034
895 Ga0070672_100152234
896 Ga0070672_101619603
897 Ga0070672_101910417
898 Ga0070686_101345841
899 Ga0070695_100000158
900 Ga0070696_100233450
901 Ga0070693_100356129
902 Ga0070693_100486276
903 Ga0070693_100815878
904 Ga0070693_101005415
905 Ga0070665_100010765
906 Ga0070665_100081964
907 Ga0070665_100388894
908 Ga0070704_100008256
909 Ga0070704_100086648
910 Ga0068855_100067522
911 Ga0068855_100139229
912 Ga0068855_100408200
913 Ga0068855_100597169
914 Ga0068855_101111531
915 Ga0068855_101135554
916 Ga0068855_101216124
917 Ga0068855_102125797
918 Ga0070664_100118502
919 Ga0070664_100571187
920 Ga0070664_101117158
921 Ga0070664_101540017
922 Ga0068857_100009560
923 Ga0068857_100548081
924 Ga0068854_100509208
925 Ga0068856_101363028
926 Ga0070702_100016066
927 Ga0070702_101697119
928 Ga0068852_100392752
929 Ga0068852_100681505
930 Ga0068852_101875297
931 Ga0068859_100003502
932 Ga0068859_100194379
933 Ga0068859_102532578
934 Ga0068864_100025178
935 Ga0068864_100540208
936 Ga0068866_10721483
937 Ga0068866_10845806
938 Ga0068861_100023390
939 Ga0068861_100042905
940 Ga0068861_100221668
941 Ga0068870_10120828
942 Ga0068870_10159334
943 Ga0068870_10591421
944 Ga0068863_100107338
945 Ga0068863_100250601
946 Ga0068863_100329608
947 Ga0068858_100488445
948 Ga0068858_102056274
949 Ga0068860_100001841
950 Ga0068860_100080379
951 Ga0068862_100002731
952 Ga0068862_100017501
953 Ga0068862_100296142
954 Ga0068862_101976356
955 Ga0075365_10045106
956 Ga0075365_10076577
957 Ga0075365_10176951
958 Ga0075365_10448618
959 Ga0075365_10627213
960 Ga0075363_100114453
961 Ga0075363_100474799
962 Ga0075364_10016127
963 Ga0075364_10030113
964 Ga0075432_10059355
965 Ga0070715_10267802
966 Ga0075362_10045679
967 Ga0075362_10652552
968 Ga0075367_10030475
969 Ga0075367_10098355
970 Ga0075367_10933851
971 Ga0075369_10304711
972 Ga0075366_10021454
973 Ga0075366_11010888
974 Ga0097621_100330182
975 Ga0097621_101146284
976 Ga0097621_101272882
977 Ga0075370_10060801
978 Ga0075370_10335264
979 Ga0075370_10476437
980 Ga0068871_100358514
981 Ga0068871_100614064
982 Ga0068871_100806206
983 Ga0068871_101692096
984 Ga0075428_100251939
985 Ga0075428_101471530
986 Ga0075430_100009987
987 Ga0075430_100484328
988 Ga0075430_101409045
989 Ga0075431_100856752
990 Ga0075433_10018253
991 Ga0075434_100004344
992 Ga0075429_100744713
993 Ga0068865_100296126
994 Ga0068865_100340032
995 Ga0097620_100003500
996 Ga0097620_100194396
997 Ga0097620_102532335
998 Ga0075435_100198189
999 Ga0105244_10260307
1000 Ga0105244_10340994
1001 Ga0105240_10080457
1002 Ga0105240_11077991
1003 Ga0105240_11867774
1004 Ga0105240_11927442
1005 Ga0111539_10158996
1006 Ga0111539_11939178
1007 Ga0105245_10067879
1008 Ga0105245_10703437
1009 Ga0105245_11771471
1010 Ga0105245_13110375
1011 Ga0105247_10129646
1012 Ga0105247_10515956
1013 Ga0105243_10056569
1014 Ga0105243_10204910
1015 Ga0105243_11520150
1016 Ga0105241_10023704
1017 Ga0105241_10990175
1018 Ga0105241_11441256
1019 Ga0105242_10205554
1020 Ga0105242_12505360
1021 Ga0105248_10555022
1022 Ga0105248_11451535
1023 Ga0105237_10130058
1024 Ga0105237_11127746
1025 Ga0105237_12454848
1026 Ga0105238_10075653
1027 Ga0105238_10317910
1028 Ga0105238_10589408
1029 Ga0105238_12751765
1030 Ga0105249_10046892
1031 Ga0105249_10710686
1032 Ga0105249_11170778
1033 Ga0105035_105373
1034 Ga0105239_10053150
1035 Ga0105239_10346368
1036 Ga0105239_11216887
1037 Ga0105239_12198351
1038 Ga0105239_12536316
1039 Ga0105246_10012864
1040 Ga0105246_10040416
1041 Ga0105246_10162168
1042 Ga0157371_10027723
1043 Ga0157370_10025664
1044 Ga0157370_10205779
1045 Ga0157369_10069466
1046 Ga0157369_10148213
1047 Ga0157369_12121682
1048 Ga0157374_12211206
1049 Ga0157378_10099522
1050 Ga0157378_12670550
1051 Ga0163162_10214861
1052 Ga0163162_10354739
1053 Ga0163162_10528127
1054 Ga0157372_10051543
1055 Ga0157372_10729895
1056 Ga0157375_10306008
1057 Ga0157375_10565070
1058 Ga0157375_11999221
1059 Ga0157375_12313859
1060 Ga0157375_13330215
1061 Ga0163163_10051486
1062 Ga0163163_12341025
1063 Ga0157380_10059377
1064 Ga0157380_10144692
1065 Ga0157380_10238703
1066 Ga0157380_10888827
1067 Ga0157380_11899401
1068 Ga0182008_10278474
1069 Ga0157377_10640670
1070 Ga0157376_10222379
1071 Ga0157376_11054875
1072 Ga0157376_12607770
1073 Ga0163161_10170332
1074 Ga0207653_10102885
1075 Ga0207682_10264184
1076 Ga0207642_11064305
1077 Ga0207710_10679884
1078 Ga0207688_10030603
1079 Ga0207688_10270634
1080 Ga0207647_10567915
1081 Ga0207643_10015598
1082 Ga0207643_10094685
1083 Ga0207643_10383986
1084 Ga0207705_10033509
1085 Ga0207654_10048191
1086 Ga0207654_11433403
1087 Ga0207707_10000582
1088 Ga0207707_10030337
1089 Ga0207707_10104342
1090 Ga0207707_10141199
1091 Ga0207707_10191415
1092 Ga0207707_10323175
1093 Ga0207707_10371165
1094 Ga0207707_10990929
1095 Ga0207707_11009592
1096 Ga0207660_10012873
1097 Ga0207660_10015931
1098 Ga0207660_10064435
1099 Ga0207660_10510124
1100 Ga0207660_11316053
1101 Ga0207662_10116595
1102 Ga0207657_10021633
1103 Ga0207657_10135285
1104 Ga0207657_10644674
1105 Ga0207657_10682167
1106 Ga0207652_10004959
1107 Ga0207652_10837897
1108 Ga0207681_10055802
1109 Ga0207681_10958824
1110 Ga0207681_11697489
1111 Ga0207694_10063948
1112 Ga0207694_10343267
1113 Ga0207694_10507525
1114 Ga0207694_11700437
1115 Ga0207650_10934547
1116 Ga0207659_10412969
1117 Ga0207659_11004091
1118 Ga0207687_10096947
1119 Ga0207687_11691348
1120 Ga0207644_10535143
1121 Ga0207690_10615816
1122 Ga0207690_10631317
1123 Ga0207706_10036082
1124 Ga0207706_10150165
1125 Ga0207686_10213002
1126 Ga0207686_11530481
1127 Ga0207709_10097817
1128 Ga0207709_10122331
1129 Ga0207709_10204763
1130 Ga0207709_11009493
1131 Ga0207709_11344699
1132 Ga0207670_11151847
1133 Ga0207670_11295079
1134 Ga0207669_10028127
1135 Ga0207669_10141941
1136 Ga0207669_10383372
1137 Ga0207669_10414842
1138 Ga0207669_11428380
1139 Ga0207669_11652370
1140 Ga0207704_10191751
1141 Ga0207691_10068902
1142 Ga0207691_10125677
1143 Ga0207711_10557441
1144 Ga0207711_11712006
1145 Ga0207689_10089709
1146 Ga0207689_10239819
1147 Ga0207689_10613256
1148 Ga0207689_10854579
1149 Ga0207661_10168132
1150 Ga0207661_11070446
1151 Ga0207661_11837484
1152 Ga0207679_10167946
1153 Ga0207679_10218784
1154 Ga0207679_10445218
1155 Ga0207679_11371176
1156 Ga0207667_10901174
1157 Ga0207667_10913870
1158 Ga0207667_11076569
1159 Ga0207651_10338271
1160 Ga0207712_10023018
1161 Ga0207712_10961598
1162 Ga0207668_10024309
1163 Ga0207668_10063083
1164 Ga0207668_10100363
1165 Ga0207668_10609292
1166 Ga0207640_11282329
1167 Ga0207640_11409018
1168 Ga0207658_10484723
1169 Ga0207677_10127328
1170 Ga0207677_10145170
1171 Ga0207677_11012158
1172 Ga0207703_10949219
1173 Ga0207639_10024518
1174 Ga0207639_10348575
1175 Ga0207639_10432801
1176 Ga0207639_10748999
1177 Ga0207678_10044918
1178 Ga0207678_10183237
1179 Ga0207678_10234417
1180 Ga0207678_10574323
1181 Ga0207678_10763050
1182 Ga0207678_10910281
1183 Ga0207678_11372633
1184 Ga0207708_10001399
1185 Ga0207708_10087186
1186 Ga0207708_10103918
1187 Ga0207708_10251993
1188 Ga0207708_10608897
1189 Ga0207708_11203057
1190 Ga0207702_10052860
1191 Ga0207702_10299496
1192 Ga0207641_10131630
1193 Ga0207641_10164075
1194 Ga0207641_11717776
1195 Ga0207648_10635847
1196 Ga0207676_10003912
1197 Ga0207676_10080910
1198 Ga0207674_10001143
1199 Ga0207675_100041267
1200 Ga0207675_100048221
1201 Ga0207675_100135123
1202 Ga0207675_101488178
1203 Ga0207683_10053612
1204 Ga0207683_10168119
1205 Ga0207683_10362701
1206 Ga0207683_10880818
1207 Ga0207698_10319495
1208 Ga0207698_11032649
1209 Ga0209371_1088252
1210 Ga0209813_10013463
1211 Ga0209813_10228284
1212 Ga0268266_10008617
1213 Ga0268266_10119099
1214 Ga0268266_10494045
1215 Ga0268265_10000626
1216 Ga0268265_10036784
1217 Ga0268265_11065293
1218 Ga0268265_11425059
1219 Ga0268264_10003320
1220 Ga0268264_11778713
1221 Ga0268256_1097476
1222 Ga0307408_101340466
1223 Ga0307405_10723144
1224 Ga0307413_10325848
1225 Ga0307413_11901714
1226 Ga0307410_10055976
1227 Ga0307410_10531599
1228 Ga0307410_11210545
1229 Ga0307406_10007814
1230 Ga0307406_10118690
1231 Ga0307407_10265865
1232 Ga0307407_10567894
1233 Ga0307412_11399774
1234 Ga0307409_100003248
1235 Ga0307409_100027346
1236 Ga0307409_101467771
1237 Ga0307416_102331309
1238 Ga0307414_10412783
1239 Ga0307411_11457571
1240 Ga0307411_11945905
1241 Ga0307415_100012409
1242 Ga0307415_100071786
1243 Ga0307415_100209505
1244 Ga0373936_0360103
1245 Ga0373939_0455072
1246 Ga0373941_0168862
1247 Ga0373961_0012192
1248 Ga0373961_0294112
1249 Ga0373931_0000324
1250 Ga0373925_0135394
1251 Ga0395899_0060742
1252 Ga0395900_0020727
1253 Ga0395900_0346047
1254 Ga0395898_0003674
1255 Ga0395905_0133717
1256 Ga0395905_0465636
1257 Ga0395905_1165290
1258 Ga0395901_0270420
1259 Ga0395901_0339236
1260 Ga0395901_0854541
1261 Ga0395901_1483482
1262 Ga0451787_007409
1263 Ga0451789_0738026
1264 Ga0451789_0923876
1265 Ga0451793_1234692
1266 Ga0451797_1299792
1267 Ga0451795_0299550
1268 Ga0451798_1123436
1269 Ga0451802_2128099
1270 Ga0451807_0571173
1271 Ga0451807_1294539
1272 Ga0451807_1494924
1273 Ga0451807_2155322
1274 Ga0451807_2693519
1275 Ga0451833_0416748
1276 Ga0451837_0650742
1277 Ga0451841_1348048
1278 Ga0451845_0436157
1279 Ga0451843_1116658
1280 Ga0451853_2901402
1281 Ga0439448_0303566
1282 Ga0439432_243951
1283 Ga0450894_015381
1284 Ga0439446_0024012
1285 Ga0439434_0360652
1286 Ga0453683_0379638
1287 Ga0466965_0058514
1288 Ga0466957_0117044
1289 Ga0466960_0217108
1290 Ga0466967_0036885
1291 Ga0495629_0217343
1292 Ga0495632_0364017
1293 Ga0495587_0568915
1294 Ga0495635_0548676
1295 Ga0495600_0699478
1296 Ga0495581_0363512
1297 Ga0495604_0426369
1298 Ga0496100_0796125
1299 Ga0496100_1376768
1300 Ga0496101_0109131
1301 Ga0496101_0291161
1302 Ga0496102_0009559
1303 Ga0496102_0039333
1304 Ga0496102_0251716
1305 Ga0496102_0848433
1306 Ga0496102_1295703
1307 Ga0496102_1756408
1308 Ga0496103_0036330
1309 Ga0496103_0098712
1310 Ga0496103_0161053
1311 Ga0496103_0953668
1312 Ga0496104_0132289
1313 Ga0496104_0659058
1314 Ga0496104_1091422
1315 Ga0496105_0052219
1316 Ga0496105_0121824
1317 Ga0496106_0042073
1318 Ga0496106_0438092
1319 Ga0496106_0723222
1320 Ga0496107_0011296
1321 Ga0496107_0067379
1322 Ga0496107_1094858
1323 Ga0496108_0040335
1324 Ga0496108_1311453
1325 Ga0496109_0039540
1326 Ga0496109_0336834
1327 Ga0496109_0874317
1328 Ga0496109_1102814
1329 Ga0496109_1790395
1330 Ga0496110_0017647
1331 Ga0496111_0307412
1332 Ga0496112_0015803
1333 Ga0496112_0016184
1334 Ga0496114_0008572
1335 Ga0496114_0040997
1336 Ga0496114_1256416
1337 Ga0496114_1782755
1338 Ga0496115_0345469
1339 Ga0496115_0549615
1340 Ga0496116_0000100
1341 Ga0496116_0043510
1342 Ga0496118_0059604
1343 Ga0496119_0019768
1344 Ga0496119_0585542
1345 Ga0496120_0052116
1346 Ga0496121_0000001
1347 Ga0496121_0358017
1348 Ga0496121_0678993
1349 Ga0496122_0003647
1350 Ga0496122_0008413
1351 Ga0496122_0158319
1352 Ga0496122_0164361
1353 Ga0496122_0314577
1354 Ga0496123_0000517
1355 Ga0496123_0076793
1356 Ga0496123_0226076
1357 Ga0496124_0015675
1358 Ga0496124_0107810
1359 Ga0496125_0000001
1360 Ga0496125_0000713
1361 Ga0496126_0000094
1362 Ga0496126_0561186
1363 Ga0496126_0628342
1364 Ga0501300_023806
1365 Ga0501031_0000010
1366 Ga0501031_0002408
1367 Ga0501031_0006171
1368 Ga0501031_0093978
1369 Ga0501031_0121925
1370 Ga0501032_0000023
1371 Ga0501032_0038284
1372 Ga0501032_0038787
1373 Ga0501032_0082015
1374 Ga0501033_0000104
1375 Ga0501033_0004294
1376 Ga0501033_0007428
1377 Ga0501033_0214291
1378 Ga0501033_0237615
1379 Ga0501033_0364429
1380 Ga0501033_0434097
1381 Ga0501034_0000116
1382 Ga0501034_0073146
1383 Ga0501034_0076906
1384 Ga0501034_0139192
1385 Ga0501034_0194349
1386 Ga0501034_0204182
1387 Ga0501034_0208416
1388 Ga0501034_0407536
1389 Ga0501036_0000015
1390 Ga0501036_0039590
1391 Ga0501036_0043249
1392 Ga0501036_0206600
1393 Ga0501036_0522077
1394 Ga0501037_0000023
1395 Ga0501037_0004454
1396 Ga0501037_0015413
1397 Ga0501037_0029303
1398 Ga0501037_0349858
1399 Ga0501038_0000025
1400 Ga0501038_0023114
1401 Ga0501038_0087169
1402 Ga0501038_0095352
1403 Ga0501038_0134187
1404 Ga0501038_0208276
1405 Ga0501039_0000037
1406 Ga0501039_0053240
1407 Ga0501039_0266770
1408 Ga0501039_0740038
1409 Ga0501040_0005598
1410 Ga0501040_0389412
1411 Ga0501041_0137308
1412 Ga0501041_0260106
1413 Ga0501042_0006985
1414 Ga0501042_0226930
1415 Ga0501042_0333915
1416 Ga0501042_1124383
1417 Ga0501043_0000070
1418 Ga0501043_0017343
1419 Ga0501043_0083685
1420 Ga0501043_0398702
1421 Ga0501043_0414385
1422 Ga0501043_0498715
1423 Ga0501043_0592366
1424 Ga0501046_0039644
1425 Ga0501046_0103078
1426 Ga0501046_0116579
1427 Ga0501046_0478553
1428 Ga0501047_0001244
1429 Ga0501047_0025205
1430 Ga0501047_0122146
1431 Ga0501047_0284741
1432 Ga0501047_0452411
1433 Ga0501047_0512479
1434 Ga0501048_1044042
1435 Ga0501048_1079766
1436 Ga0501067_0424955
1437 Ga0501068_0023785
1438 Ga0501068_0528692
1439 Ga0501069_0080090
1440 Ga0501070_0047983
1441 Ga0501070_0073374
1442 Ga0501070_0076324
1443 Ga0501070_0186288
1444 Ga0501070_0803663
1445 Ga0501070_1134270
1446 Ga0501071_0031594
1447 Ga0501071_0083056
1448 Ga0501071_1196037
1449 Ga0501073_0201448
1450 Ga0501074_0245860
1451 Ga0501074_0394119
1452 Ga0501074_0421783
1453 Ga0501074_0482451
1454 Ga0501075_0243164
1455 Ga0501076_0093445
1456 Ga0501076_0176205
1457 Ga0501077_0407783
1458 Ga0501077_0744717
1459 Ga0501077_0918813
1460 Ga0501079_0183477
1461 Ga0501080_0084392
1462 Ga0501080_0110362
1463 Ga0501080_0187004
1464 Ga0501080_0891638
1465 Ga0501080_0985345
1466 Ga0501080_1000669
1467 Ga0501080_1037235
1468 Ga0501080_1212241
1469 Ga0501081_0089620
1470 Ga0501081_0252915
1471 Ga0501083_0347970
1472 Ga0501083_0428470
1473 Ga0501083_0570771
1474 Ga0501083_0847682
1475 Ga0501280_001054
1476 Ga0501280_112724
1477 Ga0501282_003196
1478 Ga0501035_0000074
1479 Ga0501035_0008072
1480 Ga0501035_0054537
1481 Ga0501035_0066879
1482 Ga0501035_0230153
1483 Ga0501035_0265749
1484 Ga0501044_0000069
1485 Ga0501044_0030874
1486 Ga0501044_0099811
1487 Ga0501044_0108035
1488 Ga0501044_0192500
1489 Ga0501044_0202925
1490 Ga0501044_0509090
1491 Ga0501044_0836155
1492 Ga0501044_0931967
1493 Ga0501045_0103639
1494 Ga0501045_0164076
1495 Ga0501045_0438656
1496 nmdc:mga03683_30478_c1
1497 nmdc:mga03n38_157042_c1
1498 nmdc:mga03n38_24061_c1
1499 nmdc:mga00v17_5790_c1
1500 nmdc:mga0yw44_138138_c1
1501 nmdc:mga0yw44_169194_c1
1502 nmdc:mga0yw44_224437_c1
1503 nmdc:mga0yw44_4246_c1
1504 nmdc:mga0yw44_583868_c1
1505 nmdc:mga0yw44_696899_c1
1506 nmdc:mga0yw44_828363_c1
1507 nmdc:mga0k408_148904_c1
1508 nmdc:mga0k408_220406_c1
1509 nmdc:mga06z11_110892_c1
1510 nmdc:mga06z11_341823_c1
1511 nmdc:mga06z11_883595_c1
1512 nmdc:mga06z11_9784_c1
1513 nmdc:mga04h51_10906_c1
1514 nmdc:mga04h51_259831_c1
1515 nmdc:mga07m45_27801_c2
1516 nmdc:mga07m45_37513_c1
1517 nmdc:mga07m45_590160_c1
1518 nmdc:mga07m45_904608_c1
1519 nmdc:mga0qj67_1199774_c1
1520 nmdc:mga0qj67_26058_c1
1521 nmdc:mga0qj67_354997_c1
1522 nmdc:mga06r32_26679_c1
1523 nmdc:mga06r32_946660_c1
1524 nmdc:mga0n895_39998_c1
1525 nmdc:mga08x19_1190915_c1
1526 nmdc:mga0a205_18086_c1
1527 nmdc:mga0sz30_330859_c1
1528 nmdc:mga0sz30_80476_c1
1529 Ga0500641_0016481
1530 Ga0500556_0000039
1531 Ga0500572_020801
1532 Ga0500603_238306
1533 Ga0500636_0000006
1534 Ga0500636_0129561
1535 Ga0501084_1246404
1536 Ga0501082_0000006
1537 Ga0501082_0080879
1538 Ga0501082_0385566
1539 Ga0530510_0062570
1540 Ga0530510_0849547
1541 Ga0530510_1044026
1542 2508731125
1543 2535486473
1544 2599104605
1545 2643837794
1546 2643855215
1547 2644133095
1548 2739305873
1549 2757569368
1550 2842719657
1551 2844004668
1552 2846955462
1553 2848862659
1554 2854916674
1555 2894777199
1556 2915652453
1557 2919166786
1558 2919451995
1559 2929138719
1560 2974323725
1561 2977959128
1562 2978973202
1563 2984591450
1564 2996314958
1565 8001849919
1566 8054461231

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04066

MrpF_PhaF

Multiple resistance and pH regulation protein F (MrpF / PhaF)

52

104

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zme-assembly1.cif.gz_6 cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 2) - membrane arm 0.9605 11 87
7d3u-assembly1.cif.gz_A structure of mrp complex from dietzia sp. dq12-45-1b 0.9565 15 82
6cfw-assembly1.cif.gz_D cryoem structure of a respiratory membrane-bound hydrogenase 0.9465 9 74
7p63-assembly1.cif.gz_J complex i from e. coli, ddm/lmng-purified, under turnover at ph 6, closed state 0.9453 10 87
7zdh-assembly1.cif.gz_J complex i from ovis aries at ph7.4, closed state 0.9408 13 84
ID Description Score Start End Superfamily
af_Q9XK79_1_97_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9515 13 84 1.10.287.3510
5xtdk00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9151 10 80 1.10.287.3510
af_P03901_1_98_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9131 10 89 1.10.287.3510
6g72K00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8907 13 89 1.10.287.3510
4he8K00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8823 12 84 1.10.287.3510
ID Description Score Start End GO Terms
AF-A0A350WPA1-F1-model_v4 Cation:proton antiporter 0.9872 1 84 GO:0005886
GO:0015385
AF-A0A4U6R5H1-F1-model_v4 pH regulation protein F 0.9809 7 82 GO:0005886
GO:0015385
AF-A0A6B1G8P7-F1-model_v4 Cation transporter 0.9789 1 83 GO:0005886
GO:0015385
AF-A0A424YWX2-F1-model_v4 Cation:proton antiporter 0.9746 8 84 GO:0005886
GO:0015385
AF-A0A7W1SNR3-F1-model_v4 K+/H+ antiporter subunit F 0.9736 5 78 GO:0005886
GO:0015385

Map