F480693

General Info

Members Datasets Scaffolds Average Seq Length
784 350 747 68

Family's Representative Sequence

Representative Sequence 3300025294|Ga0209025_1003012|Ga0209025_10030126
Length 71
Sequence MTIIVNIDVMLAKRKMSVTELSERIGITMANLSILKNGKAIRLSTLETICKALECQPGDVLEYRLDEDKPD

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
3 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
4 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
5 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
6 2738543010 Bacillus sp. YR335 Isolate Unclassified
7 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
8 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
9 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
10 2842682962 Bacillus sp. R-72492 Isolate Unclassified
11 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
12 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
13 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
14 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
15 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
16 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
17 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
18 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
19 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
20 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
21 2965761152 Bacillus sp. COPE52 Isolate Unclassified
22 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
23 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
24 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
25 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
26 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
27 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
28 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
29 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
30 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
31 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
32 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
33 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
34 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
37 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
63 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
64 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
67 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
68 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
73 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
74 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
75 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
76 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
77 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
78 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
79 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
80 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
81 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
82 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
83 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
84 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
85 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
86 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
90 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
93 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
94 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
95 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
98 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
104 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
105 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
106 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
107 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
108 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
109 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
110 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
111 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
112 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
113 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
114 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
115 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
117 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
118 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
119 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
120 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
121 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
122 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
123 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
124 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
126 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
127 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
128 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
129 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
130 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
132 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
133 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
134 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
135 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
136 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
137 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
138 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
139 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
140 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
141 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
142 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
143 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
144 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
145 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
146 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
147 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
148 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
149 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
150 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
151 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
152 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
153 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
154 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
155 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
156 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
157 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
158 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
159 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
160 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
161 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
162 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
220 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
221 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
225 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
226 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
227 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
228 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
229 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
230 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
231 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
232 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
233 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
234 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
235 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
236 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
237 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
238 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
239 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
240 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
241 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
242 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
243 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
245 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
246 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
247 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
248 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
249 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
252 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
253 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
254 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
255 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
256 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
257 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
258 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
259 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
260 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
261 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
262 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
263 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
264 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
265 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
266 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
267 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
268 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
269 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
270 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
271 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
272 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
273 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
274 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
275 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
276 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
277 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
278 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
279 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
280 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
281 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
282 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
283 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
287 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
288 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
289 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
290 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
291 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
292 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
293 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
294 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
295 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
304 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
305 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
306 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
307 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
308 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
309 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
310 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
311 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
312 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
313 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
314 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
315 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
316 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
317 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
318 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
319 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
320 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
321 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
322 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
323 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
324 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
325 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
326 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
327 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
328 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
329 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
333 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
334 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
335 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
336 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
337 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
338 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
339 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
340 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
341 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
342 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
343 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
344 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
345 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
346 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
347 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
348 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
349 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
350 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.28
Metatranscriptomes 0
Isolates 4.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.83
Nodule 0
Rhizoplane 0.89
Rhizosphere 90.82
Stem 0
Stem Tuber 0
Unclassified 4.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_241812 2162886012 Bacteria 858
2 JGI24737J22298_10081403 3300001990 Unclassified 963
3 JGI24034J26672_10111614 3300002239 Bacteria 523
4 JGI25151J46595_10002839 3300003187 Bacteria 9978
5 JGI25406J46586_10270816 3300003203 Unclassified 501
6 Ga0065704_10156118 3300005289 Bacteria 1390
7 Ga0065712_10161230 3300005290 Bacteria 1301
8 Ga0065712_10658855 3300005290 Bacteria 564
9 Ga0065715_10298803 3300005293 Bacteria 1046
10 Ga0065715_10754867 3300005293 Bacteria 628
11 Ga0065715_11173411 3300005293 Bacteria 504
12 Ga0070658_10000503 3300005327 Bacteria 33889
13 Ga0070658_10199276 3300005327 Bacteria 1689
14 Ga0070658_10412436 3300005327 Bacteria 1161
15 Ga0070658_11133758 3300005327 Bacteria 680
16 Ga0070676_10170564 3300005328 Bacteria 1407
17 Ga0070683_100078503 3300005329 Bacteria 3088
18 Ga0070683_101245411 3300005329 Bacteria 715
19 Ga0070683_101566709 3300005329 Bacteria 633
20 Ga0070690_100229331 3300005330 Bacteria 1305
21 Ga0070690_100392192 3300005330 Bacteria 1017
22 Ga0070690_100443391 3300005330 Bacteria 961
23 Ga0070690_100644834 3300005330 Bacteria 808
24 Ga0070690_101388932 3300005330 Bacteria 565
25 Ga0070670_100087163 3300005331 Bacteria 2683
26 Ga0070670_100135395 3300005331 Bacteria 2129
27 Ga0070670_100256689 3300005331 Bacteria 1523
28 Ga0070670_100978334 3300005331 Bacteria 769
29 Ga0070677_10606825 3300005333 Bacteria 607
30 Ga0068869_100058007 3300005334 Bacteria 2829
31 Ga0068869_100902591 3300005334 Bacteria 765
32 Ga0068869_101008689 3300005334 Bacteria 725
33 Ga0068869_101245198 3300005334 Unclassified 655
34 Ga0068869_101258556 3300005334 Bacteria 652
35 Ga0068869_101312832 3300005334 Bacteria 638
36 Ga0068869_101807043 3300005334 Bacteria 547
37 Ga0070666_10023040 3300005335 Bacteria 4049
38 Ga0070666_10041127 3300005335 Bacteria 3088
39 Ga0070666_10745546 3300005335 Bacteria 720
40 Ga0070666_10767646 3300005335 Bacteria 709
41 Ga0070680_100169601 3300005336 Bacteria 1836
42 Ga0068868_100007182 3300005338 Bacteria 7914
43 Ga0068868_100084077 3300005338 Bacteria 2556
44 Ga0068868_100245120 3300005338 Bacteria 1507
45 Ga0068868_100308293 3300005338 Bacteria 1346
46 Ga0068868_100451833 3300005338 Bacteria 1118
47 Ga0068868_101564616 3300005338 Bacteria 619
48 Ga0068868_101635663 3300005338 Bacteria 606
49 Ga0070660_100539583 3300005339 Bacteria 972
50 Ga0070660_101946979 3300005339 Bacteria 501
51 Ga0070689_100162330 3300005340 Bacteria 1807
52 Ga0070689_100787178 3300005340 Bacteria 836
53 Ga0070687_100668791 3300005343 Bacteria 722
54 Ga0070687_100721512 3300005343 Unclassified 698
55 Ga0070661_100393111 3300005344 Bacteria 1095
56 Ga0070661_100447023 3300005344 Bacteria 1028
57 Ga0070692_11316221 3300005345 Bacteria 519
58 Ga0070668_100072580 3300005347 Bacteria 2682
59 Ga0070668_100571823 3300005347 Bacteria 986
60 Ga0070669_100256170 3300005353 Bacteria 1395
61 Ga0070669_100458594 3300005353 Bacteria 1052
62 Ga0070675_100142727 3300005354 Bacteria 2048
63 Ga0070675_101329411 3300005354 Bacteria 662
64 Ga0070671_100086629 3300005355 Bacteria 2621
65 Ga0070671_100141336 3300005355 Bacteria 2031
66 Ga0070671_100271116 3300005355 Unclassified 1443
67 Ga0070671_100651167 3300005355 Bacteria 912
68 Ga0070671_100921460 3300005355 Bacteria 764
69 Ga0070671_100926429 3300005355 Bacteria 762
70 Ga0070671_101920160 3300005355 Bacteria 527
71 Ga0070673_100272930 3300005364 Bacteria 1481
72 Ga0070673_100452422 3300005364 Bacteria 1155
73 Ga0070673_100912714 3300005364 Bacteria 815
74 Ga0070673_101911421 3300005364 Bacteria 563
75 Ga0070688_100314494 3300005365 Bacteria 1136
76 Ga0070659_100458799 3300005366 Bacteria 1082
77 Ga0070659_100844934 3300005366 Bacteria 798
78 Ga0070667_100002793 3300005367 Bacteria 15077
79 Ga0070667_100472457 3300005367 Bacteria 1147
80 Ga0070667_100769227 3300005367 Bacteria 893
81 Ga0070667_100838710 3300005367 Bacteria 854
82 Ga0070667_101465580 3300005367 Bacteria 641
83 Ga0070714_100610352 3300005435 Bacteria 1048
84 Ga0070714_101594768 3300005435 Bacteria 637
85 Ga0070714_101937831 3300005435 Unclassified 575
86 Ga0070713_101186234 3300005436 Bacteria 739
87 Ga0070713_101310604 3300005436 Bacteria 702
88 Ga0070710_10795186 3300005437 Bacteria 675
89 Ga0070701_11346104 3300005438 Bacteria 512
90 Ga0070711_100935608 3300005439 Bacteria 741
91 Ga0070711_102060764 3300005439 Bacteria 502
92 Ga0070705_100564675 3300005440 Bacteria 875
93 Ga0070694_100437190 3300005444 Bacteria 1031
94 Ga0070708_100501364 3300005445 Bacteria 1145
95 Ga0070663_101027599 3300005455 Bacteria 718
96 Ga0070678_101503567 3300005456 Bacteria 631
97 Ga0070678_101532508 3300005456 Bacteria 625
98 Ga0070662_100747599 3300005457 Unclassified 829
99 Ga0070662_100770288 3300005457 Bacteria 817
100 Ga0070662_101421206 3300005457 Bacteria 598
101 Ga0070681_10047881 3300005458 Bacteria 4273
102 Ga0070706_100576250 3300005467 Bacteria 1046
103 Ga0070707_100827780 3300005468 Bacteria 890
104 Ga0070698_100444719 3300005471 Bacteria 1231
105 Ga0070698_100768311 3300005471 Unclassified 907
106 Ga0070698_101955161 3300005471 Unclassified 539
107 Ga0070699_100724340 3300005518 Bacteria 909
108 Ga0070699_101808808 3300005518 Bacteria 559
109 Ga0070679_101022291 3300005530 Bacteria 771
110 Ga0070679_101162553 3300005530 Bacteria 717
111 Ga0070679_101260278 3300005530 Bacteria 685
112 Ga0070679_101841671 3300005530 Bacteria 554
113 Ga0070684_100335819 3300005535 Bacteria 1389
114 Ga0070684_101967143 3300005535 Bacteria 552
115 Ga0070697_101053202 3300005536 Bacteria 723
116 Ga0068853_100497642 3300005539 Bacteria 1150
117 Ga0068853_100574938 3300005539 Bacteria 1069
118 Ga0068853_101140503 3300005539 Bacteria 752
119 Ga0068853_101716384 3300005539 Bacteria 609
120 Ga0068853_102269131 3300005539 Unclassified 526
121 Ga0070672_100471518 3300005543 Bacteria 1083
122 Ga0070686_100116096 3300005544 Bacteria 1831
123 Ga0070686_100334751 3300005544 Bacteria 1133
124 Ga0070686_100871072 3300005544 Bacteria 731
125 Ga0070686_101125407 3300005544 Bacteria 649
126 Ga0070686_101474628 3300005544 Bacteria 573
127 Ga0070695_100088704 3300005545 Bacteria 2060
128 Ga0070695_100573088 3300005545 Bacteria 883
129 Ga0070696_100157241 3300005546 Bacteria 1672
130 Ga0070696_100744212 3300005546 Bacteria 803
131 Ga0070665_101154780 3300005548 Bacteria 785
132 Ga0070665_101178301 3300005548 Bacteria 777
133 Ga0070704_100528738 3300005549 Bacteria 1027
134 Ga0070704_100672590 3300005549 Bacteria 916
135 Ga0070704_101260875 3300005549 Bacteria 675
136 Ga0070704_101449384 3300005549 Bacteria 631
137 Ga0068855_100957890 3300005563 Bacteria 901
138 Ga0068855_101213315 3300005563 Bacteria 784
139 Ga0070664_100008130 3300005564 Bacteria 8480
140 Ga0070664_100129041 3300005564 Bacteria 2220
141 Ga0070664_100973139 3300005564 Bacteria 797
142 Ga0068857_100011013 3300005577 Bacteria 7874
143 Ga0068857_100199292 3300005577 Bacteria 1825
144 Ga0068857_101398863 3300005577 Bacteria 680
145 Ga0068857_102523641 3300005577 Bacteria 505
146 Ga0068854_100003839 3300005578 Bacteria 9412
147 Ga0068854_101155293 3300005578 Unclassified 692
148 Ga0068854_101543184 3300005578 Bacteria 604
149 Ga0068856_100012947 3300005614 Bacteria 8075
150 Ga0068856_100081781 3300005614 Bacteria 3205
151 Ga0068856_100738087 3300005614 Bacteria 1005
152 Ga0070702_100284963 3300005615 Bacteria 1136
153 Ga0070702_101296198 3300005615 Bacteria 591
154 Ga0068852_100099507 3300005616 Bacteria 2621
155 Ga0068852_101421370 3300005616 Bacteria 716
156 Ga0068852_102224509 3300005616 Bacteria 570
157 Ga0068852_102835652 3300005616 Bacteria 503
158 Ga0068859_100004003 3300005617 Bacteria 15022
159 Ga0068859_100015657 3300005617 Bacteria 7621
160 Ga0068859_100094224 3300005617 Bacteria 3046
161 Ga0068859_100509971 3300005617 Bacteria 1298
162 Ga0068859_100521956 3300005617 Bacteria 1283
163 Ga0068864_100000699 3300005618 Bacteria 28153
164 Ga0068864_100001921 3300005618 Bacteria 17059
165 Ga0068864_100087203 3300005618 Bacteria 2747
166 Ga0068864_100317836 3300005618 Bacteria 1462
167 Ga0068864_100499037 3300005618 Bacteria 1170
168 Ga0068864_100894203 3300005618 Bacteria 877
169 Ga0068864_101495015 3300005618 Bacteria 678
170 Ga0068861_100007458 3300005719 Bacteria 7496
171 Ga0068861_101569281 3300005719 Bacteria 648
172 Ga0068851_10105119 3300005834 Bacteria 1502
173 Ga0068851_10207687 3300005834 Bacteria 1095
174 Ga0068851_10622565 3300005834 Bacteria 659
175 Ga0068870_10109067 3300005840 Bacteria 1577
176 Ga0068870_10369002 3300005840 Bacteria 926
177 Ga0068870_10484246 3300005840 Bacteria 822
178 Ga0068863_100003791 3300005841 Bacteria 14948
179 Ga0068863_101514157 3300005841 Bacteria 679
180 Ga0068863_101594252 3300005841 Bacteria 662
181 Ga0068863_101953137 3300005841 Bacteria 597
182 Ga0068863_102393114 3300005841 Bacteria 538
183 Ga0068863_102597047 3300005841 Bacteria 515
184 Ga0068858_100001364 3300005842 Bacteria 25143
185 Ga0068858_100144427 3300005842 Bacteria 2234
186 Ga0068858_100186935 3300005842 Bacteria 1957
187 Ga0068858_100523872 3300005842 Bacteria 1146
188 Ga0068858_100536136 3300005842 Bacteria 1133
189 Ga0068858_101700439 3300005842 Bacteria 623
190 Ga0068858_102178841 3300005842 Bacteria 548
191 Ga0068860_100001500 3300005843 Bacteria 25180
192 Ga0068860_100564665 3300005843 Bacteria 1141
193 Ga0068860_101300860 3300005843 Bacteria 748
194 Ga0068860_102234569 3300005843 Bacteria 568
195 Ga0068862_100026444 3300005844 Bacteria 4877
196 Ga0068862_100059474 3300005844 Bacteria 3282
197 Ga0068862_100313513 3300005844 Unclassified 1446
198 Ga0068862_101555128 3300005844 Bacteria 668
199 Ga0081455_10005340 3300005937 Bacteria 14111
200 Ga0081455_10037013 3300005937 Bacteria 4337
201 Ga0081455_10131971 3300005937 Unclassified 1952
202 Ga0081455_10292715 3300005937 Unclassified 1171
203 Ga0081540_1102018 3300005983 Bacteria 1233
204 Ga0081540_1133542 3300005983 Bacteria 1009
205 Ga0081539_10049991 3300005985 Bacteria 2368
206 Ga0070717_10027369 3300006028 Bacteria 4557
207 Ga0075365_10756325 3300006038 Unclassified 686
208 Ga0075363_100109992 3300006048 Bacteria 1531
209 Ga0075364_10269955 3300006051 Bacteria 1157
210 Ga0075432_10240260 3300006058 Bacteria 731
211 Ga0070712_100746246 3300006175 Bacteria 837
212 Ga0075367_10000350 3300006178 Bacteria 16471
213 Ga0075367_10095500 3300006178 Bacteria 1813
214 Ga0075367_10529334 3300006178 Bacteria 748
215 Ga0075367_11022751 3300006178 Bacteria 528
216 Ga0075369_10439111 3300006186 Bacteria 617
217 Ga0075366_10001505 3300006195 Bacteria 11630
218 Ga0075366_10028424 3300006195 Unclassified 3282
219 Ga0097621_100344160 3300006237 Unclassified 1324
220 Ga0097621_100508702 3300006237 Bacteria 1092
221 Ga0097621_101480867 3300006237 Bacteria 644
222 Ga0068871_100063008 3300006358 Bacteria 3032
223 Ga0068871_100092833 3300006358 Bacteria 2518
224 Ga0068871_100405498 3300006358 Bacteria 1215
225 Ga0068871_100684161 3300006358 Bacteria 939
226 Ga0075428_100874560 3300006844 Bacteria 954
227 Ga0075428_101930113 3300006844 Bacteria 613
228 Ga0075430_101531390 3300006846 Bacteria 548
229 Ga0075431_100085779 3300006847 Bacteria 3250
230 Ga0075433_10501135 3300006852 Bacteria 1069
231 Ga0075434_102509550 3300006871 Bacteria 517
232 Ga0068865_102087380 3300006881 Bacteria 515
233 Ga0075436_100551380 3300006914 Bacteria 846
234 Ga0097620_100004003 3300006931 Bacteria 15022
235 Ga0097620_100015657 3300006931 Bacteria 7621
236 Ga0097620_100094227 3300006931 Bacteria 3046
237 Ga0097620_100510046 3300006931 Bacteria 1298
238 Ga0097620_100521950 3300006931 Bacteria 1283
239 Ga0075435_100425468 3300007076 Bacteria 1144
240 Ga0099795_10620005 3300007788 Bacteria 516
241 Ga0105251_10138636 3300009011 Bacteria 1101
242 Ga0105250_10010924 3300009092 Bacteria 3776
243 Ga0105240_10537271 3300009093 Unclassified 1295
244 Ga0105240_10572622 3300009093 Bacteria 1247
245 Ga0105240_10638445 3300009093 Bacteria 1168
246 Ga0105240_12227336 3300009093 Bacteria 568
247 Ga0105240_12318175 3300009093 Bacteria 556
248 Ga0105240_12814343 3300009093 Bacteria 500
249 Ga0111539_10748300 3300009094 Bacteria 1138
250 Ga0111539_11502800 3300009094 Bacteria 781
251 Ga0105245_10024050 3300009098 Bacteria 5347
252 Ga0105245_10282147 3300009098 Bacteria 1624
253 Ga0105245_10340747 3300009098 Bacteria 1482
254 Ga0105245_10591288 3300009098 Bacteria 1135
255 Ga0105245_10751832 3300009098 Bacteria 1011
256 Ga0105245_11699014 3300009098 Bacteria 683
257 Ga0105245_11787038 3300009098 Bacteria 667
258 Ga0105247_10017863 3300009101 Bacteria 4255
259 Ga0105247_10033484 3300009101 Bacteria 3126
260 Ga0105247_10649482 3300009101 Bacteria 788
261 Ga0105247_11001755 3300009101 Bacteria 652
262 Ga0105247_11361303 3300009101 Bacteria 573
263 Ga0114129_10784244 3300009147 Bacteria 1217
264 Ga0114129_11667977 3300009147 Bacteria 779
265 Ga0114129_12642863 3300009147 Bacteria 599
266 Ga0105243_10875039 3300009148 Bacteria 892
267 Ga0105243_11103058 3300009148 Bacteria 802
268 Ga0105243_11121885 3300009148 Bacteria 796
269 Ga0105243_12534980 3300009148 Bacteria 552
270 Ga0105241_10088123 3300009174 Bacteria 2444
271 Ga0105241_10111985 3300009174 Bacteria 2186
272 Ga0105241_10295680 3300009174 Bacteria 1388
273 Ga0105242_10052792 3300009176 Bacteria 3318
274 Ga0105242_12560495 3300009176 Bacteria 559
275 Ga0105248_10005280 3300009177 Bacteria 14217
276 Ga0105248_10031481 3300009177 Bacteria 5930
277 Ga0105248_11053012 3300009177 Bacteria 919
278 Ga0105248_11088664 3300009177 Bacteria 903
279 Ga0105248_11755333 3300009177 Bacteria 704
280 Ga0105248_12211483 3300009177 Bacteria 626
281 Ga0105237_12056196 3300009545 Bacteria 580
282 Ga0105238_10014096 3300009551 Bacteria 8083
283 Ga0105238_10886559 3300009551 Unclassified 910
284 Ga0105238_10993710 3300009551 Bacteria 860
285 Ga0105238_11866223 3300009551 Bacteria 634
286 Ga0105249_10003155 3300009553 Bacteria 14257
287 Ga0105249_11036653 3300009553 Unclassified 890
288 Ga0105249_11210990 3300009553 Bacteria 826
289 Ga0105249_11549112 3300009553 Bacteria 735
290 Ga0105249_12306592 3300009553 Bacteria 611
291 Ga0105249_12904915 3300009553 Bacteria 550
292 Ga0105032_112054 3300009979 Bacteria 693
293 Ga0105147_108972 3300009982 Bacteria 849
294 Ga0105028_100449 3300009993 Bacteria 4422
295 Ga0105028_101043 3300009993 Bacteria 2925
296 Ga0105239_10026828 3300010375 Bacteria 6340
297 Ga0105239_10234893 3300010375 Bacteria 2057
298 Ga0105239_10652915 3300010375 Bacteria 1202
299 Ga0105239_11481683 3300010375 Unclassified 784
300 Ga0105239_12077686 3300010375 Bacteria 660
301 Ga0105239_13506989 3300010375 Bacteria 510
302 Ga0105246_10050003 3300011119 Bacteria 2866
303 Ga0105246_10562684 3300011119 Bacteria 979
304 Ga0105246_11250469 3300011119 Bacteria 686
305 Ga0105246_11727676 3300011119 Bacteria 595
306 Ga0157373_10027245 3300013100 Bacteria 4123
307 Ga0157373_10337199 3300013100 Unclassified 1074
308 Ga0157373_10859638 3300013100 Bacteria 671
309 Ga0157371_10144534 3300013102 Bacteria 1695
310 Ga0157371_10592633 3300013102 Bacteria 824
311 Ga0157370_10003091 3300013104 Bacteria 19703
312 Ga0157370_10129075 3300013104 Unclassified 2359
313 Ga0157370_10409557 3300013104 Unclassified 1248
314 Ga0157370_10638133 3300013104 Bacteria 974
315 Ga0157370_11549961 3300013104 Bacteria 595
316 Ga0157369_10090313 3300013105 Bacteria 3270
317 Ga0157369_10194244 3300013105 Bacteria 2132
318 Ga0157369_10350564 3300013105 Bacteria 1533
319 Ga0157369_10787378 3300013105 Bacteria 977
320 Ga0157369_10795951 3300013105 Bacteria 971
321 Ga0157369_11424394 3300013105 Bacteria 705
322 Ga0157369_12304133 3300013105 Bacteria 546
323 Ga0157369_12484025 3300013105 Bacteria 525
324 Ga0157374_10000651 3300013296 Bacteria 30638
325 Ga0157374_10010838 3300013296 Bacteria 7866
326 Ga0157374_10012997 3300013296 Bacteria 7258
327 Ga0157374_10381809 3300013296 Bacteria 1403
328 Ga0157374_10382606 3300013296 Bacteria 1402
329 Ga0157374_10775673 3300013296 Bacteria 974
330 Ga0157374_10896486 3300013296 Bacteria 904
331 Ga0157374_10933704 3300013296 Bacteria 886
332 Ga0157374_10959708 3300013296 Bacteria 874
333 Ga0157374_11792342 3300013296 Unclassified 639
334 Ga0157374_12140040 3300013296 Bacteria 586
335 Ga0157378_10016043 3300013297 Bacteria 6561
336 Ga0157378_10022421 3300013297 Bacteria 5559
337 Ga0157378_10298955 3300013297 Bacteria 1557
338 Ga0157378_10492754 3300013297 Bacteria 1223
339 Ga0157378_10837221 3300013297 Bacteria 948
340 Ga0157378_10849249 3300013297 Bacteria 941
341 Ga0157378_11018339 3300013297 Bacteria 863
342 Ga0157378_11187585 3300013297 Bacteria 802
343 Ga0157378_11477792 3300013297 Bacteria 724
344 Ga0157378_11561909 3300013297 Bacteria 705
345 Ga0157378_12137939 3300013297 Bacteria 611
346 Ga0157378_12475139 3300013297 Bacteria 571
347 Ga0163162_10013461 3300013306 Bacteria 7984
348 Ga0163162_10119839 3300013306 Bacteria 2735
349 Ga0163162_10198693 3300013306 Bacteria 2134
350 Ga0163162_10836146 3300013306 Bacteria 1036
351 Ga0163162_11191862 3300013306 Bacteria 864
352 Ga0163162_11315797 3300013306 Bacteria 821
353 Ga0163162_12263718 3300013306 Bacteria 624
354 Ga0163162_13282939 3300013306 Bacteria 518
355 Ga0157372_10001400 3300013307 Bacteria 26003
356 Ga0157372_10276602 3300013307 Bacteria 1952
357 Ga0157372_11073579 3300013307 Bacteria 932
358 Ga0157372_11135566 3300013307 Bacteria 904
359 Ga0157372_11184058 3300013307 Bacteria 883
360 Ga0157372_11471805 3300013307 Unclassified 785
361 Ga0157375_10014421 3300013308 Bacteria 7050
362 Ga0157375_10015271 3300013308 Bacteria 6872
363 Ga0157375_10172707 3300013308 Bacteria 2310
364 Ga0157375_10688917 3300013308 Bacteria 1176
365 Ga0157375_11464537 3300013308 Bacteria 805
366 Ga0157375_13414869 3300013308 Bacteria 529
367 Ga0163163_10000140 3300014325 Bacteria 74966
368 Ga0163163_10000412 3300014325 Bacteria 40056
369 Ga0163163_10395622 3300014325 Bacteria 1440
370 Ga0163163_10646288 3300014325 Bacteria 1121
371 Ga0163163_10905750 3300014325 Bacteria 945
372 Ga0163163_11579672 3300014325 Bacteria 717
373 Ga0163163_12827877 3300014325 Bacteria 542
374 Ga0157380_13451536 3300014326 Bacteria 506
375 Ga0157377_10025131 3300014745 Bacteria 3174
376 Ga0157379_10010309 3300014968 Bacteria 8138
377 Ga0157379_10133912 3300014968 Bacteria 2232
378 Ga0157379_10234448 3300014968 Bacteria 1664
379 Ga0157379_10265734 3300014968 Bacteria 1560
380 Ga0157379_10381296 3300014968 Bacteria 1294
381 Ga0157376_10083065 3300014969 Bacteria 2754
382 Ga0157376_10096279 3300014969 Unclassified 2576
383 Ga0157376_11340603 3300014969 Bacteria 746
384 Ga0157376_12614354 3300014969 Bacteria 545
385 Ga0163161_10712248 3300017792 Bacteria 837
386 Ga0163161_10760959 3300017792 Bacteria 811
387 Ga0163161_11142916 3300017792 Bacteria 671
388 Ga0163161_11632194 3300017792 Bacteria 569
389 Ga0209025_1003012 3300025294 Bacteria 16658
390 Ga0207697_10094189 3300025315 Bacteria 1271
391 Ga0207697_10247743 3300025315 Unclassified 788
392 Ga0207697_10562651 3300025315 Bacteria 501
393 Ga0207656_10111536 3300025321 Bacteria 1264
394 Ga0207656_10223911 3300025321 Bacteria 915
395 Ga0207696_1014686 3300025711 Bacteria 2678
396 Ga0207642_10728983 3300025899 Bacteria 626
397 Ga0207710_10016171 3300025900 Bacteria 3156
398 Ga0207710_10018201 3300025900 Bacteria 2986
399 Ga0207688_10486369 3300025901 Bacteria 772
400 Ga0207680_10043146 3300025903 Bacteria 2643
401 Ga0207680_10108229 3300025903 Bacteria 1798
402 Ga0207680_10138914 3300025903 Bacteria 1609
403 Ga0207680_10810953 3300025903 Bacteria 671
404 Ga0207647_10012819 3300025904 Bacteria 5824
405 Ga0207685_10123871 3300025905 Bacteria 1138
406 Ga0207645_11144133 3300025907 Bacteria 524
407 Ga0207643_10088991 3300025908 Bacteria 1798
408 Ga0207643_10748674 3300025908 Bacteria 632
409 Ga0207705_10007203 3300025909 Bacteria 8192
410 Ga0207705_10993598 3300025909 Bacteria 648
411 Ga0207654_10807594 3300025911 Bacteria 678
412 Ga0207707_10114076 3300025912 Bacteria 2362
413 Ga0207707_10978585 3300025912 Bacteria 695
414 Ga0207695_10061162 3300025913 Bacteria 3894
415 Ga0207695_10841816 3300025913 Bacteria 797
416 Ga0207660_10326218 3300025917 Bacteria 1227
417 Ga0207660_11370930 3300025917 Bacteria 573
418 Ga0207662_10358055 3300025918 Bacteria 981
419 Ga0207662_10443483 3300025918 Bacteria 886
420 Ga0207662_10969643 3300025918 Bacteria 603
421 Ga0207657_11321500 3300025919 Bacteria 544
422 Ga0207649_10333712 3300025920 Unclassified 1118
423 Ga0207649_10634158 3300025920 Bacteria 824
424 Ga0207652_10844363 3300025921 Bacteria 811
425 Ga0207652_11005627 3300025921 Unclassified 733
426 Ga0207681_10074149 3300025923 Bacteria 2383
427 Ga0207681_11295325 3300025923 Bacteria 612
428 Ga0207694_10066924 3300025924 Bacteria 2803
429 Ga0207694_10984261 3300025924 Unclassified 714
430 Ga0207650_10181630 3300025925 Bacteria 1677
431 Ga0207650_10218070 3300025925 Unclassified 1534
432 Ga0207650_10594062 3300025925 Bacteria 930
433 Ga0207650_11508266 3300025925 Bacteria 571
434 Ga0207650_11842753 3300025925 Bacteria 511
435 Ga0207659_10255513 3300025926 Bacteria 1423
436 Ga0207659_10606940 3300025926 Bacteria 933
437 Ga0207687_10026842 3300025927 Bacteria 3859
438 Ga0207687_10154658 3300025927 Bacteria 1753
439 Ga0207700_10251859 3300025928 Bacteria 1509
440 Ga0207664_10835921 3300025929 Bacteria 828
441 Ga0207644_10021845 3300025931 Bacteria 4364
442 Ga0207644_10099645 3300025931 Bacteria 2181
443 Ga0207644_10338089 3300025931 Bacteria 1220
444 Ga0207644_11064009 3300025931 Bacteria 680
445 Ga0207644_11219072 3300025931 Bacteria 632
446 Ga0207706_11052936 3300025933 Bacteria 682
447 Ga0207706_11519886 3300025933 Bacteria 545
448 Ga0207706_11562093 3300025933 Bacteria 536
449 Ga0207686_10142853 3300025934 Bacteria 1657
450 Ga0207686_10383054 3300025934 Bacteria 1067
451 Ga0207670_10086769 3300025936 Bacteria 2203
452 Ga0207670_10124712 3300025936 Bacteria 1878
453 Ga0207670_10956363 3300025936 Bacteria 719
454 Ga0207669_11412727 3300025937 Bacteria 593
455 Ga0207704_10878767 3300025938 Bacteria 753
456 Ga0207704_10972932 3300025938 Bacteria 717
457 Ga0207691_11197353 3300025940 Unclassified 630
458 Ga0207711_10000307 3300025941 Bacteria 52746
459 Ga0207711_10197913 3300025941 Bacteria 1833
460 Ga0207711_10686948 3300025941 Bacteria 955
461 Ga0207711_11132845 3300025941 Bacteria 723
462 Ga0207711_11298347 3300025941 Bacteria 670
463 Ga0207711_11780069 3300025941 Bacteria 559
464 Ga0207689_10116560 3300025942 Bacteria 2196
465 Ga0207689_10343202 3300025942 Bacteria 1241
466 Ga0207689_10531405 3300025942 Bacteria 987
467 Ga0207689_11041444 3300025942 Bacteria 690
468 Ga0207661_10067519 3300025944 Bacteria 2909
469 Ga0207661_10143088 3300025944 Bacteria 2060
470 Ga0207679_10005785 3300025945 Bacteria 7762
471 Ga0207679_10065423 3300025945 Bacteria 2721
472 Ga0207679_11057354 3300025945 Bacteria 744
473 Ga0207679_11503905 3300025945 Bacteria 617
474 Ga0207667_10069308 3300025949 Bacteria 3671
475 Ga0207667_10637120 3300025949 Bacteria 1072
476 Ga0207667_11743067 3300025949 Bacteria 588
477 Ga0207651_10149806 3300025960 Bacteria 1814
478 Ga0207651_10348135 3300025960 Bacteria 1247
479 Ga0207651_11786524 3300025960 Bacteria 553
480 Ga0207651_12021311 3300025960 Bacteria 518
481 Ga0207712_10011723 3300025961 Bacteria 5589
482 Ga0207712_10029309 3300025961 Bacteria 3691
483 Ga0207712_10314705 3300025961 Bacteria 1289
484 Ga0207712_10550940 3300025961 Unclassified 992
485 Ga0207668_10086815 3300025972 Bacteria 2287
486 Ga0207668_10290440 3300025972 Bacteria 1345
487 Ga0207668_11234810 3300025972 Bacteria 672
488 Ga0207640_10033935 3300025981 Bacteria 3180
489 Ga0207640_10583083 3300025981 Unclassified 944
490 Ga0207640_10597757 3300025981 Bacteria 933
491 Ga0207640_11173914 3300025981 Bacteria 682
492 Ga0207658_10001500 3300025986 Bacteria 18142
493 Ga0207658_10311435 3300025986 Bacteria 1360
494 Ga0207677_10073284 3300026023 Bacteria 2424
495 Ga0207677_10294708 3300026023 Bacteria 1338
496 Ga0207677_10382922 3300026023 Bacteria 1188
497 Ga0207677_11282408 3300026023 Bacteria 672
498 Ga0207703_10005721 3300026035 Bacteria 9962
499 Ga0207703_10136675 3300026035 Bacteria 2122
500 Ga0207703_10174909 3300026035 Bacteria 1891
501 Ga0207703_10283935 3300026035 Bacteria 1504
502 Ga0207703_10442510 3300026035 Bacteria 1213
503 Ga0207703_10477614 3300026035 Bacteria 1168
504 Ga0207703_12141841 3300026035 Bacteria 535
505 Ga0207639_10363117 3300026041 Bacteria 1296
506 Ga0207639_10442726 3300026041 Bacteria 1178
507 Ga0207639_11682373 3300026041 Unclassified 595
508 Ga0207678_10656193 3300026067 Bacteria 922
509 Ga0207708_10670720 3300026075 Bacteria 884
510 Ga0207708_10931890 3300026075 Bacteria 753
511 Ga0207702_10009019 3300026078 Bacteria 8399
512 Ga0207702_10130275 3300026078 Bacteria 2263
513 Ga0207702_10680747 3300026078 Bacteria 1013
514 Ga0207702_11275604 3300026078 Bacteria 729
515 Ga0207702_11668010 3300026078 Unclassified 630
516 Ga0207641_10001412 3300026088 Bacteria 23683
517 Ga0207641_10058605 3300026088 Bacteria 3278
518 Ga0207641_10113016 3300026088 Bacteria 2410
519 Ga0207641_10718227 3300026088 Bacteria 985
520 Ga0207641_10774296 3300026088 Bacteria 948
521 Ga0207641_10873570 3300026088 Bacteria 892
522 Ga0207641_10946859 3300026088 Bacteria 856
523 Ga0207641_11874414 3300026088 Bacteria 601
524 Ga0207641_12159222 3300026088 Bacteria 557
525 Ga0207648_10270686 3300026089 Bacteria 1517
526 Ga0207648_10856826 3300026089 Bacteria 848
527 Ga0207676_10002011 3300026095 Bacteria 14810
528 Ga0207676_10046801 3300026095 Bacteria 3349
529 Ga0207676_10269508 3300026095 Bacteria 1541
530 Ga0207676_10921042 3300026095 Bacteria 858
531 Ga0207676_10938281 3300026095 Bacteria 850
532 Ga0207676_11633095 3300026095 Bacteria 642
533 Ga0207674_10000905 3300026116 Bacteria 38684
534 Ga0207674_10167732 3300026116 Bacteria 2149
535 Ga0207674_11142759 3300026116 Bacteria 748
536 Ga0207674_11663046 3300026116 Bacteria 607
537 Ga0207675_100016334 3300026118 Bacteria 6929
538 Ga0207675_100068024 3300026118 Bacteria 3330
539 Ga0207675_100895716 3300026118 Bacteria 903
540 Ga0207675_101204067 3300026118 Bacteria 778
541 Ga0207675_101383745 3300026118 Bacteria 724
542 Ga0207675_101429820 3300026118 Bacteria 712
543 Ga0207675_102747646 3300026118 Bacteria 500
544 Ga0207683_11002682 3300026121 Bacteria 775
545 Ga0207683_11024975 3300026121 Bacteria 766
546 Ga0207683_11841687 3300026121 Bacteria 554
547 Ga0207698_10052318 3300026142 Bacteria 3128
548 Ga0207698_11227259 3300026142 Bacteria 764
549 Ga0209813_10127343 3300027866 Bacteria 892
550 Ga0207428_10875236 3300027907 Bacteria 635
551 Ga0268266_11524383 3300028379 Bacteria 644
552 Ga0268265_10193074 3300028380 Bacteria 1760
553 Ga0268265_10588012 3300028380 Bacteria 1062
554 Ga0268265_11183290 3300028380 Bacteria 761
555 Ga0268265_11207806 3300028380 Bacteria 754
556 Ga0268264_10001167 3300028381 Bacteria 25555
557 Ga0268264_10065240 3300028381 Bacteria 3067
558 Ga0268264_10267320 3300028381 Bacteria 1596
559 Ga0268264_12393954 3300028381 Bacteria 534
560 Ga0268264_12394631 3300028381 Bacteria 534
561 Ga0316179_1070387 3300030734 Bacteria 9823
562 Ga0316183_1175878 3300030742 Bacteria 17011
563 Ga0316181_1060641 3300030744 Bacteria 622
564 Ga0316182_1132274 3300030745 Bacteria 2582
565 Ga0316182_1185667 3300030745 Bacteria 722
566 Ga0307513_10347931 3300031456 Bacteria 1231
567 Ga0307513_10689110 3300031456 Bacteria 728
568 Ga0307509_10036874 3300031507 Bacteria 5349
569 Ga0307408_100162823 3300031548 Bacteria 1773
570 Ga0307516_10280382 3300031730 Bacteria 1349
571 Ga0307405_10005875 3300031731 Bacteria 5976
572 Ga0307405_10120776 3300031731 Bacteria 1793
573 Ga0307413_10099064 3300031824 Bacteria 1920
574 Ga0307413_10177532 3300031824 Bacteria 1514
575 Ga0307413_10519951 3300031824 Unclassified 959
576 Ga0307413_10758610 3300031824 Bacteria 812
577 Ga0307410_10009191 3300031852 Bacteria 5530
578 Ga0307410_10047837 3300031852 Unclassified 2861
579 Ga0307410_11010409 3300031852 Bacteria 717
580 Ga0307410_11252994 3300031852 Bacteria 647
581 Ga0307406_10054133 3300031901 Unclassified 2560
582 Ga0307406_10760134 3300031901 Bacteria 814
583 Ga0307407_10308441 3300031903 Bacteria 1106
584 Ga0307407_10516863 3300031903 Bacteria 877
585 Ga0307407_11610536 3300031903 Bacteria 515
586 Ga0307412_10052660 3300031911 Bacteria 2696
587 Ga0307412_10055154 3300031911 Unclassified 2642
588 Ga0307412_10330856 3300031911 Unclassified 1216
589 Ga0307409_100174244 3300031995 Bacteria 1897
590 Ga0307409_100409525 3300031995 Unclassified 1297
591 Ga0307409_100442390 3300031995 Unclassified 1253
592 Ga0307409_101081727 3300031995 Bacteria 822
593 Ga0307409_102885840 3300031995 Bacteria 508
594 Ga0307416_101117802 3300032002 Bacteria 893
595 Ga0307416_101372137 3300032002 Bacteria 812
596 Ga0307416_101526986 3300032002 Unclassified 773
597 Ga0307414_10242421 3300032004 Bacteria 1493
598 Ga0307414_11896231 3300032004 Unclassified 556
599 Ga0307411_10216273 3300032005 Bacteria 1483
600 Ga0307411_10767803 3300032005 Bacteria 846
601 Ga0307411_11703893 3300032005 Unclassified 583
602 Ga0307411_12216140 3300032005 Bacteria 515
603 Ga0307415_100073574 3300032126 Bacteria 2411
604 Ga0307415_100084187 3300032126 Bacteria 2281
605 Ga0307415_100146132 3300032126 Unclassified 1813
606 Ga0307415_100400494 3300032126 Unclassified 1172
607 Ga0307415_102136572 3300032126 Bacteria 547
608 Ga0373923_0232869 3300035111 Bacteria 859
609 Ga0373955_0587812 3300035172 Bacteria 682
610 Ga0373933_0509509 3300035724 Bacteria 789
611 Ga0373937_0328105 3300036401 Bacteria 1448
612 Ga0395900_0110055 3300037418 Bacteria 2830
613 Ga0395898_0536127 3300037466 Bacteria 1112
614 Ga0395905_0092323 3300037471 Bacteria 2839
615 Ga0395901_0855182 3300038443 Bacteria 895
616 Ga0439436_0006432 3300041404 Bacteria 3608
617 Ga0439439_0004220 3300041406 Bacteria 3224
618 Ga0451797_0891978 3300041453 Bacteria 685
619 Ga0451807_1584278 3300041486 Bacteria 1069
620 Ga0451845_0238394 3300041501 Bacteria 570
621 Ga0451855_1054290 3300041511 Bacteria 558
622 Ga0439457_003541 3300042014 Bacteria 4238
623 Ga0451577_0114372 3300042876 Unclassified 2416
624 Ga0451577_1429898 3300042876 Unclassified 613
625 Ga0453683_0000035 3300044673 Bacteria 234280
626 Ga0453683_0033984 3300044673 Bacteria 3215
627 Ga0453683_0107942 3300044673 Unclassified 1750
628 Ga0453683_0271067 3300044673 Bacteria 1083
629 Ga0453683_0536856 3300044673 Bacteria 760
630 Ga0453684_0000128 3300044712 Bacteria 335864
631 Ga0453684_0052392 3300044712 Bacteria 5337
632 Ga0453684_0220157 3300044712 Bacteria 2199
633 Ga0451576_0002081 3300045051 Bacteria 31274
634 Ga0451576_0239300 3300045051 Bacteria 1896
635 Ga0451576_0658395 3300045051 Unclassified 1100
636 Ga0451576_0660059 3300045051 Bacteria 1099
637 Ga0451576_1065587 3300045051 Bacteria 846
638 Ga0451576_1196528 3300045051 Bacteria 794
639 Ga0451576_2048915 3300045051 Bacteria 589
640 Ga0495638_0237313 3300046460 Bacteria 1011
641 Ga0495650_0000006 3300046471 Bacteria 721347
642 Ga0495650_0042209 3300046471 Bacteria 1943
643 Ga0495584_0247089 3300046491 Bacteria 907
644 Ga0495606_0330341 3300046507 Bacteria 816
645 Ga0495608_0889861 3300046511 Bacteria 522
646 Ga0495616_0108921 3300046513 Bacteria 1289
647 Ga0495640_0730626 3300046533 Bacteria 593
648 Ga0495586_0673226 3300046535 Bacteria 598
649 Ga0495598_0020876 3300046537 Bacteria 1735
650 Ga0495598_0159068 3300046537 Bacteria 793
651 Ga0495597_0298992 3300046542 Bacteria 625
652 Ga0495645_0179284 3300046543 Bacteria 1453
653 Ga0495645_0475395 3300046543 Bacteria 785
654 Ga0495656_0198312 3300046615 Bacteria 995
655 Ga0495668_0787192 3300046616 Bacteria 527
656 Ga0495659_0177207 3300046664 Bacteria 867
657 Ga0495661_0276371 3300046665 Bacteria 848
658 Ga0495669_0145835 3300046684 Bacteria 1119
659 Ga0495670_0475673 3300046691 Bacteria 678
660 Ga0495649_0126177 3300046694 Bacteria 1352
661 Ga0495636_0276255 3300047318 Bacteria 782
662 Ga0495677_0250857 3300047445 Bacteria 692
663 Ga0495684_1077541 3300047471 Bacteria 505
664 Ga0495626_0037058 3300048091 Bacteria 2320
665 Ga0495626_0206489 3300048091 Bacteria 803
666 Ga0496109_0752630 3300048912 Bacteria 912
667 Ga0496109_1904097 3300048912 Bacteria 527
668 Ga0496112_0729904 3300048915 Bacteria 918
669 Ga0496115_1386511 3300048918 Unclassified 520
670 Ga0496117_0366720 3300048920 Bacteria 738
671 Ga0496119_0429408 3300048922 Bacteria 626
672 Ga0496120_0077948 3300048923 Bacteria 1803
673 Ga0496121_0000043 3300048924 Bacteria 341882
674 Ga0496122_0003743 3300048925 Bacteria 19623
675 Ga0496123_0026380 3300048926 Bacteria 4352
676 Ga0496123_0478382 3300048926 Bacteria 549
677 Ga0496125_0202025 3300048928 Bacteria 1300
678 Ga0496126_0000147 3300048929 Bacteria 163338
679 Ga0501034_0000246 3300049571 Bacteria 100202
680 Ga0501034_0054677 3300049571 Bacteria 4019
681 Ga0501034_1273291 3300049571 Bacteria 612
682 Ga0501037_0015422 3300049573 Bacteria 5622
683 Ga0501038_0033610 3300049574 Bacteria 4517
684 Ga0501038_0547193 3300049574 Bacteria 881
685 Ga0501038_1234583 3300049574 Bacteria 542
686 Ga0501039_0010227 3300049575 Bacteria 7149
687 Ga0501043_0008278 3300049579 Bacteria 8188
688 Ga0501046_0124302 3300049580 Bacteria 1961
689 Ga0501047_0007525 3300049581 Bacteria 10254
690 Ga0501048_0115774 3300049582 Bacteria 1894
691 Ga0501048_0963902 3300049582 Bacteria 614
692 Ga0501067_0044700 3300049583 Bacteria 2460
693 Ga0501072_0221303 3300049588 Bacteria 1508
694 Ga0501073_0000001 3300049589 Bacteria 677932
695 Ga0501073_0122609 3300049589 Bacteria 1801
696 Ga0501074_0139364 3300049590 Bacteria 1735
697 Ga0501077_0003701 3300049593 Bacteria 9197
698 Ga0501199_015872 3300049650 Bacteria 845
699 Ga0501207_012024 3300049654 Bacteria 1296
700 Ga0501233_119268 3300049668 Bacteria 712
701 Ga0501235_046307 3300049669 Bacteria 1001
702 Ga0501249_000072 3300049679 Bacteria 35371
703 Ga0501257_033308 3300049686 Bacteria 1248
704 Ga0501257_077793 3300049686 Bacteria 853
705 Ga0501259_113634 3300049688 Bacteria 636
706 Ga0501261_133231 3300049690 Unclassified 503
707 Ga0501225_0039216 3300049705 Unclassified 1305
708 Ga0501080_0019898 3300049742 Bacteria 6216
709 Ga0501080_0074841 3300049742 Bacteria 3150
710 Ga0501081_1022852 3300049743 Bacteria 625
711 Ga0501081_1251727 3300049743 Bacteria 562
712 Ga0501083_0018812 3300049744 Bacteria 4811
713 Ga0501083_0087030 3300049744 Bacteria 2066
714 Ga0501283_087991 3300049779 Bacteria 592
715 Ga0501283_133413 3300049779 Bacteria 506
716 Ga0501204_091885 3300049850 Bacteria 530
717 nmdc:mga03n38_157295_c1 3300050490 Bacteria 1148
718 nmdc:mga00v17_229780_c1 3300050491 Bacteria 1202
719 nmdc:mga0yw44_966333_c1 3300050492 Unclassified 577
720 nmdc:mga0k408_25140_c1 3300050493 Unclassified 3371
721 nmdc:mga0k408_92_c1 3300050493 Bacteria 42940
722 nmdc:mga06z11_394_c1 3300050494 Bacteria 16480
723 nmdc:mga06z11_430307_c1 3300050494 Bacteria 796
724 nmdc:mga06z11_73792_c1 3300050494 Bacteria 1812
725 nmdc:mga04h51_16905_c1 3300050495 Bacteria 2124
726 nmdc:mga05p37_11445_c1 3300050507 Bacteria 10564
727 nmdc:mga05p37_131822_c1 3300050507 Bacteria 3067
728 nmdc:mga05p37_191020_c1 3300050507 Bacteria 2486
729 nmdc:mga05p37_2245364_c1 3300050507 Bacteria 505
730 nmdc:mga06r32_97616_c1 3300050510 Bacteria 2879
731 nmdc:mga08y16_792497_c1 3300050511 Bacteria 941
732 nmdc:mga0n895_1779448_c1 3300050512 Bacteria 577
733 nmdc:mga0rr50_1771074_c1 3300050513 Bacteria 520
734 nmdc:mga0a205_294425_c1 3300050515 Bacteria 1497
735 nmdc:mga0sz30_383819_c1 3300050516 Bacteria 629
736 Ga0495601_0992390 3300053077 Bacteria 528
737 Ga0500644_0213290 3300053088 Bacteria 803
738 Ga0500641_0254615 3300053096 Bacteria 735
739 Ga0500562_104616 3300053108 Bacteria 771
740 Ga0500628_000704 3300053129 Bacteria 5970
741 Ga0500588_0251839 3300053146 Bacteria 663
742 Ga0500616_0062988 3300053153 Bacteria 1914
743 Ga0500627_0017659 3300053158 Unclassified 2808
744 Ga0501084_0194913 3300054114 Bacteria 1709
745 Ga0501082_0000018 3300060353 Bacteria 112794
746 Ga0501082_0546814 3300060353 Bacteria 1013
747 Ga0501082_1340075 3300060353 Bacteria 625

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044673 Ga0453683_0271067 Ga0453683_0271067_300_494 58
2 3300050492 nmdc:mga0yw44_966333_c1 nmdc:mga0yw44_966333_c1_22_225 58
3 iso_pu_bacteria 2904113452 2904119845 62
4 3300009176 Ga0105242_12560495 Ga0105242_125604951 63
5 iso_pu_bacteria 2512564039 2512733435 63
6 iso_pu_bacteria 2571042588 2573038951 63
7 iso_pu_bacteria 2585428157 2588108269 63
8 iso_pu_bacteria 2600255286 2601637100 63
9 iso_pu_bacteria 2738543010 2739230964 63
10 iso_pu_bacteria 2775507177 2777763420 63
11 iso_pu_bacteria 2808606364 2808867522 63
12 iso_pu_bacteria 2821111986 2821112946 63
13 iso_pu_bacteria 2842682962 2842687729 63
14 iso_pu_bacteria 2852673933 2852677255 63
15 iso_pu_bacteria 2857604169 2857608446 63
16 iso_pu_bacteria 2865002811 2865008705 63
17 iso_pu_bacteria 2907202186 2907203611 63
18 iso_pu_bacteria 2929233124 2929236644 63
19 iso_pu_bacteria 2929239360 2929244456 63
20 iso_pu_bacteria 2936340661 2936343429 63
21 iso_pu_bacteria 2946033335 2946036562 63
22 iso_pu_bacteria 2964375228 2964379618 63
23 iso_pu_bacteria 2965761152 2965764646 63
24 iso_pu_bacteria 2968558590 2968565047 63
25 iso_pu_bacteria 2971403814 2971406530 63
26 iso_pu_bacteria 2971410472 2971416742 63
27 iso_pu_bacteria 2971511577 2971513674 63
28 iso_pu_bacteria 2971511577 2971513685 63
29 iso_pu_bacteria 2979083700 2979086984 63
30 iso_pu_bacteria 2980176882 2980178517 63
31 iso_pu_bacteria 2988225383 2988226760 63
32 iso_pu_bacteria 3006826541 3006827517 63
33 iso_pu_bacteria 3006978542 3006983350 63
34 iso_pu_bacteria 8002317523 8002318843 63
35 iso_pu_bacteria 8022948649 8022949325 63
36 iso_pu_bacteria 8022948649 8022950463 63
37 iso_pu_bacteria 8054280661 8054284278 63
38 iso_pu_bacteria 8054465665 8054469890 63
39 iso_pu_bacteria 8056533031 8056536993 63
40 iso_pu_bacteria 8057977335 8057981765 63
41 3300013297 Ga0157378_12137939 Ga0157378_121379391 64
42 3300003187 JGI25151J46595_10002839 JGI25151J46595_100028399 65
43 3300005331 Ga0070670_100256689 Ga0070670_1002566892 65
44 3300005564 Ga0070664_100129041 Ga0070664_1001290412 65
45 3300005842 Ga0068858_101700439 Ga0068858_1017004392 65
46 3300005844 Ga0068862_100313513 Ga0068862_1003135132 65
47 3300005983 Ga0081540_1133542 Ga0081540_11335422 65
48 3300006844 Ga0075428_101930113 Ga0075428_1019301131 65
49 3300009177 Ga0105248_10031481 Ga0105248_100314812 65
50 3300011119 Ga0105246_10562684 Ga0105246_105626842 65
51 3300013297 Ga0157378_10016043 Ga0157378_100160438 65
52 3300014968 Ga0157379_10265734 Ga0157379_102657341 65
53 3300025294 Ga0209025_1003012 Ga0209025_10030126 65
54 3300025903 Ga0207680_10138914 Ga0207680_101389141 65
55 3300025907 Ga0207645_11144133 Ga0207645_111441331 65
56 3300025925 Ga0207650_10594062 Ga0207650_105940622 65
57 3300025941 Ga0207711_10197913 Ga0207711_101979132 65
58 3300025941 Ga0207711_11298347 Ga0207711_112983472 65
59 3300025945 Ga0207679_11057354 Ga0207679_110573542 65
60 3300026035 Ga0207703_10442510 Ga0207703_104425102 65
61 3300026118 Ga0207675_102747646 Ga0207675_1027476462 65
62 3300028380 Ga0268265_10193074 Ga0268265_101930742 65
63 3300031507 Ga0307509_10036874 Ga0307509_100368744 65
64 3300042876 Ga0451577_1429898 Ga0451577_1429898_232_432 65
65 3300050513 nmdc:mga0rr50_1771074_c1 nmdc:mga0rr50_1771074_c1_110_310 65
66 3300005289 Ga0065704_10156118 Ga0065704_101561182 66
67 3300005329 Ga0070683_101245411 Ga0070683_1012454112 66
68 3300005330 Ga0070690_100644834 Ga0070690_1006448341 66
69 3300005353 Ga0070669_100458594 Ga0070669_1004585942 66
70 3300005364 Ga0070673_101911421 Ga0070673_1019114211 66
71 3300005366 Ga0070659_100844934 Ga0070659_1008449341 66
72 3300005367 Ga0070667_101465580 Ga0070667_1014655801 66
73 3300005438 Ga0070701_11346104 Ga0070701_113461041 66
74 3300005445 Ga0070708_100501364 Ga0070708_1005013644 66
75 3300005455 Ga0070663_101027599 Ga0070663_1010275992 66
76 3300005471 Ga0070698_101955161 Ga0070698_1019551611 66
77 3300005518 Ga0070699_101808808 Ga0070699_1018088082 66
78 3300005544 Ga0070686_101125407 Ga0070686_1011254072 66
79 3300005545 Ga0070695_100088704 Ga0070695_1000887041 66
80 3300005545 Ga0070695_100573088 Ga0070695_1005730881 66
81 3300005546 Ga0070696_100744212 Ga0070696_1007442121 66
82 3300005615 Ga0070702_101296198 Ga0070702_1012961982 66
83 3300005617 Ga0068859_100509971 Ga0068859_1005099711 66
84 3300005841 Ga0068863_102393114 Ga0068863_1023931142 66
85 3300005937 Ga0081455_10037013 Ga0081455_100370132 66
86 3300005937 Ga0081455_10292715 Ga0081455_102927152 66
87 3300006048 Ga0075363_100109992 Ga0075363_1001099923 66
88 3300006178 Ga0075367_10529334 Ga0075367_105293341 66
89 3300006186 Ga0075369_10439111 Ga0075369_104391111 66
90 3300006846 Ga0075430_101531390 Ga0075430_1015313901 66
91 3300006931 Ga0097620_100510046 Ga0097620_1005100461 66
92 3300009094 Ga0111539_11502800 Ga0111539_115028002 66
93 3300009098 Ga0105245_11699014 Ga0105245_116990141 66
94 3300009101 Ga0105247_11001755 Ga0105247_110017551 66
95 3300009551 Ga0105238_11866223 Ga0105238_118662231 66
96 3300009553 Ga0105249_11210990 Ga0105249_112109901 66
97 3300009553 Ga0105249_11549112 Ga0105249_115491122 66
98 3300010375 Ga0105239_13506989 Ga0105239_135069892 66
99 3300011119 Ga0105246_11250469 Ga0105246_112504692 66
100 3300013296 Ga0157374_12140040 Ga0157374_121400401 66
101 3300013297 Ga0157378_10492754 Ga0157378_104927541 66
102 3300013297 Ga0157378_11187585 Ga0157378_111875852 66
103 3300013297 Ga0157378_11561909 Ga0157378_115619092 66
104 3300013306 Ga0163162_11191862 Ga0163162_111918621 66
105 3300013308 Ga0157375_13414869 Ga0157375_134148691 66
106 3300014325 Ga0163163_10395622 Ga0163163_103956222 66
107 3300014968 Ga0157379_10234448 Ga0157379_102344482 66
108 3300017792 Ga0163161_10760959 Ga0163161_107609591 66
109 3300017792 Ga0163161_11142916 Ga0163161_111429162 66
110 3300025903 Ga0207680_10810953 Ga0207680_108109532 66
111 3300025905 Ga0207685_10123871 Ga0207685_101238712 66
112 3300025923 Ga0207681_11295325 Ga0207681_112953252 66
113 3300025933 Ga0207706_11562093 Ga0207706_115620932 66
114 3300025938 Ga0207704_10878767 Ga0207704_108787672 66
115 3300025960 Ga0207651_12021311 Ga0207651_120213111 66
116 3300025961 Ga0207712_10550940 Ga0207712_105509403 66
117 3300025972 Ga0207668_11234810 Ga0207668_112348101 66
118 3300026088 Ga0207641_10718227 Ga0207641_107182272 66
119 3300026118 Ga0207675_100895716 Ga0207675_1008957161 66
120 3300026121 Ga0207683_11002682 Ga0207683_110026822 66
121 3300026121 Ga0207683_11024975 Ga0207683_110249751 66
122 3300026121 Ga0207683_11841687 Ga0207683_118416872 66
123 3300028380 Ga0268265_11207806 Ga0268265_112078061 66
124 3300032126 Ga0307415_102136572 Ga0307415_1021365722 66
125 3300041511 Ga0451855_1054290 Ga0451855_1054290_262_468 66
126 3300042876 Ga0451577_0114372 Ga0451577_0114372_870_1070 66
127 3300044673 Ga0453683_0107942 Ga0453683_0107942_665_865 66
128 3300045051 Ga0451576_0658395 Ga0451576_0658395_622_822 66
129 3300049571 Ga0501034_0000246 Ga0501034_0000246_88112_88312 66
130 3300049571 Ga0501034_1273291 Ga0501034_1273291_322_522 66
131 3300049573 Ga0501037_0015422 Ga0501037_0015422_3670_3870 66
132 3300049574 Ga0501038_0547193 Ga0501038_0547193_109_309 66
133 3300049575 Ga0501039_0010227 Ga0501039_0010227_1639_1839 66
134 3300049579 Ga0501043_0008278 Ga0501043_0008278_1768_1968 66
135 3300049580 Ga0501046_0124302 Ga0501046_0124302_1433_1633 66
136 3300049581 Ga0501047_0007525 Ga0501047_0007525_3488_3688 66
137 3300049582 Ga0501048_0115774 Ga0501048_0115774_12_212 66
138 3300049582 Ga0501048_0963902 Ga0501048_0963902_198_398 66
139 3300049583 Ga0501067_0044700 Ga0501067_0044700_1052_1252 66
140 3300049589 Ga0501073_0000001 Ga0501073_0000001_221579_221779 66
141 3300049590 Ga0501074_0139364 Ga0501074_0139364_83_283 66
142 3300049593 Ga0501077_0003701 Ga0501077_0003701_2356_2556 66
143 3300049743 Ga0501081_1251727 Ga0501081_1251727_15_215 66
144 3300049744 Ga0501083_0018812 Ga0501083_0018812_3387_3587 66
145 3300050490 nmdc:mga03n38_157295_c1 nmdc:mga03n38_157295_c1_507_707 66
146 3300050494 nmdc:mga06z11_430307_c1 nmdc:mga06z11_430307_c1_517_717 66
147 3300050516 nmdc:mga0sz30_383819_c1 nmdc:mga0sz30_383819_c1_44_244 66
148 3300053077 Ga0495601_0992390 Ga0495601_0992390_231_431 66
149 3300053088 Ga0500644_0213290 Ga0500644_0213290_289_489 66
150 3300053129 Ga0500628_000704 Ga0500628_000704_415_615 66
151 3300054114 Ga0501084_0194913 Ga0501084_0194913_903_1103 66
152 3300060353 Ga0501082_0000018 Ga0501082_0000018_31702_31902 66
153 2162886012 MBSR1b_contig_241812 MBSR1b_0216.00002030 67
154 3300001990 JGI24737J22298_10081403 JGI24737J22298_100814032 67
155 3300002239 JGI24034J26672_10111614 JGI24034J26672_101116142 67
156 3300003203 JGI25406J46586_10270816 JGI25406J46586_102708162 67
157 3300005290 Ga0065712_10161230 Ga0065712_101612302 67
158 3300005290 Ga0065712_10658855 Ga0065712_106588552 67
159 3300005293 Ga0065715_10298803 Ga0065715_102988031 67
160 3300005293 Ga0065715_10754867 Ga0065715_107548672 67
161 3300005293 Ga0065715_11173411 Ga0065715_111734112 67
162 3300005327 Ga0070658_10000503 Ga0070658_1000050329 67
163 3300005327 Ga0070658_10199276 Ga0070658_101992764 67
164 3300005327 Ga0070658_10412436 Ga0070658_104124361 67
165 3300005327 Ga0070658_11133758 Ga0070658_111337582 67
166 3300005328 Ga0070676_10170564 Ga0070676_101705643 67
167 3300005329 Ga0070683_100078503 Ga0070683_1000785032 67
168 3300005329 Ga0070683_101566709 Ga0070683_1015667091 67
169 3300005330 Ga0070690_100229331 Ga0070690_1002293313 67
170 3300005330 Ga0070690_100392192 Ga0070690_1003921922 67
171 3300005330 Ga0070690_100443391 Ga0070690_1004433912 67
172 3300005330 Ga0070690_101388932 Ga0070690_1013889321 67
173 3300005331 Ga0070670_100087163 Ga0070670_1000871634 67
174 3300005331 Ga0070670_100135395 Ga0070670_1001353953 67
175 3300005331 Ga0070670_100978334 Ga0070670_1009783342 67
176 3300005333 Ga0070677_10606825 Ga0070677_106068252 67
177 3300005334 Ga0068869_100058007 Ga0068869_1000580073 67
178 3300005334 Ga0068869_100902591 Ga0068869_1009025911 67
179 3300005334 Ga0068869_101008689 Ga0068869_1010086891 67
180 3300005334 Ga0068869_101245198 Ga0068869_1012451982 67
181 3300005334 Ga0068869_101258556 Ga0068869_1012585562 67
182 3300005334 Ga0068869_101312832 Ga0068869_1013128321 67
183 3300005334 Ga0068869_101807043 Ga0068869_1018070432 67
184 3300005335 Ga0070666_10023040 Ga0070666_100230403 67
185 3300005335 Ga0070666_10041127 Ga0070666_100411273 67
186 3300005335 Ga0070666_10745546 Ga0070666_107455461 67
187 3300005335 Ga0070666_10767646 Ga0070666_107676462 67
188 3300005336 Ga0070680_100169601 Ga0070680_1001696013 67
189 3300005338 Ga0068868_100007182 Ga0068868_1000071826 67
190 3300005338 Ga0068868_100084077 Ga0068868_1000840773 67
191 3300005338 Ga0068868_100245120 Ga0068868_1002451202 67
192 3300005338 Ga0068868_100308293 Ga0068868_1003082932 67
193 3300005338 Ga0068868_100451833 Ga0068868_1004518332 67
194 3300005338 Ga0068868_101564616 Ga0068868_1015646162 67
195 3300005338 Ga0068868_101635663 Ga0068868_1016356632 67
196 3300005339 Ga0070660_100539583 Ga0070660_1005395831 67
197 3300005339 Ga0070660_101946979 Ga0070660_1019469792 67
198 3300005340 Ga0070689_100162330 Ga0070689_1001623302 67
199 3300005340 Ga0070689_100787178 Ga0070689_1007871782 67
200 3300005343 Ga0070687_100668791 Ga0070687_1006687912 67
201 3300005343 Ga0070687_100721512 Ga0070687_1007215121 67
202 3300005344 Ga0070661_100393111 Ga0070661_1003931111 67
203 3300005344 Ga0070661_100447023 Ga0070661_1004470231 67
204 3300005345 Ga0070692_11316221 Ga0070692_113162212 67
205 3300005347 Ga0070668_100072580 Ga0070668_1000725803 67
206 3300005347 Ga0070668_100571823 Ga0070668_1005718232 67
207 3300005353 Ga0070669_100256170 Ga0070669_1002561702 67
208 3300005354 Ga0070675_100142727 Ga0070675_1001427272 67
209 3300005354 Ga0070675_101329411 Ga0070675_1013294112 67
210 3300005355 Ga0070671_100086629 Ga0070671_1000866293 67
211 3300005355 Ga0070671_100141336 Ga0070671_1001413363 67
212 3300005355 Ga0070671_100271116 Ga0070671_1002711163 67
213 3300005355 Ga0070671_100651167 Ga0070671_1006511671 67
214 3300005355 Ga0070671_100921460 Ga0070671_1009214602 67
215 3300005355 Ga0070671_100926429 Ga0070671_1009264292 67
216 3300005355 Ga0070671_101920160 Ga0070671_1019201601 67
217 3300005364 Ga0070673_100272930 Ga0070673_1002729302 67
218 3300005364 Ga0070673_100452422 Ga0070673_1004524222 67
219 3300005364 Ga0070673_100912714 Ga0070673_1009127142 67
220 3300005365 Ga0070688_100314494 Ga0070688_1003144941 67
221 3300005366 Ga0070659_100458799 Ga0070659_1004587992 67
222 3300005367 Ga0070667_100002793 Ga0070667_1000027938 67
223 3300005367 Ga0070667_100472457 Ga0070667_1004724572 67
224 3300005367 Ga0070667_100769227 Ga0070667_1007692272 67
225 3300005367 Ga0070667_100838710 Ga0070667_1008387102 67
226 3300005435 Ga0070714_100610352 Ga0070714_1006103521 67
227 3300005435 Ga0070714_101594768 Ga0070714_1015947682 67
228 3300005435 Ga0070714_101937831 Ga0070714_1019378312 67
229 3300005436 Ga0070713_101186234 Ga0070713_1011862342 67
230 3300005436 Ga0070713_101310604 Ga0070713_1013106041 67
231 3300005437 Ga0070710_10795186 Ga0070710_107951862 67
232 3300005439 Ga0070711_100935608 Ga0070711_1009356081 67
233 3300005439 Ga0070711_102060764 Ga0070711_1020607641 67
234 3300005440 Ga0070705_100564675 Ga0070705_1005646751 67
235 3300005444 Ga0070694_100437190 Ga0070694_1004371902 67
236 3300005456 Ga0070678_101503567 Ga0070678_1015035671 67
237 3300005456 Ga0070678_101532508 Ga0070678_1015325081 67
238 3300005457 Ga0070662_100747599 Ga0070662_1007475992 67
239 3300005457 Ga0070662_100770288 Ga0070662_1007702882 67
240 3300005457 Ga0070662_101421206 Ga0070662_1014212061 67
241 3300005458 Ga0070681_10047881 Ga0070681_100478812 67
242 3300005467 Ga0070706_100576250 Ga0070706_1005762502 67
243 3300005468 Ga0070707_100827780 Ga0070707_1008277802 67
244 3300005471 Ga0070698_100444719 Ga0070698_1004447192 67
245 3300005471 Ga0070698_100768311 Ga0070698_1007683112 67
246 3300005518 Ga0070699_100724340 Ga0070699_1007243402 67
247 3300005530 Ga0070679_101022291 Ga0070679_1010222912 67
248 3300005530 Ga0070679_101162553 Ga0070679_1011625532 67
249 3300005530 Ga0070679_101260278 Ga0070679_1012602782 67
250 3300005530 Ga0070679_101841671 Ga0070679_1018416711 67
251 3300005535 Ga0070684_100335819 Ga0070684_1003358192 67
252 3300005535 Ga0070684_101967143 Ga0070684_1019671432 67
253 3300005536 Ga0070697_101053202 Ga0070697_1010532021 67
254 3300005539 Ga0068853_100497642 Ga0068853_1004976423 67
255 3300005539 Ga0068853_100574938 Ga0068853_1005749382 67
256 3300005539 Ga0068853_101140503 Ga0068853_1011405032 67
257 3300005539 Ga0068853_101716384 Ga0068853_1017163842 67
258 3300005539 Ga0068853_102269131 Ga0068853_1022691311 67
259 3300005543 Ga0070672_100471518 Ga0070672_1004715182 67
260 3300005544 Ga0070686_100116096 Ga0070686_1001160961 67
261 3300005544 Ga0070686_100334751 Ga0070686_1003347512 67
262 3300005544 Ga0070686_100871072 Ga0070686_1008710722 67
263 3300005544 Ga0070686_101474628 Ga0070686_1014746282 67
264 3300005546 Ga0070696_100157241 Ga0070696_1001572412 67
265 3300005548 Ga0070665_101154780 Ga0070665_1011547802 67
266 3300005548 Ga0070665_101178301 Ga0070665_1011783012 67
267 3300005549 Ga0070704_100528738 Ga0070704_1005287382 67
268 3300005549 Ga0070704_100672590 Ga0070704_1006725902 67
269 3300005549 Ga0070704_101260875 Ga0070704_1012608752 67
270 3300005549 Ga0070704_101449384 Ga0070704_1014493842 67
271 3300005563 Ga0068855_100957890 Ga0068855_1009578901 67
272 3300005563 Ga0068855_101213315 Ga0068855_1012133152 67
273 3300005564 Ga0070664_100008130 Ga0070664_1000081301 67
274 3300005564 Ga0070664_100973139 Ga0070664_1009731391 67
275 3300005577 Ga0068857_100011013 Ga0068857_1000110133 67
276 3300005577 Ga0068857_100199292 Ga0068857_1001992923 67
277 3300005577 Ga0068857_101398863 Ga0068857_1013988632 67
278 3300005577 Ga0068857_102523641 Ga0068857_1025236412 67
279 3300005578 Ga0068854_100003839 Ga0068854_1000038395 67
280 3300005578 Ga0068854_101155293 Ga0068854_1011552932 67
281 3300005578 Ga0068854_101543184 Ga0068854_1015431842 67
282 3300005614 Ga0068856_100012947 Ga0068856_1000129475 67
283 3300005614 Ga0068856_100081781 Ga0068856_1000817814 67
284 3300005614 Ga0068856_100738087 Ga0068856_1007380871 67
285 3300005615 Ga0070702_100284963 Ga0070702_1002849632 67
286 3300005616 Ga0068852_100099507 Ga0068852_1000995071 67
287 3300005616 Ga0068852_101421370 Ga0068852_1014213702 67
288 3300005616 Ga0068852_102224509 Ga0068852_1022245092 67
289 3300005616 Ga0068852_102835652 Ga0068852_1028356522 67
290 3300005617 Ga0068859_100004003 Ga0068859_1000040033 67
291 3300005617 Ga0068859_100015657 Ga0068859_1000156573 67
292 3300005617 Ga0068859_100094224 Ga0068859_1000942244 67
293 3300005617 Ga0068859_100521956 Ga0068859_1005219562 67
294 3300005618 Ga0068864_100000699 Ga0068864_10000069918 67
295 3300005618 Ga0068864_100001921 Ga0068864_10000192113 67
296 3300005618 Ga0068864_100087203 Ga0068864_1000872035 67
297 3300005618 Ga0068864_100317836 Ga0068864_1003178362 67
298 3300005618 Ga0068864_100499037 Ga0068864_1004990373 67
299 3300005618 Ga0068864_100894203 Ga0068864_1008942032 67
300 3300005618 Ga0068864_101495015 Ga0068864_1014950152 67
301 3300005719 Ga0068861_100007458 Ga0068861_1000074589 67
302 3300005719 Ga0068861_101569281 Ga0068861_1015692812 67
303 3300005834 Ga0068851_10105119 Ga0068851_101051192 67
304 3300005834 Ga0068851_10207687 Ga0068851_102076873 67
305 3300005834 Ga0068851_10622565 Ga0068851_106225652 67
306 3300005840 Ga0068870_10109067 Ga0068870_101090673 67
307 3300005840 Ga0068870_10369002 Ga0068870_103690022 67
308 3300005840 Ga0068870_10484246 Ga0068870_104842462 67
309 3300005841 Ga0068863_100003791 Ga0068863_10000379121 67
310 3300005841 Ga0068863_101514157 Ga0068863_1015141572 67
311 3300005841 Ga0068863_101594252 Ga0068863_1015942522 67
312 3300005841 Ga0068863_101953137 Ga0068863_1019531372 67
313 3300005841 Ga0068863_102597047 Ga0068863_1025970471 67
314 3300005842 Ga0068858_100001364 Ga0068858_10000136421 67
315 3300005842 Ga0068858_100144427 Ga0068858_1001444273 67
316 3300005842 Ga0068858_100186935 Ga0068858_1001869353 67
317 3300005842 Ga0068858_100523872 Ga0068858_1005238723 67
318 3300005842 Ga0068858_100536136 Ga0068858_1005361362 67
319 3300005842 Ga0068858_102178841 Ga0068858_1021788412 67
320 3300005843 Ga0068860_100001500 Ga0068860_10000150011 67
321 3300005843 Ga0068860_100564665 Ga0068860_1005646652 67
322 3300005843 Ga0068860_101300860 Ga0068860_1013008601 67
323 3300005843 Ga0068860_102234569 Ga0068860_1022345692 67
324 3300005844 Ga0068862_100026444 Ga0068862_1000264443 67
325 3300005844 Ga0068862_100059474 Ga0068862_1000594741 67
326 3300005844 Ga0068862_101555128 Ga0068862_1015551282 67
327 3300005937 Ga0081455_10005340 Ga0081455_1000534012 67
328 3300005937 Ga0081455_10131971 Ga0081455_101319714 67
329 3300005983 Ga0081540_1102018 Ga0081540_11020182 67
330 3300005985 Ga0081539_10049991 Ga0081539_100499913 67
331 3300006028 Ga0070717_10027369 Ga0070717_100273692 67
332 3300006038 Ga0075365_10756325 Ga0075365_107563252 67
333 3300006051 Ga0075364_10269955 Ga0075364_102699552 67
334 3300006058 Ga0075432_10240260 Ga0075432_102402602 67
335 3300006175 Ga0070712_100746246 Ga0070712_1007462461 67
336 3300006178 Ga0075367_10000350 Ga0075367_100003504 67
337 3300006178 Ga0075367_10095500 Ga0075367_100955003 67
338 3300006178 Ga0075367_11022751 Ga0075367_110227512 67
339 3300006195 Ga0075366_10001505 Ga0075366_1000150515 67
340 3300006195 Ga0075366_10028424 Ga0075366_100284243 67
341 3300006237 Ga0097621_100344160 Ga0097621_1003441602 67
342 3300006237 Ga0097621_100508702 Ga0097621_1005087021 67
343 3300006237 Ga0097621_101480867 Ga0097621_1014808672 67
344 3300006358 Ga0068871_100063008 Ga0068871_1000630082 67
345 3300006358 Ga0068871_100092833 Ga0068871_1000928333 67
346 3300006358 Ga0068871_100405498 Ga0068871_1004054982 67
347 3300006358 Ga0068871_100684161 Ga0068871_1006841612 67
348 3300006844 Ga0075428_100874560 Ga0075428_1008745602 67
349 3300006847 Ga0075431_100085779 Ga0075431_1000857795 67
350 3300006852 Ga0075433_10501135 Ga0075433_105011352 67
351 3300006871 Ga0075434_102509550 Ga0075434_1025095501 67
352 3300006881 Ga0068865_102087380 Ga0068865_1020873801 67
353 3300006914 Ga0075436_100551380 Ga0075436_1005513802 67
354 3300006931 Ga0097620_100004003 Ga0097620_1000040033 67
355 3300006931 Ga0097620_100015657 Ga0097620_1000156573 67
356 3300006931 Ga0097620_100094227 Ga0097620_1000942274 67
357 3300006931 Ga0097620_100521950 Ga0097620_1005219502 67
358 3300007076 Ga0075435_100425468 Ga0075435_1004254683 67
359 3300007788 Ga0099795_10620005 Ga0099795_106200052 67
360 3300009011 Ga0105251_10138636 Ga0105251_101386362 67
361 3300009092 Ga0105250_10010924 Ga0105250_100109243 67
362 3300009093 Ga0105240_10537271 Ga0105240_105372711 67
363 3300009093 Ga0105240_10572622 Ga0105240_105726223 67
364 3300009093 Ga0105240_10638445 Ga0105240_106384452 67
365 3300009093 Ga0105240_12227336 Ga0105240_122273361 67
366 3300009093 Ga0105240_12318175 Ga0105240_123181751 67
367 3300009093 Ga0105240_12814343 Ga0105240_128143432 67
368 3300009094 Ga0111539_10748300 Ga0111539_107483002 67
369 3300009098 Ga0105245_10024050 Ga0105245_100240503 67
370 3300009098 Ga0105245_10282147 Ga0105245_102821472 67
371 3300009098 Ga0105245_10340747 Ga0105245_103407471 67
372 3300009098 Ga0105245_10591288 Ga0105245_105912881 67
373 3300009098 Ga0105245_10751832 Ga0105245_107518322 67
374 3300009098 Ga0105245_11787038 Ga0105245_117870381 67
375 3300009101 Ga0105247_10017863 Ga0105247_100178634 67
376 3300009101 Ga0105247_10033484 Ga0105247_100334842 67
377 3300009101 Ga0105247_10649482 Ga0105247_106494822 67
378 3300009101 Ga0105247_11361303 Ga0105247_113613032 67
379 3300009147 Ga0114129_10784244 Ga0114129_107842441 67
380 3300009147 Ga0114129_11667977 Ga0114129_116679772 67
381 3300009147 Ga0114129_12642863 Ga0114129_126428631 67
382 3300009148 Ga0105243_10875039 Ga0105243_108750392 67
383 3300009148 Ga0105243_11103058 Ga0105243_111030581 67
384 3300009148 Ga0105243_11121885 Ga0105243_111218852 67
385 3300009148 Ga0105243_12534980 Ga0105243_125349801 67
386 3300009174 Ga0105241_10088123 Ga0105241_100881233 67
387 3300009174 Ga0105241_10111985 Ga0105241_101119853 67
388 3300009174 Ga0105241_10295680 Ga0105241_102956803 67
389 3300009176 Ga0105242_10052792 Ga0105242_100527923 67
390 3300009177 Ga0105248_10005280 Ga0105248_100052802 67
391 3300009177 Ga0105248_11053012 Ga0105248_110530122 67
392 3300009177 Ga0105248_11088664 Ga0105248_110886642 67
393 3300009177 Ga0105248_11755333 Ga0105248_117553332 67
394 3300009177 Ga0105248_12211483 Ga0105248_122114832 67
395 3300009545 Ga0105237_12056196 Ga0105237_120561962 67
396 3300009551 Ga0105238_10014096 Ga0105238_100140966 67
397 3300009551 Ga0105238_10886559 Ga0105238_108865592 67
398 3300009551 Ga0105238_10993710 Ga0105238_109937102 67
399 3300009553 Ga0105249_10003155 Ga0105249_100031552 67
400 3300009553 Ga0105249_11036653 Ga0105249_110366531 67
401 3300009553 Ga0105249_12306592 Ga0105249_123065922 67
402 3300009553 Ga0105249_12904915 Ga0105249_129049151 67
403 3300009979 Ga0105032_112054 Ga0105032_1120542 67
404 3300009982 Ga0105147_108972 Ga0105147_1089722 67
405 3300009993 Ga0105028_100449 Ga0105028_1004492 67
406 3300009993 Ga0105028_101043 Ga0105028_1010432 67
407 3300010375 Ga0105239_10026828 Ga0105239_100268283 67
408 3300010375 Ga0105239_10234893 Ga0105239_102348931 67
409 3300010375 Ga0105239_10652915 Ga0105239_106529151 67
410 3300010375 Ga0105239_11481683 Ga0105239_114816831 67
411 3300010375 Ga0105239_12077686 Ga0105239_120776861 67
412 3300011119 Ga0105246_10050003 Ga0105246_100500033 67
413 3300011119 Ga0105246_11727676 Ga0105246_117276761 67
414 3300013100 Ga0157373_10027245 Ga0157373_100272453 67
415 3300013100 Ga0157373_10337199 Ga0157373_103371991 67
416 3300013100 Ga0157373_10859638 Ga0157373_108596382 67
417 3300013102 Ga0157371_10144534 Ga0157371_101445342 67
418 3300013102 Ga0157371_10592633 Ga0157371_105926332 67
419 3300013104 Ga0157370_10003091 Ga0157370_1000309119 67
420 3300013104 Ga0157370_10129075 Ga0157370_101290754 67
421 3300013104 Ga0157370_10409557 Ga0157370_104095572 67
422 3300013104 Ga0157370_10638133 Ga0157370_106381332 67
423 3300013104 Ga0157370_11549961 Ga0157370_115499612 67
424 3300013105 Ga0157369_10090313 Ga0157369_100903134 67
425 3300013105 Ga0157369_10194244 Ga0157369_101942442 67
426 3300013105 Ga0157369_10350564 Ga0157369_103505642 67
427 3300013105 Ga0157369_10787378 Ga0157369_107873782 67
428 3300013105 Ga0157369_10795951 Ga0157369_107959511 67
429 3300013105 Ga0157369_11424394 Ga0157369_114243941 67
430 3300013105 Ga0157369_12304133 Ga0157369_123041332 67
431 3300013105 Ga0157369_12484025 Ga0157369_124840252 67
432 3300013296 Ga0157374_10000651 Ga0157374_1000065110 67
433 3300013296 Ga0157374_10010838 Ga0157374_100108382 67
434 3300013296 Ga0157374_10012997 Ga0157374_100129974 67
435 3300013296 Ga0157374_10381809 Ga0157374_103818092 67
436 3300013296 Ga0157374_10382606 Ga0157374_103826062 67
437 3300013296 Ga0157374_10775673 Ga0157374_107756732 67
438 3300013296 Ga0157374_10896486 Ga0157374_108964862 67
439 3300013296 Ga0157374_10933704 Ga0157374_109337042 67
440 3300013296 Ga0157374_10959708 Ga0157374_109597082 67
441 3300013296 Ga0157374_11792342 Ga0157374_117923421 67
442 3300013297 Ga0157378_10022421 Ga0157378_100224214 67
443 3300013297 Ga0157378_10298955 Ga0157378_102989552 67
444 3300013297 Ga0157378_10837221 Ga0157378_108372212 67
445 3300013297 Ga0157378_10849249 Ga0157378_108492492 67
446 3300013297 Ga0157378_11018339 Ga0157378_110183392 67
447 3300013297 Ga0157378_11477792 Ga0157378_114777921 67
448 3300013297 Ga0157378_12475139 Ga0157378_124751392 67
449 3300013306 Ga0163162_10013461 Ga0163162_100134615 67
450 3300013306 Ga0163162_10119839 Ga0163162_101198391 67
451 3300013306 Ga0163162_10198693 Ga0163162_101986934 67
452 3300013306 Ga0163162_10836146 Ga0163162_108361463 67
453 3300013306 Ga0163162_11315797 Ga0163162_113157971 67
454 3300013306 Ga0163162_12263718 Ga0163162_122637182 67
455 3300013306 Ga0163162_13282939 Ga0163162_132829392 67
456 3300013307 Ga0157372_10001400 Ga0157372_1000140010 67
457 3300013307 Ga0157372_10276602 Ga0157372_102766024 67
458 3300013307 Ga0157372_11073579 Ga0157372_110735792 67
459 3300013307 Ga0157372_11135566 Ga0157372_111355662 67
460 3300013307 Ga0157372_11184058 Ga0157372_111840582 67
461 3300013307 Ga0157372_11471805 Ga0157372_114718052 67
462 3300013308 Ga0157375_10014421 Ga0157375_100144215 67
463 3300013308 Ga0157375_10015271 Ga0157375_100152717 67
464 3300013308 Ga0157375_10172707 Ga0157375_101727073 67
465 3300013308 Ga0157375_10688917 Ga0157375_106889172 67
466 3300013308 Ga0157375_11464537 Ga0157375_114645372 67
467 3300014325 Ga0163163_10000140 Ga0163163_1000014027 67
468 3300014325 Ga0163163_10000412 Ga0163163_1000041244 67
469 3300014325 Ga0163163_10646288 Ga0163163_106462882 67
470 3300014325 Ga0163163_10905750 Ga0163163_109057502 67
471 3300014325 Ga0163163_11579672 Ga0163163_115796721 67
472 3300014325 Ga0163163_12827877 Ga0163163_128278771 67
473 3300014326 Ga0157380_13451536 Ga0157380_134515362 67
474 3300014745 Ga0157377_10025131 Ga0157377_100251313 67
475 3300014968 Ga0157379_10010309 Ga0157379_100103096 67
476 3300014968 Ga0157379_10133912 Ga0157379_101339122 67
477 3300014968 Ga0157379_10381296 Ga0157379_103812962 67
478 3300014969 Ga0157376_10083065 Ga0157376_100830653 67
479 3300014969 Ga0157376_10096279 Ga0157376_100962791 67
480 3300014969 Ga0157376_11340603 Ga0157376_113406032 67
481 3300014969 Ga0157376_12614354 Ga0157376_126143542 67
482 3300017792 Ga0163161_10712248 Ga0163161_107122482 67
483 3300017792 Ga0163161_11632194 Ga0163161_116321942 67
484 3300025315 Ga0207697_10094189 Ga0207697_100941892 67
485 3300025315 Ga0207697_10247743 Ga0207697_102477432 67
486 3300025315 Ga0207697_10562651 Ga0207697_105626511 67
487 3300025321 Ga0207656_10111536 Ga0207656_101115363 67
488 3300025321 Ga0207656_10223911 Ga0207656_102239111 67
489 3300025711 Ga0207696_1014686 Ga0207696_10146862 67
490 3300025899 Ga0207642_10728983 Ga0207642_107289832 67
491 3300025900 Ga0207710_10016171 Ga0207710_100161711 67
492 3300025900 Ga0207710_10018201 Ga0207710_100182015 67
493 3300025901 Ga0207688_10486369 Ga0207688_104863691 67
494 3300025903 Ga0207680_10043146 Ga0207680_100431462 67
495 3300025903 Ga0207680_10108229 Ga0207680_101082292 67
496 3300025904 Ga0207647_10012819 Ga0207647_100128192 67
497 3300025908 Ga0207643_10088991 Ga0207643_100889913 67
498 3300025908 Ga0207643_10748674 Ga0207643_107486742 67
499 3300025909 Ga0207705_10007203 Ga0207705_100072034 67
500 3300025909 Ga0207705_10993598 Ga0207705_109935982 67
501 3300025911 Ga0207654_10807594 Ga0207654_108075942 67
502 3300025912 Ga0207707_10114076 Ga0207707_101140762 67
503 3300025912 Ga0207707_10978585 Ga0207707_109785852 67
504 3300025913 Ga0207695_10061162 Ga0207695_100611625 67
505 3300025913 Ga0207695_10841816 Ga0207695_108418162 67
506 3300025917 Ga0207660_10326218 Ga0207660_103262182 67
507 3300025917 Ga0207660_11370930 Ga0207660_113709301 67
508 3300025918 Ga0207662_10358055 Ga0207662_103580552 67
509 3300025918 Ga0207662_10443483 Ga0207662_104434832 67
510 3300025918 Ga0207662_10969643 Ga0207662_109696432 67
511 3300025919 Ga0207657_11321500 Ga0207657_113215001 67
512 3300025920 Ga0207649_10333712 Ga0207649_103337121 67
513 3300025920 Ga0207649_10634158 Ga0207649_106341582 67
514 3300025921 Ga0207652_10844363 Ga0207652_108443632 67
515 3300025921 Ga0207652_11005627 Ga0207652_110056272 67
516 3300025923 Ga0207681_10074149 Ga0207681_100741493 67
517 3300025924 Ga0207694_10066924 Ga0207694_100669245 67
518 3300025924 Ga0207694_10984261 Ga0207694_109842612 67
519 3300025925 Ga0207650_10181630 Ga0207650_101816303 67
520 3300025925 Ga0207650_10218070 Ga0207650_102180701 67
521 3300025925 Ga0207650_11508266 Ga0207650_115082662 67
522 3300025925 Ga0207650_11842753 Ga0207650_118427531 67
523 3300025926 Ga0207659_10255513 Ga0207659_102555132 67
524 3300025926 Ga0207659_10606940 Ga0207659_106069402 67
525 3300025927 Ga0207687_10026842 Ga0207687_100268427 67
526 3300025927 Ga0207687_10154658 Ga0207687_101546582 67
527 3300025928 Ga0207700_10251859 Ga0207700_102518592 67
528 3300025929 Ga0207664_10835921 Ga0207664_108359211 67
529 3300025931 Ga0207644_10021845 Ga0207644_100218453 67
530 3300025931 Ga0207644_10099645 Ga0207644_100996452 67
531 3300025931 Ga0207644_10338089 Ga0207644_103380892 67
532 3300025931 Ga0207644_11064009 Ga0207644_110640092 67
533 3300025931 Ga0207644_11219072 Ga0207644_112190721 67
534 3300025933 Ga0207706_11052936 Ga0207706_110529361 67
535 3300025933 Ga0207706_11519886 Ga0207706_115198862 67
536 3300025934 Ga0207686_10142853 Ga0207686_101428532 67
537 3300025934 Ga0207686_10383054 Ga0207686_103830542 67
538 3300025936 Ga0207670_10086769 Ga0207670_100867692 67
539 3300025936 Ga0207670_10124712 Ga0207670_101247122 67
540 3300025936 Ga0207670_10956363 Ga0207670_109563632 67
541 3300025937 Ga0207669_11412727 Ga0207669_114127271 67
542 3300025938 Ga0207704_10972932 Ga0207704_109729321 67
543 3300025940 Ga0207691_11197353 Ga0207691_111973532 67
544 3300025941 Ga0207711_10000307 Ga0207711_1000030745 67
545 3300025941 Ga0207711_10686948 Ga0207711_106869482 67
546 3300025941 Ga0207711_11132845 Ga0207711_111328451 67
547 3300025941 Ga0207711_11780069 Ga0207711_117800692 67
548 3300025942 Ga0207689_10116560 Ga0207689_101165602 67
549 3300025942 Ga0207689_10343202 Ga0207689_103432021 67
550 3300025942 Ga0207689_10531405 Ga0207689_105314052 67
551 3300025942 Ga0207689_11041444 Ga0207689_110414442 67
552 3300025944 Ga0207661_10067519 Ga0207661_100675194 67
553 3300025944 Ga0207661_10143088 Ga0207661_101430883 67
554 3300025945 Ga0207679_10005785 Ga0207679_100057854 67
555 3300025945 Ga0207679_10065423 Ga0207679_100654233 67
556 3300025945 Ga0207679_11503905 Ga0207679_115039051 67
557 3300025949 Ga0207667_10069308 Ga0207667_100693083 67
558 3300025949 Ga0207667_10637120 Ga0207667_106371203 67
559 3300025949 Ga0207667_11743067 Ga0207667_117430671 67
560 3300025960 Ga0207651_10149806 Ga0207651_101498063 67
561 3300025960 Ga0207651_10348135 Ga0207651_103481352 67
562 3300025960 Ga0207651_11786524 Ga0207651_117865242 67
563 3300025961 Ga0207712_10011723 Ga0207712_100117235 67
564 3300025961 Ga0207712_10029309 Ga0207712_100293094 67
565 3300025961 Ga0207712_10314705 Ga0207712_103147051 67
566 3300025972 Ga0207668_10086815 Ga0207668_100868154 67
567 3300025972 Ga0207668_10290440 Ga0207668_102904403 67
568 3300025981 Ga0207640_10033935 Ga0207640_100339352 67
569 3300025981 Ga0207640_10583083 Ga0207640_105830832 67
570 3300025981 Ga0207640_10597757 Ga0207640_105977572 67
571 3300025981 Ga0207640_11173914 Ga0207640_111739142 67
572 3300025986 Ga0207658_10001500 Ga0207658_100015006 67
573 3300025986 Ga0207658_10311435 Ga0207658_103114353 67
574 3300026023 Ga0207677_10073284 Ga0207677_100732842 67
575 3300026023 Ga0207677_10294708 Ga0207677_102947082 67
576 3300026023 Ga0207677_10382922 Ga0207677_103829222 67
577 3300026023 Ga0207677_11282408 Ga0207677_112824082 67
578 3300026035 Ga0207703_10005721 Ga0207703_100057218 67
579 3300026035 Ga0207703_10136675 Ga0207703_101366752 67
580 3300026035 Ga0207703_10174909 Ga0207703_101749093 67
581 3300026035 Ga0207703_10283935 Ga0207703_102839351 67
582 3300026035 Ga0207703_10477614 Ga0207703_104776142 67
583 3300026035 Ga0207703_12141841 Ga0207703_121418411 67
584 3300026041 Ga0207639_10363117 Ga0207639_103631171 67
585 3300026041 Ga0207639_10442726 Ga0207639_104427261 67
586 3300026041 Ga0207639_11682373 Ga0207639_116823732 67
587 3300026067 Ga0207678_10656193 Ga0207678_106561931 67
588 3300026075 Ga0207708_10670720 Ga0207708_106707202 67
589 3300026075 Ga0207708_10931890 Ga0207708_109318902 67
590 3300026078 Ga0207702_10009019 Ga0207702_100090192 67
591 3300026078 Ga0207702_10130275 Ga0207702_101302753 67
592 3300026078 Ga0207702_10680747 Ga0207702_106807471 67
593 3300026078 Ga0207702_11275604 Ga0207702_112756042 67
594 3300026078 Ga0207702_11668010 Ga0207702_116680101 67
595 3300026088 Ga0207641_10001412 Ga0207641_1000141211 67
596 3300026088 Ga0207641_10058605 Ga0207641_100586052 67
597 3300026088 Ga0207641_10113016 Ga0207641_101130162 67
598 3300026088 Ga0207641_10774296 Ga0207641_107742962 67
599 3300026088 Ga0207641_10873570 Ga0207641_108735702 67
600 3300026088 Ga0207641_10946859 Ga0207641_109468592 67
601 3300026088 Ga0207641_11874414 Ga0207641_118744142 67
602 3300026088 Ga0207641_12159222 Ga0207641_121592222 67
603 3300026089 Ga0207648_10270686 Ga0207648_102706862 67
604 3300026089 Ga0207648_10856826 Ga0207648_108568262 67
605 3300026095 Ga0207676_10002011 Ga0207676_100020117 67
606 3300026095 Ga0207676_10046801 Ga0207676_100468013 67
607 3300026095 Ga0207676_10269508 Ga0207676_102695082 67
608 3300026095 Ga0207676_10921042 Ga0207676_109210422 67
609 3300026095 Ga0207676_10938281 Ga0207676_109382812 67
610 3300026095 Ga0207676_11633095 Ga0207676_116330952 67
611 3300026116 Ga0207674_10000905 Ga0207674_1000090522 67
612 3300026116 Ga0207674_10167732 Ga0207674_101677322 67
613 3300026116 Ga0207674_11142759 Ga0207674_111427592 67
614 3300026116 Ga0207674_11663046 Ga0207674_116630462 67
615 3300026118 Ga0207675_100016334 Ga0207675_1000163347 67
616 3300026118 Ga0207675_100068024 Ga0207675_1000680242 67
617 3300026118 Ga0207675_101204067 Ga0207675_1012040672 67
618 3300026118 Ga0207675_101383745 Ga0207675_1013837453 67
619 3300026118 Ga0207675_101429820 Ga0207675_1014298202 67
620 3300026142 Ga0207698_10052318 Ga0207698_100523183 67
621 3300026142 Ga0207698_11227259 Ga0207698_112272591 67
622 3300027866 Ga0209813_10127343 Ga0209813_101273432 67
623 3300027907 Ga0207428_10875236 Ga0207428_108752362 67
624 3300028379 Ga0268266_11524383 Ga0268266_115243832 67
625 3300028380 Ga0268265_10588012 Ga0268265_105880121 67
626 3300028380 Ga0268265_11183290 Ga0268265_111832901 67
627 3300028381 Ga0268264_10001167 Ga0268264_1000116711 67
628 3300028381 Ga0268264_10065240 Ga0268264_100652404 67
629 3300028381 Ga0268264_10267320 Ga0268264_102673204 67
630 3300028381 Ga0268264_12393954 Ga0268264_123939541 67
631 3300028381 Ga0268264_12394631 Ga0268264_123946311 67
632 3300030734 Ga0316179_1070387 Ga0316179_107038714 67
633 3300030742 Ga0316183_1175878 Ga0316183_117587817 67
634 3300030744 Ga0316181_1060641 Ga0316181_10606412 67
635 3300030745 Ga0316182_1132274 Ga0316182_11322744 67
636 3300030745 Ga0316182_1185667 Ga0316182_11856672 67
637 3300031456 Ga0307513_10347931 Ga0307513_103479311 67
638 3300031456 Ga0307513_10689110 Ga0307513_106891101 67
639 3300031548 Ga0307408_100162823 Ga0307408_1001628233 67
640 3300031730 Ga0307516_10280382 Ga0307516_102803822 67
641 3300031731 Ga0307405_10005875 Ga0307405_100058754 67
642 3300031731 Ga0307405_10120776 Ga0307405_101207763 67
643 3300031824 Ga0307413_10099064 Ga0307413_100990643 67
644 3300031824 Ga0307413_10177532 Ga0307413_101775322 67
645 3300031824 Ga0307413_10519951 Ga0307413_105199512 67
646 3300031824 Ga0307413_10758610 Ga0307413_107586102 67
647 3300031852 Ga0307410_10009191 Ga0307410_100091916 67
648 3300031852 Ga0307410_10047837 Ga0307410_100478373 67
649 3300031852 Ga0307410_11010409 Ga0307410_110104092 67
650 3300031852 Ga0307410_11252994 Ga0307410_112529942 67
651 3300031901 Ga0307406_10054133 Ga0307406_100541332 67
652 3300031901 Ga0307406_10760134 Ga0307406_107601342 67
653 3300031903 Ga0307407_10308441 Ga0307407_103084411 67
654 3300031903 Ga0307407_10516863 Ga0307407_105168632 67
655 3300031903 Ga0307407_11610536 Ga0307407_116105362 67
656 3300031911 Ga0307412_10052660 Ga0307412_100526604 67
657 3300031911 Ga0307412_10055154 Ga0307412_100551542 67
658 3300031911 Ga0307412_10330856 Ga0307412_103308562 67
659 3300031995 Ga0307409_100174244 Ga0307409_1001742443 67
660 3300031995 Ga0307409_100409525 Ga0307409_1004095252 67
661 3300031995 Ga0307409_100442390 Ga0307409_1004423902 67
662 3300031995 Ga0307409_101081727 Ga0307409_1010817272 67
663 3300031995 Ga0307409_102885840 Ga0307409_1028858402 67
664 3300032002 Ga0307416_101117802 Ga0307416_1011178022 67
665 3300032002 Ga0307416_101372137 Ga0307416_1013721371 67
666 3300032002 Ga0307416_101526986 Ga0307416_1015269862 67
667 3300032004 Ga0307414_10242421 Ga0307414_102424213 67
668 3300032004 Ga0307414_11896231 Ga0307414_118962312 67
669 3300032005 Ga0307411_10216273 Ga0307411_102162732 67
670 3300032005 Ga0307411_10767803 Ga0307411_107678032 67
671 3300032005 Ga0307411_11703893 Ga0307411_117038931 67
672 3300032005 Ga0307411_12216140 Ga0307411_122161401 67
673 3300032126 Ga0307415_100073574 Ga0307415_1000735744 67
674 3300032126 Ga0307415_100084187 Ga0307415_1000841872 67
675 3300032126 Ga0307415_100146132 Ga0307415_1001461323 67
676 3300032126 Ga0307415_100400494 Ga0307415_1004004941 67
677 3300035111 Ga0373923_0232869 Ga0373923_0232869_424_627 67
678 3300035172 Ga0373955_0587812 Ga0373955_0587812_194_397 67
679 3300035724 Ga0373933_0509509 Ga0373933_0509509_38_241 67
680 3300036401 Ga0373937_0328105 Ga0373937_0328105_320_523 67
681 3300037418 Ga0395900_0110055 Ga0395900_0110055_392_595 67
682 3300037466 Ga0395898_0536127 Ga0395898_0536127_194_397 67
683 3300037471 Ga0395905_0092323 Ga0395905_0092323_465_671 67
684 3300038443 Ga0395901_0855182 Ga0395901_0855182_517_720 67
685 3300041404 Ga0439436_0006432 Ga0439436_0006432_2346_2561 67
686 3300041406 Ga0439439_0004220 Ga0439439_0004220_2142_2357 67
687 3300041453 Ga0451797_0891978 Ga0451797_0891978_47_262 67
688 3300041486 Ga0451807_1584278 Ga0451807_1584278_537_740 67
689 3300041501 Ga0451845_0238394 Ga0451845_0238394_241_444 67
690 3300042014 Ga0439457_003541 Ga0439457_003541_904_1119 67
691 3300044673 Ga0453683_0000035 Ga0453683_0000035_119564_119767 67
692 3300044673 Ga0453683_0033984 Ga0453683_0033984_1886_2089 67
693 3300044673 Ga0453683_0536856 Ga0453683_0536856_369_572 67
694 3300044712 Ga0453684_0000128 Ga0453684_0000128_181559_181765 67
695 3300044712 Ga0453684_0052392 Ga0453684_0052392_4430_4633 67
696 3300044712 Ga0453684_0220157 Ga0453684_0220157_1120_1323 67
697 3300045051 Ga0451576_0002081 Ga0451576_0002081_7410_7613 67
698 3300045051 Ga0451576_0239300 Ga0451576_0239300_1233_1436 67
699 3300045051 Ga0451576_0660059 Ga0451576_0660059_129_332 67
700 3300045051 Ga0451576_1065587 Ga0451576_1065587_168_374 67
701 3300045051 Ga0451576_1196528 Ga0451576_1196528_465_668 67
702 3300045051 Ga0451576_2048915 Ga0451576_2048915_252_455 67
703 3300046460 Ga0495638_0237313 Ga0495638_0237313_255_458 67
704 3300046471 Ga0495650_0000006 Ga0495650_0000006_507556_507759 67
705 3300046471 Ga0495650_0042209 Ga0495650_0042209_402_605 67
706 3300046491 Ga0495584_0247089 Ga0495584_0247089_418_621 67
707 3300046507 Ga0495606_0330341 Ga0495606_0330341_464_694 67
708 3300046511 Ga0495608_0889861 Ga0495608_0889861_65_268 67
709 3300046513 Ga0495616_0108921 Ga0495616_0108921_318_521 67
710 3300046533 Ga0495640_0730626 Ga0495640_0730626_371_574 67
711 3300046535 Ga0495586_0673226 Ga0495586_0673226_239_454 67
712 3300046537 Ga0495598_0020876 Ga0495598_0020876_241_444 67
713 3300046537 Ga0495598_0159068 Ga0495598_0159068_361_564 67
714 3300046542 Ga0495597_0298992 Ga0495597_0298992_398_601 67
715 3300046543 Ga0495645_0179284 Ga0495645_0179284_565_768 67
716 3300046543 Ga0495645_0475395 Ga0495645_0475395_131_334 67
717 3300046615 Ga0495656_0198312 Ga0495656_0198312_351_554 67
718 3300046616 Ga0495668_0787192 Ga0495668_0787192_100_303 67
719 3300046664 Ga0495659_0177207 Ga0495659_0177207_436_639 67
720 3300046665 Ga0495661_0276371 Ga0495661_0276371_302_532 67
721 3300046684 Ga0495669_0145835 Ga0495669_0145835_170_373 67
722 3300046691 Ga0495670_0475673 Ga0495670_0475673_31_261 67
723 3300046694 Ga0495649_0126177 Ga0495649_0126177_433_663 67
724 3300047318 Ga0495636_0276255 Ga0495636_0276255_557_766 67
725 3300047445 Ga0495677_0250857 Ga0495677_0250857_111_314 67
726 3300047471 Ga0495684_1077541 Ga0495684_1077541_260_463 67
727 3300048091 Ga0495626_0037058 Ga0495626_0037058_413_643 67
728 3300048091 Ga0495626_0206489 Ga0495626_0206489_171_392 67
729 3300048912 Ga0496109_0752630 Ga0496109_0752630_560_772 67
730 3300048912 Ga0496109_1904097 Ga0496109_1904097_30_233 67
731 3300048915 Ga0496112_0729904 Ga0496112_0729904_243_476 67
732 3300048918 Ga0496115_1386511 Ga0496115_1386511_167_370 67
733 3300048920 Ga0496117_0366720 Ga0496117_0366720_494_727 67
734 3300048922 Ga0496119_0429408 Ga0496119_0429408_357_560 67
735 3300048923 Ga0496120_0077948 Ga0496120_0077948_572_775 67
736 3300048924 Ga0496121_0000043 Ga0496121_0000043_277865_278074 67
737 3300048925 Ga0496122_0003743 Ga0496122_0003743_11103_11312 67
738 3300048926 Ga0496123_0026380 Ga0496123_0026380_1328_1537 67
739 3300048926 Ga0496123_0478382 Ga0496123_0478382_129_362 67
740 3300048928 Ga0496125_0202025 Ga0496125_0202025_357_566 67
741 3300048929 Ga0496126_0000147 Ga0496126_0000147_28544_28747 67
742 3300049571 Ga0501034_0054677 Ga0501034_0054677_1273_1476 67
743 3300049574 Ga0501038_0033610 Ga0501038_0033610_3451_3666 67
744 3300049574 Ga0501038_1234583 Ga0501038_1234583_324_527 67
745 3300049588 Ga0501072_0221303 Ga0501072_0221303_1082_1288 67
746 3300049589 Ga0501073_0122609 Ga0501073_0122609_308_511 67
747 3300049650 Ga0501199_015872 Ga0501199_015872_312_515 67
748 3300049654 Ga0501207_012024 Ga0501207_012024_130_333 67
749 3300049668 Ga0501233_119268 Ga0501233_119268_460_663 67
750 3300049669 Ga0501235_046307 Ga0501235_046307_576_779 67
751 3300049679 Ga0501249_000072 Ga0501249_000072_5165_5368 67
752 3300049686 Ga0501257_033308 Ga0501257_033308_374_577 67
753 3300049686 Ga0501257_077793 Ga0501257_077793_414_617 67
754 3300049688 Ga0501259_113634 Ga0501259_113634_92_295 67
755 3300049690 Ga0501261_133231 Ga0501261_133231_242_451 67
756 3300049705 Ga0501225_0039216 Ga0501225_0039216_218_421 67
757 3300049742 Ga0501080_0019898 Ga0501080_0019898_5397_5600 67
758 3300049742 Ga0501080_0074841 Ga0501080_0074841_2624_2830 67
759 3300049743 Ga0501081_1022852 Ga0501081_1022852_25_240 67
760 3300049744 Ga0501083_0087030 Ga0501083_0087030_1678_1881 67
761 3300049779 Ga0501283_087991 Ga0501283_087991_206_409 67
762 3300049779 Ga0501283_133413 Ga0501283_133413_263_466 67
763 3300049850 Ga0501204_091885 Ga0501204_091885_118_321 67
764 3300050491 nmdc:mga00v17_229780_c1 nmdc:mga00v17_229780_c1_530_748 67
765 3300050493 nmdc:mga0k408_25140_c1 nmdc:mga0k408_25140_c1_1624_1830 67
766 3300050493 nmdc:mga0k408_92_c1 nmdc:mga0k408_92_c1_3070_3288 67
767 3300050494 nmdc:mga06z11_394_c1 nmdc:mga06z11_394_c1_14595_14813 67
768 3300050494 nmdc:mga06z11_73792_c1 nmdc:mga06z11_73792_c1_827_1030 67
769 3300050495 nmdc:mga04h51_16905_c1 nmdc:mga04h51_16905_c1_845_1063 67
770 3300050507 nmdc:mga05p37_11445_c1 nmdc:mga05p37_11445_c1_334_540 67
771 3300050507 nmdc:mga05p37_131822_c1 nmdc:mga05p37_131822_c1_2540_2743 67
772 3300050507 nmdc:mga05p37_191020_c1 nmdc:mga05p37_191020_c1_296_502 67
773 3300050507 nmdc:mga05p37_2245364_c1 nmdc:mga05p37_2245364_c1_82_288 67
774 3300050510 nmdc:mga06r32_97616_c1 nmdc:mga06r32_97616_c1_677_883 67
775 3300050511 nmdc:mga08y16_792497_c1 nmdc:mga08y16_792497_c1_202_405 67
776 3300050512 nmdc:mga0n895_1779448_c1 nmdc:mga0n895_1779448_c1_110_313 67
777 3300050515 nmdc:mga0a205_294425_c1 nmdc:mga0a205_294425_c1_1026_1229 67
778 3300053096 Ga0500641_0254615 Ga0500641_0254615_510_713 67
779 3300053108 Ga0500562_104616 Ga0500562_104616_459_680 67
780 3300053146 Ga0500588_0251839 Ga0500588_0251839_238_441 67
781 3300053153 Ga0500616_0062988 Ga0500616_0062988_1047_1253 67
782 3300053158 Ga0500627_0017659 Ga0500627_0017659_2422_2625 67
783 3300060353 Ga0501082_0546814 Ga0501082_0546814_628_831 67
784 3300060353 Ga0501082_1340075 Ga0501082_1340075_297_500 67

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

6

66

0.97

PF01381

HTH_3

Helix-turn-helix

9

60

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7t5u-assembly1.cif.gz_A structure of e. coli ms115-1 caph n-terminal domain 0.9039 6 58
1b0n-assembly1.cif.gz_A sinr protein/sini protein complex 0.9036 7 57
6rnz-assembly2.cif.gz_B crystal structure of the n-terminal hth dna-binding domain of the essential repressor ddro from radiation-resistant deinococcus bacteria (deinococcus deserti) 0.9004 6 56
6jq1-assembly1.cif.gz_A crystal structure of ddro from deinococcus geothermalis 0.8938 6 56
1r69-assembly1.cif.gz_A structure of the amino-terminal domain of phage 434 repressor at 2.0 angstroms resolution 0.8932 7 58
ID Description Score Start End Superfamily
3qq6B00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9058 6 58 1.10.260.40
1b0nA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9036 7 57 1.10.260.40
2b5aB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8953 6 58 1.10.260.40
2b5aC00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8948 6 58 1.10.260.40
3zkcB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8899 7 58 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A1T5GIX8-F1-model_v4 Putative transcriptional regulator 0.9726 2 67 GO:0003677
AF-A0A1Q6LVU2-F1-model_v4 deleted 0.9724 2 67
AF-F9MVV8-F1-model_v4 deleted 0.9721 3 67
AF-A0A1H9FDC5-F1-model_v4 Putative transcriptional regulator 0.9695 2 67 GO:0003677
AF-A0A6N3AWF2-F1-model_v4 HTH cro/C1-type domain-containing protein 0.9691 3 67 GO:0003677

Feature Viewer

pLDDT pTM Quality
85.51 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map