F480693
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 784 | 350 | 747 | 68 |
Family's Representative Sequence
| Representative Sequence | 3300025294|Ga0209025_1003012|Ga0209025_10030126 |
| Length | 71 |
| Sequence | MTIIVNIDVMLAKRKMSVTELSERIGITMANLSILKNGKAIRLSTLETICKALECQPGDVLEYRLDEDKPD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2512564039 | Paenibacillus mucilaginosus 3016 | Isolate | Rhizosphere |
| 3 | 2571042588 | Paenibacillus zanthoxyli JH29 | Isolate | Unclassified |
| 4 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 5 | 2600255286 | Paenibacillus sp. NFR01 | Isolate | Rhizoplane |
| 6 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 7 | 2775507177 | Bacillus sp. AFS055030 | Isolate | Unclassified |
| 8 | 2808606364 | Bacillus sp. SLBN-3 | Isolate | Unclassified |
| 9 | 2821111986 | Paenibacillus illinoisensis 582 | Isolate | Unclassified |
| 10 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 11 | 2852673933 | Sporosarcina sp. JAI121 | Isolate | Rhizosphere |
| 12 | 2857604169 | Domibacillus sp. R-71921 | Isolate | Unclassified |
| 13 | 2865002811 | Paenibacillus sp. R-74131 | Isolate | Unclassified |
| 14 | 2904113452 | Paenibacillus paridis py1325 | Isolate | Unclassified |
| 15 | 2907202186 | Paenibacillus sp. HJL G12 | Isolate | Unclassified |
| 16 | 2929233124 | Bacillus sp. R-74298 Hybrid assembly | Isolate | Unclassified |
| 17 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 18 | 2936340661 | Gottfriedia acidiceleris 1-17 | Isolate | Rhizosphere |
| 19 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 20 | 2964375228 | Anaerobacillus alkaliphilus B16-10 | Isolate | Rhizosphere |
| 21 | 2965761152 | Bacillus sp. COPE52 | Isolate | Unclassified |
| 22 | 2968558590 | Paenibacillus sp. P3E | Isolate | Rhizosphere |
| 23 | 2971403814 | Paenibacillus tritici LMG 29502 | Isolate | Unclassified |
| 24 | 2971410472 | Paenibacillus oryzisoli 1ZS3-15 | Isolate | Unclassified |
| 25 | 2971511577 | Paenibacillus apii 7124 | Isolate | Rhizosphere |
| 26 | 2979083700 | Bacillus toyonensis SORGH_AS 407 | Isolate | Unclassified |
| 27 | 2980176882 | Paenibacillus apii 7028 | Isolate | Rhizosphere |
| 28 | 2988225383 | Paenibacillus sp. P46E | Isolate | Rhizosphere |
| 29 | 3006826541 | Bacillus haikouensis CrR16 | Isolate | Unclassified |
| 30 | 3006978542 | Bacillus sp. FJAT-49705 | Isolate | Rhizosphere |
| 31 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 32 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 33 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 34 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 35 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 37 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 59 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 81 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 88 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 90 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 91 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 92 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 94 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 95 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 96 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 97 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 98 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 99 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 100 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 101 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 102 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 103 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 104 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 105 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 106 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 108 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 109 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 110 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 111 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 113 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 114 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 115 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 117 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 118 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 119 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 120 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 121 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 122 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 123 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 124 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 126 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 127 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 142 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 143 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 144 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 221 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 225 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 226 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 227 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 228 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 229 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 230 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 231 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 232 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 233 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 234 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 235 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 236 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 237 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 238 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 239 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 240 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 241 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 242 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 243 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 246 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 248 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 249 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 250 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 251 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 252 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 253 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 256 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 257 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 258 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 259 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 260 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 261 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 262 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 286 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 287 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 288 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 289 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 290 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 291 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 292 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 293 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 294 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 295 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 309 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 310 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 311 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 312 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 313 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 314 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 315 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 316 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 317 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 321 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 322 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 323 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 324 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 325 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 326 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 327 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 328 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 335 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 337 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 338 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 339 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 340 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 341 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 342 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 343 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 8002317523 | Cohnella sp. GbtcB17 | Isolate | Unclassified |
| 346 | 8022948649 | Bacillus endophyticus FH5 | Isolate | Rhizosphere |
| 347 | 8054280661 | Metabacillus kandeliae GX 13764 | Isolate | Rhizosphere |
| 348 | 8054465665 | Paenibacillus sonchi IIRRBNF1 | Isolate | Rhizosphere |
| 349 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
| 350 | 8057977335 | Paenibacillus oenotherae DT7-4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.28 |
| Metatranscriptomes | 0 |
| Isolates | 4.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.83 |
| Nodule | 0 |
| Rhizoplane | 0.89 |
| Rhizosphere | 90.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_241812 | 2162886012 | Bacteria | 858 |
| 2 | JGI24737J22298_10081403 | 3300001990 | Unclassified | 963 |
| 3 | JGI24034J26672_10111614 | 3300002239 | Bacteria | 523 |
| 4 | JGI25151J46595_10002839 | 3300003187 | Bacteria | 9978 |
| 5 | JGI25406J46586_10270816 | 3300003203 | Unclassified | 501 |
| 6 | Ga0065704_10156118 | 3300005289 | Bacteria | 1390 |
| 7 | Ga0065712_10161230 | 3300005290 | Bacteria | 1301 |
| 8 | Ga0065712_10658855 | 3300005290 | Bacteria | 564 |
| 9 | Ga0065715_10298803 | 3300005293 | Bacteria | 1046 |
| 10 | Ga0065715_10754867 | 3300005293 | Bacteria | 628 |
| 11 | Ga0065715_11173411 | 3300005293 | Bacteria | 504 |
| 12 | Ga0070658_10000503 | 3300005327 | Bacteria | 33889 |
| 13 | Ga0070658_10199276 | 3300005327 | Bacteria | 1689 |
| 14 | Ga0070658_10412436 | 3300005327 | Bacteria | 1161 |
| 15 | Ga0070658_11133758 | 3300005327 | Bacteria | 680 |
| 16 | Ga0070676_10170564 | 3300005328 | Bacteria | 1407 |
| 17 | Ga0070683_100078503 | 3300005329 | Bacteria | 3088 |
| 18 | Ga0070683_101245411 | 3300005329 | Bacteria | 715 |
| 19 | Ga0070683_101566709 | 3300005329 | Bacteria | 633 |
| 20 | Ga0070690_100229331 | 3300005330 | Bacteria | 1305 |
| 21 | Ga0070690_100392192 | 3300005330 | Bacteria | 1017 |
| 22 | Ga0070690_100443391 | 3300005330 | Bacteria | 961 |
| 23 | Ga0070690_100644834 | 3300005330 | Bacteria | 808 |
| 24 | Ga0070690_101388932 | 3300005330 | Bacteria | 565 |
| 25 | Ga0070670_100087163 | 3300005331 | Bacteria | 2683 |
| 26 | Ga0070670_100135395 | 3300005331 | Bacteria | 2129 |
| 27 | Ga0070670_100256689 | 3300005331 | Bacteria | 1523 |
| 28 | Ga0070670_100978334 | 3300005331 | Bacteria | 769 |
| 29 | Ga0070677_10606825 | 3300005333 | Bacteria | 607 |
| 30 | Ga0068869_100058007 | 3300005334 | Bacteria | 2829 |
| 31 | Ga0068869_100902591 | 3300005334 | Bacteria | 765 |
| 32 | Ga0068869_101008689 | 3300005334 | Bacteria | 725 |
| 33 | Ga0068869_101245198 | 3300005334 | Unclassified | 655 |
| 34 | Ga0068869_101258556 | 3300005334 | Bacteria | 652 |
| 35 | Ga0068869_101312832 | 3300005334 | Bacteria | 638 |
| 36 | Ga0068869_101807043 | 3300005334 | Bacteria | 547 |
| 37 | Ga0070666_10023040 | 3300005335 | Bacteria | 4049 |
| 38 | Ga0070666_10041127 | 3300005335 | Bacteria | 3088 |
| 39 | Ga0070666_10745546 | 3300005335 | Bacteria | 720 |
| 40 | Ga0070666_10767646 | 3300005335 | Bacteria | 709 |
| 41 | Ga0070680_100169601 | 3300005336 | Bacteria | 1836 |
| 42 | Ga0068868_100007182 | 3300005338 | Bacteria | 7914 |
| 43 | Ga0068868_100084077 | 3300005338 | Bacteria | 2556 |
| 44 | Ga0068868_100245120 | 3300005338 | Bacteria | 1507 |
| 45 | Ga0068868_100308293 | 3300005338 | Bacteria | 1346 |
| 46 | Ga0068868_100451833 | 3300005338 | Bacteria | 1118 |
| 47 | Ga0068868_101564616 | 3300005338 | Bacteria | 619 |
| 48 | Ga0068868_101635663 | 3300005338 | Bacteria | 606 |
| 49 | Ga0070660_100539583 | 3300005339 | Bacteria | 972 |
| 50 | Ga0070660_101946979 | 3300005339 | Bacteria | 501 |
| 51 | Ga0070689_100162330 | 3300005340 | Bacteria | 1807 |
| 52 | Ga0070689_100787178 | 3300005340 | Bacteria | 836 |
| 53 | Ga0070687_100668791 | 3300005343 | Bacteria | 722 |
| 54 | Ga0070687_100721512 | 3300005343 | Unclassified | 698 |
| 55 | Ga0070661_100393111 | 3300005344 | Bacteria | 1095 |
| 56 | Ga0070661_100447023 | 3300005344 | Bacteria | 1028 |
| 57 | Ga0070692_11316221 | 3300005345 | Bacteria | 519 |
| 58 | Ga0070668_100072580 | 3300005347 | Bacteria | 2682 |
| 59 | Ga0070668_100571823 | 3300005347 | Bacteria | 986 |
| 60 | Ga0070669_100256170 | 3300005353 | Bacteria | 1395 |
| 61 | Ga0070669_100458594 | 3300005353 | Bacteria | 1052 |
| 62 | Ga0070675_100142727 | 3300005354 | Bacteria | 2048 |
| 63 | Ga0070675_101329411 | 3300005354 | Bacteria | 662 |
| 64 | Ga0070671_100086629 | 3300005355 | Bacteria | 2621 |
| 65 | Ga0070671_100141336 | 3300005355 | Bacteria | 2031 |
| 66 | Ga0070671_100271116 | 3300005355 | Unclassified | 1443 |
| 67 | Ga0070671_100651167 | 3300005355 | Bacteria | 912 |
| 68 | Ga0070671_100921460 | 3300005355 | Bacteria | 764 |
| 69 | Ga0070671_100926429 | 3300005355 | Bacteria | 762 |
| 70 | Ga0070671_101920160 | 3300005355 | Bacteria | 527 |
| 71 | Ga0070673_100272930 | 3300005364 | Bacteria | 1481 |
| 72 | Ga0070673_100452422 | 3300005364 | Bacteria | 1155 |
| 73 | Ga0070673_100912714 | 3300005364 | Bacteria | 815 |
| 74 | Ga0070673_101911421 | 3300005364 | Bacteria | 563 |
| 75 | Ga0070688_100314494 | 3300005365 | Bacteria | 1136 |
| 76 | Ga0070659_100458799 | 3300005366 | Bacteria | 1082 |
| 77 | Ga0070659_100844934 | 3300005366 | Bacteria | 798 |
| 78 | Ga0070667_100002793 | 3300005367 | Bacteria | 15077 |
| 79 | Ga0070667_100472457 | 3300005367 | Bacteria | 1147 |
| 80 | Ga0070667_100769227 | 3300005367 | Bacteria | 893 |
| 81 | Ga0070667_100838710 | 3300005367 | Bacteria | 854 |
| 82 | Ga0070667_101465580 | 3300005367 | Bacteria | 641 |
| 83 | Ga0070714_100610352 | 3300005435 | Bacteria | 1048 |
| 84 | Ga0070714_101594768 | 3300005435 | Bacteria | 637 |
| 85 | Ga0070714_101937831 | 3300005435 | Unclassified | 575 |
| 86 | Ga0070713_101186234 | 3300005436 | Bacteria | 739 |
| 87 | Ga0070713_101310604 | 3300005436 | Bacteria | 702 |
| 88 | Ga0070710_10795186 | 3300005437 | Bacteria | 675 |
| 89 | Ga0070701_11346104 | 3300005438 | Bacteria | 512 |
| 90 | Ga0070711_100935608 | 3300005439 | Bacteria | 741 |
| 91 | Ga0070711_102060764 | 3300005439 | Bacteria | 502 |
| 92 | Ga0070705_100564675 | 3300005440 | Bacteria | 875 |
| 93 | Ga0070694_100437190 | 3300005444 | Bacteria | 1031 |
| 94 | Ga0070708_100501364 | 3300005445 | Bacteria | 1145 |
| 95 | Ga0070663_101027599 | 3300005455 | Bacteria | 718 |
| 96 | Ga0070678_101503567 | 3300005456 | Bacteria | 631 |
| 97 | Ga0070678_101532508 | 3300005456 | Bacteria | 625 |
| 98 | Ga0070662_100747599 | 3300005457 | Unclassified | 829 |
| 99 | Ga0070662_100770288 | 3300005457 | Bacteria | 817 |
| 100 | Ga0070662_101421206 | 3300005457 | Bacteria | 598 |
| 101 | Ga0070681_10047881 | 3300005458 | Bacteria | 4273 |
| 102 | Ga0070706_100576250 | 3300005467 | Bacteria | 1046 |
| 103 | Ga0070707_100827780 | 3300005468 | Bacteria | 890 |
| 104 | Ga0070698_100444719 | 3300005471 | Bacteria | 1231 |
| 105 | Ga0070698_100768311 | 3300005471 | Unclassified | 907 |
| 106 | Ga0070698_101955161 | 3300005471 | Unclassified | 539 |
| 107 | Ga0070699_100724340 | 3300005518 | Bacteria | 909 |
| 108 | Ga0070699_101808808 | 3300005518 | Bacteria | 559 |
| 109 | Ga0070679_101022291 | 3300005530 | Bacteria | 771 |
| 110 | Ga0070679_101162553 | 3300005530 | Bacteria | 717 |
| 111 | Ga0070679_101260278 | 3300005530 | Bacteria | 685 |
| 112 | Ga0070679_101841671 | 3300005530 | Bacteria | 554 |
| 113 | Ga0070684_100335819 | 3300005535 | Bacteria | 1389 |
| 114 | Ga0070684_101967143 | 3300005535 | Bacteria | 552 |
| 115 | Ga0070697_101053202 | 3300005536 | Bacteria | 723 |
| 116 | Ga0068853_100497642 | 3300005539 | Bacteria | 1150 |
| 117 | Ga0068853_100574938 | 3300005539 | Bacteria | 1069 |
| 118 | Ga0068853_101140503 | 3300005539 | Bacteria | 752 |
| 119 | Ga0068853_101716384 | 3300005539 | Bacteria | 609 |
| 120 | Ga0068853_102269131 | 3300005539 | Unclassified | 526 |
| 121 | Ga0070672_100471518 | 3300005543 | Bacteria | 1083 |
| 122 | Ga0070686_100116096 | 3300005544 | Bacteria | 1831 |
| 123 | Ga0070686_100334751 | 3300005544 | Bacteria | 1133 |
| 124 | Ga0070686_100871072 | 3300005544 | Bacteria | 731 |
| 125 | Ga0070686_101125407 | 3300005544 | Bacteria | 649 |
| 126 | Ga0070686_101474628 | 3300005544 | Bacteria | 573 |
| 127 | Ga0070695_100088704 | 3300005545 | Bacteria | 2060 |
| 128 | Ga0070695_100573088 | 3300005545 | Bacteria | 883 |
| 129 | Ga0070696_100157241 | 3300005546 | Bacteria | 1672 |
| 130 | Ga0070696_100744212 | 3300005546 | Bacteria | 803 |
| 131 | Ga0070665_101154780 | 3300005548 | Bacteria | 785 |
| 132 | Ga0070665_101178301 | 3300005548 | Bacteria | 777 |
| 133 | Ga0070704_100528738 | 3300005549 | Bacteria | 1027 |
| 134 | Ga0070704_100672590 | 3300005549 | Bacteria | 916 |
| 135 | Ga0070704_101260875 | 3300005549 | Bacteria | 675 |
| 136 | Ga0070704_101449384 | 3300005549 | Bacteria | 631 |
| 137 | Ga0068855_100957890 | 3300005563 | Bacteria | 901 |
| 138 | Ga0068855_101213315 | 3300005563 | Bacteria | 784 |
| 139 | Ga0070664_100008130 | 3300005564 | Bacteria | 8480 |
| 140 | Ga0070664_100129041 | 3300005564 | Bacteria | 2220 |
| 141 | Ga0070664_100973139 | 3300005564 | Bacteria | 797 |
| 142 | Ga0068857_100011013 | 3300005577 | Bacteria | 7874 |
| 143 | Ga0068857_100199292 | 3300005577 | Bacteria | 1825 |
| 144 | Ga0068857_101398863 | 3300005577 | Bacteria | 680 |
| 145 | Ga0068857_102523641 | 3300005577 | Bacteria | 505 |
| 146 | Ga0068854_100003839 | 3300005578 | Bacteria | 9412 |
| 147 | Ga0068854_101155293 | 3300005578 | Unclassified | 692 |
| 148 | Ga0068854_101543184 | 3300005578 | Bacteria | 604 |
| 149 | Ga0068856_100012947 | 3300005614 | Bacteria | 8075 |
| 150 | Ga0068856_100081781 | 3300005614 | Bacteria | 3205 |
| 151 | Ga0068856_100738087 | 3300005614 | Bacteria | 1005 |
| 152 | Ga0070702_100284963 | 3300005615 | Bacteria | 1136 |
| 153 | Ga0070702_101296198 | 3300005615 | Bacteria | 591 |
| 154 | Ga0068852_100099507 | 3300005616 | Bacteria | 2621 |
| 155 | Ga0068852_101421370 | 3300005616 | Bacteria | 716 |
| 156 | Ga0068852_102224509 | 3300005616 | Bacteria | 570 |
| 157 | Ga0068852_102835652 | 3300005616 | Bacteria | 503 |
| 158 | Ga0068859_100004003 | 3300005617 | Bacteria | 15022 |
| 159 | Ga0068859_100015657 | 3300005617 | Bacteria | 7621 |
| 160 | Ga0068859_100094224 | 3300005617 | Bacteria | 3046 |
| 161 | Ga0068859_100509971 | 3300005617 | Bacteria | 1298 |
| 162 | Ga0068859_100521956 | 3300005617 | Bacteria | 1283 |
| 163 | Ga0068864_100000699 | 3300005618 | Bacteria | 28153 |
| 164 | Ga0068864_100001921 | 3300005618 | Bacteria | 17059 |
| 165 | Ga0068864_100087203 | 3300005618 | Bacteria | 2747 |
| 166 | Ga0068864_100317836 | 3300005618 | Bacteria | 1462 |
| 167 | Ga0068864_100499037 | 3300005618 | Bacteria | 1170 |
| 168 | Ga0068864_100894203 | 3300005618 | Bacteria | 877 |
| 169 | Ga0068864_101495015 | 3300005618 | Bacteria | 678 |
| 170 | Ga0068861_100007458 | 3300005719 | Bacteria | 7496 |
| 171 | Ga0068861_101569281 | 3300005719 | Bacteria | 648 |
| 172 | Ga0068851_10105119 | 3300005834 | Bacteria | 1502 |
| 173 | Ga0068851_10207687 | 3300005834 | Bacteria | 1095 |
| 174 | Ga0068851_10622565 | 3300005834 | Bacteria | 659 |
| 175 | Ga0068870_10109067 | 3300005840 | Bacteria | 1577 |
| 176 | Ga0068870_10369002 | 3300005840 | Bacteria | 926 |
| 177 | Ga0068870_10484246 | 3300005840 | Bacteria | 822 |
| 178 | Ga0068863_100003791 | 3300005841 | Bacteria | 14948 |
| 179 | Ga0068863_101514157 | 3300005841 | Bacteria | 679 |
| 180 | Ga0068863_101594252 | 3300005841 | Bacteria | 662 |
| 181 | Ga0068863_101953137 | 3300005841 | Bacteria | 597 |
| 182 | Ga0068863_102393114 | 3300005841 | Bacteria | 538 |
| 183 | Ga0068863_102597047 | 3300005841 | Bacteria | 515 |
| 184 | Ga0068858_100001364 | 3300005842 | Bacteria | 25143 |
| 185 | Ga0068858_100144427 | 3300005842 | Bacteria | 2234 |
| 186 | Ga0068858_100186935 | 3300005842 | Bacteria | 1957 |
| 187 | Ga0068858_100523872 | 3300005842 | Bacteria | 1146 |
| 188 | Ga0068858_100536136 | 3300005842 | Bacteria | 1133 |
| 189 | Ga0068858_101700439 | 3300005842 | Bacteria | 623 |
| 190 | Ga0068858_102178841 | 3300005842 | Bacteria | 548 |
| 191 | Ga0068860_100001500 | 3300005843 | Bacteria | 25180 |
| 192 | Ga0068860_100564665 | 3300005843 | Bacteria | 1141 |
| 193 | Ga0068860_101300860 | 3300005843 | Bacteria | 748 |
| 194 | Ga0068860_102234569 | 3300005843 | Bacteria | 568 |
| 195 | Ga0068862_100026444 | 3300005844 | Bacteria | 4877 |
| 196 | Ga0068862_100059474 | 3300005844 | Bacteria | 3282 |
| 197 | Ga0068862_100313513 | 3300005844 | Unclassified | 1446 |
| 198 | Ga0068862_101555128 | 3300005844 | Bacteria | 668 |
| 199 | Ga0081455_10005340 | 3300005937 | Bacteria | 14111 |
| 200 | Ga0081455_10037013 | 3300005937 | Bacteria | 4337 |
| 201 | Ga0081455_10131971 | 3300005937 | Unclassified | 1952 |
| 202 | Ga0081455_10292715 | 3300005937 | Unclassified | 1171 |
| 203 | Ga0081540_1102018 | 3300005983 | Bacteria | 1233 |
| 204 | Ga0081540_1133542 | 3300005983 | Bacteria | 1009 |
| 205 | Ga0081539_10049991 | 3300005985 | Bacteria | 2368 |
| 206 | Ga0070717_10027369 | 3300006028 | Bacteria | 4557 |
| 207 | Ga0075365_10756325 | 3300006038 | Unclassified | 686 |
| 208 | Ga0075363_100109992 | 3300006048 | Bacteria | 1531 |
| 209 | Ga0075364_10269955 | 3300006051 | Bacteria | 1157 |
| 210 | Ga0075432_10240260 | 3300006058 | Bacteria | 731 |
| 211 | Ga0070712_100746246 | 3300006175 | Bacteria | 837 |
| 212 | Ga0075367_10000350 | 3300006178 | Bacteria | 16471 |
| 213 | Ga0075367_10095500 | 3300006178 | Bacteria | 1813 |
| 214 | Ga0075367_10529334 | 3300006178 | Bacteria | 748 |
| 215 | Ga0075367_11022751 | 3300006178 | Bacteria | 528 |
| 216 | Ga0075369_10439111 | 3300006186 | Bacteria | 617 |
| 217 | Ga0075366_10001505 | 3300006195 | Bacteria | 11630 |
| 218 | Ga0075366_10028424 | 3300006195 | Unclassified | 3282 |
| 219 | Ga0097621_100344160 | 3300006237 | Unclassified | 1324 |
| 220 | Ga0097621_100508702 | 3300006237 | Bacteria | 1092 |
| 221 | Ga0097621_101480867 | 3300006237 | Bacteria | 644 |
| 222 | Ga0068871_100063008 | 3300006358 | Bacteria | 3032 |
| 223 | Ga0068871_100092833 | 3300006358 | Bacteria | 2518 |
| 224 | Ga0068871_100405498 | 3300006358 | Bacteria | 1215 |
| 225 | Ga0068871_100684161 | 3300006358 | Bacteria | 939 |
| 226 | Ga0075428_100874560 | 3300006844 | Bacteria | 954 |
| 227 | Ga0075428_101930113 | 3300006844 | Bacteria | 613 |
| 228 | Ga0075430_101531390 | 3300006846 | Bacteria | 548 |
| 229 | Ga0075431_100085779 | 3300006847 | Bacteria | 3250 |
| 230 | Ga0075433_10501135 | 3300006852 | Bacteria | 1069 |
| 231 | Ga0075434_102509550 | 3300006871 | Bacteria | 517 |
| 232 | Ga0068865_102087380 | 3300006881 | Bacteria | 515 |
| 233 | Ga0075436_100551380 | 3300006914 | Bacteria | 846 |
| 234 | Ga0097620_100004003 | 3300006931 | Bacteria | 15022 |
| 235 | Ga0097620_100015657 | 3300006931 | Bacteria | 7621 |
| 236 | Ga0097620_100094227 | 3300006931 | Bacteria | 3046 |
| 237 | Ga0097620_100510046 | 3300006931 | Bacteria | 1298 |
| 238 | Ga0097620_100521950 | 3300006931 | Bacteria | 1283 |
| 239 | Ga0075435_100425468 | 3300007076 | Bacteria | 1144 |
| 240 | Ga0099795_10620005 | 3300007788 | Bacteria | 516 |
| 241 | Ga0105251_10138636 | 3300009011 | Bacteria | 1101 |
| 242 | Ga0105250_10010924 | 3300009092 | Bacteria | 3776 |
| 243 | Ga0105240_10537271 | 3300009093 | Unclassified | 1295 |
| 244 | Ga0105240_10572622 | 3300009093 | Bacteria | 1247 |
| 245 | Ga0105240_10638445 | 3300009093 | Bacteria | 1168 |
| 246 | Ga0105240_12227336 | 3300009093 | Bacteria | 568 |
| 247 | Ga0105240_12318175 | 3300009093 | Bacteria | 556 |
| 248 | Ga0105240_12814343 | 3300009093 | Bacteria | 500 |
| 249 | Ga0111539_10748300 | 3300009094 | Bacteria | 1138 |
| 250 | Ga0111539_11502800 | 3300009094 | Bacteria | 781 |
| 251 | Ga0105245_10024050 | 3300009098 | Bacteria | 5347 |
| 252 | Ga0105245_10282147 | 3300009098 | Bacteria | 1624 |
| 253 | Ga0105245_10340747 | 3300009098 | Bacteria | 1482 |
| 254 | Ga0105245_10591288 | 3300009098 | Bacteria | 1135 |
| 255 | Ga0105245_10751832 | 3300009098 | Bacteria | 1011 |
| 256 | Ga0105245_11699014 | 3300009098 | Bacteria | 683 |
| 257 | Ga0105245_11787038 | 3300009098 | Bacteria | 667 |
| 258 | Ga0105247_10017863 | 3300009101 | Bacteria | 4255 |
| 259 | Ga0105247_10033484 | 3300009101 | Bacteria | 3126 |
| 260 | Ga0105247_10649482 | 3300009101 | Bacteria | 788 |
| 261 | Ga0105247_11001755 | 3300009101 | Bacteria | 652 |
| 262 | Ga0105247_11361303 | 3300009101 | Bacteria | 573 |
| 263 | Ga0114129_10784244 | 3300009147 | Bacteria | 1217 |
| 264 | Ga0114129_11667977 | 3300009147 | Bacteria | 779 |
| 265 | Ga0114129_12642863 | 3300009147 | Bacteria | 599 |
| 266 | Ga0105243_10875039 | 3300009148 | Bacteria | 892 |
| 267 | Ga0105243_11103058 | 3300009148 | Bacteria | 802 |
| 268 | Ga0105243_11121885 | 3300009148 | Bacteria | 796 |
| 269 | Ga0105243_12534980 | 3300009148 | Bacteria | 552 |
| 270 | Ga0105241_10088123 | 3300009174 | Bacteria | 2444 |
| 271 | Ga0105241_10111985 | 3300009174 | Bacteria | 2186 |
| 272 | Ga0105241_10295680 | 3300009174 | Bacteria | 1388 |
| 273 | Ga0105242_10052792 | 3300009176 | Bacteria | 3318 |
| 274 | Ga0105242_12560495 | 3300009176 | Bacteria | 559 |
| 275 | Ga0105248_10005280 | 3300009177 | Bacteria | 14217 |
| 276 | Ga0105248_10031481 | 3300009177 | Bacteria | 5930 |
| 277 | Ga0105248_11053012 | 3300009177 | Bacteria | 919 |
| 278 | Ga0105248_11088664 | 3300009177 | Bacteria | 903 |
| 279 | Ga0105248_11755333 | 3300009177 | Bacteria | 704 |
| 280 | Ga0105248_12211483 | 3300009177 | Bacteria | 626 |
| 281 | Ga0105237_12056196 | 3300009545 | Bacteria | 580 |
| 282 | Ga0105238_10014096 | 3300009551 | Bacteria | 8083 |
| 283 | Ga0105238_10886559 | 3300009551 | Unclassified | 910 |
| 284 | Ga0105238_10993710 | 3300009551 | Bacteria | 860 |
| 285 | Ga0105238_11866223 | 3300009551 | Bacteria | 634 |
| 286 | Ga0105249_10003155 | 3300009553 | Bacteria | 14257 |
| 287 | Ga0105249_11036653 | 3300009553 | Unclassified | 890 |
| 288 | Ga0105249_11210990 | 3300009553 | Bacteria | 826 |
| 289 | Ga0105249_11549112 | 3300009553 | Bacteria | 735 |
| 290 | Ga0105249_12306592 | 3300009553 | Bacteria | 611 |
| 291 | Ga0105249_12904915 | 3300009553 | Bacteria | 550 |
| 292 | Ga0105032_112054 | 3300009979 | Bacteria | 693 |
| 293 | Ga0105147_108972 | 3300009982 | Bacteria | 849 |
| 294 | Ga0105028_100449 | 3300009993 | Bacteria | 4422 |
| 295 | Ga0105028_101043 | 3300009993 | Bacteria | 2925 |
| 296 | Ga0105239_10026828 | 3300010375 | Bacteria | 6340 |
| 297 | Ga0105239_10234893 | 3300010375 | Bacteria | 2057 |
| 298 | Ga0105239_10652915 | 3300010375 | Bacteria | 1202 |
| 299 | Ga0105239_11481683 | 3300010375 | Unclassified | 784 |
| 300 | Ga0105239_12077686 | 3300010375 | Bacteria | 660 |
| 301 | Ga0105239_13506989 | 3300010375 | Bacteria | 510 |
| 302 | Ga0105246_10050003 | 3300011119 | Bacteria | 2866 |
| 303 | Ga0105246_10562684 | 3300011119 | Bacteria | 979 |
| 304 | Ga0105246_11250469 | 3300011119 | Bacteria | 686 |
| 305 | Ga0105246_11727676 | 3300011119 | Bacteria | 595 |
| 306 | Ga0157373_10027245 | 3300013100 | Bacteria | 4123 |
| 307 | Ga0157373_10337199 | 3300013100 | Unclassified | 1074 |
| 308 | Ga0157373_10859638 | 3300013100 | Bacteria | 671 |
| 309 | Ga0157371_10144534 | 3300013102 | Bacteria | 1695 |
| 310 | Ga0157371_10592633 | 3300013102 | Bacteria | 824 |
| 311 | Ga0157370_10003091 | 3300013104 | Bacteria | 19703 |
| 312 | Ga0157370_10129075 | 3300013104 | Unclassified | 2359 |
| 313 | Ga0157370_10409557 | 3300013104 | Unclassified | 1248 |
| 314 | Ga0157370_10638133 | 3300013104 | Bacteria | 974 |
| 315 | Ga0157370_11549961 | 3300013104 | Bacteria | 595 |
| 316 | Ga0157369_10090313 | 3300013105 | Bacteria | 3270 |
| 317 | Ga0157369_10194244 | 3300013105 | Bacteria | 2132 |
| 318 | Ga0157369_10350564 | 3300013105 | Bacteria | 1533 |
| 319 | Ga0157369_10787378 | 3300013105 | Bacteria | 977 |
| 320 | Ga0157369_10795951 | 3300013105 | Bacteria | 971 |
| 321 | Ga0157369_11424394 | 3300013105 | Bacteria | 705 |
| 322 | Ga0157369_12304133 | 3300013105 | Bacteria | 546 |
| 323 | Ga0157369_12484025 | 3300013105 | Bacteria | 525 |
| 324 | Ga0157374_10000651 | 3300013296 | Bacteria | 30638 |
| 325 | Ga0157374_10010838 | 3300013296 | Bacteria | 7866 |
| 326 | Ga0157374_10012997 | 3300013296 | Bacteria | 7258 |
| 327 | Ga0157374_10381809 | 3300013296 | Bacteria | 1403 |
| 328 | Ga0157374_10382606 | 3300013296 | Bacteria | 1402 |
| 329 | Ga0157374_10775673 | 3300013296 | Bacteria | 974 |
| 330 | Ga0157374_10896486 | 3300013296 | Bacteria | 904 |
| 331 | Ga0157374_10933704 | 3300013296 | Bacteria | 886 |
| 332 | Ga0157374_10959708 | 3300013296 | Bacteria | 874 |
| 333 | Ga0157374_11792342 | 3300013296 | Unclassified | 639 |
| 334 | Ga0157374_12140040 | 3300013296 | Bacteria | 586 |
| 335 | Ga0157378_10016043 | 3300013297 | Bacteria | 6561 |
| 336 | Ga0157378_10022421 | 3300013297 | Bacteria | 5559 |
| 337 | Ga0157378_10298955 | 3300013297 | Bacteria | 1557 |
| 338 | Ga0157378_10492754 | 3300013297 | Bacteria | 1223 |
| 339 | Ga0157378_10837221 | 3300013297 | Bacteria | 948 |
| 340 | Ga0157378_10849249 | 3300013297 | Bacteria | 941 |
| 341 | Ga0157378_11018339 | 3300013297 | Bacteria | 863 |
| 342 | Ga0157378_11187585 | 3300013297 | Bacteria | 802 |
| 343 | Ga0157378_11477792 | 3300013297 | Bacteria | 724 |
| 344 | Ga0157378_11561909 | 3300013297 | Bacteria | 705 |
| 345 | Ga0157378_12137939 | 3300013297 | Bacteria | 611 |
| 346 | Ga0157378_12475139 | 3300013297 | Bacteria | 571 |
| 347 | Ga0163162_10013461 | 3300013306 | Bacteria | 7984 |
| 348 | Ga0163162_10119839 | 3300013306 | Bacteria | 2735 |
| 349 | Ga0163162_10198693 | 3300013306 | Bacteria | 2134 |
| 350 | Ga0163162_10836146 | 3300013306 | Bacteria | 1036 |
| 351 | Ga0163162_11191862 | 3300013306 | Bacteria | 864 |
| 352 | Ga0163162_11315797 | 3300013306 | Bacteria | 821 |
| 353 | Ga0163162_12263718 | 3300013306 | Bacteria | 624 |
| 354 | Ga0163162_13282939 | 3300013306 | Bacteria | 518 |
| 355 | Ga0157372_10001400 | 3300013307 | Bacteria | 26003 |
| 356 | Ga0157372_10276602 | 3300013307 | Bacteria | 1952 |
| 357 | Ga0157372_11073579 | 3300013307 | Bacteria | 932 |
| 358 | Ga0157372_11135566 | 3300013307 | Bacteria | 904 |
| 359 | Ga0157372_11184058 | 3300013307 | Bacteria | 883 |
| 360 | Ga0157372_11471805 | 3300013307 | Unclassified | 785 |
| 361 | Ga0157375_10014421 | 3300013308 | Bacteria | 7050 |
| 362 | Ga0157375_10015271 | 3300013308 | Bacteria | 6872 |
| 363 | Ga0157375_10172707 | 3300013308 | Bacteria | 2310 |
| 364 | Ga0157375_10688917 | 3300013308 | Bacteria | 1176 |
| 365 | Ga0157375_11464537 | 3300013308 | Bacteria | 805 |
| 366 | Ga0157375_13414869 | 3300013308 | Bacteria | 529 |
| 367 | Ga0163163_10000140 | 3300014325 | Bacteria | 74966 |
| 368 | Ga0163163_10000412 | 3300014325 | Bacteria | 40056 |
| 369 | Ga0163163_10395622 | 3300014325 | Bacteria | 1440 |
| 370 | Ga0163163_10646288 | 3300014325 | Bacteria | 1121 |
| 371 | Ga0163163_10905750 | 3300014325 | Bacteria | 945 |
| 372 | Ga0163163_11579672 | 3300014325 | Bacteria | 717 |
| 373 | Ga0163163_12827877 | 3300014325 | Bacteria | 542 |
| 374 | Ga0157380_13451536 | 3300014326 | Bacteria | 506 |
| 375 | Ga0157377_10025131 | 3300014745 | Bacteria | 3174 |
| 376 | Ga0157379_10010309 | 3300014968 | Bacteria | 8138 |
| 377 | Ga0157379_10133912 | 3300014968 | Bacteria | 2232 |
| 378 | Ga0157379_10234448 | 3300014968 | Bacteria | 1664 |
| 379 | Ga0157379_10265734 | 3300014968 | Bacteria | 1560 |
| 380 | Ga0157379_10381296 | 3300014968 | Bacteria | 1294 |
| 381 | Ga0157376_10083065 | 3300014969 | Bacteria | 2754 |
| 382 | Ga0157376_10096279 | 3300014969 | Unclassified | 2576 |
| 383 | Ga0157376_11340603 | 3300014969 | Bacteria | 746 |
| 384 | Ga0157376_12614354 | 3300014969 | Bacteria | 545 |
| 385 | Ga0163161_10712248 | 3300017792 | Bacteria | 837 |
| 386 | Ga0163161_10760959 | 3300017792 | Bacteria | 811 |
| 387 | Ga0163161_11142916 | 3300017792 | Bacteria | 671 |
| 388 | Ga0163161_11632194 | 3300017792 | Bacteria | 569 |
| 389 | Ga0209025_1003012 | 3300025294 | Bacteria | 16658 |
| 390 | Ga0207697_10094189 | 3300025315 | Bacteria | 1271 |
| 391 | Ga0207697_10247743 | 3300025315 | Unclassified | 788 |
| 392 | Ga0207697_10562651 | 3300025315 | Bacteria | 501 |
| 393 | Ga0207656_10111536 | 3300025321 | Bacteria | 1264 |
| 394 | Ga0207656_10223911 | 3300025321 | Bacteria | 915 |
| 395 | Ga0207696_1014686 | 3300025711 | Bacteria | 2678 |
| 396 | Ga0207642_10728983 | 3300025899 | Bacteria | 626 |
| 397 | Ga0207710_10016171 | 3300025900 | Bacteria | 3156 |
| 398 | Ga0207710_10018201 | 3300025900 | Bacteria | 2986 |
| 399 | Ga0207688_10486369 | 3300025901 | Bacteria | 772 |
| 400 | Ga0207680_10043146 | 3300025903 | Bacteria | 2643 |
| 401 | Ga0207680_10108229 | 3300025903 | Bacteria | 1798 |
| 402 | Ga0207680_10138914 | 3300025903 | Bacteria | 1609 |
| 403 | Ga0207680_10810953 | 3300025903 | Bacteria | 671 |
| 404 | Ga0207647_10012819 | 3300025904 | Bacteria | 5824 |
| 405 | Ga0207685_10123871 | 3300025905 | Bacteria | 1138 |
| 406 | Ga0207645_11144133 | 3300025907 | Bacteria | 524 |
| 407 | Ga0207643_10088991 | 3300025908 | Bacteria | 1798 |
| 408 | Ga0207643_10748674 | 3300025908 | Bacteria | 632 |
| 409 | Ga0207705_10007203 | 3300025909 | Bacteria | 8192 |
| 410 | Ga0207705_10993598 | 3300025909 | Bacteria | 648 |
| 411 | Ga0207654_10807594 | 3300025911 | Bacteria | 678 |
| 412 | Ga0207707_10114076 | 3300025912 | Bacteria | 2362 |
| 413 | Ga0207707_10978585 | 3300025912 | Bacteria | 695 |
| 414 | Ga0207695_10061162 | 3300025913 | Bacteria | 3894 |
| 415 | Ga0207695_10841816 | 3300025913 | Bacteria | 797 |
| 416 | Ga0207660_10326218 | 3300025917 | Bacteria | 1227 |
| 417 | Ga0207660_11370930 | 3300025917 | Bacteria | 573 |
| 418 | Ga0207662_10358055 | 3300025918 | Bacteria | 981 |
| 419 | Ga0207662_10443483 | 3300025918 | Bacteria | 886 |
| 420 | Ga0207662_10969643 | 3300025918 | Bacteria | 603 |
| 421 | Ga0207657_11321500 | 3300025919 | Bacteria | 544 |
| 422 | Ga0207649_10333712 | 3300025920 | Unclassified | 1118 |
| 423 | Ga0207649_10634158 | 3300025920 | Bacteria | 824 |
| 424 | Ga0207652_10844363 | 3300025921 | Bacteria | 811 |
| 425 | Ga0207652_11005627 | 3300025921 | Unclassified | 733 |
| 426 | Ga0207681_10074149 | 3300025923 | Bacteria | 2383 |
| 427 | Ga0207681_11295325 | 3300025923 | Bacteria | 612 |
| 428 | Ga0207694_10066924 | 3300025924 | Bacteria | 2803 |
| 429 | Ga0207694_10984261 | 3300025924 | Unclassified | 714 |
| 430 | Ga0207650_10181630 | 3300025925 | Bacteria | 1677 |
| 431 | Ga0207650_10218070 | 3300025925 | Unclassified | 1534 |
| 432 | Ga0207650_10594062 | 3300025925 | Bacteria | 930 |
| 433 | Ga0207650_11508266 | 3300025925 | Bacteria | 571 |
| 434 | Ga0207650_11842753 | 3300025925 | Bacteria | 511 |
| 435 | Ga0207659_10255513 | 3300025926 | Bacteria | 1423 |
| 436 | Ga0207659_10606940 | 3300025926 | Bacteria | 933 |
| 437 | Ga0207687_10026842 | 3300025927 | Bacteria | 3859 |
| 438 | Ga0207687_10154658 | 3300025927 | Bacteria | 1753 |
| 439 | Ga0207700_10251859 | 3300025928 | Bacteria | 1509 |
| 440 | Ga0207664_10835921 | 3300025929 | Bacteria | 828 |
| 441 | Ga0207644_10021845 | 3300025931 | Bacteria | 4364 |
| 442 | Ga0207644_10099645 | 3300025931 | Bacteria | 2181 |
| 443 | Ga0207644_10338089 | 3300025931 | Bacteria | 1220 |
| 444 | Ga0207644_11064009 | 3300025931 | Bacteria | 680 |
| 445 | Ga0207644_11219072 | 3300025931 | Bacteria | 632 |
| 446 | Ga0207706_11052936 | 3300025933 | Bacteria | 682 |
| 447 | Ga0207706_11519886 | 3300025933 | Bacteria | 545 |
| 448 | Ga0207706_11562093 | 3300025933 | Bacteria | 536 |
| 449 | Ga0207686_10142853 | 3300025934 | Bacteria | 1657 |
| 450 | Ga0207686_10383054 | 3300025934 | Bacteria | 1067 |
| 451 | Ga0207670_10086769 | 3300025936 | Bacteria | 2203 |
| 452 | Ga0207670_10124712 | 3300025936 | Bacteria | 1878 |
| 453 | Ga0207670_10956363 | 3300025936 | Bacteria | 719 |
| 454 | Ga0207669_11412727 | 3300025937 | Bacteria | 593 |
| 455 | Ga0207704_10878767 | 3300025938 | Bacteria | 753 |
| 456 | Ga0207704_10972932 | 3300025938 | Bacteria | 717 |
| 457 | Ga0207691_11197353 | 3300025940 | Unclassified | 630 |
| 458 | Ga0207711_10000307 | 3300025941 | Bacteria | 52746 |
| 459 | Ga0207711_10197913 | 3300025941 | Bacteria | 1833 |
| 460 | Ga0207711_10686948 | 3300025941 | Bacteria | 955 |
| 461 | Ga0207711_11132845 | 3300025941 | Bacteria | 723 |
| 462 | Ga0207711_11298347 | 3300025941 | Bacteria | 670 |
| 463 | Ga0207711_11780069 | 3300025941 | Bacteria | 559 |
| 464 | Ga0207689_10116560 | 3300025942 | Bacteria | 2196 |
| 465 | Ga0207689_10343202 | 3300025942 | Bacteria | 1241 |
| 466 | Ga0207689_10531405 | 3300025942 | Bacteria | 987 |
| 467 | Ga0207689_11041444 | 3300025942 | Bacteria | 690 |
| 468 | Ga0207661_10067519 | 3300025944 | Bacteria | 2909 |
| 469 | Ga0207661_10143088 | 3300025944 | Bacteria | 2060 |
| 470 | Ga0207679_10005785 | 3300025945 | Bacteria | 7762 |
| 471 | Ga0207679_10065423 | 3300025945 | Bacteria | 2721 |
| 472 | Ga0207679_11057354 | 3300025945 | Bacteria | 744 |
| 473 | Ga0207679_11503905 | 3300025945 | Bacteria | 617 |
| 474 | Ga0207667_10069308 | 3300025949 | Bacteria | 3671 |
| 475 | Ga0207667_10637120 | 3300025949 | Bacteria | 1072 |
| 476 | Ga0207667_11743067 | 3300025949 | Bacteria | 588 |
| 477 | Ga0207651_10149806 | 3300025960 | Bacteria | 1814 |
| 478 | Ga0207651_10348135 | 3300025960 | Bacteria | 1247 |
| 479 | Ga0207651_11786524 | 3300025960 | Bacteria | 553 |
| 480 | Ga0207651_12021311 | 3300025960 | Bacteria | 518 |
| 481 | Ga0207712_10011723 | 3300025961 | Bacteria | 5589 |
| 482 | Ga0207712_10029309 | 3300025961 | Bacteria | 3691 |
| 483 | Ga0207712_10314705 | 3300025961 | Bacteria | 1289 |
| 484 | Ga0207712_10550940 | 3300025961 | Unclassified | 992 |
| 485 | Ga0207668_10086815 | 3300025972 | Bacteria | 2287 |
| 486 | Ga0207668_10290440 | 3300025972 | Bacteria | 1345 |
| 487 | Ga0207668_11234810 | 3300025972 | Bacteria | 672 |
| 488 | Ga0207640_10033935 | 3300025981 | Bacteria | 3180 |
| 489 | Ga0207640_10583083 | 3300025981 | Unclassified | 944 |
| 490 | Ga0207640_10597757 | 3300025981 | Bacteria | 933 |
| 491 | Ga0207640_11173914 | 3300025981 | Bacteria | 682 |
| 492 | Ga0207658_10001500 | 3300025986 | Bacteria | 18142 |
| 493 | Ga0207658_10311435 | 3300025986 | Bacteria | 1360 |
| 494 | Ga0207677_10073284 | 3300026023 | Bacteria | 2424 |
| 495 | Ga0207677_10294708 | 3300026023 | Bacteria | 1338 |
| 496 | Ga0207677_10382922 | 3300026023 | Bacteria | 1188 |
| 497 | Ga0207677_11282408 | 3300026023 | Bacteria | 672 |
| 498 | Ga0207703_10005721 | 3300026035 | Bacteria | 9962 |
| 499 | Ga0207703_10136675 | 3300026035 | Bacteria | 2122 |
| 500 | Ga0207703_10174909 | 3300026035 | Bacteria | 1891 |
| 501 | Ga0207703_10283935 | 3300026035 | Bacteria | 1504 |
| 502 | Ga0207703_10442510 | 3300026035 | Bacteria | 1213 |
| 503 | Ga0207703_10477614 | 3300026035 | Bacteria | 1168 |
| 504 | Ga0207703_12141841 | 3300026035 | Bacteria | 535 |
| 505 | Ga0207639_10363117 | 3300026041 | Bacteria | 1296 |
| 506 | Ga0207639_10442726 | 3300026041 | Bacteria | 1178 |
| 507 | Ga0207639_11682373 | 3300026041 | Unclassified | 595 |
| 508 | Ga0207678_10656193 | 3300026067 | Bacteria | 922 |
| 509 | Ga0207708_10670720 | 3300026075 | Bacteria | 884 |
| 510 | Ga0207708_10931890 | 3300026075 | Bacteria | 753 |
| 511 | Ga0207702_10009019 | 3300026078 | Bacteria | 8399 |
| 512 | Ga0207702_10130275 | 3300026078 | Bacteria | 2263 |
| 513 | Ga0207702_10680747 | 3300026078 | Bacteria | 1013 |
| 514 | Ga0207702_11275604 | 3300026078 | Bacteria | 729 |
| 515 | Ga0207702_11668010 | 3300026078 | Unclassified | 630 |
| 516 | Ga0207641_10001412 | 3300026088 | Bacteria | 23683 |
| 517 | Ga0207641_10058605 | 3300026088 | Bacteria | 3278 |
| 518 | Ga0207641_10113016 | 3300026088 | Bacteria | 2410 |
| 519 | Ga0207641_10718227 | 3300026088 | Bacteria | 985 |
| 520 | Ga0207641_10774296 | 3300026088 | Bacteria | 948 |
| 521 | Ga0207641_10873570 | 3300026088 | Bacteria | 892 |
| 522 | Ga0207641_10946859 | 3300026088 | Bacteria | 856 |
| 523 | Ga0207641_11874414 | 3300026088 | Bacteria | 601 |
| 524 | Ga0207641_12159222 | 3300026088 | Bacteria | 557 |
| 525 | Ga0207648_10270686 | 3300026089 | Bacteria | 1517 |
| 526 | Ga0207648_10856826 | 3300026089 | Bacteria | 848 |
| 527 | Ga0207676_10002011 | 3300026095 | Bacteria | 14810 |
| 528 | Ga0207676_10046801 | 3300026095 | Bacteria | 3349 |
| 529 | Ga0207676_10269508 | 3300026095 | Bacteria | 1541 |
| 530 | Ga0207676_10921042 | 3300026095 | Bacteria | 858 |
| 531 | Ga0207676_10938281 | 3300026095 | Bacteria | 850 |
| 532 | Ga0207676_11633095 | 3300026095 | Bacteria | 642 |
| 533 | Ga0207674_10000905 | 3300026116 | Bacteria | 38684 |
| 534 | Ga0207674_10167732 | 3300026116 | Bacteria | 2149 |
| 535 | Ga0207674_11142759 | 3300026116 | Bacteria | 748 |
| 536 | Ga0207674_11663046 | 3300026116 | Bacteria | 607 |
| 537 | Ga0207675_100016334 | 3300026118 | Bacteria | 6929 |
| 538 | Ga0207675_100068024 | 3300026118 | Bacteria | 3330 |
| 539 | Ga0207675_100895716 | 3300026118 | Bacteria | 903 |
| 540 | Ga0207675_101204067 | 3300026118 | Bacteria | 778 |
| 541 | Ga0207675_101383745 | 3300026118 | Bacteria | 724 |
| 542 | Ga0207675_101429820 | 3300026118 | Bacteria | 712 |
| 543 | Ga0207675_102747646 | 3300026118 | Bacteria | 500 |
| 544 | Ga0207683_11002682 | 3300026121 | Bacteria | 775 |
| 545 | Ga0207683_11024975 | 3300026121 | Bacteria | 766 |
| 546 | Ga0207683_11841687 | 3300026121 | Bacteria | 554 |
| 547 | Ga0207698_10052318 | 3300026142 | Bacteria | 3128 |
| 548 | Ga0207698_11227259 | 3300026142 | Bacteria | 764 |
| 549 | Ga0209813_10127343 | 3300027866 | Bacteria | 892 |
| 550 | Ga0207428_10875236 | 3300027907 | Bacteria | 635 |
| 551 | Ga0268266_11524383 | 3300028379 | Bacteria | 644 |
| 552 | Ga0268265_10193074 | 3300028380 | Bacteria | 1760 |
| 553 | Ga0268265_10588012 | 3300028380 | Bacteria | 1062 |
| 554 | Ga0268265_11183290 | 3300028380 | Bacteria | 761 |
| 555 | Ga0268265_11207806 | 3300028380 | Bacteria | 754 |
| 556 | Ga0268264_10001167 | 3300028381 | Bacteria | 25555 |
| 557 | Ga0268264_10065240 | 3300028381 | Bacteria | 3067 |
| 558 | Ga0268264_10267320 | 3300028381 | Bacteria | 1596 |
| 559 | Ga0268264_12393954 | 3300028381 | Bacteria | 534 |
| 560 | Ga0268264_12394631 | 3300028381 | Bacteria | 534 |
| 561 | Ga0316179_1070387 | 3300030734 | Bacteria | 9823 |
| 562 | Ga0316183_1175878 | 3300030742 | Bacteria | 17011 |
| 563 | Ga0316181_1060641 | 3300030744 | Bacteria | 622 |
| 564 | Ga0316182_1132274 | 3300030745 | Bacteria | 2582 |
| 565 | Ga0316182_1185667 | 3300030745 | Bacteria | 722 |
| 566 | Ga0307513_10347931 | 3300031456 | Bacteria | 1231 |
| 567 | Ga0307513_10689110 | 3300031456 | Bacteria | 728 |
| 568 | Ga0307509_10036874 | 3300031507 | Bacteria | 5349 |
| 569 | Ga0307408_100162823 | 3300031548 | Bacteria | 1773 |
| 570 | Ga0307516_10280382 | 3300031730 | Bacteria | 1349 |
| 571 | Ga0307405_10005875 | 3300031731 | Bacteria | 5976 |
| 572 | Ga0307405_10120776 | 3300031731 | Bacteria | 1793 |
| 573 | Ga0307413_10099064 | 3300031824 | Bacteria | 1920 |
| 574 | Ga0307413_10177532 | 3300031824 | Bacteria | 1514 |
| 575 | Ga0307413_10519951 | 3300031824 | Unclassified | 959 |
| 576 | Ga0307413_10758610 | 3300031824 | Bacteria | 812 |
| 577 | Ga0307410_10009191 | 3300031852 | Bacteria | 5530 |
| 578 | Ga0307410_10047837 | 3300031852 | Unclassified | 2861 |
| 579 | Ga0307410_11010409 | 3300031852 | Bacteria | 717 |
| 580 | Ga0307410_11252994 | 3300031852 | Bacteria | 647 |
| 581 | Ga0307406_10054133 | 3300031901 | Unclassified | 2560 |
| 582 | Ga0307406_10760134 | 3300031901 | Bacteria | 814 |
| 583 | Ga0307407_10308441 | 3300031903 | Bacteria | 1106 |
| 584 | Ga0307407_10516863 | 3300031903 | Bacteria | 877 |
| 585 | Ga0307407_11610536 | 3300031903 | Bacteria | 515 |
| 586 | Ga0307412_10052660 | 3300031911 | Bacteria | 2696 |
| 587 | Ga0307412_10055154 | 3300031911 | Unclassified | 2642 |
| 588 | Ga0307412_10330856 | 3300031911 | Unclassified | 1216 |
| 589 | Ga0307409_100174244 | 3300031995 | Bacteria | 1897 |
| 590 | Ga0307409_100409525 | 3300031995 | Unclassified | 1297 |
| 591 | Ga0307409_100442390 | 3300031995 | Unclassified | 1253 |
| 592 | Ga0307409_101081727 | 3300031995 | Bacteria | 822 |
| 593 | Ga0307409_102885840 | 3300031995 | Bacteria | 508 |
| 594 | Ga0307416_101117802 | 3300032002 | Bacteria | 893 |
| 595 | Ga0307416_101372137 | 3300032002 | Bacteria | 812 |
| 596 | Ga0307416_101526986 | 3300032002 | Unclassified | 773 |
| 597 | Ga0307414_10242421 | 3300032004 | Bacteria | 1493 |
| 598 | Ga0307414_11896231 | 3300032004 | Unclassified | 556 |
| 599 | Ga0307411_10216273 | 3300032005 | Bacteria | 1483 |
| 600 | Ga0307411_10767803 | 3300032005 | Bacteria | 846 |
| 601 | Ga0307411_11703893 | 3300032005 | Unclassified | 583 |
| 602 | Ga0307411_12216140 | 3300032005 | Bacteria | 515 |
| 603 | Ga0307415_100073574 | 3300032126 | Bacteria | 2411 |
| 604 | Ga0307415_100084187 | 3300032126 | Bacteria | 2281 |
| 605 | Ga0307415_100146132 | 3300032126 | Unclassified | 1813 |
| 606 | Ga0307415_100400494 | 3300032126 | Unclassified | 1172 |
| 607 | Ga0307415_102136572 | 3300032126 | Bacteria | 547 |
| 608 | Ga0373923_0232869 | 3300035111 | Bacteria | 859 |
| 609 | Ga0373955_0587812 | 3300035172 | Bacteria | 682 |
| 610 | Ga0373933_0509509 | 3300035724 | Bacteria | 789 |
| 611 | Ga0373937_0328105 | 3300036401 | Bacteria | 1448 |
| 612 | Ga0395900_0110055 | 3300037418 | Bacteria | 2830 |
| 613 | Ga0395898_0536127 | 3300037466 | Bacteria | 1112 |
| 614 | Ga0395905_0092323 | 3300037471 | Bacteria | 2839 |
| 615 | Ga0395901_0855182 | 3300038443 | Bacteria | 895 |
| 616 | Ga0439436_0006432 | 3300041404 | Bacteria | 3608 |
| 617 | Ga0439439_0004220 | 3300041406 | Bacteria | 3224 |
| 618 | Ga0451797_0891978 | 3300041453 | Bacteria | 685 |
| 619 | Ga0451807_1584278 | 3300041486 | Bacteria | 1069 |
| 620 | Ga0451845_0238394 | 3300041501 | Bacteria | 570 |
| 621 | Ga0451855_1054290 | 3300041511 | Bacteria | 558 |
| 622 | Ga0439457_003541 | 3300042014 | Bacteria | 4238 |
| 623 | Ga0451577_0114372 | 3300042876 | Unclassified | 2416 |
| 624 | Ga0451577_1429898 | 3300042876 | Unclassified | 613 |
| 625 | Ga0453683_0000035 | 3300044673 | Bacteria | 234280 |
| 626 | Ga0453683_0033984 | 3300044673 | Bacteria | 3215 |
| 627 | Ga0453683_0107942 | 3300044673 | Unclassified | 1750 |
| 628 | Ga0453683_0271067 | 3300044673 | Bacteria | 1083 |
| 629 | Ga0453683_0536856 | 3300044673 | Bacteria | 760 |
| 630 | Ga0453684_0000128 | 3300044712 | Bacteria | 335864 |
| 631 | Ga0453684_0052392 | 3300044712 | Bacteria | 5337 |
| 632 | Ga0453684_0220157 | 3300044712 | Bacteria | 2199 |
| 633 | Ga0451576_0002081 | 3300045051 | Bacteria | 31274 |
| 634 | Ga0451576_0239300 | 3300045051 | Bacteria | 1896 |
| 635 | Ga0451576_0658395 | 3300045051 | Unclassified | 1100 |
| 636 | Ga0451576_0660059 | 3300045051 | Bacteria | 1099 |
| 637 | Ga0451576_1065587 | 3300045051 | Bacteria | 846 |
| 638 | Ga0451576_1196528 | 3300045051 | Bacteria | 794 |
| 639 | Ga0451576_2048915 | 3300045051 | Bacteria | 589 |
| 640 | Ga0495638_0237313 | 3300046460 | Bacteria | 1011 |
| 641 | Ga0495650_0000006 | 3300046471 | Bacteria | 721347 |
| 642 | Ga0495650_0042209 | 3300046471 | Bacteria | 1943 |
| 643 | Ga0495584_0247089 | 3300046491 | Bacteria | 907 |
| 644 | Ga0495606_0330341 | 3300046507 | Bacteria | 816 |
| 645 | Ga0495608_0889861 | 3300046511 | Bacteria | 522 |
| 646 | Ga0495616_0108921 | 3300046513 | Bacteria | 1289 |
| 647 | Ga0495640_0730626 | 3300046533 | Bacteria | 593 |
| 648 | Ga0495586_0673226 | 3300046535 | Bacteria | 598 |
| 649 | Ga0495598_0020876 | 3300046537 | Bacteria | 1735 |
| 650 | Ga0495598_0159068 | 3300046537 | Bacteria | 793 |
| 651 | Ga0495597_0298992 | 3300046542 | Bacteria | 625 |
| 652 | Ga0495645_0179284 | 3300046543 | Bacteria | 1453 |
| 653 | Ga0495645_0475395 | 3300046543 | Bacteria | 785 |
| 654 | Ga0495656_0198312 | 3300046615 | Bacteria | 995 |
| 655 | Ga0495668_0787192 | 3300046616 | Bacteria | 527 |
| 656 | Ga0495659_0177207 | 3300046664 | Bacteria | 867 |
| 657 | Ga0495661_0276371 | 3300046665 | Bacteria | 848 |
| 658 | Ga0495669_0145835 | 3300046684 | Bacteria | 1119 |
| 659 | Ga0495670_0475673 | 3300046691 | Bacteria | 678 |
| 660 | Ga0495649_0126177 | 3300046694 | Bacteria | 1352 |
| 661 | Ga0495636_0276255 | 3300047318 | Bacteria | 782 |
| 662 | Ga0495677_0250857 | 3300047445 | Bacteria | 692 |
| 663 | Ga0495684_1077541 | 3300047471 | Bacteria | 505 |
| 664 | Ga0495626_0037058 | 3300048091 | Bacteria | 2320 |
| 665 | Ga0495626_0206489 | 3300048091 | Bacteria | 803 |
| 666 | Ga0496109_0752630 | 3300048912 | Bacteria | 912 |
| 667 | Ga0496109_1904097 | 3300048912 | Bacteria | 527 |
| 668 | Ga0496112_0729904 | 3300048915 | Bacteria | 918 |
| 669 | Ga0496115_1386511 | 3300048918 | Unclassified | 520 |
| 670 | Ga0496117_0366720 | 3300048920 | Bacteria | 738 |
| 671 | Ga0496119_0429408 | 3300048922 | Bacteria | 626 |
| 672 | Ga0496120_0077948 | 3300048923 | Bacteria | 1803 |
| 673 | Ga0496121_0000043 | 3300048924 | Bacteria | 341882 |
| 674 | Ga0496122_0003743 | 3300048925 | Bacteria | 19623 |
| 675 | Ga0496123_0026380 | 3300048926 | Bacteria | 4352 |
| 676 | Ga0496123_0478382 | 3300048926 | Bacteria | 549 |
| 677 | Ga0496125_0202025 | 3300048928 | Bacteria | 1300 |
| 678 | Ga0496126_0000147 | 3300048929 | Bacteria | 163338 |
| 679 | Ga0501034_0000246 | 3300049571 | Bacteria | 100202 |
| 680 | Ga0501034_0054677 | 3300049571 | Bacteria | 4019 |
| 681 | Ga0501034_1273291 | 3300049571 | Bacteria | 612 |
| 682 | Ga0501037_0015422 | 3300049573 | Bacteria | 5622 |
| 683 | Ga0501038_0033610 | 3300049574 | Bacteria | 4517 |
| 684 | Ga0501038_0547193 | 3300049574 | Bacteria | 881 |
| 685 | Ga0501038_1234583 | 3300049574 | Bacteria | 542 |
| 686 | Ga0501039_0010227 | 3300049575 | Bacteria | 7149 |
| 687 | Ga0501043_0008278 | 3300049579 | Bacteria | 8188 |
| 688 | Ga0501046_0124302 | 3300049580 | Bacteria | 1961 |
| 689 | Ga0501047_0007525 | 3300049581 | Bacteria | 10254 |
| 690 | Ga0501048_0115774 | 3300049582 | Bacteria | 1894 |
| 691 | Ga0501048_0963902 | 3300049582 | Bacteria | 614 |
| 692 | Ga0501067_0044700 | 3300049583 | Bacteria | 2460 |
| 693 | Ga0501072_0221303 | 3300049588 | Bacteria | 1508 |
| 694 | Ga0501073_0000001 | 3300049589 | Bacteria | 677932 |
| 695 | Ga0501073_0122609 | 3300049589 | Bacteria | 1801 |
| 696 | Ga0501074_0139364 | 3300049590 | Bacteria | 1735 |
| 697 | Ga0501077_0003701 | 3300049593 | Bacteria | 9197 |
| 698 | Ga0501199_015872 | 3300049650 | Bacteria | 845 |
| 699 | Ga0501207_012024 | 3300049654 | Bacteria | 1296 |
| 700 | Ga0501233_119268 | 3300049668 | Bacteria | 712 |
| 701 | Ga0501235_046307 | 3300049669 | Bacteria | 1001 |
| 702 | Ga0501249_000072 | 3300049679 | Bacteria | 35371 |
| 703 | Ga0501257_033308 | 3300049686 | Bacteria | 1248 |
| 704 | Ga0501257_077793 | 3300049686 | Bacteria | 853 |
| 705 | Ga0501259_113634 | 3300049688 | Bacteria | 636 |
| 706 | Ga0501261_133231 | 3300049690 | Unclassified | 503 |
| 707 | Ga0501225_0039216 | 3300049705 | Unclassified | 1305 |
| 708 | Ga0501080_0019898 | 3300049742 | Bacteria | 6216 |
| 709 | Ga0501080_0074841 | 3300049742 | Bacteria | 3150 |
| 710 | Ga0501081_1022852 | 3300049743 | Bacteria | 625 |
| 711 | Ga0501081_1251727 | 3300049743 | Bacteria | 562 |
| 712 | Ga0501083_0018812 | 3300049744 | Bacteria | 4811 |
| 713 | Ga0501083_0087030 | 3300049744 | Bacteria | 2066 |
| 714 | Ga0501283_087991 | 3300049779 | Bacteria | 592 |
| 715 | Ga0501283_133413 | 3300049779 | Bacteria | 506 |
| 716 | Ga0501204_091885 | 3300049850 | Bacteria | 530 |
| 717 | nmdc:mga03n38_157295_c1 | 3300050490 | Bacteria | 1148 |
| 718 | nmdc:mga00v17_229780_c1 | 3300050491 | Bacteria | 1202 |
| 719 | nmdc:mga0yw44_966333_c1 | 3300050492 | Unclassified | 577 |
| 720 | nmdc:mga0k408_25140_c1 | 3300050493 | Unclassified | 3371 |
| 721 | nmdc:mga0k408_92_c1 | 3300050493 | Bacteria | 42940 |
| 722 | nmdc:mga06z11_394_c1 | 3300050494 | Bacteria | 16480 |
| 723 | nmdc:mga06z11_430307_c1 | 3300050494 | Bacteria | 796 |
| 724 | nmdc:mga06z11_73792_c1 | 3300050494 | Bacteria | 1812 |
| 725 | nmdc:mga04h51_16905_c1 | 3300050495 | Bacteria | 2124 |
| 726 | nmdc:mga05p37_11445_c1 | 3300050507 | Bacteria | 10564 |
| 727 | nmdc:mga05p37_131822_c1 | 3300050507 | Bacteria | 3067 |
| 728 | nmdc:mga05p37_191020_c1 | 3300050507 | Bacteria | 2486 |
| 729 | nmdc:mga05p37_2245364_c1 | 3300050507 | Bacteria | 505 |
| 730 | nmdc:mga06r32_97616_c1 | 3300050510 | Bacteria | 2879 |
| 731 | nmdc:mga08y16_792497_c1 | 3300050511 | Bacteria | 941 |
| 732 | nmdc:mga0n895_1779448_c1 | 3300050512 | Bacteria | 577 |
| 733 | nmdc:mga0rr50_1771074_c1 | 3300050513 | Bacteria | 520 |
| 734 | nmdc:mga0a205_294425_c1 | 3300050515 | Bacteria | 1497 |
| 735 | nmdc:mga0sz30_383819_c1 | 3300050516 | Bacteria | 629 |
| 736 | Ga0495601_0992390 | 3300053077 | Bacteria | 528 |
| 737 | Ga0500644_0213290 | 3300053088 | Bacteria | 803 |
| 738 | Ga0500641_0254615 | 3300053096 | Bacteria | 735 |
| 739 | Ga0500562_104616 | 3300053108 | Bacteria | 771 |
| 740 | Ga0500628_000704 | 3300053129 | Bacteria | 5970 |
| 741 | Ga0500588_0251839 | 3300053146 | Bacteria | 663 |
| 742 | Ga0500616_0062988 | 3300053153 | Bacteria | 1914 |
| 743 | Ga0500627_0017659 | 3300053158 | Unclassified | 2808 |
| 744 | Ga0501084_0194913 | 3300054114 | Bacteria | 1709 |
| 745 | Ga0501082_0000018 | 3300060353 | Bacteria | 112794 |
| 746 | Ga0501082_0546814 | 3300060353 | Bacteria | 1013 |
| 747 | Ga0501082_1340075 | 3300060353 | Bacteria | 625 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044673 | Ga0453683_0271067 | Ga0453683_0271067_300_494 | 58 |
| 2 | 3300050492 | nmdc:mga0yw44_966333_c1 | nmdc:mga0yw44_966333_c1_22_225 | 58 |
| 3 | iso_pu_bacteria | 2904113452 | 2904119845 | 62 |
| 4 | 3300009176 | Ga0105242_12560495 | Ga0105242_125604951 | 63 |
| 5 | iso_pu_bacteria | 2512564039 | 2512733435 | 63 |
| 6 | iso_pu_bacteria | 2571042588 | 2573038951 | 63 |
| 7 | iso_pu_bacteria | 2585428157 | 2588108269 | 63 |
| 8 | iso_pu_bacteria | 2600255286 | 2601637100 | 63 |
| 9 | iso_pu_bacteria | 2738543010 | 2739230964 | 63 |
| 10 | iso_pu_bacteria | 2775507177 | 2777763420 | 63 |
| 11 | iso_pu_bacteria | 2808606364 | 2808867522 | 63 |
| 12 | iso_pu_bacteria | 2821111986 | 2821112946 | 63 |
| 13 | iso_pu_bacteria | 2842682962 | 2842687729 | 63 |
| 14 | iso_pu_bacteria | 2852673933 | 2852677255 | 63 |
| 15 | iso_pu_bacteria | 2857604169 | 2857608446 | 63 |
| 16 | iso_pu_bacteria | 2865002811 | 2865008705 | 63 |
| 17 | iso_pu_bacteria | 2907202186 | 2907203611 | 63 |
| 18 | iso_pu_bacteria | 2929233124 | 2929236644 | 63 |
| 19 | iso_pu_bacteria | 2929239360 | 2929244456 | 63 |
| 20 | iso_pu_bacteria | 2936340661 | 2936343429 | 63 |
| 21 | iso_pu_bacteria | 2946033335 | 2946036562 | 63 |
| 22 | iso_pu_bacteria | 2964375228 | 2964379618 | 63 |
| 23 | iso_pu_bacteria | 2965761152 | 2965764646 | 63 |
| 24 | iso_pu_bacteria | 2968558590 | 2968565047 | 63 |
| 25 | iso_pu_bacteria | 2971403814 | 2971406530 | 63 |
| 26 | iso_pu_bacteria | 2971410472 | 2971416742 | 63 |
| 27 | iso_pu_bacteria | 2971511577 | 2971513674 | 63 |
| 28 | iso_pu_bacteria | 2971511577 | 2971513685 | 63 |
| 29 | iso_pu_bacteria | 2979083700 | 2979086984 | 63 |
| 30 | iso_pu_bacteria | 2980176882 | 2980178517 | 63 |
| 31 | iso_pu_bacteria | 2988225383 | 2988226760 | 63 |
| 32 | iso_pu_bacteria | 3006826541 | 3006827517 | 63 |
| 33 | iso_pu_bacteria | 3006978542 | 3006983350 | 63 |
| 34 | iso_pu_bacteria | 8002317523 | 8002318843 | 63 |
| 35 | iso_pu_bacteria | 8022948649 | 8022949325 | 63 |
| 36 | iso_pu_bacteria | 8022948649 | 8022950463 | 63 |
| 37 | iso_pu_bacteria | 8054280661 | 8054284278 | 63 |
| 38 | iso_pu_bacteria | 8054465665 | 8054469890 | 63 |
| 39 | iso_pu_bacteria | 8056533031 | 8056536993 | 63 |
| 40 | iso_pu_bacteria | 8057977335 | 8057981765 | 63 |
| 41 | 3300013297 | Ga0157378_12137939 | Ga0157378_121379391 | 64 |
| 42 | 3300003187 | JGI25151J46595_10002839 | JGI25151J46595_100028399 | 65 |
| 43 | 3300005331 | Ga0070670_100256689 | Ga0070670_1002566892 | 65 |
| 44 | 3300005564 | Ga0070664_100129041 | Ga0070664_1001290412 | 65 |
| 45 | 3300005842 | Ga0068858_101700439 | Ga0068858_1017004392 | 65 |
| 46 | 3300005844 | Ga0068862_100313513 | Ga0068862_1003135132 | 65 |
| 47 | 3300005983 | Ga0081540_1133542 | Ga0081540_11335422 | 65 |
| 48 | 3300006844 | Ga0075428_101930113 | Ga0075428_1019301131 | 65 |
| 49 | 3300009177 | Ga0105248_10031481 | Ga0105248_100314812 | 65 |
| 50 | 3300011119 | Ga0105246_10562684 | Ga0105246_105626842 | 65 |
| 51 | 3300013297 | Ga0157378_10016043 | Ga0157378_100160438 | 65 |
| 52 | 3300014968 | Ga0157379_10265734 | Ga0157379_102657341 | 65 |
| 53 | 3300025294 | Ga0209025_1003012 | Ga0209025_10030126 | 65 |
| 54 | 3300025903 | Ga0207680_10138914 | Ga0207680_101389141 | 65 |
| 55 | 3300025907 | Ga0207645_11144133 | Ga0207645_111441331 | 65 |
| 56 | 3300025925 | Ga0207650_10594062 | Ga0207650_105940622 | 65 |
| 57 | 3300025941 | Ga0207711_10197913 | Ga0207711_101979132 | 65 |
| 58 | 3300025941 | Ga0207711_11298347 | Ga0207711_112983472 | 65 |
| 59 | 3300025945 | Ga0207679_11057354 | Ga0207679_110573542 | 65 |
| 60 | 3300026035 | Ga0207703_10442510 | Ga0207703_104425102 | 65 |
| 61 | 3300026118 | Ga0207675_102747646 | Ga0207675_1027476462 | 65 |
| 62 | 3300028380 | Ga0268265_10193074 | Ga0268265_101930742 | 65 |
| 63 | 3300031507 | Ga0307509_10036874 | Ga0307509_100368744 | 65 |
| 64 | 3300042876 | Ga0451577_1429898 | Ga0451577_1429898_232_432 | 65 |
| 65 | 3300050513 | nmdc:mga0rr50_1771074_c1 | nmdc:mga0rr50_1771074_c1_110_310 | 65 |
| 66 | 3300005289 | Ga0065704_10156118 | Ga0065704_101561182 | 66 |
| 67 | 3300005329 | Ga0070683_101245411 | Ga0070683_1012454112 | 66 |
| 68 | 3300005330 | Ga0070690_100644834 | Ga0070690_1006448341 | 66 |
| 69 | 3300005353 | Ga0070669_100458594 | Ga0070669_1004585942 | 66 |
| 70 | 3300005364 | Ga0070673_101911421 | Ga0070673_1019114211 | 66 |
| 71 | 3300005366 | Ga0070659_100844934 | Ga0070659_1008449341 | 66 |
| 72 | 3300005367 | Ga0070667_101465580 | Ga0070667_1014655801 | 66 |
| 73 | 3300005438 | Ga0070701_11346104 | Ga0070701_113461041 | 66 |
| 74 | 3300005445 | Ga0070708_100501364 | Ga0070708_1005013644 | 66 |
| 75 | 3300005455 | Ga0070663_101027599 | Ga0070663_1010275992 | 66 |
| 76 | 3300005471 | Ga0070698_101955161 | Ga0070698_1019551611 | 66 |
| 77 | 3300005518 | Ga0070699_101808808 | Ga0070699_1018088082 | 66 |
| 78 | 3300005544 | Ga0070686_101125407 | Ga0070686_1011254072 | 66 |
| 79 | 3300005545 | Ga0070695_100088704 | Ga0070695_1000887041 | 66 |
| 80 | 3300005545 | Ga0070695_100573088 | Ga0070695_1005730881 | 66 |
| 81 | 3300005546 | Ga0070696_100744212 | Ga0070696_1007442121 | 66 |
| 82 | 3300005615 | Ga0070702_101296198 | Ga0070702_1012961982 | 66 |
| 83 | 3300005617 | Ga0068859_100509971 | Ga0068859_1005099711 | 66 |
| 84 | 3300005841 | Ga0068863_102393114 | Ga0068863_1023931142 | 66 |
| 85 | 3300005937 | Ga0081455_10037013 | Ga0081455_100370132 | 66 |
| 86 | 3300005937 | Ga0081455_10292715 | Ga0081455_102927152 | 66 |
| 87 | 3300006048 | Ga0075363_100109992 | Ga0075363_1001099923 | 66 |
| 88 | 3300006178 | Ga0075367_10529334 | Ga0075367_105293341 | 66 |
| 89 | 3300006186 | Ga0075369_10439111 | Ga0075369_104391111 | 66 |
| 90 | 3300006846 | Ga0075430_101531390 | Ga0075430_1015313901 | 66 |
| 91 | 3300006931 | Ga0097620_100510046 | Ga0097620_1005100461 | 66 |
| 92 | 3300009094 | Ga0111539_11502800 | Ga0111539_115028002 | 66 |
| 93 | 3300009098 | Ga0105245_11699014 | Ga0105245_116990141 | 66 |
| 94 | 3300009101 | Ga0105247_11001755 | Ga0105247_110017551 | 66 |
| 95 | 3300009551 | Ga0105238_11866223 | Ga0105238_118662231 | 66 |
| 96 | 3300009553 | Ga0105249_11210990 | Ga0105249_112109901 | 66 |
| 97 | 3300009553 | Ga0105249_11549112 | Ga0105249_115491122 | 66 |
| 98 | 3300010375 | Ga0105239_13506989 | Ga0105239_135069892 | 66 |
| 99 | 3300011119 | Ga0105246_11250469 | Ga0105246_112504692 | 66 |
| 100 | 3300013296 | Ga0157374_12140040 | Ga0157374_121400401 | 66 |
| 101 | 3300013297 | Ga0157378_10492754 | Ga0157378_104927541 | 66 |
| 102 | 3300013297 | Ga0157378_11187585 | Ga0157378_111875852 | 66 |
| 103 | 3300013297 | Ga0157378_11561909 | Ga0157378_115619092 | 66 |
| 104 | 3300013306 | Ga0163162_11191862 | Ga0163162_111918621 | 66 |
| 105 | 3300013308 | Ga0157375_13414869 | Ga0157375_134148691 | 66 |
| 106 | 3300014325 | Ga0163163_10395622 | Ga0163163_103956222 | 66 |
| 107 | 3300014968 | Ga0157379_10234448 | Ga0157379_102344482 | 66 |
| 108 | 3300017792 | Ga0163161_10760959 | Ga0163161_107609591 | 66 |
| 109 | 3300017792 | Ga0163161_11142916 | Ga0163161_111429162 | 66 |
| 110 | 3300025903 | Ga0207680_10810953 | Ga0207680_108109532 | 66 |
| 111 | 3300025905 | Ga0207685_10123871 | Ga0207685_101238712 | 66 |
| 112 | 3300025923 | Ga0207681_11295325 | Ga0207681_112953252 | 66 |
| 113 | 3300025933 | Ga0207706_11562093 | Ga0207706_115620932 | 66 |
| 114 | 3300025938 | Ga0207704_10878767 | Ga0207704_108787672 | 66 |
| 115 | 3300025960 | Ga0207651_12021311 | Ga0207651_120213111 | 66 |
| 116 | 3300025961 | Ga0207712_10550940 | Ga0207712_105509403 | 66 |
| 117 | 3300025972 | Ga0207668_11234810 | Ga0207668_112348101 | 66 |
| 118 | 3300026088 | Ga0207641_10718227 | Ga0207641_107182272 | 66 |
| 119 | 3300026118 | Ga0207675_100895716 | Ga0207675_1008957161 | 66 |
| 120 | 3300026121 | Ga0207683_11002682 | Ga0207683_110026822 | 66 |
| 121 | 3300026121 | Ga0207683_11024975 | Ga0207683_110249751 | 66 |
| 122 | 3300026121 | Ga0207683_11841687 | Ga0207683_118416872 | 66 |
| 123 | 3300028380 | Ga0268265_11207806 | Ga0268265_112078061 | 66 |
| 124 | 3300032126 | Ga0307415_102136572 | Ga0307415_1021365722 | 66 |
| 125 | 3300041511 | Ga0451855_1054290 | Ga0451855_1054290_262_468 | 66 |
| 126 | 3300042876 | Ga0451577_0114372 | Ga0451577_0114372_870_1070 | 66 |
| 127 | 3300044673 | Ga0453683_0107942 | Ga0453683_0107942_665_865 | 66 |
| 128 | 3300045051 | Ga0451576_0658395 | Ga0451576_0658395_622_822 | 66 |
| 129 | 3300049571 | Ga0501034_0000246 | Ga0501034_0000246_88112_88312 | 66 |
| 130 | 3300049571 | Ga0501034_1273291 | Ga0501034_1273291_322_522 | 66 |
| 131 | 3300049573 | Ga0501037_0015422 | Ga0501037_0015422_3670_3870 | 66 |
| 132 | 3300049574 | Ga0501038_0547193 | Ga0501038_0547193_109_309 | 66 |
| 133 | 3300049575 | Ga0501039_0010227 | Ga0501039_0010227_1639_1839 | 66 |
| 134 | 3300049579 | Ga0501043_0008278 | Ga0501043_0008278_1768_1968 | 66 |
| 135 | 3300049580 | Ga0501046_0124302 | Ga0501046_0124302_1433_1633 | 66 |
| 136 | 3300049581 | Ga0501047_0007525 | Ga0501047_0007525_3488_3688 | 66 |
| 137 | 3300049582 | Ga0501048_0115774 | Ga0501048_0115774_12_212 | 66 |
| 138 | 3300049582 | Ga0501048_0963902 | Ga0501048_0963902_198_398 | 66 |
| 139 | 3300049583 | Ga0501067_0044700 | Ga0501067_0044700_1052_1252 | 66 |
| 140 | 3300049589 | Ga0501073_0000001 | Ga0501073_0000001_221579_221779 | 66 |
| 141 | 3300049590 | Ga0501074_0139364 | Ga0501074_0139364_83_283 | 66 |
| 142 | 3300049593 | Ga0501077_0003701 | Ga0501077_0003701_2356_2556 | 66 |
| 143 | 3300049743 | Ga0501081_1251727 | Ga0501081_1251727_15_215 | 66 |
| 144 | 3300049744 | Ga0501083_0018812 | Ga0501083_0018812_3387_3587 | 66 |
| 145 | 3300050490 | nmdc:mga03n38_157295_c1 | nmdc:mga03n38_157295_c1_507_707 | 66 |
| 146 | 3300050494 | nmdc:mga06z11_430307_c1 | nmdc:mga06z11_430307_c1_517_717 | 66 |
| 147 | 3300050516 | nmdc:mga0sz30_383819_c1 | nmdc:mga0sz30_383819_c1_44_244 | 66 |
| 148 | 3300053077 | Ga0495601_0992390 | Ga0495601_0992390_231_431 | 66 |
| 149 | 3300053088 | Ga0500644_0213290 | Ga0500644_0213290_289_489 | 66 |
| 150 | 3300053129 | Ga0500628_000704 | Ga0500628_000704_415_615 | 66 |
| 151 | 3300054114 | Ga0501084_0194913 | Ga0501084_0194913_903_1103 | 66 |
| 152 | 3300060353 | Ga0501082_0000018 | Ga0501082_0000018_31702_31902 | 66 |
| 153 | 2162886012 | MBSR1b_contig_241812 | MBSR1b_0216.00002030 | 67 |
| 154 | 3300001990 | JGI24737J22298_10081403 | JGI24737J22298_100814032 | 67 |
| 155 | 3300002239 | JGI24034J26672_10111614 | JGI24034J26672_101116142 | 67 |
| 156 | 3300003203 | JGI25406J46586_10270816 | JGI25406J46586_102708162 | 67 |
| 157 | 3300005290 | Ga0065712_10161230 | Ga0065712_101612302 | 67 |
| 158 | 3300005290 | Ga0065712_10658855 | Ga0065712_106588552 | 67 |
| 159 | 3300005293 | Ga0065715_10298803 | Ga0065715_102988031 | 67 |
| 160 | 3300005293 | Ga0065715_10754867 | Ga0065715_107548672 | 67 |
| 161 | 3300005293 | Ga0065715_11173411 | Ga0065715_111734112 | 67 |
| 162 | 3300005327 | Ga0070658_10000503 | Ga0070658_1000050329 | 67 |
| 163 | 3300005327 | Ga0070658_10199276 | Ga0070658_101992764 | 67 |
| 164 | 3300005327 | Ga0070658_10412436 | Ga0070658_104124361 | 67 |
| 165 | 3300005327 | Ga0070658_11133758 | Ga0070658_111337582 | 67 |
| 166 | 3300005328 | Ga0070676_10170564 | Ga0070676_101705643 | 67 |
| 167 | 3300005329 | Ga0070683_100078503 | Ga0070683_1000785032 | 67 |
| 168 | 3300005329 | Ga0070683_101566709 | Ga0070683_1015667091 | 67 |
| 169 | 3300005330 | Ga0070690_100229331 | Ga0070690_1002293313 | 67 |
| 170 | 3300005330 | Ga0070690_100392192 | Ga0070690_1003921922 | 67 |
| 171 | 3300005330 | Ga0070690_100443391 | Ga0070690_1004433912 | 67 |
| 172 | 3300005330 | Ga0070690_101388932 | Ga0070690_1013889321 | 67 |
| 173 | 3300005331 | Ga0070670_100087163 | Ga0070670_1000871634 | 67 |
| 174 | 3300005331 | Ga0070670_100135395 | Ga0070670_1001353953 | 67 |
| 175 | 3300005331 | Ga0070670_100978334 | Ga0070670_1009783342 | 67 |
| 176 | 3300005333 | Ga0070677_10606825 | Ga0070677_106068252 | 67 |
| 177 | 3300005334 | Ga0068869_100058007 | Ga0068869_1000580073 | 67 |
| 178 | 3300005334 | Ga0068869_100902591 | Ga0068869_1009025911 | 67 |
| 179 | 3300005334 | Ga0068869_101008689 | Ga0068869_1010086891 | 67 |
| 180 | 3300005334 | Ga0068869_101245198 | Ga0068869_1012451982 | 67 |
| 181 | 3300005334 | Ga0068869_101258556 | Ga0068869_1012585562 | 67 |
| 182 | 3300005334 | Ga0068869_101312832 | Ga0068869_1013128321 | 67 |
| 183 | 3300005334 | Ga0068869_101807043 | Ga0068869_1018070432 | 67 |
| 184 | 3300005335 | Ga0070666_10023040 | Ga0070666_100230403 | 67 |
| 185 | 3300005335 | Ga0070666_10041127 | Ga0070666_100411273 | 67 |
| 186 | 3300005335 | Ga0070666_10745546 | Ga0070666_107455461 | 67 |
| 187 | 3300005335 | Ga0070666_10767646 | Ga0070666_107676462 | 67 |
| 188 | 3300005336 | Ga0070680_100169601 | Ga0070680_1001696013 | 67 |
| 189 | 3300005338 | Ga0068868_100007182 | Ga0068868_1000071826 | 67 |
| 190 | 3300005338 | Ga0068868_100084077 | Ga0068868_1000840773 | 67 |
| 191 | 3300005338 | Ga0068868_100245120 | Ga0068868_1002451202 | 67 |
| 192 | 3300005338 | Ga0068868_100308293 | Ga0068868_1003082932 | 67 |
| 193 | 3300005338 | Ga0068868_100451833 | Ga0068868_1004518332 | 67 |
| 194 | 3300005338 | Ga0068868_101564616 | Ga0068868_1015646162 | 67 |
| 195 | 3300005338 | Ga0068868_101635663 | Ga0068868_1016356632 | 67 |
| 196 | 3300005339 | Ga0070660_100539583 | Ga0070660_1005395831 | 67 |
| 197 | 3300005339 | Ga0070660_101946979 | Ga0070660_1019469792 | 67 |
| 198 | 3300005340 | Ga0070689_100162330 | Ga0070689_1001623302 | 67 |
| 199 | 3300005340 | Ga0070689_100787178 | Ga0070689_1007871782 | 67 |
| 200 | 3300005343 | Ga0070687_100668791 | Ga0070687_1006687912 | 67 |
| 201 | 3300005343 | Ga0070687_100721512 | Ga0070687_1007215121 | 67 |
| 202 | 3300005344 | Ga0070661_100393111 | Ga0070661_1003931111 | 67 |
| 203 | 3300005344 | Ga0070661_100447023 | Ga0070661_1004470231 | 67 |
| 204 | 3300005345 | Ga0070692_11316221 | Ga0070692_113162212 | 67 |
| 205 | 3300005347 | Ga0070668_100072580 | Ga0070668_1000725803 | 67 |
| 206 | 3300005347 | Ga0070668_100571823 | Ga0070668_1005718232 | 67 |
| 207 | 3300005353 | Ga0070669_100256170 | Ga0070669_1002561702 | 67 |
| 208 | 3300005354 | Ga0070675_100142727 | Ga0070675_1001427272 | 67 |
| 209 | 3300005354 | Ga0070675_101329411 | Ga0070675_1013294112 | 67 |
| 210 | 3300005355 | Ga0070671_100086629 | Ga0070671_1000866293 | 67 |
| 211 | 3300005355 | Ga0070671_100141336 | Ga0070671_1001413363 | 67 |
| 212 | 3300005355 | Ga0070671_100271116 | Ga0070671_1002711163 | 67 |
| 213 | 3300005355 | Ga0070671_100651167 | Ga0070671_1006511671 | 67 |
| 214 | 3300005355 | Ga0070671_100921460 | Ga0070671_1009214602 | 67 |
| 215 | 3300005355 | Ga0070671_100926429 | Ga0070671_1009264292 | 67 |
| 216 | 3300005355 | Ga0070671_101920160 | Ga0070671_1019201601 | 67 |
| 217 | 3300005364 | Ga0070673_100272930 | Ga0070673_1002729302 | 67 |
| 218 | 3300005364 | Ga0070673_100452422 | Ga0070673_1004524222 | 67 |
| 219 | 3300005364 | Ga0070673_100912714 | Ga0070673_1009127142 | 67 |
| 220 | 3300005365 | Ga0070688_100314494 | Ga0070688_1003144941 | 67 |
| 221 | 3300005366 | Ga0070659_100458799 | Ga0070659_1004587992 | 67 |
| 222 | 3300005367 | Ga0070667_100002793 | Ga0070667_1000027938 | 67 |
| 223 | 3300005367 | Ga0070667_100472457 | Ga0070667_1004724572 | 67 |
| 224 | 3300005367 | Ga0070667_100769227 | Ga0070667_1007692272 | 67 |
| 225 | 3300005367 | Ga0070667_100838710 | Ga0070667_1008387102 | 67 |
| 226 | 3300005435 | Ga0070714_100610352 | Ga0070714_1006103521 | 67 |
| 227 | 3300005435 | Ga0070714_101594768 | Ga0070714_1015947682 | 67 |
| 228 | 3300005435 | Ga0070714_101937831 | Ga0070714_1019378312 | 67 |
| 229 | 3300005436 | Ga0070713_101186234 | Ga0070713_1011862342 | 67 |
| 230 | 3300005436 | Ga0070713_101310604 | Ga0070713_1013106041 | 67 |
| 231 | 3300005437 | Ga0070710_10795186 | Ga0070710_107951862 | 67 |
| 232 | 3300005439 | Ga0070711_100935608 | Ga0070711_1009356081 | 67 |
| 233 | 3300005439 | Ga0070711_102060764 | Ga0070711_1020607641 | 67 |
| 234 | 3300005440 | Ga0070705_100564675 | Ga0070705_1005646751 | 67 |
| 235 | 3300005444 | Ga0070694_100437190 | Ga0070694_1004371902 | 67 |
| 236 | 3300005456 | Ga0070678_101503567 | Ga0070678_1015035671 | 67 |
| 237 | 3300005456 | Ga0070678_101532508 | Ga0070678_1015325081 | 67 |
| 238 | 3300005457 | Ga0070662_100747599 | Ga0070662_1007475992 | 67 |
| 239 | 3300005457 | Ga0070662_100770288 | Ga0070662_1007702882 | 67 |
| 240 | 3300005457 | Ga0070662_101421206 | Ga0070662_1014212061 | 67 |
| 241 | 3300005458 | Ga0070681_10047881 | Ga0070681_100478812 | 67 |
| 242 | 3300005467 | Ga0070706_100576250 | Ga0070706_1005762502 | 67 |
| 243 | 3300005468 | Ga0070707_100827780 | Ga0070707_1008277802 | 67 |
| 244 | 3300005471 | Ga0070698_100444719 | Ga0070698_1004447192 | 67 |
| 245 | 3300005471 | Ga0070698_100768311 | Ga0070698_1007683112 | 67 |
| 246 | 3300005518 | Ga0070699_100724340 | Ga0070699_1007243402 | 67 |
| 247 | 3300005530 | Ga0070679_101022291 | Ga0070679_1010222912 | 67 |
| 248 | 3300005530 | Ga0070679_101162553 | Ga0070679_1011625532 | 67 |
| 249 | 3300005530 | Ga0070679_101260278 | Ga0070679_1012602782 | 67 |
| 250 | 3300005530 | Ga0070679_101841671 | Ga0070679_1018416711 | 67 |
| 251 | 3300005535 | Ga0070684_100335819 | Ga0070684_1003358192 | 67 |
| 252 | 3300005535 | Ga0070684_101967143 | Ga0070684_1019671432 | 67 |
| 253 | 3300005536 | Ga0070697_101053202 | Ga0070697_1010532021 | 67 |
| 254 | 3300005539 | Ga0068853_100497642 | Ga0068853_1004976423 | 67 |
| 255 | 3300005539 | Ga0068853_100574938 | Ga0068853_1005749382 | 67 |
| 256 | 3300005539 | Ga0068853_101140503 | Ga0068853_1011405032 | 67 |
| 257 | 3300005539 | Ga0068853_101716384 | Ga0068853_1017163842 | 67 |
| 258 | 3300005539 | Ga0068853_102269131 | Ga0068853_1022691311 | 67 |
| 259 | 3300005543 | Ga0070672_100471518 | Ga0070672_1004715182 | 67 |
| 260 | 3300005544 | Ga0070686_100116096 | Ga0070686_1001160961 | 67 |
| 261 | 3300005544 | Ga0070686_100334751 | Ga0070686_1003347512 | 67 |
| 262 | 3300005544 | Ga0070686_100871072 | Ga0070686_1008710722 | 67 |
| 263 | 3300005544 | Ga0070686_101474628 | Ga0070686_1014746282 | 67 |
| 264 | 3300005546 | Ga0070696_100157241 | Ga0070696_1001572412 | 67 |
| 265 | 3300005548 | Ga0070665_101154780 | Ga0070665_1011547802 | 67 |
| 266 | 3300005548 | Ga0070665_101178301 | Ga0070665_1011783012 | 67 |
| 267 | 3300005549 | Ga0070704_100528738 | Ga0070704_1005287382 | 67 |
| 268 | 3300005549 | Ga0070704_100672590 | Ga0070704_1006725902 | 67 |
| 269 | 3300005549 | Ga0070704_101260875 | Ga0070704_1012608752 | 67 |
| 270 | 3300005549 | Ga0070704_101449384 | Ga0070704_1014493842 | 67 |
| 271 | 3300005563 | Ga0068855_100957890 | Ga0068855_1009578901 | 67 |
| 272 | 3300005563 | Ga0068855_101213315 | Ga0068855_1012133152 | 67 |
| 273 | 3300005564 | Ga0070664_100008130 | Ga0070664_1000081301 | 67 |
| 274 | 3300005564 | Ga0070664_100973139 | Ga0070664_1009731391 | 67 |
| 275 | 3300005577 | Ga0068857_100011013 | Ga0068857_1000110133 | 67 |
| 276 | 3300005577 | Ga0068857_100199292 | Ga0068857_1001992923 | 67 |
| 277 | 3300005577 | Ga0068857_101398863 | Ga0068857_1013988632 | 67 |
| 278 | 3300005577 | Ga0068857_102523641 | Ga0068857_1025236412 | 67 |
| 279 | 3300005578 | Ga0068854_100003839 | Ga0068854_1000038395 | 67 |
| 280 | 3300005578 | Ga0068854_101155293 | Ga0068854_1011552932 | 67 |
| 281 | 3300005578 | Ga0068854_101543184 | Ga0068854_1015431842 | 67 |
| 282 | 3300005614 | Ga0068856_100012947 | Ga0068856_1000129475 | 67 |
| 283 | 3300005614 | Ga0068856_100081781 | Ga0068856_1000817814 | 67 |
| 284 | 3300005614 | Ga0068856_100738087 | Ga0068856_1007380871 | 67 |
| 285 | 3300005615 | Ga0070702_100284963 | Ga0070702_1002849632 | 67 |
| 286 | 3300005616 | Ga0068852_100099507 | Ga0068852_1000995071 | 67 |
| 287 | 3300005616 | Ga0068852_101421370 | Ga0068852_1014213702 | 67 |
| 288 | 3300005616 | Ga0068852_102224509 | Ga0068852_1022245092 | 67 |
| 289 | 3300005616 | Ga0068852_102835652 | Ga0068852_1028356522 | 67 |
| 290 | 3300005617 | Ga0068859_100004003 | Ga0068859_1000040033 | 67 |
| 291 | 3300005617 | Ga0068859_100015657 | Ga0068859_1000156573 | 67 |
| 292 | 3300005617 | Ga0068859_100094224 | Ga0068859_1000942244 | 67 |
| 293 | 3300005617 | Ga0068859_100521956 | Ga0068859_1005219562 | 67 |
| 294 | 3300005618 | Ga0068864_100000699 | Ga0068864_10000069918 | 67 |
| 295 | 3300005618 | Ga0068864_100001921 | Ga0068864_10000192113 | 67 |
| 296 | 3300005618 | Ga0068864_100087203 | Ga0068864_1000872035 | 67 |
| 297 | 3300005618 | Ga0068864_100317836 | Ga0068864_1003178362 | 67 |
| 298 | 3300005618 | Ga0068864_100499037 | Ga0068864_1004990373 | 67 |
| 299 | 3300005618 | Ga0068864_100894203 | Ga0068864_1008942032 | 67 |
| 300 | 3300005618 | Ga0068864_101495015 | Ga0068864_1014950152 | 67 |
| 301 | 3300005719 | Ga0068861_100007458 | Ga0068861_1000074589 | 67 |
| 302 | 3300005719 | Ga0068861_101569281 | Ga0068861_1015692812 | 67 |
| 303 | 3300005834 | Ga0068851_10105119 | Ga0068851_101051192 | 67 |
| 304 | 3300005834 | Ga0068851_10207687 | Ga0068851_102076873 | 67 |
| 305 | 3300005834 | Ga0068851_10622565 | Ga0068851_106225652 | 67 |
| 306 | 3300005840 | Ga0068870_10109067 | Ga0068870_101090673 | 67 |
| 307 | 3300005840 | Ga0068870_10369002 | Ga0068870_103690022 | 67 |
| 308 | 3300005840 | Ga0068870_10484246 | Ga0068870_104842462 | 67 |
| 309 | 3300005841 | Ga0068863_100003791 | Ga0068863_10000379121 | 67 |
| 310 | 3300005841 | Ga0068863_101514157 | Ga0068863_1015141572 | 67 |
| 311 | 3300005841 | Ga0068863_101594252 | Ga0068863_1015942522 | 67 |
| 312 | 3300005841 | Ga0068863_101953137 | Ga0068863_1019531372 | 67 |
| 313 | 3300005841 | Ga0068863_102597047 | Ga0068863_1025970471 | 67 |
| 314 | 3300005842 | Ga0068858_100001364 | Ga0068858_10000136421 | 67 |
| 315 | 3300005842 | Ga0068858_100144427 | Ga0068858_1001444273 | 67 |
| 316 | 3300005842 | Ga0068858_100186935 | Ga0068858_1001869353 | 67 |
| 317 | 3300005842 | Ga0068858_100523872 | Ga0068858_1005238723 | 67 |
| 318 | 3300005842 | Ga0068858_100536136 | Ga0068858_1005361362 | 67 |
| 319 | 3300005842 | Ga0068858_102178841 | Ga0068858_1021788412 | 67 |
| 320 | 3300005843 | Ga0068860_100001500 | Ga0068860_10000150011 | 67 |
| 321 | 3300005843 | Ga0068860_100564665 | Ga0068860_1005646652 | 67 |
| 322 | 3300005843 | Ga0068860_101300860 | Ga0068860_1013008601 | 67 |
| 323 | 3300005843 | Ga0068860_102234569 | Ga0068860_1022345692 | 67 |
| 324 | 3300005844 | Ga0068862_100026444 | Ga0068862_1000264443 | 67 |
| 325 | 3300005844 | Ga0068862_100059474 | Ga0068862_1000594741 | 67 |
| 326 | 3300005844 | Ga0068862_101555128 | Ga0068862_1015551282 | 67 |
| 327 | 3300005937 | Ga0081455_10005340 | Ga0081455_1000534012 | 67 |
| 328 | 3300005937 | Ga0081455_10131971 | Ga0081455_101319714 | 67 |
| 329 | 3300005983 | Ga0081540_1102018 | Ga0081540_11020182 | 67 |
| 330 | 3300005985 | Ga0081539_10049991 | Ga0081539_100499913 | 67 |
| 331 | 3300006028 | Ga0070717_10027369 | Ga0070717_100273692 | 67 |
| 332 | 3300006038 | Ga0075365_10756325 | Ga0075365_107563252 | 67 |
| 333 | 3300006051 | Ga0075364_10269955 | Ga0075364_102699552 | 67 |
| 334 | 3300006058 | Ga0075432_10240260 | Ga0075432_102402602 | 67 |
| 335 | 3300006175 | Ga0070712_100746246 | Ga0070712_1007462461 | 67 |
| 336 | 3300006178 | Ga0075367_10000350 | Ga0075367_100003504 | 67 |
| 337 | 3300006178 | Ga0075367_10095500 | Ga0075367_100955003 | 67 |
| 338 | 3300006178 | Ga0075367_11022751 | Ga0075367_110227512 | 67 |
| 339 | 3300006195 | Ga0075366_10001505 | Ga0075366_1000150515 | 67 |
| 340 | 3300006195 | Ga0075366_10028424 | Ga0075366_100284243 | 67 |
| 341 | 3300006237 | Ga0097621_100344160 | Ga0097621_1003441602 | 67 |
| 342 | 3300006237 | Ga0097621_100508702 | Ga0097621_1005087021 | 67 |
| 343 | 3300006237 | Ga0097621_101480867 | Ga0097621_1014808672 | 67 |
| 344 | 3300006358 | Ga0068871_100063008 | Ga0068871_1000630082 | 67 |
| 345 | 3300006358 | Ga0068871_100092833 | Ga0068871_1000928333 | 67 |
| 346 | 3300006358 | Ga0068871_100405498 | Ga0068871_1004054982 | 67 |
| 347 | 3300006358 | Ga0068871_100684161 | Ga0068871_1006841612 | 67 |
| 348 | 3300006844 | Ga0075428_100874560 | Ga0075428_1008745602 | 67 |
| 349 | 3300006847 | Ga0075431_100085779 | Ga0075431_1000857795 | 67 |
| 350 | 3300006852 | Ga0075433_10501135 | Ga0075433_105011352 | 67 |
| 351 | 3300006871 | Ga0075434_102509550 | Ga0075434_1025095501 | 67 |
| 352 | 3300006881 | Ga0068865_102087380 | Ga0068865_1020873801 | 67 |
| 353 | 3300006914 | Ga0075436_100551380 | Ga0075436_1005513802 | 67 |
| 354 | 3300006931 | Ga0097620_100004003 | Ga0097620_1000040033 | 67 |
| 355 | 3300006931 | Ga0097620_100015657 | Ga0097620_1000156573 | 67 |
| 356 | 3300006931 | Ga0097620_100094227 | Ga0097620_1000942274 | 67 |
| 357 | 3300006931 | Ga0097620_100521950 | Ga0097620_1005219502 | 67 |
| 358 | 3300007076 | Ga0075435_100425468 | Ga0075435_1004254683 | 67 |
| 359 | 3300007788 | Ga0099795_10620005 | Ga0099795_106200052 | 67 |
| 360 | 3300009011 | Ga0105251_10138636 | Ga0105251_101386362 | 67 |
| 361 | 3300009092 | Ga0105250_10010924 | Ga0105250_100109243 | 67 |
| 362 | 3300009093 | Ga0105240_10537271 | Ga0105240_105372711 | 67 |
| 363 | 3300009093 | Ga0105240_10572622 | Ga0105240_105726223 | 67 |
| 364 | 3300009093 | Ga0105240_10638445 | Ga0105240_106384452 | 67 |
| 365 | 3300009093 | Ga0105240_12227336 | Ga0105240_122273361 | 67 |
| 366 | 3300009093 | Ga0105240_12318175 | Ga0105240_123181751 | 67 |
| 367 | 3300009093 | Ga0105240_12814343 | Ga0105240_128143432 | 67 |
| 368 | 3300009094 | Ga0111539_10748300 | Ga0111539_107483002 | 67 |
| 369 | 3300009098 | Ga0105245_10024050 | Ga0105245_100240503 | 67 |
| 370 | 3300009098 | Ga0105245_10282147 | Ga0105245_102821472 | 67 |
| 371 | 3300009098 | Ga0105245_10340747 | Ga0105245_103407471 | 67 |
| 372 | 3300009098 | Ga0105245_10591288 | Ga0105245_105912881 | 67 |
| 373 | 3300009098 | Ga0105245_10751832 | Ga0105245_107518322 | 67 |
| 374 | 3300009098 | Ga0105245_11787038 | Ga0105245_117870381 | 67 |
| 375 | 3300009101 | Ga0105247_10017863 | Ga0105247_100178634 | 67 |
| 376 | 3300009101 | Ga0105247_10033484 | Ga0105247_100334842 | 67 |
| 377 | 3300009101 | Ga0105247_10649482 | Ga0105247_106494822 | 67 |
| 378 | 3300009101 | Ga0105247_11361303 | Ga0105247_113613032 | 67 |
| 379 | 3300009147 | Ga0114129_10784244 | Ga0114129_107842441 | 67 |
| 380 | 3300009147 | Ga0114129_11667977 | Ga0114129_116679772 | 67 |
| 381 | 3300009147 | Ga0114129_12642863 | Ga0114129_126428631 | 67 |
| 382 | 3300009148 | Ga0105243_10875039 | Ga0105243_108750392 | 67 |
| 383 | 3300009148 | Ga0105243_11103058 | Ga0105243_111030581 | 67 |
| 384 | 3300009148 | Ga0105243_11121885 | Ga0105243_111218852 | 67 |
| 385 | 3300009148 | Ga0105243_12534980 | Ga0105243_125349801 | 67 |
| 386 | 3300009174 | Ga0105241_10088123 | Ga0105241_100881233 | 67 |
| 387 | 3300009174 | Ga0105241_10111985 | Ga0105241_101119853 | 67 |
| 388 | 3300009174 | Ga0105241_10295680 | Ga0105241_102956803 | 67 |
| 389 | 3300009176 | Ga0105242_10052792 | Ga0105242_100527923 | 67 |
| 390 | 3300009177 | Ga0105248_10005280 | Ga0105248_100052802 | 67 |
| 391 | 3300009177 | Ga0105248_11053012 | Ga0105248_110530122 | 67 |
| 392 | 3300009177 | Ga0105248_11088664 | Ga0105248_110886642 | 67 |
| 393 | 3300009177 | Ga0105248_11755333 | Ga0105248_117553332 | 67 |
| 394 | 3300009177 | Ga0105248_12211483 | Ga0105248_122114832 | 67 |
| 395 | 3300009545 | Ga0105237_12056196 | Ga0105237_120561962 | 67 |
| 396 | 3300009551 | Ga0105238_10014096 | Ga0105238_100140966 | 67 |
| 397 | 3300009551 | Ga0105238_10886559 | Ga0105238_108865592 | 67 |
| 398 | 3300009551 | Ga0105238_10993710 | Ga0105238_109937102 | 67 |
| 399 | 3300009553 | Ga0105249_10003155 | Ga0105249_100031552 | 67 |
| 400 | 3300009553 | Ga0105249_11036653 | Ga0105249_110366531 | 67 |
| 401 | 3300009553 | Ga0105249_12306592 | Ga0105249_123065922 | 67 |
| 402 | 3300009553 | Ga0105249_12904915 | Ga0105249_129049151 | 67 |
| 403 | 3300009979 | Ga0105032_112054 | Ga0105032_1120542 | 67 |
| 404 | 3300009982 | Ga0105147_108972 | Ga0105147_1089722 | 67 |
| 405 | 3300009993 | Ga0105028_100449 | Ga0105028_1004492 | 67 |
| 406 | 3300009993 | Ga0105028_101043 | Ga0105028_1010432 | 67 |
| 407 | 3300010375 | Ga0105239_10026828 | Ga0105239_100268283 | 67 |
| 408 | 3300010375 | Ga0105239_10234893 | Ga0105239_102348931 | 67 |
| 409 | 3300010375 | Ga0105239_10652915 | Ga0105239_106529151 | 67 |
| 410 | 3300010375 | Ga0105239_11481683 | Ga0105239_114816831 | 67 |
| 411 | 3300010375 | Ga0105239_12077686 | Ga0105239_120776861 | 67 |
| 412 | 3300011119 | Ga0105246_10050003 | Ga0105246_100500033 | 67 |
| 413 | 3300011119 | Ga0105246_11727676 | Ga0105246_117276761 | 67 |
| 414 | 3300013100 | Ga0157373_10027245 | Ga0157373_100272453 | 67 |
| 415 | 3300013100 | Ga0157373_10337199 | Ga0157373_103371991 | 67 |
| 416 | 3300013100 | Ga0157373_10859638 | Ga0157373_108596382 | 67 |
| 417 | 3300013102 | Ga0157371_10144534 | Ga0157371_101445342 | 67 |
| 418 | 3300013102 | Ga0157371_10592633 | Ga0157371_105926332 | 67 |
| 419 | 3300013104 | Ga0157370_10003091 | Ga0157370_1000309119 | 67 |
| 420 | 3300013104 | Ga0157370_10129075 | Ga0157370_101290754 | 67 |
| 421 | 3300013104 | Ga0157370_10409557 | Ga0157370_104095572 | 67 |
| 422 | 3300013104 | Ga0157370_10638133 | Ga0157370_106381332 | 67 |
| 423 | 3300013104 | Ga0157370_11549961 | Ga0157370_115499612 | 67 |
| 424 | 3300013105 | Ga0157369_10090313 | Ga0157369_100903134 | 67 |
| 425 | 3300013105 | Ga0157369_10194244 | Ga0157369_101942442 | 67 |
| 426 | 3300013105 | Ga0157369_10350564 | Ga0157369_103505642 | 67 |
| 427 | 3300013105 | Ga0157369_10787378 | Ga0157369_107873782 | 67 |
| 428 | 3300013105 | Ga0157369_10795951 | Ga0157369_107959511 | 67 |
| 429 | 3300013105 | Ga0157369_11424394 | Ga0157369_114243941 | 67 |
| 430 | 3300013105 | Ga0157369_12304133 | Ga0157369_123041332 | 67 |
| 431 | 3300013105 | Ga0157369_12484025 | Ga0157369_124840252 | 67 |
| 432 | 3300013296 | Ga0157374_10000651 | Ga0157374_1000065110 | 67 |
| 433 | 3300013296 | Ga0157374_10010838 | Ga0157374_100108382 | 67 |
| 434 | 3300013296 | Ga0157374_10012997 | Ga0157374_100129974 | 67 |
| 435 | 3300013296 | Ga0157374_10381809 | Ga0157374_103818092 | 67 |
| 436 | 3300013296 | Ga0157374_10382606 | Ga0157374_103826062 | 67 |
| 437 | 3300013296 | Ga0157374_10775673 | Ga0157374_107756732 | 67 |
| 438 | 3300013296 | Ga0157374_10896486 | Ga0157374_108964862 | 67 |
| 439 | 3300013296 | Ga0157374_10933704 | Ga0157374_109337042 | 67 |
| 440 | 3300013296 | Ga0157374_10959708 | Ga0157374_109597082 | 67 |
| 441 | 3300013296 | Ga0157374_11792342 | Ga0157374_117923421 | 67 |
| 442 | 3300013297 | Ga0157378_10022421 | Ga0157378_100224214 | 67 |
| 443 | 3300013297 | Ga0157378_10298955 | Ga0157378_102989552 | 67 |
| 444 | 3300013297 | Ga0157378_10837221 | Ga0157378_108372212 | 67 |
| 445 | 3300013297 | Ga0157378_10849249 | Ga0157378_108492492 | 67 |
| 446 | 3300013297 | Ga0157378_11018339 | Ga0157378_110183392 | 67 |
| 447 | 3300013297 | Ga0157378_11477792 | Ga0157378_114777921 | 67 |
| 448 | 3300013297 | Ga0157378_12475139 | Ga0157378_124751392 | 67 |
| 449 | 3300013306 | Ga0163162_10013461 | Ga0163162_100134615 | 67 |
| 450 | 3300013306 | Ga0163162_10119839 | Ga0163162_101198391 | 67 |
| 451 | 3300013306 | Ga0163162_10198693 | Ga0163162_101986934 | 67 |
| 452 | 3300013306 | Ga0163162_10836146 | Ga0163162_108361463 | 67 |
| 453 | 3300013306 | Ga0163162_11315797 | Ga0163162_113157971 | 67 |
| 454 | 3300013306 | Ga0163162_12263718 | Ga0163162_122637182 | 67 |
| 455 | 3300013306 | Ga0163162_13282939 | Ga0163162_132829392 | 67 |
| 456 | 3300013307 | Ga0157372_10001400 | Ga0157372_1000140010 | 67 |
| 457 | 3300013307 | Ga0157372_10276602 | Ga0157372_102766024 | 67 |
| 458 | 3300013307 | Ga0157372_11073579 | Ga0157372_110735792 | 67 |
| 459 | 3300013307 | Ga0157372_11135566 | Ga0157372_111355662 | 67 |
| 460 | 3300013307 | Ga0157372_11184058 | Ga0157372_111840582 | 67 |
| 461 | 3300013307 | Ga0157372_11471805 | Ga0157372_114718052 | 67 |
| 462 | 3300013308 | Ga0157375_10014421 | Ga0157375_100144215 | 67 |
| 463 | 3300013308 | Ga0157375_10015271 | Ga0157375_100152717 | 67 |
| 464 | 3300013308 | Ga0157375_10172707 | Ga0157375_101727073 | 67 |
| 465 | 3300013308 | Ga0157375_10688917 | Ga0157375_106889172 | 67 |
| 466 | 3300013308 | Ga0157375_11464537 | Ga0157375_114645372 | 67 |
| 467 | 3300014325 | Ga0163163_10000140 | Ga0163163_1000014027 | 67 |
| 468 | 3300014325 | Ga0163163_10000412 | Ga0163163_1000041244 | 67 |
| 469 | 3300014325 | Ga0163163_10646288 | Ga0163163_106462882 | 67 |
| 470 | 3300014325 | Ga0163163_10905750 | Ga0163163_109057502 | 67 |
| 471 | 3300014325 | Ga0163163_11579672 | Ga0163163_115796721 | 67 |
| 472 | 3300014325 | Ga0163163_12827877 | Ga0163163_128278771 | 67 |
| 473 | 3300014326 | Ga0157380_13451536 | Ga0157380_134515362 | 67 |
| 474 | 3300014745 | Ga0157377_10025131 | Ga0157377_100251313 | 67 |
| 475 | 3300014968 | Ga0157379_10010309 | Ga0157379_100103096 | 67 |
| 476 | 3300014968 | Ga0157379_10133912 | Ga0157379_101339122 | 67 |
| 477 | 3300014968 | Ga0157379_10381296 | Ga0157379_103812962 | 67 |
| 478 | 3300014969 | Ga0157376_10083065 | Ga0157376_100830653 | 67 |
| 479 | 3300014969 | Ga0157376_10096279 | Ga0157376_100962791 | 67 |
| 480 | 3300014969 | Ga0157376_11340603 | Ga0157376_113406032 | 67 |
| 481 | 3300014969 | Ga0157376_12614354 | Ga0157376_126143542 | 67 |
| 482 | 3300017792 | Ga0163161_10712248 | Ga0163161_107122482 | 67 |
| 483 | 3300017792 | Ga0163161_11632194 | Ga0163161_116321942 | 67 |
| 484 | 3300025315 | Ga0207697_10094189 | Ga0207697_100941892 | 67 |
| 485 | 3300025315 | Ga0207697_10247743 | Ga0207697_102477432 | 67 |
| 486 | 3300025315 | Ga0207697_10562651 | Ga0207697_105626511 | 67 |
| 487 | 3300025321 | Ga0207656_10111536 | Ga0207656_101115363 | 67 |
| 488 | 3300025321 | Ga0207656_10223911 | Ga0207656_102239111 | 67 |
| 489 | 3300025711 | Ga0207696_1014686 | Ga0207696_10146862 | 67 |
| 490 | 3300025899 | Ga0207642_10728983 | Ga0207642_107289832 | 67 |
| 491 | 3300025900 | Ga0207710_10016171 | Ga0207710_100161711 | 67 |
| 492 | 3300025900 | Ga0207710_10018201 | Ga0207710_100182015 | 67 |
| 493 | 3300025901 | Ga0207688_10486369 | Ga0207688_104863691 | 67 |
| 494 | 3300025903 | Ga0207680_10043146 | Ga0207680_100431462 | 67 |
| 495 | 3300025903 | Ga0207680_10108229 | Ga0207680_101082292 | 67 |
| 496 | 3300025904 | Ga0207647_10012819 | Ga0207647_100128192 | 67 |
| 497 | 3300025908 | Ga0207643_10088991 | Ga0207643_100889913 | 67 |
| 498 | 3300025908 | Ga0207643_10748674 | Ga0207643_107486742 | 67 |
| 499 | 3300025909 | Ga0207705_10007203 | Ga0207705_100072034 | 67 |
| 500 | 3300025909 | Ga0207705_10993598 | Ga0207705_109935982 | 67 |
| 501 | 3300025911 | Ga0207654_10807594 | Ga0207654_108075942 | 67 |
| 502 | 3300025912 | Ga0207707_10114076 | Ga0207707_101140762 | 67 |
| 503 | 3300025912 | Ga0207707_10978585 | Ga0207707_109785852 | 67 |
| 504 | 3300025913 | Ga0207695_10061162 | Ga0207695_100611625 | 67 |
| 505 | 3300025913 | Ga0207695_10841816 | Ga0207695_108418162 | 67 |
| 506 | 3300025917 | Ga0207660_10326218 | Ga0207660_103262182 | 67 |
| 507 | 3300025917 | Ga0207660_11370930 | Ga0207660_113709301 | 67 |
| 508 | 3300025918 | Ga0207662_10358055 | Ga0207662_103580552 | 67 |
| 509 | 3300025918 | Ga0207662_10443483 | Ga0207662_104434832 | 67 |
| 510 | 3300025918 | Ga0207662_10969643 | Ga0207662_109696432 | 67 |
| 511 | 3300025919 | Ga0207657_11321500 | Ga0207657_113215001 | 67 |
| 512 | 3300025920 | Ga0207649_10333712 | Ga0207649_103337121 | 67 |
| 513 | 3300025920 | Ga0207649_10634158 | Ga0207649_106341582 | 67 |
| 514 | 3300025921 | Ga0207652_10844363 | Ga0207652_108443632 | 67 |
| 515 | 3300025921 | Ga0207652_11005627 | Ga0207652_110056272 | 67 |
| 516 | 3300025923 | Ga0207681_10074149 | Ga0207681_100741493 | 67 |
| 517 | 3300025924 | Ga0207694_10066924 | Ga0207694_100669245 | 67 |
| 518 | 3300025924 | Ga0207694_10984261 | Ga0207694_109842612 | 67 |
| 519 | 3300025925 | Ga0207650_10181630 | Ga0207650_101816303 | 67 |
| 520 | 3300025925 | Ga0207650_10218070 | Ga0207650_102180701 | 67 |
| 521 | 3300025925 | Ga0207650_11508266 | Ga0207650_115082662 | 67 |
| 522 | 3300025925 | Ga0207650_11842753 | Ga0207650_118427531 | 67 |
| 523 | 3300025926 | Ga0207659_10255513 | Ga0207659_102555132 | 67 |
| 524 | 3300025926 | Ga0207659_10606940 | Ga0207659_106069402 | 67 |
| 525 | 3300025927 | Ga0207687_10026842 | Ga0207687_100268427 | 67 |
| 526 | 3300025927 | Ga0207687_10154658 | Ga0207687_101546582 | 67 |
| 527 | 3300025928 | Ga0207700_10251859 | Ga0207700_102518592 | 67 |
| 528 | 3300025929 | Ga0207664_10835921 | Ga0207664_108359211 | 67 |
| 529 | 3300025931 | Ga0207644_10021845 | Ga0207644_100218453 | 67 |
| 530 | 3300025931 | Ga0207644_10099645 | Ga0207644_100996452 | 67 |
| 531 | 3300025931 | Ga0207644_10338089 | Ga0207644_103380892 | 67 |
| 532 | 3300025931 | Ga0207644_11064009 | Ga0207644_110640092 | 67 |
| 533 | 3300025931 | Ga0207644_11219072 | Ga0207644_112190721 | 67 |
| 534 | 3300025933 | Ga0207706_11052936 | Ga0207706_110529361 | 67 |
| 535 | 3300025933 | Ga0207706_11519886 | Ga0207706_115198862 | 67 |
| 536 | 3300025934 | Ga0207686_10142853 | Ga0207686_101428532 | 67 |
| 537 | 3300025934 | Ga0207686_10383054 | Ga0207686_103830542 | 67 |
| 538 | 3300025936 | Ga0207670_10086769 | Ga0207670_100867692 | 67 |
| 539 | 3300025936 | Ga0207670_10124712 | Ga0207670_101247122 | 67 |
| 540 | 3300025936 | Ga0207670_10956363 | Ga0207670_109563632 | 67 |
| 541 | 3300025937 | Ga0207669_11412727 | Ga0207669_114127271 | 67 |
| 542 | 3300025938 | Ga0207704_10972932 | Ga0207704_109729321 | 67 |
| 543 | 3300025940 | Ga0207691_11197353 | Ga0207691_111973532 | 67 |
| 544 | 3300025941 | Ga0207711_10000307 | Ga0207711_1000030745 | 67 |
| 545 | 3300025941 | Ga0207711_10686948 | Ga0207711_106869482 | 67 |
| 546 | 3300025941 | Ga0207711_11132845 | Ga0207711_111328451 | 67 |
| 547 | 3300025941 | Ga0207711_11780069 | Ga0207711_117800692 | 67 |
| 548 | 3300025942 | Ga0207689_10116560 | Ga0207689_101165602 | 67 |
| 549 | 3300025942 | Ga0207689_10343202 | Ga0207689_103432021 | 67 |
| 550 | 3300025942 | Ga0207689_10531405 | Ga0207689_105314052 | 67 |
| 551 | 3300025942 | Ga0207689_11041444 | Ga0207689_110414442 | 67 |
| 552 | 3300025944 | Ga0207661_10067519 | Ga0207661_100675194 | 67 |
| 553 | 3300025944 | Ga0207661_10143088 | Ga0207661_101430883 | 67 |
| 554 | 3300025945 | Ga0207679_10005785 | Ga0207679_100057854 | 67 |
| 555 | 3300025945 | Ga0207679_10065423 | Ga0207679_100654233 | 67 |
| 556 | 3300025945 | Ga0207679_11503905 | Ga0207679_115039051 | 67 |
| 557 | 3300025949 | Ga0207667_10069308 | Ga0207667_100693083 | 67 |
| 558 | 3300025949 | Ga0207667_10637120 | Ga0207667_106371203 | 67 |
| 559 | 3300025949 | Ga0207667_11743067 | Ga0207667_117430671 | 67 |
| 560 | 3300025960 | Ga0207651_10149806 | Ga0207651_101498063 | 67 |
| 561 | 3300025960 | Ga0207651_10348135 | Ga0207651_103481352 | 67 |
| 562 | 3300025960 | Ga0207651_11786524 | Ga0207651_117865242 | 67 |
| 563 | 3300025961 | Ga0207712_10011723 | Ga0207712_100117235 | 67 |
| 564 | 3300025961 | Ga0207712_10029309 | Ga0207712_100293094 | 67 |
| 565 | 3300025961 | Ga0207712_10314705 | Ga0207712_103147051 | 67 |
| 566 | 3300025972 | Ga0207668_10086815 | Ga0207668_100868154 | 67 |
| 567 | 3300025972 | Ga0207668_10290440 | Ga0207668_102904403 | 67 |
| 568 | 3300025981 | Ga0207640_10033935 | Ga0207640_100339352 | 67 |
| 569 | 3300025981 | Ga0207640_10583083 | Ga0207640_105830832 | 67 |
| 570 | 3300025981 | Ga0207640_10597757 | Ga0207640_105977572 | 67 |
| 571 | 3300025981 | Ga0207640_11173914 | Ga0207640_111739142 | 67 |
| 572 | 3300025986 | Ga0207658_10001500 | Ga0207658_100015006 | 67 |
| 573 | 3300025986 | Ga0207658_10311435 | Ga0207658_103114353 | 67 |
| 574 | 3300026023 | Ga0207677_10073284 | Ga0207677_100732842 | 67 |
| 575 | 3300026023 | Ga0207677_10294708 | Ga0207677_102947082 | 67 |
| 576 | 3300026023 | Ga0207677_10382922 | Ga0207677_103829222 | 67 |
| 577 | 3300026023 | Ga0207677_11282408 | Ga0207677_112824082 | 67 |
| 578 | 3300026035 | Ga0207703_10005721 | Ga0207703_100057218 | 67 |
| 579 | 3300026035 | Ga0207703_10136675 | Ga0207703_101366752 | 67 |
| 580 | 3300026035 | Ga0207703_10174909 | Ga0207703_101749093 | 67 |
| 581 | 3300026035 | Ga0207703_10283935 | Ga0207703_102839351 | 67 |
| 582 | 3300026035 | Ga0207703_10477614 | Ga0207703_104776142 | 67 |
| 583 | 3300026035 | Ga0207703_12141841 | Ga0207703_121418411 | 67 |
| 584 | 3300026041 | Ga0207639_10363117 | Ga0207639_103631171 | 67 |
| 585 | 3300026041 | Ga0207639_10442726 | Ga0207639_104427261 | 67 |
| 586 | 3300026041 | Ga0207639_11682373 | Ga0207639_116823732 | 67 |
| 587 | 3300026067 | Ga0207678_10656193 | Ga0207678_106561931 | 67 |
| 588 | 3300026075 | Ga0207708_10670720 | Ga0207708_106707202 | 67 |
| 589 | 3300026075 | Ga0207708_10931890 | Ga0207708_109318902 | 67 |
| 590 | 3300026078 | Ga0207702_10009019 | Ga0207702_100090192 | 67 |
| 591 | 3300026078 | Ga0207702_10130275 | Ga0207702_101302753 | 67 |
| 592 | 3300026078 | Ga0207702_10680747 | Ga0207702_106807471 | 67 |
| 593 | 3300026078 | Ga0207702_11275604 | Ga0207702_112756042 | 67 |
| 594 | 3300026078 | Ga0207702_11668010 | Ga0207702_116680101 | 67 |
| 595 | 3300026088 | Ga0207641_10001412 | Ga0207641_1000141211 | 67 |
| 596 | 3300026088 | Ga0207641_10058605 | Ga0207641_100586052 | 67 |
| 597 | 3300026088 | Ga0207641_10113016 | Ga0207641_101130162 | 67 |
| 598 | 3300026088 | Ga0207641_10774296 | Ga0207641_107742962 | 67 |
| 599 | 3300026088 | Ga0207641_10873570 | Ga0207641_108735702 | 67 |
| 600 | 3300026088 | Ga0207641_10946859 | Ga0207641_109468592 | 67 |
| 601 | 3300026088 | Ga0207641_11874414 | Ga0207641_118744142 | 67 |
| 602 | 3300026088 | Ga0207641_12159222 | Ga0207641_121592222 | 67 |
| 603 | 3300026089 | Ga0207648_10270686 | Ga0207648_102706862 | 67 |
| 604 | 3300026089 | Ga0207648_10856826 | Ga0207648_108568262 | 67 |
| 605 | 3300026095 | Ga0207676_10002011 | Ga0207676_100020117 | 67 |
| 606 | 3300026095 | Ga0207676_10046801 | Ga0207676_100468013 | 67 |
| 607 | 3300026095 | Ga0207676_10269508 | Ga0207676_102695082 | 67 |
| 608 | 3300026095 | Ga0207676_10921042 | Ga0207676_109210422 | 67 |
| 609 | 3300026095 | Ga0207676_10938281 | Ga0207676_109382812 | 67 |
| 610 | 3300026095 | Ga0207676_11633095 | Ga0207676_116330952 | 67 |
| 611 | 3300026116 | Ga0207674_10000905 | Ga0207674_1000090522 | 67 |
| 612 | 3300026116 | Ga0207674_10167732 | Ga0207674_101677322 | 67 |
| 613 | 3300026116 | Ga0207674_11142759 | Ga0207674_111427592 | 67 |
| 614 | 3300026116 | Ga0207674_11663046 | Ga0207674_116630462 | 67 |
| 615 | 3300026118 | Ga0207675_100016334 | Ga0207675_1000163347 | 67 |
| 616 | 3300026118 | Ga0207675_100068024 | Ga0207675_1000680242 | 67 |
| 617 | 3300026118 | Ga0207675_101204067 | Ga0207675_1012040672 | 67 |
| 618 | 3300026118 | Ga0207675_101383745 | Ga0207675_1013837453 | 67 |
| 619 | 3300026118 | Ga0207675_101429820 | Ga0207675_1014298202 | 67 |
| 620 | 3300026142 | Ga0207698_10052318 | Ga0207698_100523183 | 67 |
| 621 | 3300026142 | Ga0207698_11227259 | Ga0207698_112272591 | 67 |
| 622 | 3300027866 | Ga0209813_10127343 | Ga0209813_101273432 | 67 |
| 623 | 3300027907 | Ga0207428_10875236 | Ga0207428_108752362 | 67 |
| 624 | 3300028379 | Ga0268266_11524383 | Ga0268266_115243832 | 67 |
| 625 | 3300028380 | Ga0268265_10588012 | Ga0268265_105880121 | 67 |
| 626 | 3300028380 | Ga0268265_11183290 | Ga0268265_111832901 | 67 |
| 627 | 3300028381 | Ga0268264_10001167 | Ga0268264_1000116711 | 67 |
| 628 | 3300028381 | Ga0268264_10065240 | Ga0268264_100652404 | 67 |
| 629 | 3300028381 | Ga0268264_10267320 | Ga0268264_102673204 | 67 |
| 630 | 3300028381 | Ga0268264_12393954 | Ga0268264_123939541 | 67 |
| 631 | 3300028381 | Ga0268264_12394631 | Ga0268264_123946311 | 67 |
| 632 | 3300030734 | Ga0316179_1070387 | Ga0316179_107038714 | 67 |
| 633 | 3300030742 | Ga0316183_1175878 | Ga0316183_117587817 | 67 |
| 634 | 3300030744 | Ga0316181_1060641 | Ga0316181_10606412 | 67 |
| 635 | 3300030745 | Ga0316182_1132274 | Ga0316182_11322744 | 67 |
| 636 | 3300030745 | Ga0316182_1185667 | Ga0316182_11856672 | 67 |
| 637 | 3300031456 | Ga0307513_10347931 | Ga0307513_103479311 | 67 |
| 638 | 3300031456 | Ga0307513_10689110 | Ga0307513_106891101 | 67 |
| 639 | 3300031548 | Ga0307408_100162823 | Ga0307408_1001628233 | 67 |
| 640 | 3300031730 | Ga0307516_10280382 | Ga0307516_102803822 | 67 |
| 641 | 3300031731 | Ga0307405_10005875 | Ga0307405_100058754 | 67 |
| 642 | 3300031731 | Ga0307405_10120776 | Ga0307405_101207763 | 67 |
| 643 | 3300031824 | Ga0307413_10099064 | Ga0307413_100990643 | 67 |
| 644 | 3300031824 | Ga0307413_10177532 | Ga0307413_101775322 | 67 |
| 645 | 3300031824 | Ga0307413_10519951 | Ga0307413_105199512 | 67 |
| 646 | 3300031824 | Ga0307413_10758610 | Ga0307413_107586102 | 67 |
| 647 | 3300031852 | Ga0307410_10009191 | Ga0307410_100091916 | 67 |
| 648 | 3300031852 | Ga0307410_10047837 | Ga0307410_100478373 | 67 |
| 649 | 3300031852 | Ga0307410_11010409 | Ga0307410_110104092 | 67 |
| 650 | 3300031852 | Ga0307410_11252994 | Ga0307410_112529942 | 67 |
| 651 | 3300031901 | Ga0307406_10054133 | Ga0307406_100541332 | 67 |
| 652 | 3300031901 | Ga0307406_10760134 | Ga0307406_107601342 | 67 |
| 653 | 3300031903 | Ga0307407_10308441 | Ga0307407_103084411 | 67 |
| 654 | 3300031903 | Ga0307407_10516863 | Ga0307407_105168632 | 67 |
| 655 | 3300031903 | Ga0307407_11610536 | Ga0307407_116105362 | 67 |
| 656 | 3300031911 | Ga0307412_10052660 | Ga0307412_100526604 | 67 |
| 657 | 3300031911 | Ga0307412_10055154 | Ga0307412_100551542 | 67 |
| 658 | 3300031911 | Ga0307412_10330856 | Ga0307412_103308562 | 67 |
| 659 | 3300031995 | Ga0307409_100174244 | Ga0307409_1001742443 | 67 |
| 660 | 3300031995 | Ga0307409_100409525 | Ga0307409_1004095252 | 67 |
| 661 | 3300031995 | Ga0307409_100442390 | Ga0307409_1004423902 | 67 |
| 662 | 3300031995 | Ga0307409_101081727 | Ga0307409_1010817272 | 67 |
| 663 | 3300031995 | Ga0307409_102885840 | Ga0307409_1028858402 | 67 |
| 664 | 3300032002 | Ga0307416_101117802 | Ga0307416_1011178022 | 67 |
| 665 | 3300032002 | Ga0307416_101372137 | Ga0307416_1013721371 | 67 |
| 666 | 3300032002 | Ga0307416_101526986 | Ga0307416_1015269862 | 67 |
| 667 | 3300032004 | Ga0307414_10242421 | Ga0307414_102424213 | 67 |
| 668 | 3300032004 | Ga0307414_11896231 | Ga0307414_118962312 | 67 |
| 669 | 3300032005 | Ga0307411_10216273 | Ga0307411_102162732 | 67 |
| 670 | 3300032005 | Ga0307411_10767803 | Ga0307411_107678032 | 67 |
| 671 | 3300032005 | Ga0307411_11703893 | Ga0307411_117038931 | 67 |
| 672 | 3300032005 | Ga0307411_12216140 | Ga0307411_122161401 | 67 |
| 673 | 3300032126 | Ga0307415_100073574 | Ga0307415_1000735744 | 67 |
| 674 | 3300032126 | Ga0307415_100084187 | Ga0307415_1000841872 | 67 |
| 675 | 3300032126 | Ga0307415_100146132 | Ga0307415_1001461323 | 67 |
| 676 | 3300032126 | Ga0307415_100400494 | Ga0307415_1004004941 | 67 |
| 677 | 3300035111 | Ga0373923_0232869 | Ga0373923_0232869_424_627 | 67 |
| 678 | 3300035172 | Ga0373955_0587812 | Ga0373955_0587812_194_397 | 67 |
| 679 | 3300035724 | Ga0373933_0509509 | Ga0373933_0509509_38_241 | 67 |
| 680 | 3300036401 | Ga0373937_0328105 | Ga0373937_0328105_320_523 | 67 |
| 681 | 3300037418 | Ga0395900_0110055 | Ga0395900_0110055_392_595 | 67 |
| 682 | 3300037466 | Ga0395898_0536127 | Ga0395898_0536127_194_397 | 67 |
| 683 | 3300037471 | Ga0395905_0092323 | Ga0395905_0092323_465_671 | 67 |
| 684 | 3300038443 | Ga0395901_0855182 | Ga0395901_0855182_517_720 | 67 |
| 685 | 3300041404 | Ga0439436_0006432 | Ga0439436_0006432_2346_2561 | 67 |
| 686 | 3300041406 | Ga0439439_0004220 | Ga0439439_0004220_2142_2357 | 67 |
| 687 | 3300041453 | Ga0451797_0891978 | Ga0451797_0891978_47_262 | 67 |
| 688 | 3300041486 | Ga0451807_1584278 | Ga0451807_1584278_537_740 | 67 |
| 689 | 3300041501 | Ga0451845_0238394 | Ga0451845_0238394_241_444 | 67 |
| 690 | 3300042014 | Ga0439457_003541 | Ga0439457_003541_904_1119 | 67 |
| 691 | 3300044673 | Ga0453683_0000035 | Ga0453683_0000035_119564_119767 | 67 |
| 692 | 3300044673 | Ga0453683_0033984 | Ga0453683_0033984_1886_2089 | 67 |
| 693 | 3300044673 | Ga0453683_0536856 | Ga0453683_0536856_369_572 | 67 |
| 694 | 3300044712 | Ga0453684_0000128 | Ga0453684_0000128_181559_181765 | 67 |
| 695 | 3300044712 | Ga0453684_0052392 | Ga0453684_0052392_4430_4633 | 67 |
| 696 | 3300044712 | Ga0453684_0220157 | Ga0453684_0220157_1120_1323 | 67 |
| 697 | 3300045051 | Ga0451576_0002081 | Ga0451576_0002081_7410_7613 | 67 |
| 698 | 3300045051 | Ga0451576_0239300 | Ga0451576_0239300_1233_1436 | 67 |
| 699 | 3300045051 | Ga0451576_0660059 | Ga0451576_0660059_129_332 | 67 |
| 700 | 3300045051 | Ga0451576_1065587 | Ga0451576_1065587_168_374 | 67 |
| 701 | 3300045051 | Ga0451576_1196528 | Ga0451576_1196528_465_668 | 67 |
| 702 | 3300045051 | Ga0451576_2048915 | Ga0451576_2048915_252_455 | 67 |
| 703 | 3300046460 | Ga0495638_0237313 | Ga0495638_0237313_255_458 | 67 |
| 704 | 3300046471 | Ga0495650_0000006 | Ga0495650_0000006_507556_507759 | 67 |
| 705 | 3300046471 | Ga0495650_0042209 | Ga0495650_0042209_402_605 | 67 |
| 706 | 3300046491 | Ga0495584_0247089 | Ga0495584_0247089_418_621 | 67 |
| 707 | 3300046507 | Ga0495606_0330341 | Ga0495606_0330341_464_694 | 67 |
| 708 | 3300046511 | Ga0495608_0889861 | Ga0495608_0889861_65_268 | 67 |
| 709 | 3300046513 | Ga0495616_0108921 | Ga0495616_0108921_318_521 | 67 |
| 710 | 3300046533 | Ga0495640_0730626 | Ga0495640_0730626_371_574 | 67 |
| 711 | 3300046535 | Ga0495586_0673226 | Ga0495586_0673226_239_454 | 67 |
| 712 | 3300046537 | Ga0495598_0020876 | Ga0495598_0020876_241_444 | 67 |
| 713 | 3300046537 | Ga0495598_0159068 | Ga0495598_0159068_361_564 | 67 |
| 714 | 3300046542 | Ga0495597_0298992 | Ga0495597_0298992_398_601 | 67 |
| 715 | 3300046543 | Ga0495645_0179284 | Ga0495645_0179284_565_768 | 67 |
| 716 | 3300046543 | Ga0495645_0475395 | Ga0495645_0475395_131_334 | 67 |
| 717 | 3300046615 | Ga0495656_0198312 | Ga0495656_0198312_351_554 | 67 |
| 718 | 3300046616 | Ga0495668_0787192 | Ga0495668_0787192_100_303 | 67 |
| 719 | 3300046664 | Ga0495659_0177207 | Ga0495659_0177207_436_639 | 67 |
| 720 | 3300046665 | Ga0495661_0276371 | Ga0495661_0276371_302_532 | 67 |
| 721 | 3300046684 | Ga0495669_0145835 | Ga0495669_0145835_170_373 | 67 |
| 722 | 3300046691 | Ga0495670_0475673 | Ga0495670_0475673_31_261 | 67 |
| 723 | 3300046694 | Ga0495649_0126177 | Ga0495649_0126177_433_663 | 67 |
| 724 | 3300047318 | Ga0495636_0276255 | Ga0495636_0276255_557_766 | 67 |
| 725 | 3300047445 | Ga0495677_0250857 | Ga0495677_0250857_111_314 | 67 |
| 726 | 3300047471 | Ga0495684_1077541 | Ga0495684_1077541_260_463 | 67 |
| 727 | 3300048091 | Ga0495626_0037058 | Ga0495626_0037058_413_643 | 67 |
| 728 | 3300048091 | Ga0495626_0206489 | Ga0495626_0206489_171_392 | 67 |
| 729 | 3300048912 | Ga0496109_0752630 | Ga0496109_0752630_560_772 | 67 |
| 730 | 3300048912 | Ga0496109_1904097 | Ga0496109_1904097_30_233 | 67 |
| 731 | 3300048915 | Ga0496112_0729904 | Ga0496112_0729904_243_476 | 67 |
| 732 | 3300048918 | Ga0496115_1386511 | Ga0496115_1386511_167_370 | 67 |
| 733 | 3300048920 | Ga0496117_0366720 | Ga0496117_0366720_494_727 | 67 |
| 734 | 3300048922 | Ga0496119_0429408 | Ga0496119_0429408_357_560 | 67 |
| 735 | 3300048923 | Ga0496120_0077948 | Ga0496120_0077948_572_775 | 67 |
| 736 | 3300048924 | Ga0496121_0000043 | Ga0496121_0000043_277865_278074 | 67 |
| 737 | 3300048925 | Ga0496122_0003743 | Ga0496122_0003743_11103_11312 | 67 |
| 738 | 3300048926 | Ga0496123_0026380 | Ga0496123_0026380_1328_1537 | 67 |
| 739 | 3300048926 | Ga0496123_0478382 | Ga0496123_0478382_129_362 | 67 |
| 740 | 3300048928 | Ga0496125_0202025 | Ga0496125_0202025_357_566 | 67 |
| 741 | 3300048929 | Ga0496126_0000147 | Ga0496126_0000147_28544_28747 | 67 |
| 742 | 3300049571 | Ga0501034_0054677 | Ga0501034_0054677_1273_1476 | 67 |
| 743 | 3300049574 | Ga0501038_0033610 | Ga0501038_0033610_3451_3666 | 67 |
| 744 | 3300049574 | Ga0501038_1234583 | Ga0501038_1234583_324_527 | 67 |
| 745 | 3300049588 | Ga0501072_0221303 | Ga0501072_0221303_1082_1288 | 67 |
| 746 | 3300049589 | Ga0501073_0122609 | Ga0501073_0122609_308_511 | 67 |
| 747 | 3300049650 | Ga0501199_015872 | Ga0501199_015872_312_515 | 67 |
| 748 | 3300049654 | Ga0501207_012024 | Ga0501207_012024_130_333 | 67 |
| 749 | 3300049668 | Ga0501233_119268 | Ga0501233_119268_460_663 | 67 |
| 750 | 3300049669 | Ga0501235_046307 | Ga0501235_046307_576_779 | 67 |
| 751 | 3300049679 | Ga0501249_000072 | Ga0501249_000072_5165_5368 | 67 |
| 752 | 3300049686 | Ga0501257_033308 | Ga0501257_033308_374_577 | 67 |
| 753 | 3300049686 | Ga0501257_077793 | Ga0501257_077793_414_617 | 67 |
| 754 | 3300049688 | Ga0501259_113634 | Ga0501259_113634_92_295 | 67 |
| 755 | 3300049690 | Ga0501261_133231 | Ga0501261_133231_242_451 | 67 |
| 756 | 3300049705 | Ga0501225_0039216 | Ga0501225_0039216_218_421 | 67 |
| 757 | 3300049742 | Ga0501080_0019898 | Ga0501080_0019898_5397_5600 | 67 |
| 758 | 3300049742 | Ga0501080_0074841 | Ga0501080_0074841_2624_2830 | 67 |
| 759 | 3300049743 | Ga0501081_1022852 | Ga0501081_1022852_25_240 | 67 |
| 760 | 3300049744 | Ga0501083_0087030 | Ga0501083_0087030_1678_1881 | 67 |
| 761 | 3300049779 | Ga0501283_087991 | Ga0501283_087991_206_409 | 67 |
| 762 | 3300049779 | Ga0501283_133413 | Ga0501283_133413_263_466 | 67 |
| 763 | 3300049850 | Ga0501204_091885 | Ga0501204_091885_118_321 | 67 |
| 764 | 3300050491 | nmdc:mga00v17_229780_c1 | nmdc:mga00v17_229780_c1_530_748 | 67 |
| 765 | 3300050493 | nmdc:mga0k408_25140_c1 | nmdc:mga0k408_25140_c1_1624_1830 | 67 |
| 766 | 3300050493 | nmdc:mga0k408_92_c1 | nmdc:mga0k408_92_c1_3070_3288 | 67 |
| 767 | 3300050494 | nmdc:mga06z11_394_c1 | nmdc:mga06z11_394_c1_14595_14813 | 67 |
| 768 | 3300050494 | nmdc:mga06z11_73792_c1 | nmdc:mga06z11_73792_c1_827_1030 | 67 |
| 769 | 3300050495 | nmdc:mga04h51_16905_c1 | nmdc:mga04h51_16905_c1_845_1063 | 67 |
| 770 | 3300050507 | nmdc:mga05p37_11445_c1 | nmdc:mga05p37_11445_c1_334_540 | 67 |
| 771 | 3300050507 | nmdc:mga05p37_131822_c1 | nmdc:mga05p37_131822_c1_2540_2743 | 67 |
| 772 | 3300050507 | nmdc:mga05p37_191020_c1 | nmdc:mga05p37_191020_c1_296_502 | 67 |
| 773 | 3300050507 | nmdc:mga05p37_2245364_c1 | nmdc:mga05p37_2245364_c1_82_288 | 67 |
| 774 | 3300050510 | nmdc:mga06r32_97616_c1 | nmdc:mga06r32_97616_c1_677_883 | 67 |
| 775 | 3300050511 | nmdc:mga08y16_792497_c1 | nmdc:mga08y16_792497_c1_202_405 | 67 |
| 776 | 3300050512 | nmdc:mga0n895_1779448_c1 | nmdc:mga0n895_1779448_c1_110_313 | 67 |
| 777 | 3300050515 | nmdc:mga0a205_294425_c1 | nmdc:mga0a205_294425_c1_1026_1229 | 67 |
| 778 | 3300053096 | Ga0500641_0254615 | Ga0500641_0254615_510_713 | 67 |
| 779 | 3300053108 | Ga0500562_104616 | Ga0500562_104616_459_680 | 67 |
| 780 | 3300053146 | Ga0500588_0251839 | Ga0500588_0251839_238_441 | 67 |
| 781 | 3300053153 | Ga0500616_0062988 | Ga0500616_0062988_1047_1253 | 67 |
| 782 | 3300053158 | Ga0500627_0017659 | Ga0500627_0017659_2422_2625 | 67 |
| 783 | 3300060353 | Ga0501082_0546814 | Ga0501082_0546814_628_831 | 67 |
| 784 | 3300060353 | Ga0501082_1340075 | Ga0501082_1340075_297_500 | 67 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7t5u-assembly1.cif.gz_A | structure of e. coli ms115-1 caph n-terminal domain | 0.9039 | 6 | 58 |
| 1b0n-assembly1.cif.gz_A | sinr protein/sini protein complex | 0.9036 | 7 | 57 |
| 6rnz-assembly2.cif.gz_B | crystal structure of the n-terminal hth dna-binding domain of the essential repressor ddro from radiation-resistant deinococcus bacteria (deinococcus deserti) | 0.9004 | 6 | 56 |
| 6jq1-assembly1.cif.gz_A | crystal structure of ddro from deinococcus geothermalis | 0.8938 | 6 | 56 |
| 1r69-assembly1.cif.gz_A | structure of the amino-terminal domain of phage 434 repressor at 2.0 angstroms resolution | 0.8932 | 7 | 58 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3qq6B00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9058 | 6 | 58 | 1.10.260.40 |
| 1b0nA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9036 | 7 | 57 | 1.10.260.40 |
| 2b5aB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8953 | 6 | 58 | 1.10.260.40 |
| 2b5aC00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8948 | 6 | 58 | 1.10.260.40 |
| 3zkcB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8899 | 7 | 58 | 1.10.260.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1T5GIX8-F1-model_v4 | Putative transcriptional regulator | 0.9726 | 2 | 67 |
GO:0003677
|
| AF-A0A1Q6LVU2-F1-model_v4 | deleted | 0.9724 | 2 | 67 |
|
| AF-F9MVV8-F1-model_v4 | deleted | 0.9721 | 3 | 67 |
|
| AF-A0A1H9FDC5-F1-model_v4 | Putative transcriptional regulator | 0.9695 | 2 | 67 |
GO:0003677
|
| AF-A0A6N3AWF2-F1-model_v4 | HTH cro/C1-type domain-containing protein | 0.9691 | 3 | 67 |
GO:0003677
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar