F480696
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 784 | 384 | 1568 | 154 |
Family's Representative Sequence
| Representative Sequence | 3300025949|Ga0207667_10626150|Ga0207667_106261502 |
| Length | 188 |
| Sequence | MVRYLLVGSLIPPGVRAATADGSGILPKLCLCPGPPMIQLTINGKARRFDGDPEMPLLWFLRDELQLTGTKFGCGMGLCGACTVHVNGEAARSCLTPMSAAAGKTVTTIEGLSATGSHPLQKAWEEANVPQCGYCQSGQIMQAAAMLKAKPHPTDQDIDSAMSGNICRCGTYQRIRQAIRMAANGGKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 29 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 34 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 45 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 74 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 82 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 83 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 88 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 93 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 95 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 96 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 98 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 99 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 103 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 104 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 105 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 107 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 108 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 109 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 110 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 111 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 112 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 115 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 116 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 129 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 130 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013875 | Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 | Metagenome | Rhizosphere |
| 140 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 143 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 146 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 147 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 151 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 152 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 153 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 154 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 155 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 156 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 157 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 166 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 167 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 170 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 221 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 223 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 224 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 227 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 229 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 230 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 231 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 236 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 238 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 241 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 242 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 243 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 244 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 245 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 246 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 247 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 248 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 249 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 250 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 251 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 252 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 254 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 255 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 256 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 257 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 258 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 259 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 260 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 261 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 262 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 263 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 264 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 265 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 266 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 267 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 268 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 269 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 270 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 271 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 272 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 273 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 274 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 306 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 307 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 308 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 309 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 310 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 312 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 313 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 314 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 315 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 316 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 317 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 318 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 319 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 320 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 321 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 322 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 323 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 324 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 325 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 343 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 344 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 345 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 350 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 351 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 358 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 359 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 360 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 361 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 362 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 363 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 364 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 365 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 366 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 367 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 368 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 369 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 370 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 371 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 372 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 373 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 374 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 375 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 376 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 377 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 378 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 379 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 380 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 383 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 384 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.72 |
| Metatranscriptomes | 1.15 |
| Isolates | 0.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.27 |
| Nodule | 0 |
| Rhizoplane | 2.42 |
| Rhizosphere | 75.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207667_10626150 | 3300025949 | Bacteria | 1083 |
| 2 | JGI24740J21852_10082966 | 3300001979 | Bacteria | 837 |
| 3 | JGI24739J22299_10027145 | 3300001989 | Bacteria | 2004 |
| 4 | JGI24735J21928_10072852 | 3300002067 | Bacteria | 984 |
| 5 | JGI25156J39149_1001597 | 3300002705 | Bacteria | 9270 |
| 6 | JGI25156J39149_1016641 | 3300002705 | Bacteria | 1422 |
| 7 | JGI25162J39368_1006156 | 3300002737 | Bacteria | 2141 |
| 8 | JGI25157J39369_1001161 | 3300002741 | Bacteria | 11328 |
| 9 | JGI25157J39369_1001478 | 3300002741 | Bacteria | 8667 |
| 10 | JGI25164J39214_1000198 | 3300002772 | Bacteria | 51603 |
| 11 | JGI25406J46586_10032341 | 3300003203 | Bacteria | 1945 |
| 12 | JGI25165J46597_1000354 | 3300003214 | Bacteria | 51605 |
| 13 | rootH1_10024611 | 3300003316 | Bacteria | 4634 |
| 14 | rootH2_10304912 | 3300003320 | Bacteria | 1231 |
| 15 | Ga0007416J51690_1114583 | 3300003577 | Bacteria | 626 |
| 16 | Ga0007429J51699_1092521 | 3300003579 | Bacteria | 932 |
| 17 | Ga0055539_1001188 | 3300003752 | Bacteria | 5293 |
| 18 | Ga0055533_1014903 | 3300003756 | Bacteria | 773 |
| 19 | Ga0055532_1000185 | 3300003758 | Bacteria | 52548 |
| 20 | Ga0055532_1000217 | 3300003758 | Bacteria | 44081 |
| 21 | Ga0055525_1000059 | 3300003759 | Bacteria | 202797 |
| 22 | Ga0055527_1000050 | 3300003760 | Bacteria | 104542 |
| 23 | Ga0055527_1000128 | 3300003760 | Bacteria | 53342 |
| 24 | Ga0055527_1001996 | 3300003760 | Bacteria | 3719 |
| 25 | Ga0055527_1006915 | 3300003760 | Bacteria | 1406 |
| 26 | Ga0055535_1000119 | 3300003761 | Bacteria | 84990 |
| 27 | Ga0055535_1000206 | 3300003761 | Bacteria | 62330 |
| 28 | Ga0055535_1000212 | 3300003761 | Bacteria | 61691 |
| 29 | Ga0055535_1000287 | 3300003761 | Bacteria | 53346 |
| 30 | Ga0055535_1000295 | 3300003761 | Bacteria | 51620 |
| 31 | Ga0055542_1000057 | 3300003762 | Bacteria | 162955 |
| 32 | Ga0055542_1000119 | 3300003762 | Bacteria | 104542 |
| 33 | Ga0055542_1000238 | 3300003762 | Bacteria | 63399 |
| 34 | Ga0055542_1000311 | 3300003762 | Bacteria | 53346 |
| 35 | Ga0055542_1000966 | 3300003762 | Bacteria | 18722 |
| 36 | Ga0055529_1000049 | 3300003763 | Bacteria | 208413 |
| 37 | Ga0055529_1000270 | 3300003763 | Bacteria | 61712 |
| 38 | Ga0055529_1000329 | 3300003763 | Bacteria | 53347 |
| 39 | Ga0055529_1000884 | 3300003763 | Bacteria | 16980 |
| 40 | Ga0055526_1017989 | 3300003771 | Bacteria | 2665 |
| 41 | Ga0055528_1000986 | 3300003790 | Bacteria | 18895 |
| 42 | Ga0055540_1007096 | 3300003792 | Bacteria | 4300 |
| 43 | Ga0055531_10015237 | 3300003794 | Bacteria | 3405 |
| 44 | Ga0055541_1015339 | 3300003841 | Bacteria | 1022 |
| 45 | JGI25405J52794_10117483 | 3300003911 | Bacteria | 598 |
| 46 | Ga0055543_1025049 | 3300004625 | Bacteria | 1067 |
| 47 | Ga0058862_12866476 | 3300004803 | Bacteria | 597 |
| 48 | Ga0065165_1000490 | 3300005262 | Bacteria | 61094 |
| 49 | Ga0065704_10379807 | 3300005289 | Bacteria | 775 |
| 50 | Ga0065712_10025321 | 3300005290 | Bacteria | 1399 |
| 51 | Ga0065715_10016620 | 3300005293 | Bacteria | 2090 |
| 52 | Ga0065707_10020820 | 3300005295 | Bacteria | 1694 |
| 53 | Ga0070658_10013460 | 3300005327 | Bacteria | 6565 |
| 54 | Ga0070658_10019732 | 3300005327 | Bacteria | 5397 |
| 55 | Ga0070676_10460293 | 3300005328 | Bacteria | 896 |
| 56 | Ga0070690_100826417 | 3300005330 | Bacteria | 720 |
| 57 | Ga0070670_101042285 | 3300005331 | Bacteria | 745 |
| 58 | Ga0068869_100621768 | 3300005334 | Bacteria | 914 |
| 59 | Ga0070666_11014417 | 3300005335 | Bacteria | 616 |
| 60 | Ga0070680_100003733 | 3300005336 | Bacteria | 11378 |
| 61 | Ga0070680_100092078 | 3300005336 | Bacteria | 2510 |
| 62 | Ga0070680_100646880 | 3300005336 | Bacteria | 909 |
| 63 | Ga0070680_101034608 | 3300005336 | Bacteria | 709 |
| 64 | Ga0070682_101551439 | 3300005337 | Bacteria | 571 |
| 65 | Ga0068868_101255339 | 3300005338 | Bacteria | 687 |
| 66 | Ga0070660_100000004 | 3300005339 | Bacteria | 171018 |
| 67 | Ga0070660_100237424 | 3300005339 | Bacteria | 1484 |
| 68 | Ga0070689_101386646 | 3300005340 | Bacteria | 635 |
| 69 | Ga0070675_100985211 | 3300005354 | Bacteria | 774 |
| 70 | Ga0070675_101303418 | 3300005354 | Unclassified | 669 |
| 71 | Ga0070674_100058186 | 3300005356 | Bacteria | 2686 |
| 72 | Ga0070674_100438288 | 3300005356 | Bacteria | 1076 |
| 73 | Ga0070673_100065377 | 3300005364 | Bacteria | 2901 |
| 74 | Ga0070673_100889690 | 3300005364 | Bacteria | 825 |
| 75 | Ga0070688_100176706 | 3300005365 | Bacteria | 1478 |
| 76 | Ga0070688_100803867 | 3300005365 | Bacteria | 736 |
| 77 | Ga0070659_100000023 | 3300005366 | Bacteria | 150907 |
| 78 | Ga0070659_100282912 | 3300005366 | Bacteria | 1380 |
| 79 | Ga0070709_10026841 | 3300005434 | Bacteria | 3417 |
| 80 | Ga0070714_100176322 | 3300005435 | Bacteria | 1942 |
| 81 | Ga0070714_100298913 | 3300005435 | Bacteria | 1500 |
| 82 | Ga0070714_100779577 | 3300005435 | Bacteria | 925 |
| 83 | Ga0070713_101691405 | 3300005436 | Bacteria | 614 |
| 84 | Ga0070713_101977762 | 3300005436 | Bacteria | 565 |
| 85 | Ga0070710_10052966 | 3300005437 | Bacteria | 2284 |
| 86 | Ga0070710_10109467 | 3300005437 | Bacteria | 1657 |
| 87 | Ga0070710_10390861 | 3300005437 | Bacteria | 930 |
| 88 | Ga0070711_100019243 | 3300005439 | Bacteria | 4378 |
| 89 | Ga0070711_100137094 | 3300005439 | Bacteria | 1830 |
| 90 | Ga0070711_100187298 | 3300005439 | Bacteria | 1588 |
| 91 | Ga0070705_100656145 | 3300005440 | Bacteria | 819 |
| 92 | Ga0070694_100003493 | 3300005444 | Bacteria | 9404 |
| 93 | Ga0070694_101397333 | 3300005444 | Bacteria | 590 |
| 94 | Ga0070708_100101800 | 3300005445 | Bacteria | 2631 |
| 95 | Ga0070708_100165342 | 3300005445 | Bacteria | 2064 |
| 96 | Ga0070663_100003816 | 3300005455 | Bacteria | 8772 |
| 97 | Ga0070678_100258533 | 3300005456 | Bacteria | 1463 |
| 98 | Ga0070678_100418023 | 3300005456 | Bacteria | 1168 |
| 99 | Ga0070662_100139989 | 3300005457 | Bacteria | 1874 |
| 100 | Ga0070662_101229062 | 3300005457 | Bacteria | 644 |
| 101 | Ga0070681_10280278 | 3300005458 | Bacteria | 1577 |
| 102 | Ga0070681_10747956 | 3300005458 | Bacteria | 894 |
| 103 | Ga0070681_11367505 | 3300005458 | Bacteria | 631 |
| 104 | Ga0068867_100221425 | 3300005459 | Bacteria | 1525 |
| 105 | Ga0070685_11189472 | 3300005466 | Bacteria | 579 |
| 106 | Ga0070706_100293128 | 3300005467 | Bacteria | 1518 |
| 107 | Ga0070706_100368912 | 3300005467 | Bacteria | 1337 |
| 108 | Ga0070706_100720437 | 3300005467 | Bacteria | 925 |
| 109 | Ga0070707_100039683 | 3300005468 | Bacteria | 4501 |
| 110 | Ga0070707_100860618 | 3300005468 | Bacteria | 871 |
| 111 | Ga0070698_100000373 | 3300005471 | Bacteria | 46692 |
| 112 | Ga0070698_100095616 | 3300005471 | Bacteria | 2948 |
| 113 | Ga0070699_100058652 | 3300005518 | Bacteria | 3335 |
| 114 | Ga0070699_100100014 | 3300005518 | Bacteria | 2541 |
| 115 | Ga0070699_100279308 | 3300005518 | Bacteria | 1496 |
| 116 | Ga0070699_101285789 | 3300005518 | Bacteria | 671 |
| 117 | Ga0070679_100180423 | 3300005530 | Bacteria | 2084 |
| 118 | Ga0070679_100576487 | 3300005530 | Bacteria | 1069 |
| 119 | Ga0070679_100791708 | 3300005530 | Bacteria | 891 |
| 120 | Ga0070684_100138170 | 3300005535 | Bacteria | 2202 |
| 121 | Ga0070697_100030107 | 3300005536 | Bacteria | 4358 |
| 122 | Ga0068853_100312418 | 3300005539 | Bacteria | 1455 |
| 123 | Ga0068853_101553536 | 3300005539 | Bacteria | 641 |
| 124 | Ga0070672_100330382 | 3300005543 | Bacteria | 1297 |
| 125 | Ga0070672_101570790 | 3300005543 | Bacteria | 590 |
| 126 | Ga0070695_100257127 | 3300005545 | Bacteria | 1274 |
| 127 | Ga0070696_100115548 | 3300005546 | Bacteria | 1937 |
| 128 | Ga0070665_100031017 | 3300005548 | Bacteria | 5380 |
| 129 | Ga0070665_100034634 | 3300005548 | Bacteria | 5078 |
| 130 | Ga0070665_100102956 | 3300005548 | Bacteria | 2859 |
| 131 | Ga0070665_100205709 | 3300005548 | Bacteria | 1969 |
| 132 | Ga0070665_100861402 | 3300005548 | Bacteria | 919 |
| 133 | Ga0070704_100573890 | 3300005549 | Bacteria | 988 |
| 134 | Ga0070704_100712086 | 3300005549 | Bacteria | 891 |
| 135 | Ga0068855_100008161 | 3300005563 | Bacteria | 12658 |
| 136 | Ga0068855_100018483 | 3300005563 | Bacteria | 8378 |
| 137 | Ga0068855_100021333 | 3300005563 | Bacteria | 7767 |
| 138 | Ga0068855_100078722 | 3300005563 | Bacteria | 3824 |
| 139 | Ga0068855_100558349 | 3300005563 | Bacteria | 1239 |
| 140 | Ga0068855_100881104 | 3300005563 | Bacteria | 947 |
| 141 | Ga0070664_100092553 | 3300005564 | Bacteria | 2618 |
| 142 | Ga0070664_100140946 | 3300005564 | Bacteria | 2123 |
| 143 | Ga0068854_101301605 | 3300005578 | Bacteria | 654 |
| 144 | Ga0068854_101588320 | 3300005578 | Bacteria | 596 |
| 145 | Ga0068856_100000455 | 3300005614 | Bacteria | 45174 |
| 146 | Ga0068856_100039844 | 3300005614 | Bacteria | 4613 |
| 147 | Ga0068856_100111296 | 3300005614 | Bacteria | 2736 |
| 148 | Ga0068856_100164962 | 3300005614 | Bacteria | 2226 |
| 149 | Ga0068856_100326776 | 3300005614 | Bacteria | 1551 |
| 150 | Ga0068856_100447973 | 3300005614 | Bacteria | 1312 |
| 151 | Ga0068856_100638230 | 3300005614 | Bacteria | 1086 |
| 152 | Ga0068856_101137822 | 3300005614 | Bacteria | 798 |
| 153 | Ga0070702_101267641 | 3300005615 | Bacteria | 597 |
| 154 | Ga0068852_100015181 | 3300005616 | Bacteria | 5961 |
| 155 | Ga0068852_100544718 | 3300005616 | Bacteria | 1160 |
| 156 | Ga0068852_101517615 | 3300005616 | Unclassified | 692 |
| 157 | Ga0068859_100277630 | 3300005617 | Bacteria | 1768 |
| 158 | Ga0068864_100527368 | 3300005618 | Bacteria | 1139 |
| 159 | Ga0068864_100893620 | 3300005618 | Bacteria | 877 |
| 160 | Ga0068864_101246982 | 3300005618 | Bacteria | 743 |
| 161 | Ga0068864_101394447 | 3300005618 | Bacteria | 702 |
| 162 | Ga0068866_10732638 | 3300005718 | Bacteria | 681 |
| 163 | Ga0068861_100067402 | 3300005719 | Bacteria | 2762 |
| 164 | Ga0068861_100335650 | 3300005719 | Bacteria | 1321 |
| 165 | Ga0068863_100389331 | 3300005841 | Bacteria | 1362 |
| 166 | Ga0068858_100280984 | 3300005842 | Bacteria | 1585 |
| 167 | Ga0068858_100306012 | 3300005842 | Bacteria | 1517 |
| 168 | Ga0068858_100807547 | 3300005842 | Bacteria | 915 |
| 169 | Ga0068858_101053404 | 3300005842 | Bacteria | 798 |
| 170 | Ga0068862_100027705 | 3300005844 | Bacteria | 4770 |
| 171 | Ga0081455_10078082 | 3300005937 | Bacteria | 2721 |
| 172 | Ga0081455_10090188 | 3300005937 | Bacteria | 2486 |
| 173 | Ga0081455_10183189 | 3300005937 | Bacteria | 1584 |
| 174 | Ga0081538_10010333 | 3300005981 | Bacteria | 7658 |
| 175 | Ga0081540_1104017 | 3300005983 | Bacteria | 1216 |
| 176 | Ga0081540_1219320 | 3300005983 | Bacteria | 678 |
| 177 | Ga0081539_10016966 | 3300005985 | Bacteria | 5157 |
| 178 | Ga0070717_10028502 | 3300006028 | Bacteria | 4471 |
| 179 | Ga0070717_10033606 | 3300006028 | Bacteria | 4138 |
| 180 | Ga0070717_10048549 | 3300006028 | Bacteria | 3482 |
| 181 | Ga0070717_10158061 | 3300006028 | Bacteria | 1965 |
| 182 | Ga0070717_11529869 | 3300006028 | Bacteria | 605 |
| 183 | Ga0075368_10284662 | 3300006042 | Bacteria | 711 |
| 184 | Ga0075364_10263931 | 3300006051 | Bacteria | 1171 |
| 185 | Ga0075364_10452104 | 3300006051 | Bacteria | 877 |
| 186 | Ga0070715_10005486 | 3300006163 | Bacteria | 4234 |
| 187 | Ga0070716_100221099 | 3300006173 | Bacteria | 1272 |
| 188 | Ga0070712_100207703 | 3300006175 | Bacteria | 1542 |
| 189 | Ga0070712_100237032 | 3300006175 | Bacteria | 1452 |
| 190 | Ga0070712_100371547 | 3300006175 | Bacteria | 1175 |
| 191 | Ga0070712_100688436 | 3300006175 | Bacteria | 871 |
| 192 | Ga0075367_10140420 | 3300006178 | Bacteria | 1496 |
| 193 | Ga0075367_10319264 | 3300006178 | Bacteria | 979 |
| 194 | Ga0075369_10008829 | 3300006186 | Bacteria | 3893 |
| 195 | Ga0075366_10079958 | 3300006195 | Bacteria | 1952 |
| 196 | Ga0097621_100378603 | 3300006237 | Bacteria | 1264 |
| 197 | Ga0075428_100129484 | 3300006844 | Bacteria | 2746 |
| 198 | Ga0075428_100213687 | 3300006844 | Bacteria | 2084 |
| 199 | Ga0075428_101365436 | 3300006844 | Bacteria | 744 |
| 200 | Ga0075430_100017099 | 3300006846 | Bacteria | 6178 |
| 201 | Ga0075430_100208253 | 3300006846 | Bacteria | 1623 |
| 202 | Ga0075430_100365188 | 3300006846 | Bacteria | 1192 |
| 203 | Ga0075430_100382421 | 3300006846 | Bacteria | 1162 |
| 204 | Ga0075431_100049994 | 3300006847 | Bacteria | 4311 |
| 205 | Ga0075431_101303471 | 3300006847 | Bacteria | 687 |
| 206 | Ga0075433_10739008 | 3300006852 | Bacteria | 861 |
| 207 | Ga0075434_100074195 | 3300006871 | Bacteria | 3395 |
| 208 | Ga0075434_101430195 | 3300006871 | Bacteria | 701 |
| 209 | Ga0075429_100065686 | 3300006880 | Bacteria | 3159 |
| 210 | Ga0075429_100289861 | 3300006880 | Unclassified | 1433 |
| 211 | Ga0075436_100177970 | 3300006914 | Bacteria | 1503 |
| 212 | Ga0097620_100277631 | 3300006931 | Bacteria | 1768 |
| 213 | Ga0075435_100117975 | 3300007076 | Bacteria | 2212 |
| 214 | Ga0099795_10002609 | 3300007788 | Bacteria | 4283 |
| 215 | Ga0099795_10030126 | 3300007788 | Bacteria | 1860 |
| 216 | Ga0099795_10172256 | 3300007788 | Bacteria | 900 |
| 217 | Ga0105250_10019883 | 3300009092 | Bacteria | 2715 |
| 218 | Ga0105240_10000337 | 3300009093 | Bacteria | 87719 |
| 219 | Ga0105240_10001353 | 3300009093 | Bacteria | 42046 |
| 220 | Ga0105240_10006874 | 3300009093 | Bacteria | 16625 |
| 221 | Ga0105240_10095466 | 3300009093 | Bacteria | 3625 |
| 222 | Ga0105240_10132247 | 3300009093 | Bacteria | 2992 |
| 223 | Ga0105240_10296296 | 3300009093 | Bacteria | 1852 |
| 224 | Ga0105240_10335475 | 3300009093 | Bacteria | 1719 |
| 225 | Ga0105240_12115071 | 3300009093 | Bacteria | 584 |
| 226 | Ga0111539_10305921 | 3300009094 | Bacteria | 1850 |
| 227 | Ga0111539_10617194 | 3300009094 | Bacteria | 1263 |
| 228 | Ga0105245_10041617 | 3300009098 | Bacteria | 4096 |
| 229 | Ga0105245_10529817 | 3300009098 | Bacteria | 1198 |
| 230 | Ga0105245_10548624 | 3300009098 | Bacteria | 1178 |
| 231 | Ga0105245_10953931 | 3300009098 | Bacteria | 901 |
| 232 | Ga0114129_10202084 | 3300009147 | Bacteria | 2691 |
| 233 | Ga0114129_10257209 | 3300009147 | Bacteria | 2342 |
| 234 | Ga0114129_10283516 | 3300009147 | Bacteria | 2213 |
| 235 | Ga0114129_10772223 | 3300009147 | Bacteria | 1228 |
| 236 | Ga0114129_11024268 | 3300009147 | Bacteria | 1038 |
| 237 | Ga0114129_11050039 | 3300009147 | Bacteria | 1023 |
| 238 | Ga0114129_12410464 | 3300009147 | Bacteria | 630 |
| 239 | Ga0105243_10291796 | 3300009148 | Unclassified | 1474 |
| 240 | Ga0105241_10877466 | 3300009174 | Bacteria | 831 |
| 241 | Ga0105241_11182011 | 3300009174 | Bacteria | 724 |
| 242 | Ga0105242_10159121 | 3300009176 | Bacteria | 1975 |
| 243 | Ga0105242_10279618 | 3300009176 | Bacteria | 1515 |
| 244 | Ga0105242_10453292 | 3300009176 | Bacteria | 1210 |
| 245 | Ga0105248_10050901 | 3300009177 | Bacteria | 4647 |
| 246 | Ga0105248_10757727 | 3300009177 | Bacteria | 1095 |
| 247 | Ga0105248_10806005 | 3300009177 | Bacteria | 1060 |
| 248 | Ga0105248_10982851 | 3300009177 | Bacteria | 953 |
| 249 | Ga0105248_11411424 | 3300009177 | Bacteria | 788 |
| 250 | Ga0105248_12343157 | 3300009177 | Bacteria | 608 |
| 251 | Ga0105248_12591790 | 3300009177 | Bacteria | 578 |
| 252 | Ga0105237_10002393 | 3300009545 | Bacteria | 23297 |
| 253 | Ga0105237_10004165 | 3300009545 | Bacteria | 16837 |
| 254 | Ga0105237_10009190 | 3300009545 | Bacteria | 10610 |
| 255 | Ga0105237_10133017 | 3300009545 | Bacteria | 2482 |
| 256 | Ga0105238_10008672 | 3300009551 | Bacteria | 10171 |
| 257 | Ga0105238_10021470 | 3300009551 | Bacteria | 6576 |
| 258 | Ga0105238_10324851 | 3300009551 | Bacteria | 1525 |
| 259 | Ga0105249_10613862 | 3300009553 | Bacteria | 1143 |
| 260 | Ga0105249_10805681 | 3300009553 | Bacteria | 1003 |
| 261 | Ga0105249_11518156 | 3300009553 | Bacteria | 742 |
| 262 | Ga0105035_107571 | 3300009988 | Bacteria | 916 |
| 263 | Ga0099796_10006093 | 3300010159 | Bacteria | 3065 |
| 264 | Ga0099796_10115822 | 3300010159 | Bacteria | 1025 |
| 265 | Ga0105239_10005104 | 3300010375 | Bacteria | 15496 |
| 266 | Ga0105246_10533496 | 3300011119 | Bacteria | 1003 |
| 267 | Ga0105246_11086427 | 3300011119 | Bacteria | 730 |
| 268 | Ga0157370_10005606 | 3300013104 | Bacteria | 14053 |
| 269 | Ga0157370_10146500 | 3300013104 | Bacteria | 2199 |
| 270 | Ga0157370_10276222 | 3300013104 | Bacteria | 1552 |
| 271 | Ga0157370_10607615 | 3300013104 | Bacteria | 1001 |
| 272 | Ga0157370_11069860 | 3300013104 | Bacteria | 729 |
| 273 | Ga0157369_10001633 | 3300013105 | Bacteria | 27410 |
| 274 | Ga0157369_10004521 | 3300013105 | Bacteria | 16369 |
| 275 | Ga0157369_10088108 | 3300013105 | Bacteria | 3313 |
| 276 | Ga0157369_10215104 | 3300013105 | Bacteria | 2013 |
| 277 | Ga0157369_10504677 | 3300013105 | Bacteria | 1251 |
| 278 | Ga0157369_11449589 | 3300013105 | Bacteria | 699 |
| 279 | Ga0157374_10027248 | 3300013296 | Bacteria | 5152 |
| 280 | Ga0157374_10180316 | 3300013296 | Bacteria | 2063 |
| 281 | Ga0157374_11790706 | 3300013296 | Bacteria | 639 |
| 282 | Ga0157378_10064717 | 3300013297 | Bacteria | 3272 |
| 283 | Ga0157378_12308919 | 3300013297 | Bacteria | 589 |
| 284 | Ga0163162_10181605 | 3300013306 | Bacteria | 2230 |
| 285 | Ga0163162_11346718 | 3300013306 | Bacteria | 812 |
| 286 | Ga0163162_11670522 | 3300013306 | Bacteria | 727 |
| 287 | Ga0163162_11964272 | 3300013306 | Bacteria | 670 |
| 288 | Ga0157372_10450412 | 3300013307 | Bacteria | 1500 |
| 289 | Ga0157372_11166673 | 3300013307 | Bacteria | 890 |
| 290 | Ga0157375_11085361 | 3300013308 | Bacteria | 937 |
| 291 | Ga0157375_12126510 | 3300013308 | Bacteria | 668 |
| 292 | Ga0157515_126273 | 3300013875 | Bacteria | 814 |
| 293 | Ga0163163_10024356 | 3300014325 | Bacteria | 5760 |
| 294 | Ga0163163_10024722 | 3300014325 | Bacteria | 5719 |
| 295 | Ga0163163_10026417 | 3300014325 | Bacteria | 5550 |
| 296 | Ga0163163_10179909 | 3300014325 | Bacteria | 2162 |
| 297 | Ga0163163_12157092 | 3300014325 | Bacteria | 616 |
| 298 | Ga0157380_10075894 | 3300014326 | Bacteria | 2733 |
| 299 | Ga0157380_10240941 | 3300014326 | Bacteria | 1630 |
| 300 | Ga0157380_10603157 | 3300014326 | Bacteria | 1087 |
| 301 | Ga0157380_11581399 | 3300014326 | Bacteria | 711 |
| 302 | Ga0157380_12208626 | 3300014326 | Bacteria | 614 |
| 303 | Ga0182008_10403786 | 3300014497 | Bacteria | 734 |
| 304 | Ga0157379_10029397 | 3300014968 | Bacteria | 4888 |
| 305 | Ga0157376_10105338 | 3300014969 | Bacteria | 2472 |
| 306 | Ga0157376_10816888 | 3300014969 | Bacteria | 946 |
| 307 | Ga0157376_10892597 | 3300014969 | Bacteria | 907 |
| 308 | Ga0182006_1014936 | 3300015261 | Bacteria | 3339 |
| 309 | Ga0182006_1021466 | 3300015261 | Bacteria | 2693 |
| 310 | Ga0182007_10000106 | 3300015262 | Bacteria | 59012 |
| 311 | Ga0163161_10590593 | 3300017792 | Bacteria | 914 |
| 312 | Ga0163161_11083324 | 3300017792 | Bacteria | 688 |
| 313 | Ga0184601_134489 | 3300019183 | Bacteria | 587 |
| 314 | Ga0206350_10736505 | 3300020080 | Bacteria | 1520 |
| 315 | Ga0213873_10071571 | 3300021358 | Bacteria | 956 |
| 316 | Ga0213872_10000071 | 3300021361 | Bacteria | 91423 |
| 317 | Ga0213872_10000785 | 3300021361 | Bacteria | 23235 |
| 318 | Ga0213872_10003152 | 3300021361 | Bacteria | 9257 |
| 319 | Ga0213872_10059439 | 3300021361 | Bacteria | 1730 |
| 320 | Ga0213872_10060842 | 3300021361 | Bacteria | 1708 |
| 321 | Ga0213872_10115178 | 3300021361 | Bacteria | 1191 |
| 322 | Ga0213872_10117995 | 3300021361 | Bacteria | 1174 |
| 323 | Ga0213874_10030925 | 3300021377 | Bacteria | 1546 |
| 324 | Ga0213874_10179083 | 3300021377 | Bacteria | 753 |
| 325 | Ga0213876_10033677 | 3300021384 | Bacteria | 2701 |
| 326 | Ga0213876_10156838 | 3300021384 | Bacteria | 1211 |
| 327 | Ga0213876_10227828 | 3300021384 | Bacteria | 991 |
| 328 | Ga0213875_10000004 | 3300021388 | Bacteria | 703388 |
| 329 | Ga0213875_10000409 | 3300021388 | Bacteria | 37759 |
| 330 | Ga0213875_10010793 | 3300021388 | Bacteria | 4567 |
| 331 | Ga0213875_10084814 | 3300021388 | Bacteria | 1478 |
| 332 | Ga0213875_10122583 | 3300021388 | Bacteria | 1215 |
| 333 | Ga0213875_10445581 | 3300021388 | Bacteria | 619 |
| 334 | Ga0213875_10542333 | 3300021388 | Bacteria | 560 |
| 335 | Ga0213871_10006468 | 3300021441 | Bacteria | 2479 |
| 336 | Ga0213871_10024857 | 3300021441 | Bacteria | 1521 |
| 337 | Ga0228598_1041091 | 3300024227 | Bacteria | 913 |
| 338 | Ga0209566_100408 | 3300025225 | Bacteria | 34108 |
| 339 | Ga0209674_100026 | 3300025226 | Bacteria | 490631 |
| 340 | Ga0209674_101565 | 3300025226 | Bacteria | 5812 |
| 341 | Ga0209674_102480 | 3300025226 | Bacteria | 3933 |
| 342 | Ga0209672_100007 | 3300025228 | Bacteria | 959482 |
| 343 | Ga0209672_100017 | 3300025228 | Bacteria | 514236 |
| 344 | Ga0209672_100065 | 3300025228 | Bacteria | 198168 |
| 345 | Ga0209672_100173 | 3300025228 | Bacteria | 54084 |
| 346 | Ga0209672_100857 | 3300025228 | Bacteria | 13919 |
| 347 | Ga0209147_100044 | 3300025229 | Bacteria | 300330 |
| 348 | Ga0209147_100124 | 3300025229 | Bacteria | 133627 |
| 349 | Ga0209563_100074 | 3300025230 | Bacteria | 224912 |
| 350 | Ga0207427_100213 | 3300025231 | Bacteria | 51669 |
| 351 | Ga0209437_100381 | 3300025233 | Bacteria | 43879 |
| 352 | Ga0209258_100017 | 3300025242 | Bacteria | 590785 |
| 353 | Ga0209258_100031 | 3300025242 | Bacteria | 463572 |
| 354 | Ga0209258_100038 | 3300025242 | Bacteria | 398959 |
| 355 | Ga0209258_100118 | 3300025242 | Bacteria | 183558 |
| 356 | Ga0209258_100144 | 3300025242 | Bacteria | 163814 |
| 357 | Ga0209646_1000824 | 3300025246 | Bacteria | 10466 |
| 358 | Ga0209026_1000044 | 3300025250 | Bacteria | 266550 |
| 359 | Ga0209026_1000431 | 3300025250 | Bacteria | 34966 |
| 360 | Ga0209677_107487 | 3300025253 | Bacteria | 2310 |
| 361 | Ga0209148_1000009 | 3300025254 | Bacteria | 1395625 |
| 362 | Ga0209148_1000024 | 3300025254 | Bacteria | 669890 |
| 363 | Ga0209148_1000027 | 3300025254 | Bacteria | 616374 |
| 364 | Ga0209148_1000044 | 3300025254 | Bacteria | 458417 |
| 365 | Ga0209148_1000141 | 3300025254 | Bacteria | 163821 |
| 366 | Ga0209759_1000517 | 3300025256 | Bacteria | 41788 |
| 367 | Ga0209759_1000779 | 3300025256 | Bacteria | 26706 |
| 368 | Ga0209233_1000323 | 3300025261 | Bacteria | 51669 |
| 369 | Ga0209455_1000010 | 3300025272 | Bacteria | 959482 |
| 370 | Ga0209455_1000025 | 3300025272 | Bacteria | 670673 |
| 371 | Ga0209455_1000032 | 3300025272 | Bacteria | 514243 |
| 372 | Ga0209455_1000058 | 3300025272 | Bacteria | 342028 |
| 373 | Ga0209455_1001839 | 3300025272 | Bacteria | 8885 |
| 374 | Ga0209673_1000059 | 3300025273 | Bacteria | 268892 |
| 375 | Ga0209564_1000283 | 3300025295 | Bacteria | 102740 |
| 376 | Ga0209051_1001186 | 3300025303 | Bacteria | 23570 |
| 377 | Ga0209051_1005394 | 3300025303 | Bacteria | 7492 |
| 378 | Ga0209051_1047107 | 3300025303 | Bacteria | 1476 |
| 379 | Ga0209257_1000264 | 3300025304 | Bacteria | 120518 |
| 380 | Ga0209257_1059664 | 3300025304 | Bacteria | 1041 |
| 381 | Ga0207696_1074758 | 3300025711 | Bacteria | 939 |
| 382 | Ga0207692_10083636 | 3300025898 | Bacteria | 1713 |
| 383 | Ga0207692_10247372 | 3300025898 | Bacteria | 1067 |
| 384 | Ga0207647_10004854 | 3300025904 | Bacteria | 9943 |
| 385 | Ga0207685_10073115 | 3300025905 | Bacteria | 1396 |
| 386 | Ga0207699_10016761 | 3300025906 | Bacteria | 3840 |
| 387 | Ga0207705_10112777 | 3300025909 | Bacteria | 2010 |
| 388 | Ga0207705_10329270 | 3300025909 | Bacteria | 1174 |
| 389 | Ga0207705_10404288 | 3300025909 | Bacteria | 1056 |
| 390 | Ga0207684_10332074 | 3300025910 | Bacteria | 1310 |
| 391 | Ga0207654_11063366 | 3300025911 | Bacteria | 589 |
| 392 | Ga0207695_10000203 | 3300025913 | Bacteria | 163681 |
| 393 | Ga0207695_10000273 | 3300025913 | Bacteria | 129404 |
| 394 | Ga0207695_10001289 | 3300025913 | Bacteria | 42571 |
| 395 | Ga0207695_10005122 | 3300025913 | Bacteria | 17554 |
| 396 | Ga0207695_10098915 | 3300025913 | Bacteria | 2916 |
| 397 | Ga0207695_10217137 | 3300025913 | Bacteria | 1821 |
| 398 | Ga0207695_10597292 | 3300025913 | Bacteria | 985 |
| 399 | Ga0207695_10780400 | 3300025913 | Bacteria | 836 |
| 400 | Ga0207671_10011634 | 3300025914 | Bacteria | 7141 |
| 401 | Ga0207671_10013289 | 3300025914 | Bacteria | 6566 |
| 402 | Ga0207671_10313390 | 3300025914 | Bacteria | 1241 |
| 403 | Ga0207693_10016897 | 3300025915 | Bacteria | 5826 |
| 404 | Ga0207693_10052095 | 3300025915 | Bacteria | 3210 |
| 405 | Ga0207693_10154990 | 3300025915 | Bacteria | 1802 |
| 406 | Ga0207693_10161001 | 3300025915 | Bacteria | 1766 |
| 407 | Ga0207693_10332234 | 3300025915 | Bacteria | 1190 |
| 408 | Ga0207663_10052557 | 3300025916 | Bacteria | 2542 |
| 409 | Ga0207663_10122286 | 3300025916 | Bacteria | 1784 |
| 410 | Ga0207663_10144307 | 3300025916 | Bacteria | 1662 |
| 411 | Ga0207663_10271920 | 3300025916 | Bacteria | 1255 |
| 412 | Ga0207660_10091219 | 3300025917 | Bacteria | 2259 |
| 413 | Ga0207657_10000001 | 3300025919 | Bacteria | 458536 |
| 414 | Ga0207649_10388800 | 3300025920 | Bacteria | 1041 |
| 415 | Ga0207649_11187655 | 3300025920 | Bacteria | 603 |
| 416 | Ga0207652_10148061 | 3300025921 | Bacteria | 2101 |
| 417 | Ga0207652_10158359 | 3300025921 | Bacteria | 2029 |
| 418 | Ga0207652_10952038 | 3300025921 | Bacteria | 756 |
| 419 | Ga0207646_10008018 | 3300025922 | Bacteria | 10651 |
| 420 | Ga0207646_10123363 | 3300025922 | Bacteria | 2329 |
| 421 | Ga0207681_10010470 | 3300025923 | Bacteria | 5676 |
| 422 | Ga0207681_10403376 | 3300025923 | Bacteria | 1105 |
| 423 | Ga0207694_10050890 | 3300025924 | Bacteria | 3210 |
| 424 | Ga0207694_10499828 | 3300025924 | Bacteria | 1018 |
| 425 | Ga0207650_10446098 | 3300025925 | Bacteria | 1076 |
| 426 | Ga0207650_10625289 | 3300025925 | Bacteria | 907 |
| 427 | Ga0207700_10013731 | 3300025928 | Bacteria | 5283 |
| 428 | Ga0207700_10543166 | 3300025928 | Bacteria | 1031 |
| 429 | Ga0207664_10390836 | 3300025929 | Bacteria | 1236 |
| 430 | Ga0207664_10460911 | 3300025929 | Bacteria | 1135 |
| 431 | Ga0207664_10569742 | 3300025929 | Bacteria | 1016 |
| 432 | Ga0207690_10000029 | 3300025932 | Bacteria | 160406 |
| 433 | Ga0207690_10090684 | 3300025932 | Bacteria | 2158 |
| 434 | Ga0207690_10221243 | 3300025932 | Bacteria | 1448 |
| 435 | Ga0207686_10016496 | 3300025934 | Bacteria | 4146 |
| 436 | Ga0207686_10543413 | 3300025934 | Bacteria | 907 |
| 437 | Ga0207686_10568711 | 3300025934 | Bacteria | 888 |
| 438 | Ga0207669_10070655 | 3300025937 | Bacteria | 2190 |
| 439 | Ga0207665_10001976 | 3300025939 | Bacteria | 13813 |
| 440 | Ga0207665_10019541 | 3300025939 | Bacteria | 4455 |
| 441 | Ga0207691_10342247 | 3300025940 | Bacteria | 1280 |
| 442 | Ga0207711_10832823 | 3300025941 | Bacteria | 859 |
| 443 | Ga0207689_11530744 | 3300025942 | Bacteria | 556 |
| 444 | Ga0207679_10224928 | 3300025945 | Bacteria | 1581 |
| 445 | Ga0207679_10549384 | 3300025945 | Bacteria | 1036 |
| 446 | Ga0207667_10003915 | 3300025949 | Bacteria | 18324 |
| 447 | Ga0207667_10049760 | 3300025949 | Bacteria | 4424 |
| 448 | Ga0207667_10374971 | 3300025949 | Bacteria | 1450 |
| 449 | Ga0207667_10605563 | 3300025949 | Bacteria | 1104 |
| 450 | Ga0207667_10655380 | 3300025949 | Bacteria | 1055 |
| 451 | Ga0207651_10120103 | 3300025960 | Bacteria | 1992 |
| 452 | Ga0207651_11151891 | 3300025960 | Bacteria | 696 |
| 453 | Ga0207712_10202145 | 3300025961 | Bacteria | 1576 |
| 454 | Ga0207712_10357695 | 3300025961 | Bacteria | 1215 |
| 455 | Ga0207703_10247960 | 3300026035 | Bacteria | 1604 |
| 456 | Ga0207703_10442763 | 3300026035 | Bacteria | 1212 |
| 457 | Ga0207703_10895219 | 3300026035 | Bacteria | 850 |
| 458 | Ga0207703_12129612 | 3300026035 | Bacteria | 537 |
| 459 | Ga0207639_10283578 | 3300026041 | Bacteria | 1458 |
| 460 | Ga0207639_11275386 | 3300026041 | Bacteria | 689 |
| 461 | Ga0207678_10000227 | 3300026067 | Bacteria | 50150 |
| 462 | Ga0207708_10202584 | 3300026075 | Bacteria | 1584 |
| 463 | Ga0207708_10763063 | 3300026075 | Bacteria | 831 |
| 464 | Ga0207708_11089557 | 3300026075 | Bacteria | 696 |
| 465 | Ga0207702_10002529 | 3300026078 | Bacteria | 17222 |
| 466 | Ga0207702_10012718 | 3300026078 | Bacteria | 7003 |
| 467 | Ga0207702_10036512 | 3300026078 | Bacteria | 4111 |
| 468 | Ga0207702_10052635 | 3300026078 | Bacteria | 3445 |
| 469 | Ga0207702_10401868 | 3300026078 | Bacteria | 1321 |
| 470 | Ga0207702_10472674 | 3300026078 | Bacteria | 1219 |
| 471 | Ga0207648_10353116 | 3300026089 | Bacteria | 1326 |
| 472 | Ga0207676_10860450 | 3300026095 | Bacteria | 887 |
| 473 | Ga0207675_100085125 | 3300026118 | Bacteria | 2967 |
| 474 | Ga0207675_100460912 | 3300026118 | Bacteria | 1261 |
| 475 | Ga0207675_100500949 | 3300026118 | Bacteria | 1209 |
| 476 | Ga0207698_10024704 | 3300026142 | Bacteria | 4222 |
| 477 | Ga0207698_10054163 | 3300026142 | Bacteria | 3085 |
| 478 | Ga0207698_11276307 | 3300026142 | Unclassified | 749 |
| 479 | Ga0207698_11417460 | 3300026142 | Bacteria | 710 |
| 480 | Ga0207698_12393151 | 3300026142 | Bacteria | 539 |
| 481 | Ga0209371_1000129 | 3300027312 | Bacteria | 124523 |
| 482 | Ga0268266_10010740 | 3300028379 | Bacteria | 7980 |
| 483 | Ga0268266_10284707 | 3300028379 | Bacteria | 1538 |
| 484 | Ga0268265_10308291 | 3300028380 | Bacteria | 1428 |
| 485 | Ga0307515_10093088 | 3300028794 | Bacteria | 3742 |
| 486 | Ga0265338_10113802 | 3300028800 | Bacteria | 2173 |
| 487 | Ga0268256_1000133 | 3300030500 | Bacteria | 102725 |
| 488 | Ga0307512_10172021 | 3300030522 | Bacteria | 1239 |
| 489 | Ga0265770_1007398 | 3300030878 | Bacteria | 1546 |
| 490 | Ga0265760_10011916 | 3300031090 | Bacteria | 2484 |
| 491 | Ga0265760_10339073 | 3300031090 | Bacteria | 537 |
| 492 | Ga0265327_10004235 | 3300031251 | Bacteria | 12871 |
| 493 | Ga0265316_10095091 | 3300031344 | Bacteria | 2270 |
| 494 | Ga0265316_10105173 | 3300031344 | Bacteria | 2142 |
| 495 | Ga0265316_11192990 | 3300031344 | Bacteria | 527 |
| 496 | Ga0307513_10284836 | 3300031456 | Bacteria | 1427 |
| 497 | Ga0307516_10000499 | 3300031730 | Bacteria | 52269 |
| 498 | Ga0316053_112151 | 3300032120 | Bacteria | 614 |
| 499 | Ga0373923_0296135 | 3300035111 | Bacteria | 765 |
| 500 | Ga0373932_0011260 | 3300035112 | Bacteria | 2182 |
| 501 | Ga0373943_0026858 | 3300035170 | Bacteria | 2701 |
| 502 | Ga0373943_0364261 | 3300035170 | Bacteria | 830 |
| 503 | Ga0373946_0226390 | 3300035171 | Bacteria | 905 |
| 504 | Ga0316574_0221228 | 3300035398 | Bacteria | 1213 |
| 505 | Ga0373935_0008964 | 3300035692 | Bacteria | 5988 |
| 506 | Ga0373947_0044834 | 3300035725 | Bacteria | 2645 |
| 507 | Ga0373947_0265587 | 3300035725 | Bacteria | 1138 |
| 508 | Ga0373947_0331982 | 3300035725 | Bacteria | 1018 |
| 509 | Ga0373937_0228238 | 3300036401 | Bacteria | 1753 |
| 510 | Ga0373925_0149534 | 3300037068 | Bacteria | 1833 |
| 511 | Ga0373925_0854255 | 3300037068 | Bacteria | 750 |
| 512 | Ga0373925_0882413 | 3300037068 | Bacteria | 737 |
| 513 | Ga0395899_0000062 | 3300037312 | Bacteria | 211388 |
| 514 | Ga0395899_0000167 | 3300037312 | Bacteria | 100973 |
| 515 | Ga0395899_0051027 | 3300037312 | Bacteria | 3071 |
| 516 | Ga0395899_0345830 | 3300037312 | Bacteria | 996 |
| 517 | Ga0395900_0000009 | 3300037418 | Bacteria | 476249 |
| 518 | Ga0395900_0000039 | 3300037418 | Bacteria | 248722 |
| 519 | Ga0395900_0043542 | 3300037418 | Bacteria | 4627 |
| 520 | Ga0395900_0599874 | 3300037418 | Bacteria | 1042 |
| 521 | Ga0395898_0000069 | 3300037466 | Bacteria | 254587 |
| 522 | Ga0395898_0000140 | 3300037466 | Bacteria | 190587 |
| 523 | Ga0395898_0259449 | 3300037466 | Bacteria | 1657 |
| 524 | Ga0395898_1487548 | 3300037466 | Bacteria | 603 |
| 525 | Ga0395898_1726355 | 3300037466 | Bacteria | 548 |
| 526 | Ga0395905_0019189 | 3300037471 | Bacteria | 6484 |
| 527 | Ga0395905_0078049 | 3300037471 | Bacteria | 3103 |
| 528 | Ga0395905_1479575 | 3300037471 | Bacteria | 583 |
| 529 | Ga0436364_0199993 | 3300037853 | Bacteria | 1822 |
| 530 | Ga0436364_0356734 | 3300037853 | Bacteria | 1492 |
| 531 | Ga0436364_0431728 | 3300037853 | Bacteria | 222864 |
| 532 | Ga0436364_0748068 | 3300037853 | Bacteria | 528910 |
| 533 | Ga0436364_0843268 | 3300037853 | Bacteria | 3606 |
| 534 | Ga0436364_1236165 | 3300037853 | Bacteria | 5054 |
| 535 | Ga0436364_1261036 | 3300037853 | Bacteria | 595 |
| 536 | Ga0436364_1342962 | 3300037853 | Bacteria | 521 |
| 537 | Ga0436364_1457846 | 3300037853 | Bacteria | 7907 |
| 538 | Ga0395901_0000014 | 3300038443 | Bacteria | 375100 |
| 539 | Ga0395901_1521625 | 3300038443 | Bacteria | 624 |
| 540 | Ga0400489_41603 | 3300039093 | Bacteria | 12259 |
| 541 | Ga0436365_0206806 | 3300039437 | Bacteria | 1657 |
| 542 | Ga0436365_0430209 | 3300039437 | Bacteria | 2425 |
| 543 | Ga0436365_0472708 | 3300039437 | Bacteria | 4488 |
| 544 | Ga0436365_0543679 | 3300039437 | Bacteria | 12016 |
| 545 | Ga0436365_0844407 | 3300039437 | Unclassified | 1031 |
| 546 | Ga0436365_1303722 | 3300039437 | Bacteria | 1639 |
| 547 | Ga0436365_1737587 | 3300039437 | Bacteria | 1954 |
| 548 | Ga0436360_0058815 | 3300039438 | Bacteria | 1227 |
| 549 | Ga0436360_0213572 | 3300039438 | Bacteria | 12542 |
| 550 | Ga0436360_0285718 | 3300039438 | Bacteria | 878 |
| 551 | Ga0436360_0380383 | 3300039438 | Bacteria | 11032 |
| 552 | Ga0436360_0517441 | 3300039438 | Bacteria | 2030 |
| 553 | Ga0436360_0914568 | 3300039438 | Bacteria | 14130 |
| 554 | Ga0436360_1336127 | 3300039438 | Bacteria | 987 |
| 555 | Ga0436361_0047346 | 3300039447 | Bacteria | 87631 |
| 556 | Ga0436361_0055354 | 3300039447 | Bacteria | 9058 |
| 557 | Ga0436361_0154707 | 3300039447 | Bacteria | 20033 |
| 558 | Ga0436361_0157085 | 3300039447 | Bacteria | 3080 |
| 559 | Ga0436361_0384722 | 3300039447 | Bacteria | 11499 |
| 560 | Ga0436361_0484676 | 3300039447 | Unclassified | 3794 |
| 561 | Ga0436361_0652142 | 3300039447 | Bacteria | 829 |
| 562 | Ga0436361_0666244 | 3300039447 | Bacteria | 8526 |
| 563 | Ga0436361_0788442 | 3300039447 | Bacteria | 540 |
| 564 | Ga0436361_0895187 | 3300039447 | Bacteria | 79068 |
| 565 | Ga0436361_0910912 | 3300039447 | Bacteria | 627 |
| 566 | Ga0436361_0923671 | 3300039447 | Bacteria | 2829 |
| 567 | Ga0436361_0932086 | 3300039447 | Bacteria | 3324 |
| 568 | Ga0436361_1021429 | 3300039447 | Bacteria | 12623 |
| 569 | Ga0436361_1097826 | 3300039447 | Bacteria | 2340 |
| 570 | Ga0436363_0756951 | 3300039450 | Bacteria | 1047 |
| 571 | Ga0436363_0963290 | 3300039450 | Unclassified | 2428 |
| 572 | Ga0436363_1397348 | 3300039450 | Bacteria | 3742 |
| 573 | Ga0436362_0063915 | 3300039453 | Bacteria | 5363 |
| 574 | Ga0436362_0283413 | 3300039453 | Bacteria | 2818 |
| 575 | Ga0436362_0566135 | 3300039453 | Bacteria | 1031 |
| 576 | Ga0436362_0955192 | 3300039453 | Bacteria | 1290 |
| 577 | Ga0436362_1210783 | 3300039453 | Bacteria | 3954 |
| 578 | Ga0451795_1304938 | 3300041456 | Bacteria | 1254 |
| 579 | Ga0451849_0220963 | 3300041505 | Bacteria | 756 |
| 580 | Ga0451853_0555938 | 3300041512 | Bacteria | 518 |
| 581 | Ga0439431_0003477 | 3300041997 | Bacteria | 3472 |
| 582 | Ga0439432_063004 | 3300042006 | Bacteria | 1140 |
| 583 | Ga0439446_0177389 | 3300042156 | Bacteria | 711 |
| 584 | Ga0451577_0035832 | 3300042876 | Bacteria | 4469 |
| 585 | Ga0451577_0070218 | 3300042876 | Bacteria | 3124 |
| 586 | Ga0451577_0815176 | 3300042876 | Bacteria | 843 |
| 587 | Ga0466969_0013964 | 3300044656 | Bacteria | 4228 |
| 588 | Ga0453683_0003615 | 3300044673 | Bacteria | 11339 |
| 589 | Ga0453683_0045779 | 3300044673 | Bacteria | 2743 |
| 590 | Ga0453683_0163493 | 3300044673 | Bacteria | 1409 |
| 591 | Ga0453683_0182467 | 3300044673 | Bacteria | 1331 |
| 592 | Ga0466965_0325808 | 3300044683 | Bacteria | 837 |
| 593 | Ga0466966_0021400 | 3300044684 | Bacteria | 4246 |
| 594 | Ga0466966_0253495 | 3300044684 | Bacteria | 1060 |
| 595 | Ga0466966_0408152 | 3300044684 | Bacteria | 816 |
| 596 | Ga0466961_0019310 | 3300044693 | Bacteria | 4384 |
| 597 | Ga0466961_0035203 | 3300044693 | Bacteria | 3215 |
| 598 | Ga0466961_0072126 | 3300044693 | Bacteria | 2190 |
| 599 | Ga0466961_0128385 | 3300044693 | Bacteria | 1589 |
| 600 | Ga0466963_0232258 | 3300044694 | Bacteria | 1293 |
| 601 | Ga0466963_0814535 | 3300044694 | Bacteria | 658 |
| 602 | Ga0453684_0000951 | 3300044712 | Bacteria | 95417 |
| 603 | Ga0453684_0001767 | 3300044712 | Bacteria | 57669 |
| 604 | Ga0453684_0165592 | 3300044712 | Bacteria | 2610 |
| 605 | Ga0453684_0391319 | 3300044712 | Bacteria | 1559 |
| 606 | Ga0466971_0002070 | 3300044719 | Bacteria | 8502 |
| 607 | Ga0466968_0066312 | 3300044735 | Bacteria | 1564 |
| 608 | Ga0466970_0000163 | 3300044765 | Bacteria | 31774 |
| 609 | Ga0466970_0279741 | 3300044765 | Bacteria | 938 |
| 610 | Ga0466957_0002878 | 3300044842 | Bacteria | 9324 |
| 611 | Ga0466959_0000383 | 3300045049 | Bacteria | 26156 |
| 612 | Ga0466959_0068211 | 3300045049 | Bacteria | 2577 |
| 613 | Ga0466959_0169300 | 3300045049 | Bacteria | 1533 |
| 614 | Ga0466959_0486696 | 3300045049 | Bacteria | 834 |
| 615 | Ga0451576_0003996 | 3300045051 | Bacteria | 19640 |
| 616 | Ga0451576_0424920 | 3300045051 | Bacteria | 1394 |
| 617 | Ga0451576_0503573 | 3300045051 | Bacteria | 1272 |
| 618 | Ga0466958_0145503 | 3300045836 | Bacteria | 1493 |
| 619 | Ga0466967_0579131 | 3300045976 | Bacteria | 1106 |
| 620 | Ga0495627_000483 | 3300046453 | Bacteria | 33680 |
| 621 | Ga0495638_0169811 | 3300046460 | Bacteria | 1252 |
| 622 | Ga0495650_0000007 | 3300046471 | Bacteria | 718072 |
| 623 | Ga0495650_0063018 | 3300046471 | Bacteria | 1480 |
| 624 | Ga0495580_0527279 | 3300046472 | Bacteria | 786 |
| 625 | Ga0495585_0013190 | 3300046492 | Bacteria | 4842 |
| 626 | Ga0495610_0018383 | 3300046512 | Bacteria | 3951 |
| 627 | Ga0495620_0061257 | 3300046515 | Bacteria | 1566 |
| 628 | Ga0495630_1027872 | 3300046517 | Bacteria | 626 |
| 629 | Ga0495632_0018888 | 3300046519 | Bacteria | 3767 |
| 630 | Ga0495637_0042169 | 3300046520 | Bacteria | 1954 |
| 631 | Ga0495648_0000039 | 3300046524 | Bacteria | 185430 |
| 632 | Ga0495666_0269840 | 3300046526 | Bacteria | 773 |
| 633 | Ga0495652_0103129 | 3300046529 | Bacteria | 2309 |
| 634 | Ga0495652_0622100 | 3300046529 | Bacteria | 734 |
| 635 | Ga0495654_0000053 | 3300046530 | Bacteria | 145014 |
| 636 | Ga0495634_0634917 | 3300046642 | Bacteria | 618 |
| 637 | Ga0495625_0000683 | 3300046660 | Bacteria | 48312 |
| 638 | Ga0495625_0004788 | 3300046660 | Bacteria | 12657 |
| 639 | Ga0495625_0007535 | 3300046660 | Bacteria | 9453 |
| 640 | Ga0495625_0009883 | 3300046660 | Bacteria | 7934 |
| 641 | Ga0495625_0387504 | 3300046660 | Bacteria | 875 |
| 642 | Ga0495588_0120713 | 3300046674 | Bacteria | 1382 |
| 643 | Ga0495647_0184949 | 3300046681 | Bacteria | 908 |
| 644 | Ga0495658_0067976 | 3300046683 | Bacteria | 2062 |
| 645 | Ga0495670_0647241 | 3300046691 | Bacteria | 576 |
| 646 | Ga0495671_0250159 | 3300046692 | Bacteria | 855 |
| 647 | Ga0495604_0159347 | 3300047317 | Bacteria | 1596 |
| 648 | Ga0495674_0080503 | 3300047319 | Bacteria | 2795 |
| 649 | Ga0495675_0146301 | 3300047444 | Bacteria | 1462 |
| 650 | Ga0495673_0000148 | 3300047469 | Bacteria | 124135 |
| 651 | Ga0495673_0000377 | 3300047469 | Bacteria | 53346 |
| 652 | Ga0495684_0556766 | 3300047471 | Bacteria | 780 |
| 653 | Ga0495686_0010996 | 3300047472 | Bacteria | 6402 |
| 654 | Ga0495686_0015143 | 3300047472 | Bacteria | 5281 |
| 655 | Ga0495686_0063473 | 3300047472 | Bacteria | 2289 |
| 656 | Ga0495602_0271131 | 3300048088 | Bacteria | 1254 |
| 657 | Ga0495602_0378390 | 3300048088 | Bacteria | 1015 |
| 658 | Ga0495614_0356171 | 3300048089 | Bacteria | 683 |
| 659 | Ga0496100_0550846 | 3300048903 | Bacteria | 892 |
| 660 | Ga0496101_0072322 | 3300048904 | Bacteria | 2531 |
| 661 | Ga0496102_1527023 | 3300048905 | Bacteria | 586 |
| 662 | Ga0496104_0131456 | 3300048907 | Bacteria | 2404 |
| 663 | Ga0496105_0089442 | 3300048908 | Bacteria | 2544 |
| 664 | Ga0496106_0208732 | 3300048909 | Bacteria | 1555 |
| 665 | Ga0496106_0743448 | 3300048909 | Bacteria | 780 |
| 666 | Ga0496107_0000113 | 3300048910 | Bacteria | 39326 |
| 667 | Ga0496107_0841192 | 3300048910 | Bacteria | 671 |
| 668 | Ga0496108_0305201 | 3300048911 | Bacteria | 1387 |
| 669 | Ga0496110_0387687 | 3300048913 | Bacteria | 1273 |
| 670 | Ga0496112_0103364 | 3300048915 | Bacteria | 2819 |
| 671 | Ga0496113_0592473 | 3300048916 | Bacteria | 888 |
| 672 | Ga0496113_0820937 | 3300048916 | Bacteria | 738 |
| 673 | Ga0496113_1386334 | 3300048916 | Bacteria | 545 |
| 674 | Ga0496114_0199953 | 3300048917 | Bacteria | 1750 |
| 675 | Ga0496114_0362178 | 3300048917 | Bacteria | 1283 |
| 676 | Ga0496115_0034331 | 3300048918 | Bacteria | 4009 |
| 677 | Ga0496116_0010230 | 3300048919 | Bacteria | 7891 |
| 678 | Ga0496117_0131997 | 3300048920 | Bacteria | 1512 |
| 679 | Ga0496117_0485986 | 3300048920 | Bacteria | 602 |
| 680 | Ga0496118_0042016 | 3300048921 | Bacteria | 3612 |
| 681 | Ga0496118_0072464 | 3300048921 | Bacteria | 2474 |
| 682 | Ga0496118_0186132 | 3300048921 | Bacteria | 1248 |
| 683 | Ga0496118_0294034 | 3300048921 | Bacteria | 896 |
| 684 | Ga0496118_0322079 | 3300048921 | Bacteria | 838 |
| 685 | Ga0496120_0053556 | 3300048923 | Bacteria | 2292 |
| 686 | Ga0496121_0000197 | 3300048924 | Bacteria | 135555 |
| 687 | Ga0496121_0002319 | 3300048924 | Bacteria | 29484 |
| 688 | Ga0496121_0003184 | 3300048924 | Bacteria | 23655 |
| 689 | Ga0496121_0038189 | 3300048924 | Bacteria | 4257 |
| 690 | Ga0496121_0282033 | 3300048924 | Bacteria | 1136 |
| 691 | Ga0496122_0015369 | 3300048925 | Bacteria | 7322 |
| 692 | Ga0496123_0008845 | 3300048926 | Bacteria | 9174 |
| 693 | Ga0496125_0249106 | 3300048928 | Bacteria | 1122 |
| 694 | Ga0496126_0002536 | 3300048929 | Bacteria | 24441 |
| 695 | Ga0496126_0009870 | 3300048929 | Bacteria | 10101 |
| 696 | Ga0496126_0076035 | 3300048929 | Bacteria | 2980 |
| 697 | Ga0496126_0091443 | 3300048929 | Bacteria | 2676 |
| 698 | Ga0496126_0315743 | 3300048929 | Bacteria | 1286 |
| 699 | Ga0501034_0481604 | 3300049571 | Bacteria | 1156 |
| 700 | Ga0501036_0029060 | 3300049572 | Bacteria | 4673 |
| 701 | Ga0501036_0217846 | 3300049572 | Bacteria | 1603 |
| 702 | Ga0501037_0546519 | 3300049573 | Bacteria | 782 |
| 703 | Ga0501038_0110429 | 3300049574 | Bacteria | 2278 |
| 704 | Ga0501039_0065713 | 3300049575 | Bacteria | 2814 |
| 705 | Ga0501039_0142423 | 3300049575 | Bacteria | 1883 |
| 706 | Ga0501040_0097502 | 3300049576 | Bacteria | 2048 |
| 707 | Ga0501041_0061435 | 3300049577 | Bacteria | 2300 |
| 708 | Ga0501041_0087895 | 3300049577 | Bacteria | 1918 |
| 709 | Ga0501042_0044735 | 3300049578 | Bacteria | 3155 |
| 710 | Ga0501042_0158598 | 3300049578 | Bacteria | 1632 |
| 711 | Ga0501042_0600819 | 3300049578 | Bacteria | 800 |
| 712 | Ga0501046_0121394 | 3300049580 | Bacteria | 1988 |
| 713 | Ga0501046_0146614 | 3300049580 | Bacteria | 1782 |
| 714 | Ga0501048_0076493 | 3300049582 | Bacteria | 2362 |
| 715 | Ga0501048_0125570 | 3300049582 | Bacteria | 1814 |
| 716 | Ga0501048_0279458 | 3300049582 | Bacteria | 1187 |
| 717 | Ga0501068_0175822 | 3300049584 | Bacteria | 1352 |
| 718 | Ga0501071_0024968 | 3300049587 | Bacteria | 4183 |
| 719 | Ga0501072_0027502 | 3300049588 | Bacteria | 4437 |
| 720 | Ga0501074_0062883 | 3300049590 | Bacteria | 2674 |
| 721 | Ga0501074_0532786 | 3300049590 | Bacteria | 832 |
| 722 | Ga0501075_0166277 | 3300049591 | Bacteria | 1683 |
| 723 | Ga0501075_0288508 | 3300049591 | Bacteria | 1250 |
| 724 | Ga0501075_0331294 | 3300049591 | Bacteria | 1160 |
| 725 | Ga0501076_0081126 | 3300049592 | Bacteria | 2604 |
| 726 | Ga0501076_0275343 | 3300049592 | Bacteria | 1378 |
| 727 | Ga0501077_0570600 | 3300049593 | Bacteria | 726 |
| 728 | Ga0501206_066988 | 3300049653 | Bacteria | 600 |
| 729 | Ga0501249_072623 | 3300049679 | Unclassified | 804 |
| 730 | Ga0501257_111028 | 3300049686 | Bacteria | 727 |
| 731 | Ga0501079_0093635 | 3300049741 | Bacteria | 2328 |
| 732 | Ga0501079_0283130 | 3300049741 | Bacteria | 1296 |
| 733 | Ga0501081_0028476 | 3300049743 | Bacteria | 3771 |
| 734 | Ga0501044_0179264 | 3300049823 | Bacteria | 2086 |
| 735 | Ga0501045_0033860 | 3300049824 | Bacteria | 3706 |
| 736 | Ga0501045_0052036 | 3300049824 | Bacteria | 2989 |
| 737 | Ga0501045_0733848 | 3300049824 | Bacteria | 728 |
| 738 | nmdc:mga00v17_111656_c1 | 3300050491 | Bacteria | 1734 |
| 739 | nmdc:mga0k408_76832_c1 | 3300050493 | Bacteria | 1952 |
| 740 | nmdc:mga05p37_116569_c1 | 3300050507 | Bacteria | 3282 |
| 741 | nmdc:mga05p37_792441_c1 | 3300050507 | Bacteria | 1038 |
| 742 | nmdc:mga0qj67_15553_c1 | 3300050509 | Bacteria | 5761 |
| 743 | nmdc:mga0qj67_218183_c1 | 3300050509 | Bacteria | 1548 |
| 744 | nmdc:mga0qj67_501783_c1 | 3300050509 | Bacteria | 975 |
| 745 | nmdc:mga0qj67_598641_c1 | 3300050509 | Bacteria | 882 |
| 746 | nmdc:mga06r32_368541_c1 | 3300050510 | Bacteria | 1420 |
| 747 | nmdc:mga06r32_647643_c1 | 3300050510 | Bacteria | 1025 |
| 748 | nmdc:mga08y16_455950_c1 | 3300050511 | Bacteria | 1303 |
| 749 | nmdc:mga0rr50_150110_c1 | 3300050513 | Bacteria | 1882 |
| 750 | nmdc:mga0rr50_168753_c1 | 3300050513 | Bacteria | 1781 |
| 751 | nmdc:mga0a205_645359_c1 | 3300050515 | Bacteria | 910 |
| 752 | nmdc:mga0sz30_65059_c1 | 3300050516 | Bacteria | 1563 |
| 753 | Ga0500643_017572 | 3300053087 | Bacteria | 2393 |
| 754 | Ga0500644_0000241 | 3300053088 | Bacteria | 31000 |
| 755 | Ga0500566_0000074 | 3300053094 | Bacteria | 48359 |
| 756 | Ga0500641_0033523 | 3300053096 | Bacteria | 2039 |
| 757 | Ga0500554_001170 | 3300053102 | Bacteria | 5087 |
| 758 | Ga0500555_008448 | 3300053103 | Bacteria | 2935 |
| 759 | Ga0500572_003846 | 3300053111 | Bacteria | 3411 |
| 760 | Ga0500608_068929 | 3300053122 | Bacteria | 1683 |
| 761 | Ga0500614_000300 | 3300053123 | Bacteria | 12752 |
| 762 | Ga0500618_006400 | 3300053125 | Bacteria | 3463 |
| 763 | Ga0500559_0000015 | 3300053136 | Bacteria | 158494 |
| 764 | Ga0500559_0001726 | 3300053136 | Bacteria | 11987 |
| 765 | Ga0500564_000200 | 3300053138 | Bacteria | 16311 |
| 766 | Ga0500577_0010853 | 3300053142 | Bacteria | 2698 |
| 767 | Ga0500588_0150619 | 3300053146 | Bacteria | 841 |
| 768 | Ga0500590_020390 | 3300053148 | Bacteria | 3441 |
| 769 | Ga0500603_000030 | 3300053150 | Bacteria | 34154 |
| 770 | Ga0500604_0008017 | 3300053151 | Bacteria | 2802 |
| 771 | Ga0500616_0013843 | 3300053153 | Bacteria | 4657 |
| 772 | Ga0500627_0041165 | 3300053158 | Bacteria | 1985 |
| 773 | Ga0500630_003168 | 3300053159 | Bacteria | 7958 |
| 774 | Ga0500639_000047 | 3300053163 | Bacteria | 57835 |
| 775 | Ga0500596_003610 | 3300053735 | Bacteria | 2916 |
| 776 | Ga0501084_0199189 | 3300054114 | Bacteria | 1689 |
| 777 | Ga0501084_0470074 | 3300054114 | Bacteria | 1063 |
| 778 | Ga0501084_0758517 | 3300054114 | Bacteria | 817 |
| 779 | Ga0501082_0473518 | 3300060353 | Bacteria | 1094 |
| 780 | Ga0501082_0602291 | 3300060353 | Bacteria | 961 |
| 781 | Ga0466962_0001068 | 3300061719 | Bacteria | 12599 |
| 782 | Ga0530510_0357863 | 3300061734 | Bacteria | 1097 |
| 783 | Ga0530510_0576680 | 3300061734 | Bacteria | 855 |
| 784 | 2829749919 | 2829745981 | Bacteria | 5406054 |
| 785 | Ga0207667_10626150 | |||
| 786 | JGI24740J21852_10082966 | |||
| 787 | JGI24739J22299_10027145 | |||
| 788 | JGI24735J21928_10072852 | |||
| 789 | JGI25156J39149_1001597 | |||
| 790 | JGI25156J39149_1016641 | |||
| 791 | JGI25162J39368_1006156 | |||
| 792 | JGI25157J39369_1001161 | |||
| 793 | JGI25157J39369_1001478 | |||
| 794 | JGI25164J39214_1000198 | |||
| 795 | JGI25406J46586_10032341 | |||
| 796 | JGI25165J46597_1000354 | |||
| 797 | rootH1_10024611 | |||
| 798 | rootH2_10304912 | |||
| 799 | Ga0007416J51690_1114583 | |||
| 800 | Ga0007429J51699_1092521 | |||
| 801 | Ga0055539_1001188 | |||
| 802 | Ga0055533_1014903 | |||
| 803 | Ga0055532_1000185 | |||
| 804 | Ga0055532_1000217 | |||
| 805 | Ga0055525_1000059 | |||
| 806 | Ga0055527_1000050 | |||
| 807 | Ga0055527_1000128 | |||
| 808 | Ga0055527_1001996 | |||
| 809 | Ga0055527_1006915 | |||
| 810 | Ga0055535_1000119 | |||
| 811 | Ga0055535_1000206 | |||
| 812 | Ga0055535_1000212 | |||
| 813 | Ga0055535_1000287 | |||
| 814 | Ga0055535_1000295 | |||
| 815 | Ga0055542_1000057 | |||
| 816 | Ga0055542_1000119 | |||
| 817 | Ga0055542_1000238 | |||
| 818 | Ga0055542_1000311 | |||
| 819 | Ga0055542_1000966 | |||
| 820 | Ga0055529_1000049 | |||
| 821 | Ga0055529_1000270 | |||
| 822 | Ga0055529_1000329 | |||
| 823 | Ga0055529_1000884 | |||
| 824 | Ga0055526_1017989 | |||
| 825 | Ga0055528_1000986 | |||
| 826 | Ga0055540_1007096 | |||
| 827 | Ga0055531_10015237 | |||
| 828 | Ga0055541_1015339 | |||
| 829 | JGI25405J52794_10117483 | |||
| 830 | Ga0055543_1025049 | |||
| 831 | Ga0058862_12866476 | |||
| 832 | Ga0065165_1000490 | |||
| 833 | Ga0065704_10379807 | |||
| 834 | Ga0065712_10025321 | |||
| 835 | Ga0065715_10016620 | |||
| 836 | Ga0065707_10020820 | |||
| 837 | Ga0070658_10013460 | |||
| 838 | Ga0070658_10019732 | |||
| 839 | Ga0070676_10460293 | |||
| 840 | Ga0070690_100826417 | |||
| 841 | Ga0070670_101042285 | |||
| 842 | Ga0068869_100621768 | |||
| 843 | Ga0070666_11014417 | |||
| 844 | Ga0070680_100003733 | |||
| 845 | Ga0070680_100092078 | |||
| 846 | Ga0070680_100646880 | |||
| 847 | Ga0070680_101034608 | |||
| 848 | Ga0070682_101551439 | |||
| 849 | Ga0068868_101255339 | |||
| 850 | Ga0070660_100000004 | |||
| 851 | Ga0070660_100237424 | |||
| 852 | Ga0070689_101386646 | |||
| 853 | Ga0070675_100985211 | |||
| 854 | Ga0070675_101303418 | |||
| 855 | Ga0070674_100058186 | |||
| 856 | Ga0070674_100438288 | |||
| 857 | Ga0070673_100065377 | |||
| 858 | Ga0070673_100889690 | |||
| 859 | Ga0070688_100176706 | |||
| 860 | Ga0070688_100803867 | |||
| 861 | Ga0070659_100000023 | |||
| 862 | Ga0070659_100282912 | |||
| 863 | Ga0070709_10026841 | |||
| 864 | Ga0070714_100176322 | |||
| 865 | Ga0070714_100298913 | |||
| 866 | Ga0070714_100779577 | |||
| 867 | Ga0070713_101691405 | |||
| 868 | Ga0070713_101977762 | |||
| 869 | Ga0070710_10052966 | |||
| 870 | Ga0070710_10109467 | |||
| 871 | Ga0070710_10390861 | |||
| 872 | Ga0070711_100019243 | |||
| 873 | Ga0070711_100137094 | |||
| 874 | Ga0070711_100187298 | |||
| 875 | Ga0070705_100656145 | |||
| 876 | Ga0070694_100003493 | |||
| 877 | Ga0070694_101397333 | |||
| 878 | Ga0070708_100101800 | |||
| 879 | Ga0070708_100165342 | |||
| 880 | Ga0070663_100003816 | |||
| 881 | Ga0070678_100258533 | |||
| 882 | Ga0070678_100418023 | |||
| 883 | Ga0070662_100139989 | |||
| 884 | Ga0070662_101229062 | |||
| 885 | Ga0070681_10280278 | |||
| 886 | Ga0070681_10747956 | |||
| 887 | Ga0070681_11367505 | |||
| 888 | Ga0068867_100221425 | |||
| 889 | Ga0070685_11189472 | |||
| 890 | Ga0070706_100293128 | |||
| 891 | Ga0070706_100368912 | |||
| 892 | Ga0070706_100720437 | |||
| 893 | Ga0070707_100039683 | |||
| 894 | Ga0070707_100860618 | |||
| 895 | Ga0070698_100000373 | |||
| 896 | Ga0070698_100095616 | |||
| 897 | Ga0070699_100058652 | |||
| 898 | Ga0070699_100100014 | |||
| 899 | Ga0070699_100279308 | |||
| 900 | Ga0070699_101285789 | |||
| 901 | Ga0070679_100180423 | |||
| 902 | Ga0070679_100576487 | |||
| 903 | Ga0070679_100791708 | |||
| 904 | Ga0070684_100138170 | |||
| 905 | Ga0070697_100030107 | |||
| 906 | Ga0068853_100312418 | |||
| 907 | Ga0068853_101553536 | |||
| 908 | Ga0070672_100330382 | |||
| 909 | Ga0070672_101570790 | |||
| 910 | Ga0070695_100257127 | |||
| 911 | Ga0070696_100115548 | |||
| 912 | Ga0070665_100031017 | |||
| 913 | Ga0070665_100034634 | |||
| 914 | Ga0070665_100102956 | |||
| 915 | Ga0070665_100205709 | |||
| 916 | Ga0070665_100861402 | |||
| 917 | Ga0070704_100573890 | |||
| 918 | Ga0070704_100712086 | |||
| 919 | Ga0068855_100008161 | |||
| 920 | Ga0068855_100018483 | |||
| 921 | Ga0068855_100021333 | |||
| 922 | Ga0068855_100078722 | |||
| 923 | Ga0068855_100558349 | |||
| 924 | Ga0068855_100881104 | |||
| 925 | Ga0070664_100092553 | |||
| 926 | Ga0070664_100140946 | |||
| 927 | Ga0068854_101301605 | |||
| 928 | Ga0068854_101588320 | |||
| 929 | Ga0068856_100000455 | |||
| 930 | Ga0068856_100039844 | |||
| 931 | Ga0068856_100111296 | |||
| 932 | Ga0068856_100164962 | |||
| 933 | Ga0068856_100326776 | |||
| 934 | Ga0068856_100447973 | |||
| 935 | Ga0068856_100638230 | |||
| 936 | Ga0068856_101137822 | |||
| 937 | Ga0070702_101267641 | |||
| 938 | Ga0068852_100015181 | |||
| 939 | Ga0068852_100544718 | |||
| 940 | Ga0068852_101517615 | |||
| 941 | Ga0068859_100277630 | |||
| 942 | Ga0068864_100527368 | |||
| 943 | Ga0068864_100893620 | |||
| 944 | Ga0068864_101246982 | |||
| 945 | Ga0068864_101394447 | |||
| 946 | Ga0068866_10732638 | |||
| 947 | Ga0068861_100067402 | |||
| 948 | Ga0068861_100335650 | |||
| 949 | Ga0068863_100389331 | |||
| 950 | Ga0068858_100280984 | |||
| 951 | Ga0068858_100306012 | |||
| 952 | Ga0068858_100807547 | |||
| 953 | Ga0068858_101053404 | |||
| 954 | Ga0068862_100027705 | |||
| 955 | Ga0081455_10078082 | |||
| 956 | Ga0081455_10090188 | |||
| 957 | Ga0081455_10183189 | |||
| 958 | Ga0081538_10010333 | |||
| 959 | Ga0081540_1104017 | |||
| 960 | Ga0081540_1219320 | |||
| 961 | Ga0081539_10016966 | |||
| 962 | Ga0070717_10028502 | |||
| 963 | Ga0070717_10033606 | |||
| 964 | Ga0070717_10048549 | |||
| 965 | Ga0070717_10158061 | |||
| 966 | Ga0070717_11529869 | |||
| 967 | Ga0075368_10284662 | |||
| 968 | Ga0075364_10263931 | |||
| 969 | Ga0075364_10452104 | |||
| 970 | Ga0070715_10005486 | |||
| 971 | Ga0070716_100221099 | |||
| 972 | Ga0070712_100207703 | |||
| 973 | Ga0070712_100237032 | |||
| 974 | Ga0070712_100371547 | |||
| 975 | Ga0070712_100688436 | |||
| 976 | Ga0075367_10140420 | |||
| 977 | Ga0075367_10319264 | |||
| 978 | Ga0075369_10008829 | |||
| 979 | Ga0075366_10079958 | |||
| 980 | Ga0097621_100378603 | |||
| 981 | Ga0075428_100129484 | |||
| 982 | Ga0075428_100213687 | |||
| 983 | Ga0075428_101365436 | |||
| 984 | Ga0075430_100017099 | |||
| 985 | Ga0075430_100208253 | |||
| 986 | Ga0075430_100365188 | |||
| 987 | Ga0075430_100382421 | |||
| 988 | Ga0075431_100049994 | |||
| 989 | Ga0075431_101303471 | |||
| 990 | Ga0075433_10739008 | |||
| 991 | Ga0075434_100074195 | |||
| 992 | Ga0075434_101430195 | |||
| 993 | Ga0075429_100065686 | |||
| 994 | Ga0075429_100289861 | |||
| 995 | Ga0075436_100177970 | |||
| 996 | Ga0097620_100277631 | |||
| 997 | Ga0075435_100117975 | |||
| 998 | Ga0099795_10002609 | |||
| 999 | Ga0099795_10030126 | |||
| 1000 | Ga0099795_10172256 | |||
| 1001 | Ga0105250_10019883 | |||
| 1002 | Ga0105240_10000337 | |||
| 1003 | Ga0105240_10001353 | |||
| 1004 | Ga0105240_10006874 | |||
| 1005 | Ga0105240_10095466 | |||
| 1006 | Ga0105240_10132247 | |||
| 1007 | Ga0105240_10296296 | |||
| 1008 | Ga0105240_10335475 | |||
| 1009 | Ga0105240_12115071 | |||
| 1010 | Ga0111539_10305921 | |||
| 1011 | Ga0111539_10617194 | |||
| 1012 | Ga0105245_10041617 | |||
| 1013 | Ga0105245_10529817 | |||
| 1014 | Ga0105245_10548624 | |||
| 1015 | Ga0105245_10953931 | |||
| 1016 | Ga0114129_10202084 | |||
| 1017 | Ga0114129_10257209 | |||
| 1018 | Ga0114129_10283516 | |||
| 1019 | Ga0114129_10772223 | |||
| 1020 | Ga0114129_11024268 | |||
| 1021 | Ga0114129_11050039 | |||
| 1022 | Ga0114129_12410464 | |||
| 1023 | Ga0105243_10291796 | |||
| 1024 | Ga0105241_10877466 | |||
| 1025 | Ga0105241_11182011 | |||
| 1026 | Ga0105242_10159121 | |||
| 1027 | Ga0105242_10279618 | |||
| 1028 | Ga0105242_10453292 | |||
| 1029 | Ga0105248_10050901 | |||
| 1030 | Ga0105248_10757727 | |||
| 1031 | Ga0105248_10806005 | |||
| 1032 | Ga0105248_10982851 | |||
| 1033 | Ga0105248_11411424 | |||
| 1034 | Ga0105248_12343157 | |||
| 1035 | Ga0105248_12591790 | |||
| 1036 | Ga0105237_10002393 | |||
| 1037 | Ga0105237_10004165 | |||
| 1038 | Ga0105237_10009190 | |||
| 1039 | Ga0105237_10133017 | |||
| 1040 | Ga0105238_10008672 | |||
| 1041 | Ga0105238_10021470 | |||
| 1042 | Ga0105238_10324851 | |||
| 1043 | Ga0105249_10613862 | |||
| 1044 | Ga0105249_10805681 | |||
| 1045 | Ga0105249_11518156 | |||
| 1046 | Ga0105035_107571 | |||
| 1047 | Ga0099796_10006093 | |||
| 1048 | Ga0099796_10115822 | |||
| 1049 | Ga0105239_10005104 | |||
| 1050 | Ga0105246_10533496 | |||
| 1051 | Ga0105246_11086427 | |||
| 1052 | Ga0157370_10005606 | |||
| 1053 | Ga0157370_10146500 | |||
| 1054 | Ga0157370_10276222 | |||
| 1055 | Ga0157370_10607615 | |||
| 1056 | Ga0157370_11069860 | |||
| 1057 | Ga0157369_10001633 | |||
| 1058 | Ga0157369_10004521 | |||
| 1059 | Ga0157369_10088108 | |||
| 1060 | Ga0157369_10215104 | |||
| 1061 | Ga0157369_10504677 | |||
| 1062 | Ga0157369_11449589 | |||
| 1063 | Ga0157374_10027248 | |||
| 1064 | Ga0157374_10180316 | |||
| 1065 | Ga0157374_11790706 | |||
| 1066 | Ga0157378_10064717 | |||
| 1067 | Ga0157378_12308919 | |||
| 1068 | Ga0163162_10181605 | |||
| 1069 | Ga0163162_11346718 | |||
| 1070 | Ga0163162_11670522 | |||
| 1071 | Ga0163162_11964272 | |||
| 1072 | Ga0157372_10450412 | |||
| 1073 | Ga0157372_11166673 | |||
| 1074 | Ga0157375_11085361 | |||
| 1075 | Ga0157375_12126510 | |||
| 1076 | Ga0157515_126273 | |||
| 1077 | Ga0163163_10024356 | |||
| 1078 | Ga0163163_10024722 | |||
| 1079 | Ga0163163_10026417 | |||
| 1080 | Ga0163163_10179909 | |||
| 1081 | Ga0163163_12157092 | |||
| 1082 | Ga0157380_10075894 | |||
| 1083 | Ga0157380_10240941 | |||
| 1084 | Ga0157380_10603157 | |||
| 1085 | Ga0157380_11581399 | |||
| 1086 | Ga0157380_12208626 | |||
| 1087 | Ga0182008_10403786 | |||
| 1088 | Ga0157379_10029397 | |||
| 1089 | Ga0157376_10105338 | |||
| 1090 | Ga0157376_10816888 | |||
| 1091 | Ga0157376_10892597 | |||
| 1092 | Ga0182006_1014936 | |||
| 1093 | Ga0182006_1021466 | |||
| 1094 | Ga0182007_10000106 | |||
| 1095 | Ga0163161_10590593 | |||
| 1096 | Ga0163161_11083324 | |||
| 1097 | Ga0184601_134489 | |||
| 1098 | Ga0206350_10736505 | |||
| 1099 | Ga0213873_10071571 | |||
| 1100 | Ga0213872_10000071 | |||
| 1101 | Ga0213872_10000785 | |||
| 1102 | Ga0213872_10003152 | |||
| 1103 | Ga0213872_10059439 | |||
| 1104 | Ga0213872_10060842 | |||
| 1105 | Ga0213872_10115178 | |||
| 1106 | Ga0213872_10117995 | |||
| 1107 | Ga0213874_10030925 | |||
| 1108 | Ga0213874_10179083 | |||
| 1109 | Ga0213876_10033677 | |||
| 1110 | Ga0213876_10156838 | |||
| 1111 | Ga0213876_10227828 | |||
| 1112 | Ga0213875_10000004 | |||
| 1113 | Ga0213875_10000409 | |||
| 1114 | Ga0213875_10010793 | |||
| 1115 | Ga0213875_10084814 | |||
| 1116 | Ga0213875_10122583 | |||
| 1117 | Ga0213875_10445581 | |||
| 1118 | Ga0213875_10542333 | |||
| 1119 | Ga0213871_10006468 | |||
| 1120 | Ga0213871_10024857 | |||
| 1121 | Ga0228598_1041091 | |||
| 1122 | Ga0209566_100408 | |||
| 1123 | Ga0209674_100026 | |||
| 1124 | Ga0209674_101565 | |||
| 1125 | Ga0209674_102480 | |||
| 1126 | Ga0209672_100007 | |||
| 1127 | Ga0209672_100017 | |||
| 1128 | Ga0209672_100065 | |||
| 1129 | Ga0209672_100173 | |||
| 1130 | Ga0209672_100857 | |||
| 1131 | Ga0209147_100044 | |||
| 1132 | Ga0209147_100124 | |||
| 1133 | Ga0209563_100074 | |||
| 1134 | Ga0207427_100213 | |||
| 1135 | Ga0209437_100381 | |||
| 1136 | Ga0209258_100017 | |||
| 1137 | Ga0209258_100031 | |||
| 1138 | Ga0209258_100038 | |||
| 1139 | Ga0209258_100118 | |||
| 1140 | Ga0209258_100144 | |||
| 1141 | Ga0209646_1000824 | |||
| 1142 | Ga0209026_1000044 | |||
| 1143 | Ga0209026_1000431 | |||
| 1144 | Ga0209677_107487 | |||
| 1145 | Ga0209148_1000009 | |||
| 1146 | Ga0209148_1000024 | |||
| 1147 | Ga0209148_1000027 | |||
| 1148 | Ga0209148_1000044 | |||
| 1149 | Ga0209148_1000141 | |||
| 1150 | Ga0209759_1000517 | |||
| 1151 | Ga0209759_1000779 | |||
| 1152 | Ga0209233_1000323 | |||
| 1153 | Ga0209455_1000010 | |||
| 1154 | Ga0209455_1000025 | |||
| 1155 | Ga0209455_1000032 | |||
| 1156 | Ga0209455_1000058 | |||
| 1157 | Ga0209455_1001839 | |||
| 1158 | Ga0209673_1000059 | |||
| 1159 | Ga0209564_1000283 | |||
| 1160 | Ga0209051_1001186 | |||
| 1161 | Ga0209051_1005394 | |||
| 1162 | Ga0209051_1047107 | |||
| 1163 | Ga0209257_1000264 | |||
| 1164 | Ga0209257_1059664 | |||
| 1165 | Ga0207696_1074758 | |||
| 1166 | Ga0207692_10083636 | |||
| 1167 | Ga0207692_10247372 | |||
| 1168 | Ga0207647_10004854 | |||
| 1169 | Ga0207685_10073115 | |||
| 1170 | Ga0207699_10016761 | |||
| 1171 | Ga0207705_10112777 | |||
| 1172 | Ga0207705_10329270 | |||
| 1173 | Ga0207705_10404288 | |||
| 1174 | Ga0207684_10332074 | |||
| 1175 | Ga0207654_11063366 | |||
| 1176 | Ga0207695_10000203 | |||
| 1177 | Ga0207695_10000273 | |||
| 1178 | Ga0207695_10001289 | |||
| 1179 | Ga0207695_10005122 | |||
| 1180 | Ga0207695_10098915 | |||
| 1181 | Ga0207695_10217137 | |||
| 1182 | Ga0207695_10597292 | |||
| 1183 | Ga0207695_10780400 | |||
| 1184 | Ga0207671_10011634 | |||
| 1185 | Ga0207671_10013289 | |||
| 1186 | Ga0207671_10313390 | |||
| 1187 | Ga0207693_10016897 | |||
| 1188 | Ga0207693_10052095 | |||
| 1189 | Ga0207693_10154990 | |||
| 1190 | Ga0207693_10161001 | |||
| 1191 | Ga0207693_10332234 | |||
| 1192 | Ga0207663_10052557 | |||
| 1193 | Ga0207663_10122286 | |||
| 1194 | Ga0207663_10144307 | |||
| 1195 | Ga0207663_10271920 | |||
| 1196 | Ga0207660_10091219 | |||
| 1197 | Ga0207657_10000001 | |||
| 1198 | Ga0207649_10388800 | |||
| 1199 | Ga0207649_11187655 | |||
| 1200 | Ga0207652_10148061 | |||
| 1201 | Ga0207652_10158359 | |||
| 1202 | Ga0207652_10952038 | |||
| 1203 | Ga0207646_10008018 | |||
| 1204 | Ga0207646_10123363 | |||
| 1205 | Ga0207681_10010470 | |||
| 1206 | Ga0207681_10403376 | |||
| 1207 | Ga0207694_10050890 | |||
| 1208 | Ga0207694_10499828 | |||
| 1209 | Ga0207650_10446098 | |||
| 1210 | Ga0207650_10625289 | |||
| 1211 | Ga0207700_10013731 | |||
| 1212 | Ga0207700_10543166 | |||
| 1213 | Ga0207664_10390836 | |||
| 1214 | Ga0207664_10460911 | |||
| 1215 | Ga0207664_10569742 | |||
| 1216 | Ga0207690_10000029 | |||
| 1217 | Ga0207690_10090684 | |||
| 1218 | Ga0207690_10221243 | |||
| 1219 | Ga0207686_10016496 | |||
| 1220 | Ga0207686_10543413 | |||
| 1221 | Ga0207686_10568711 | |||
| 1222 | Ga0207669_10070655 | |||
| 1223 | Ga0207665_10001976 | |||
| 1224 | Ga0207665_10019541 | |||
| 1225 | Ga0207691_10342247 | |||
| 1226 | Ga0207711_10832823 | |||
| 1227 | Ga0207689_11530744 | |||
| 1228 | Ga0207679_10224928 | |||
| 1229 | Ga0207679_10549384 | |||
| 1230 | Ga0207667_10003915 | |||
| 1231 | Ga0207667_10049760 | |||
| 1232 | Ga0207667_10374971 | |||
| 1233 | Ga0207667_10605563 | |||
| 1234 | Ga0207667_10655380 | |||
| 1235 | Ga0207651_10120103 | |||
| 1236 | Ga0207651_11151891 | |||
| 1237 | Ga0207712_10202145 | |||
| 1238 | Ga0207712_10357695 | |||
| 1239 | Ga0207703_10247960 | |||
| 1240 | Ga0207703_10442763 | |||
| 1241 | Ga0207703_10895219 | |||
| 1242 | Ga0207703_12129612 | |||
| 1243 | Ga0207639_10283578 | |||
| 1244 | Ga0207639_11275386 | |||
| 1245 | Ga0207678_10000227 | |||
| 1246 | Ga0207708_10202584 | |||
| 1247 | Ga0207708_10763063 | |||
| 1248 | Ga0207708_11089557 | |||
| 1249 | Ga0207702_10002529 | |||
| 1250 | Ga0207702_10012718 | |||
| 1251 | Ga0207702_10036512 | |||
| 1252 | Ga0207702_10052635 | |||
| 1253 | Ga0207702_10401868 | |||
| 1254 | Ga0207702_10472674 | |||
| 1255 | Ga0207648_10353116 | |||
| 1256 | Ga0207676_10860450 | |||
| 1257 | Ga0207675_100085125 | |||
| 1258 | Ga0207675_100460912 | |||
| 1259 | Ga0207675_100500949 | |||
| 1260 | Ga0207698_10024704 | |||
| 1261 | Ga0207698_10054163 | |||
| 1262 | Ga0207698_11276307 | |||
| 1263 | Ga0207698_11417460 | |||
| 1264 | Ga0207698_12393151 | |||
| 1265 | Ga0209371_1000129 | |||
| 1266 | Ga0268266_10010740 | |||
| 1267 | Ga0268266_10284707 | |||
| 1268 | Ga0268265_10308291 | |||
| 1269 | Ga0307515_10093088 | |||
| 1270 | Ga0265338_10113802 | |||
| 1271 | Ga0268256_1000133 | |||
| 1272 | Ga0307512_10172021 | |||
| 1273 | Ga0265770_1007398 | |||
| 1274 | Ga0265760_10011916 | |||
| 1275 | Ga0265760_10339073 | |||
| 1276 | Ga0265327_10004235 | |||
| 1277 | Ga0265316_10095091 | |||
| 1278 | Ga0265316_10105173 | |||
| 1279 | Ga0265316_11192990 | |||
| 1280 | Ga0307513_10284836 | |||
| 1281 | Ga0307516_10000499 | |||
| 1282 | Ga0316053_112151 | |||
| 1283 | Ga0373923_0296135 | |||
| 1284 | Ga0373932_0011260 | |||
| 1285 | Ga0373943_0026858 | |||
| 1286 | Ga0373943_0364261 | |||
| 1287 | Ga0373946_0226390 | |||
| 1288 | Ga0316574_0221228 | |||
| 1289 | Ga0373935_0008964 | |||
| 1290 | Ga0373947_0044834 | |||
| 1291 | Ga0373947_0265587 | |||
| 1292 | Ga0373947_0331982 | |||
| 1293 | Ga0373937_0228238 | |||
| 1294 | Ga0373925_0149534 | |||
| 1295 | Ga0373925_0854255 | |||
| 1296 | Ga0373925_0882413 | |||
| 1297 | Ga0395899_0000062 | |||
| 1298 | Ga0395899_0000167 | |||
| 1299 | Ga0395899_0051027 | |||
| 1300 | Ga0395899_0345830 | |||
| 1301 | Ga0395900_0000009 | |||
| 1302 | Ga0395900_0000039 | |||
| 1303 | Ga0395900_0043542 | |||
| 1304 | Ga0395900_0599874 | |||
| 1305 | Ga0395898_0000069 | |||
| 1306 | Ga0395898_0000140 | |||
| 1307 | Ga0395898_0259449 | |||
| 1308 | Ga0395898_1487548 | |||
| 1309 | Ga0395898_1726355 | |||
| 1310 | Ga0395905_0019189 | |||
| 1311 | Ga0395905_0078049 | |||
| 1312 | Ga0395905_1479575 | |||
| 1313 | Ga0436364_0199993 | |||
| 1314 | Ga0436364_0356734 | |||
| 1315 | Ga0436364_0431728 | |||
| 1316 | Ga0436364_0748068 | |||
| 1317 | Ga0436364_0843268 | |||
| 1318 | Ga0436364_1236165 | |||
| 1319 | Ga0436364_1261036 | |||
| 1320 | Ga0436364_1342962 | |||
| 1321 | Ga0436364_1457846 | |||
| 1322 | Ga0395901_0000014 | |||
| 1323 | Ga0395901_1521625 | |||
| 1324 | Ga0400489_41603 | |||
| 1325 | Ga0436365_0206806 | |||
| 1326 | Ga0436365_0430209 | |||
| 1327 | Ga0436365_0472708 | |||
| 1328 | Ga0436365_0543679 | |||
| 1329 | Ga0436365_0844407 | |||
| 1330 | Ga0436365_1303722 | |||
| 1331 | Ga0436365_1737587 | |||
| 1332 | Ga0436360_0058815 | |||
| 1333 | Ga0436360_0213572 | |||
| 1334 | Ga0436360_0285718 | |||
| 1335 | Ga0436360_0380383 | |||
| 1336 | Ga0436360_0517441 | |||
| 1337 | Ga0436360_0914568 | |||
| 1338 | Ga0436360_1336127 | |||
| 1339 | Ga0436361_0047346 | |||
| 1340 | Ga0436361_0055354 | |||
| 1341 | Ga0436361_0154707 | |||
| 1342 | Ga0436361_0157085 | |||
| 1343 | Ga0436361_0384722 | |||
| 1344 | Ga0436361_0484676 | |||
| 1345 | Ga0436361_0652142 | |||
| 1346 | Ga0436361_0666244 | |||
| 1347 | Ga0436361_0788442 | |||
| 1348 | Ga0436361_0895187 | |||
| 1349 | Ga0436361_0910912 | |||
| 1350 | Ga0436361_0923671 | |||
| 1351 | Ga0436361_0932086 | |||
| 1352 | Ga0436361_1021429 | |||
| 1353 | Ga0436361_1097826 | |||
| 1354 | Ga0436363_0756951 | |||
| 1355 | Ga0436363_0963290 | |||
| 1356 | Ga0436363_1397348 | |||
| 1357 | Ga0436362_0063915 | |||
| 1358 | Ga0436362_0283413 | |||
| 1359 | Ga0436362_0566135 | |||
| 1360 | Ga0436362_0955192 | |||
| 1361 | Ga0436362_1210783 | |||
| 1362 | Ga0451795_1304938 | |||
| 1363 | Ga0451849_0220963 | |||
| 1364 | Ga0451853_0555938 | |||
| 1365 | Ga0439431_0003477 | |||
| 1366 | Ga0439432_063004 | |||
| 1367 | Ga0439446_0177389 | |||
| 1368 | Ga0451577_0035832 | |||
| 1369 | Ga0451577_0070218 | |||
| 1370 | Ga0451577_0815176 | |||
| 1371 | Ga0466969_0013964 | |||
| 1372 | Ga0453683_0003615 | |||
| 1373 | Ga0453683_0045779 | |||
| 1374 | Ga0453683_0163493 | |||
| 1375 | Ga0453683_0182467 | |||
| 1376 | Ga0466965_0325808 | |||
| 1377 | Ga0466966_0021400 | |||
| 1378 | Ga0466966_0253495 | |||
| 1379 | Ga0466966_0408152 | |||
| 1380 | Ga0466961_0019310 | |||
| 1381 | Ga0466961_0035203 | |||
| 1382 | Ga0466961_0072126 | |||
| 1383 | Ga0466961_0128385 | |||
| 1384 | Ga0466963_0232258 | |||
| 1385 | Ga0466963_0814535 | |||
| 1386 | Ga0453684_0000951 | |||
| 1387 | Ga0453684_0001767 | |||
| 1388 | Ga0453684_0165592 | |||
| 1389 | Ga0453684_0391319 | |||
| 1390 | Ga0466971_0002070 | |||
| 1391 | Ga0466968_0066312 | |||
| 1392 | Ga0466970_0000163 | |||
| 1393 | Ga0466970_0279741 | |||
| 1394 | Ga0466957_0002878 | |||
| 1395 | Ga0466959_0000383 | |||
| 1396 | Ga0466959_0068211 | |||
| 1397 | Ga0466959_0169300 | |||
| 1398 | Ga0466959_0486696 | |||
| 1399 | Ga0451576_0003996 | |||
| 1400 | Ga0451576_0424920 | |||
| 1401 | Ga0451576_0503573 | |||
| 1402 | Ga0466958_0145503 | |||
| 1403 | Ga0466967_0579131 | |||
| 1404 | Ga0495627_000483 | |||
| 1405 | Ga0495638_0169811 | |||
| 1406 | Ga0495650_0000007 | |||
| 1407 | Ga0495650_0063018 | |||
| 1408 | Ga0495580_0527279 | |||
| 1409 | Ga0495585_0013190 | |||
| 1410 | Ga0495610_0018383 | |||
| 1411 | Ga0495620_0061257 | |||
| 1412 | Ga0495630_1027872 | |||
| 1413 | Ga0495632_0018888 | |||
| 1414 | Ga0495637_0042169 | |||
| 1415 | Ga0495648_0000039 | |||
| 1416 | Ga0495666_0269840 | |||
| 1417 | Ga0495652_0103129 | |||
| 1418 | Ga0495652_0622100 | |||
| 1419 | Ga0495654_0000053 | |||
| 1420 | Ga0495634_0634917 | |||
| 1421 | Ga0495625_0000683 | |||
| 1422 | Ga0495625_0004788 | |||
| 1423 | Ga0495625_0007535 | |||
| 1424 | Ga0495625_0009883 | |||
| 1425 | Ga0495625_0387504 | |||
| 1426 | Ga0495588_0120713 | |||
| 1427 | Ga0495647_0184949 | |||
| 1428 | Ga0495658_0067976 | |||
| 1429 | Ga0495670_0647241 | |||
| 1430 | Ga0495671_0250159 | |||
| 1431 | Ga0495604_0159347 | |||
| 1432 | Ga0495674_0080503 | |||
| 1433 | Ga0495675_0146301 | |||
| 1434 | Ga0495673_0000148 | |||
| 1435 | Ga0495673_0000377 | |||
| 1436 | Ga0495684_0556766 | |||
| 1437 | Ga0495686_0010996 | |||
| 1438 | Ga0495686_0015143 | |||
| 1439 | Ga0495686_0063473 | |||
| 1440 | Ga0495602_0271131 | |||
| 1441 | Ga0495602_0378390 | |||
| 1442 | Ga0495614_0356171 | |||
| 1443 | Ga0496100_0550846 | |||
| 1444 | Ga0496101_0072322 | |||
| 1445 | Ga0496102_1527023 | |||
| 1446 | Ga0496104_0131456 | |||
| 1447 | Ga0496105_0089442 | |||
| 1448 | Ga0496106_0208732 | |||
| 1449 | Ga0496106_0743448 | |||
| 1450 | Ga0496107_0000113 | |||
| 1451 | Ga0496107_0841192 | |||
| 1452 | Ga0496108_0305201 | |||
| 1453 | Ga0496110_0387687 | |||
| 1454 | Ga0496112_0103364 | |||
| 1455 | Ga0496113_0592473 | |||
| 1456 | Ga0496113_0820937 | |||
| 1457 | Ga0496113_1386334 | |||
| 1458 | Ga0496114_0199953 | |||
| 1459 | Ga0496114_0362178 | |||
| 1460 | Ga0496115_0034331 | |||
| 1461 | Ga0496116_0010230 | |||
| 1462 | Ga0496117_0131997 | |||
| 1463 | Ga0496117_0485986 | |||
| 1464 | Ga0496118_0042016 | |||
| 1465 | Ga0496118_0072464 | |||
| 1466 | Ga0496118_0186132 | |||
| 1467 | Ga0496118_0294034 | |||
| 1468 | Ga0496118_0322079 | |||
| 1469 | Ga0496120_0053556 | |||
| 1470 | Ga0496121_0000197 | |||
| 1471 | Ga0496121_0002319 | |||
| 1472 | Ga0496121_0003184 | |||
| 1473 | Ga0496121_0038189 | |||
| 1474 | Ga0496121_0282033 | |||
| 1475 | Ga0496122_0015369 | |||
| 1476 | Ga0496123_0008845 | |||
| 1477 | Ga0496125_0249106 | |||
| 1478 | Ga0496126_0002536 | |||
| 1479 | Ga0496126_0009870 | |||
| 1480 | Ga0496126_0076035 | |||
| 1481 | Ga0496126_0091443 | |||
| 1482 | Ga0496126_0315743 | |||
| 1483 | Ga0501034_0481604 | |||
| 1484 | Ga0501036_0029060 | |||
| 1485 | Ga0501036_0217846 | |||
| 1486 | Ga0501037_0546519 | |||
| 1487 | Ga0501038_0110429 | |||
| 1488 | Ga0501039_0065713 | |||
| 1489 | Ga0501039_0142423 | |||
| 1490 | Ga0501040_0097502 | |||
| 1491 | Ga0501041_0061435 | |||
| 1492 | Ga0501041_0087895 | |||
| 1493 | Ga0501042_0044735 | |||
| 1494 | Ga0501042_0158598 | |||
| 1495 | Ga0501042_0600819 | |||
| 1496 | Ga0501046_0121394 | |||
| 1497 | Ga0501046_0146614 | |||
| 1498 | Ga0501048_0076493 | |||
| 1499 | Ga0501048_0125570 | |||
| 1500 | Ga0501048_0279458 | |||
| 1501 | Ga0501068_0175822 | |||
| 1502 | Ga0501071_0024968 | |||
| 1503 | Ga0501072_0027502 | |||
| 1504 | Ga0501074_0062883 | |||
| 1505 | Ga0501074_0532786 | |||
| 1506 | Ga0501075_0166277 | |||
| 1507 | Ga0501075_0288508 | |||
| 1508 | Ga0501075_0331294 | |||
| 1509 | Ga0501076_0081126 | |||
| 1510 | Ga0501076_0275343 | |||
| 1511 | Ga0501077_0570600 | |||
| 1512 | Ga0501206_066988 | |||
| 1513 | Ga0501249_072623 | |||
| 1514 | Ga0501257_111028 | |||
| 1515 | Ga0501079_0093635 | |||
| 1516 | Ga0501079_0283130 | |||
| 1517 | Ga0501081_0028476 | |||
| 1518 | Ga0501044_0179264 | |||
| 1519 | Ga0501045_0033860 | |||
| 1520 | Ga0501045_0052036 | |||
| 1521 | Ga0501045_0733848 | |||
| 1522 | nmdc:mga00v17_111656_c1 | |||
| 1523 | nmdc:mga0k408_76832_c1 | |||
| 1524 | nmdc:mga05p37_116569_c1 | |||
| 1525 | nmdc:mga05p37_792441_c1 | |||
| 1526 | nmdc:mga0qj67_15553_c1 | |||
| 1527 | nmdc:mga0qj67_218183_c1 | |||
| 1528 | nmdc:mga0qj67_501783_c1 | |||
| 1529 | nmdc:mga0qj67_598641_c1 | |||
| 1530 | nmdc:mga06r32_368541_c1 | |||
| 1531 | nmdc:mga06r32_647643_c1 | |||
| 1532 | nmdc:mga08y16_455950_c1 | |||
| 1533 | nmdc:mga0rr50_150110_c1 | |||
| 1534 | nmdc:mga0rr50_168753_c1 | |||
| 1535 | nmdc:mga0a205_645359_c1 | |||
| 1536 | nmdc:mga0sz30_65059_c1 | |||
| 1537 | Ga0500643_017572 | |||
| 1538 | Ga0500644_0000241 | |||
| 1539 | Ga0500566_0000074 | |||
| 1540 | Ga0500641_0033523 | |||
| 1541 | Ga0500554_001170 | |||
| 1542 | Ga0500555_008448 | |||
| 1543 | Ga0500572_003846 | |||
| 1544 | Ga0500608_068929 | |||
| 1545 | Ga0500614_000300 | |||
| 1546 | Ga0500618_006400 | |||
| 1547 | Ga0500559_0000015 | |||
| 1548 | Ga0500559_0001726 | |||
| 1549 | Ga0500564_000200 | |||
| 1550 | Ga0500577_0010853 | |||
| 1551 | Ga0500588_0150619 | |||
| 1552 | Ga0500590_020390 | |||
| 1553 | Ga0500603_000030 | |||
| 1554 | Ga0500604_0008017 | |||
| 1555 | Ga0500616_0013843 | |||
| 1556 | Ga0500627_0041165 | |||
| 1557 | Ga0500630_003168 | |||
| 1558 | Ga0500639_000047 | |||
| 1559 | Ga0500596_003610 | |||
| 1560 | Ga0501084_0199189 | |||
| 1561 | Ga0501084_0470074 | |||
| 1562 | Ga0501084_0758517 | |||
| 1563 | Ga0501082_0473518 | |||
| 1564 | Ga0501082_0602291 | |||
| 1565 | Ga0466962_0001068 | |||
| 1566 | Ga0530510_0357863 | |||
| 1567 | Ga0530510_0576680 | |||
| 1568 | 2829749919 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8gy3-assembly1.cif.gz_B | cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans | 0.9816 | 2 | 150 |
| 1rm6-assembly1.cif.gz_C | structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica | 0.9617 | 2 | 150 |
| 1ffv-assembly1.cif.gz_A | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.9611 | 2 | 149 |
| 1n5w-assembly1.cif.gz_D | crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form | 0.9555 | 2 | 149 |
| 8gy3-assembly1.cif.gz_B | cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans | 0.9502 | 2 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5y6qA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9783 | 2 | 74 | 3.10.20.30 |
| af_Q46801_1_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9741 | 2 | 72 | 3.10.20.30 |
| 1sb3F01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9643 | 2 | 74 | 3.10.20.30 |
| 1sb3C02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9626 | 82 | 150 | 1.10.150.120 |
| 1n5wA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9556 | 2 | 74 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y5QJI1-F1-model_v4 | (2Fe-2S)-binding protein | 0.9924 | 2 | 150 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A7V9BKS3-F1-model_v4 | (2Fe-2S)-binding protein | 0.992 | 2 | 150 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A191ZHF8-F1-model_v4 | (2Fe-2S)-binding protein | 0.9916 | 2 | 148 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A1X9X044-F1-model_v4 | MmAcDH small subunit | 0.9914 | 1 | 133 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A349TGJ4-F1-model_v4 | (2Fe-2S)-binding protein | 0.9913 | 2 | 140 |
GO:0016491
GO:0046872 GO:0051537 |