F480699
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 784 | 220 | 1568 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300031665|Ga0316575_10004418|Ga0316575_100044182 |
| Length | 209 |
| Sequence | MLYLASRSPRRRQLLEQVGVDFRLLEVEVPEHPAPGEAPHDYVARVARDKARAGYARVDRARDAVLGSDTEVVLDGEVFGKPADAAAASAMLGRLSGRTHRVISCVCLVDARGEHAAACVSEVRFAPLDAPTIAAYVASGESFGKAGGYAIQGRAAAFVAHLSGSYSGVMGLPLHETAGLLREAGLWPVADDRGPAGRNRARAAGSETP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 2 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 3 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 7 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 23 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 25 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 27 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 28 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 38 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 39 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 40 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 41 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 42 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 43 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 44 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 45 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 46 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 48 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 49 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 52 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 71 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 72 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 73 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 74 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 75 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 76 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 77 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 78 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 79 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 80 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 81 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 82 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 83 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 84 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 85 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 86 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 87 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 88 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 89 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 90 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 91 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 92 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 93 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 94 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 95 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 96 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 97 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 98 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 99 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 100 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 101 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 102 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 188 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 189 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 190 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 191 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 194 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 195 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 196 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 197 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 198 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 199 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 200 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 201 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 202 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 203 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 209 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 210 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 211 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 212 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 213 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 216 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 217 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 218 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 219 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 220 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.6 |
| Metatranscriptomes | 0.64 |
| Isolates | 0.77 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.87 |
| Nodule | 0 |
| Rhizoplane | 4.46 |
| Rhizosphere | 87.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316575_10004418 | 3300031665 | Bacteria | 4949 |
| 2 | JGI25152J39213_1017009 | 3300002773 | Bacteria | 1384 |
| 3 | JGI25159J45721_1011520 | 3300002987 | Bacteria | 2161 |
| 4 | JGI25159J45721_1017705 | 3300002987 | Bacteria | 1463 |
| 5 | JGI25153J46596_10016703 | 3300003215 | Bacteria | 2926 |
| 6 | JGI25160J50197_1001196 | 3300003354 | Bacteria | 13190 |
| 7 | JGI25161J50226_1008044 | 3300003374 | Bacteria | 1671 |
| 8 | JGI25161J50226_1008104 | 3300003374 | Bacteria | 1659 |
| 9 | Ga0007409J51694_1030117 | 3300003575 | Bacteria | 2274 |
| 10 | Ga0055525_1000009 | 3300003759 | Bacteria | 596899 |
| 11 | Ga0055526_1006308 | 3300003771 | Bacteria | 6483 |
| 12 | Ga0055524_1008902 | 3300003775 | Bacteria | 4132 |
| 13 | Ga0055528_1001071 | 3300003790 | Bacteria | 18031 |
| 14 | Ga0055530_10020167 | 3300003791 | Bacteria | 2000 |
| 15 | Ga0055543_1012566 | 3300004625 | Bacteria | 1697 |
| 16 | Ga0065165_1005080 | 3300005262 | Bacteria | 7647 |
| 17 | Ga0065165_1030708 | 3300005262 | Bacteria | 1706 |
| 18 | Ga0065165_1065443 | 3300005262 | Bacteria | 981 |
| 19 | Ga0070658_10581000 | 3300005327 | Bacteria | 970 |
| 20 | Ga0070690_100096753 | 3300005330 | Bacteria | 1951 |
| 21 | Ga0070660_100129005 | 3300005339 | Bacteria | 2022 |
| 22 | Ga0070660_100455364 | 3300005339 | Bacteria | 1062 |
| 23 | Ga0070659_100017739 | 3300005366 | Bacteria | 5361 |
| 24 | Ga0070667_100000012 | 3300005367 | Bacteria | 258575 |
| 25 | Ga0070663_100231623 | 3300005455 | Bacteria | 1455 |
| 26 | Ga0070662_100181434 | 3300005457 | Bacteria | 1659 |
| 27 | Ga0068855_100113722 | 3300005563 | Bacteria | 3104 |
| 28 | Ga0068855_100165633 | 3300005563 | Bacteria | 2506 |
| 29 | Ga0070664_100032141 | 3300005564 | Bacteria | 4389 |
| 30 | Ga0068852_100061672 | 3300005616 | Bacteria | 3260 |
| 31 | Ga0097621_100143978 | 3300006237 | Bacteria | 2039 |
| 32 | Ga0068871_100411846 | 3300006358 | Bacteria | 1205 |
| 33 | Ga0068865_100071882 | 3300006881 | Bacteria | 2456 |
| 34 | Ga0105240_10924312 | 3300009093 | Bacteria | 937 |
| 35 | Ga0105243_10098754 | 3300009148 | Bacteria | 2419 |
| 36 | Ga0105241_10039397 | 3300009174 | Bacteria | 3564 |
| 37 | Ga0105242_10102219 | 3300009176 | Bacteria | 2430 |
| 38 | Ga0105242_10783172 | 3300009176 | Bacteria | 942 |
| 39 | Ga0105237_10229421 | 3300009545 | Bacteria | 1857 |
| 40 | Ga0105239_10304910 | 3300010375 | Bacteria | 1794 |
| 41 | Ga0105246_10223272 | 3300011119 | Bacteria | 1478 |
| 42 | Ga0157371_10000001 | 3300013102 | Bacteria | 1162285 |
| 43 | Ga0157371_10249628 | 3300013102 | Bacteria | 1277 |
| 44 | Ga0157372_10356019 | 3300013307 | Bacteria | 1705 |
| 45 | Ga0157372_10383363 | 3300013307 | Bacteria | 1638 |
| 46 | Ga0182008_10063856 | 3300014497 | Bacteria | 1813 |
| 47 | Ga0182006_1074199 | 3300015261 | Bacteria | 1254 |
| 48 | Ga0209436_100115 | 3300025208 | Bacteria | 39587 |
| 49 | Ga0209436_101923 | 3300025208 | Bacteria | 6695 |
| 50 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 51 | Ga0207425_1000006 | 3300025245 | Bacteria | 808854 |
| 52 | Ga0207425_1000105 | 3300025245 | Bacteria | 78746 |
| 53 | Ga0209148_1000298 | 3300025254 | Bacteria | 72028 |
| 54 | Ga0209129_1000090 | 3300025258 | Bacteria | 175755 |
| 55 | Ga0209565_1000701 | 3300025263 | Bacteria | 20606 |
| 56 | Ga0209565_1009748 | 3300025263 | Bacteria | 2415 |
| 57 | Ga0209673_1003116 | 3300025273 | Bacteria | 10150 |
| 58 | Ga0209130_1001125 | 3300025284 | Bacteria | 19650 |
| 59 | Ga0209130_1017815 | 3300025284 | Bacteria | 1682 |
| 60 | Ga0209675_1000696 | 3300025291 | Bacteria | 23334 |
| 61 | Ga0209675_1017866 | 3300025291 | Bacteria | 2007 |
| 62 | Ga0209564_1000513 | 3300025295 | Bacteria | 63602 |
| 63 | Ga0209564_1003076 | 3300025295 | Bacteria | 11835 |
| 64 | Ga0209564_1010005 | 3300025295 | Bacteria | 4428 |
| 65 | Ga0209758_1000047 | 3300025297 | Bacteria | 360971 |
| 66 | Ga0209050_1000085 | 3300025298 | Bacteria | 263219 |
| 67 | Ga0209050_1000607 | 3300025298 | Bacteria | 56864 |
| 68 | Ga0209050_1001173 | 3300025298 | Bacteria | 30937 |
| 69 | Ga0209050_1001734 | 3300025298 | Bacteria | 21704 |
| 70 | Ga0209256_1000080 | 3300025299 | Bacteria | 224592 |
| 71 | Ga0209256_1000423 | 3300025299 | Bacteria | 66412 |
| 72 | Ga0209256_1021723 | 3300025299 | Bacteria | 1961 |
| 73 | Ga0207426_1000939 | 3300025302 | Bacteria | 28944 |
| 74 | Ga0209051_1011911 | 3300025303 | Bacteria | 4250 |
| 75 | Ga0209257_1000010 | 3300025304 | Bacteria | 1158682 |
| 76 | Ga0207705_10016196 | 3300025909 | Bacteria | 5347 |
| 77 | Ga0207654_10001747 | 3300025911 | Bacteria | 11288 |
| 78 | Ga0207695_10607487 | 3300025913 | Bacteria | 975 |
| 79 | Ga0207671_10164482 | 3300025914 | Bacteria | 1719 |
| 80 | Ga0207657_10085942 | 3300025919 | Bacteria | 2634 |
| 81 | Ga0207657_10106262 | 3300025919 | Bacteria | 2323 |
| 82 | Ga0207657_10398307 | 3300025919 | Bacteria | 1083 |
| 83 | Ga0207694_10090549 | 3300025924 | Bacteria | 2414 |
| 84 | Ga0207687_10122197 | 3300025927 | Bacteria | 1949 |
| 85 | Ga0207706_10275337 | 3300025933 | Bacteria | 1468 |
| 86 | Ga0207686_10017029 | 3300025934 | Bacteria | 4087 |
| 87 | Ga0207704_10085859 | 3300025938 | Bacteria | 2050 |
| 88 | Ga0207689_10076233 | 3300025942 | Bacteria | 2757 |
| 89 | Ga0207679_10094622 | 3300025945 | Bacteria | 2320 |
| 90 | Ga0207639_10543367 | 3300026041 | Bacteria | 1066 |
| 91 | Ga0207702_10274120 | 3300026078 | Bacteria | 1592 |
| 92 | Ga0207698_10040957 | 3300026142 | Bacteria | 3448 |
| 93 | Ga0207698_10169882 | 3300026142 | Bacteria | 1918 |
| 94 | Ga0316182_1315875 | 3300030745 | Bacteria | 1078 |
| 95 | Ga0307513_10586424 | 3300031456 | Bacteria | 825 |
| 96 | Ga0307408_100000923 | 3300031548 | Bacteria | 22896 |
| 97 | Ga0307408_100000967 | 3300031548 | Bacteria | 22251 |
| 98 | Ga0265314_10157071 | 3300031711 | Bacteria | 1388 |
| 99 | Ga0307416_100326982 | 3300032002 | Bacteria | 1539 |
| 100 | Ga0395899_0000141 | 3300037312 | Bacteria | 109773 |
| 101 | Ga0395899_0073652 | 3300037312 | Bacteria | 2496 |
| 102 | Ga0395899_0119351 | 3300037312 | Bacteria | 1890 |
| 103 | Ga0395899_0213312 | 3300037312 | Bacteria | 1340 |
| 104 | Ga0395900_0000931 | 3300037418 | Bacteria | 38293 |
| 105 | Ga0395900_0001595 | 3300037418 | Bacteria | 26765 |
| 106 | Ga0395900_0041748 | 3300037418 | Bacteria | 4727 |
| 107 | Ga0395900_0058390 | 3300037418 | Bacteria | 3971 |
| 108 | Ga0395900_0160216 | 3300037418 | Bacteria | 2295 |
| 109 | Ga0395900_0326801 | 3300037418 | Bacteria | 1512 |
| 110 | Ga0395900_0334077 | 3300037418 | Bacteria | 1492 |
| 111 | Ga0395900_0562808 | 3300037418 | Bacteria | 1083 |
| 112 | Ga0395900_0617362 | 3300037418 | Bacteria | 1023 |
| 113 | Ga0395898_0108505 | 3300037466 | Bacteria | 2661 |
| 114 | Ga0395898_0174397 | 3300037466 | Bacteria | 2055 |
| 115 | Ga0395898_0350623 | 3300037466 | Bacteria | 1407 |
| 116 | Ga0395898_0352403 | 3300037466 | Bacteria | 1403 |
| 117 | Ga0395905_0022278 | 3300037471 | Bacteria | 5994 |
| 118 | Ga0395905_0050011 | 3300037471 | Bacteria | 3917 |
| 119 | Ga0395905_0269066 | 3300037471 | Bacteria | 1590 |
| 120 | Ga0395905_0742545 | 3300037471 | Bacteria | 884 |
| 121 | Ga0395905_0777136 | 3300037471 | Bacteria | 860 |
| 122 | Ga0395901_0031322 | 3300038443 | Bacteria | 5484 |
| 123 | Ga0395901_0056453 | 3300038443 | Bacteria | 4084 |
| 124 | Ga0395901_0235989 | 3300038443 | Bacteria | 1908 |
| 125 | Ga0395901_0524967 | 3300038443 | Bacteria | 1202 |
| 126 | Ga0395901_0867754 | 3300038443 | Bacteria | 886 |
| 127 | Ga0439448_0000618 | 3300042005 | Bacteria | 8368 |
| 128 | Ga0439448_0019868 | 3300042005 | Bacteria | 2074 |
| 129 | Ga0439448_0022578 | 3300042005 | Bacteria | 1957 |
| 130 | Ga0439448_0027238 | 3300042005 | Bacteria | 1800 |
| 131 | Ga0439449_0016303 | 3300042007 | Bacteria | 2792 |
| 132 | Ga0439450_001788 | 3300042008 | Bacteria | 3229 |
| 133 | Ga0439450_004472 | 3300042008 | Bacteria | 2389 |
| 134 | Ga0439450_015568 | 3300042008 | Bacteria | 1559 |
| 135 | Ga0439455_0004613 | 3300042012 | Bacteria | 2744 |
| 136 | Ga0439455_0027460 | 3300042012 | Bacteria | 1395 |
| 137 | Ga0450897_012747 | 3300042128 | Bacteria | 832 |
| 138 | Ga0450904_001280 | 3300042139 | Bacteria | 3700 |
| 139 | Ga0439458_0025328 | 3300042157 | Bacteria | 1391 |
| 140 | Ga0439458_0033940 | 3300042157 | Bacteria | 1223 |
| 141 | Ga0439458_0044640 | 3300042157 | Bacteria | 1082 |
| 142 | Ga0466969_0069802 | 3300044656 | Bacteria | 1691 |
| 143 | Ga0466969_0182509 | 3300044656 | Bacteria | 960 |
| 144 | Ga0466972_0002165 | 3300044658 | Bacteria | 9644 |
| 145 | Ga0466972_0151200 | 3300044658 | Bacteria | 1091 |
| 146 | Ga0466965_0002517 | 3300044683 | Bacteria | 7810 |
| 147 | Ga0466965_0031809 | 3300044683 | Bacteria | 2574 |
| 148 | Ga0466965_0038242 | 3300044683 | Bacteria | 2356 |
| 149 | Ga0466966_0028615 | 3300044684 | Bacteria | 3627 |
| 150 | Ga0466966_0049635 | 3300044684 | Bacteria | 2672 |
| 151 | Ga0466966_0056424 | 3300044684 | Bacteria | 2484 |
| 152 | Ga0466966_0060100 | 3300044684 | Bacteria | 2399 |
| 153 | Ga0466961_0063166 | 3300044693 | Bacteria | 2352 |
| 154 | Ga0466963_0441823 | 3300044694 | Bacteria | 918 |
| 155 | Ga0466964_0020947 | 3300044706 | Bacteria | 2523 |
| 156 | Ga0466964_0023461 | 3300044706 | Bacteria | 2398 |
| 157 | Ga0466964_0032348 | 3300044706 | Bacteria | 2078 |
| 158 | Ga0466971_0118610 | 3300044719 | Bacteria | 1224 |
| 159 | Ga0466971_0144912 | 3300044719 | Bacteria | 1107 |
| 160 | Ga0466968_0014325 | 3300044735 | Bacteria | 3132 |
| 161 | Ga0466968_0050562 | 3300044735 | Bacteria | 1774 |
| 162 | Ga0466970_0136669 | 3300044765 | Bacteria | 1349 |
| 163 | Ga0466957_0000115 | 3300044842 | Bacteria | 33097 |
| 164 | Ga0466957_0031414 | 3300044842 | Bacteria | 3173 |
| 165 | Ga0466957_0085085 | 3300044842 | Bacteria | 1974 |
| 166 | Ga0466957_0114782 | 3300044842 | Bacteria | 1711 |
| 167 | Ga0466960_0204464 | 3300044901 | Bacteria | 1080 |
| 168 | Ga0466959_0005620 | 3300045049 | Bacteria | 8622 |
| 169 | Ga0466958_0068494 | 3300045836 | Bacteria | 2169 |
| 170 | Ga0466958_0107439 | 3300045836 | Bacteria | 1740 |
| 171 | Ga0466958_0136340 | 3300045836 | Bacteria | 1543 |
| 172 | Ga0466967_0010104 | 3300045976 | Bacteria | 7054 |
| 173 | Ga0466967_0103801 | 3300045976 | Bacteria | 2601 |
| 174 | Ga0495617_000002 | 3300046452 | Bacteria | 710121 |
| 175 | Ga0495617_000503 | 3300046452 | Bacteria | 20474 |
| 176 | Ga0495627_001506 | 3300046453 | Bacteria | 13413 |
| 177 | Ga0495627_004155 | 3300046453 | Bacteria | 6139 |
| 178 | Ga0495627_005062 | 3300046453 | Bacteria | 5386 |
| 179 | Ga0495627_017741 | 3300046453 | Bacteria | 2412 |
| 180 | Ga0495603_0055000 | 3300046455 | Bacteria | 2358 |
| 181 | Ga0495603_0075579 | 3300046455 | Bacteria | 1977 |
| 182 | Ga0495603_0077126 | 3300046455 | Bacteria | 1955 |
| 183 | Ga0495590_0000007 | 3300046457 | Bacteria | 331108 |
| 184 | Ga0495590_0000136 | 3300046457 | Bacteria | 43748 |
| 185 | Ga0495591_000062 | 3300046458 | Bacteria | 124615 |
| 186 | Ga0495591_009009 | 3300046458 | Bacteria | 4015 |
| 187 | Ga0495591_054244 | 3300046458 | Bacteria | 1084 |
| 188 | Ga0495629_0045794 | 3300046459 | Bacteria | 3068 |
| 189 | Ga0495629_0137652 | 3300046459 | Bacteria | 1700 |
| 190 | Ga0495629_0139322 | 3300046459 | Bacteria | 1688 |
| 191 | Ga0495629_0170463 | 3300046459 | Bacteria | 1510 |
| 192 | Ga0495638_0005843 | 3300046460 | Bacteria | 9049 |
| 193 | Ga0495638_0015067 | 3300046460 | Bacteria | 5202 |
| 194 | Ga0495638_0062179 | 3300046460 | Bacteria | 2305 |
| 195 | Ga0495638_0226864 | 3300046460 | Bacteria | 1041 |
| 196 | Ga0495653_0013275 | 3300046463 | Bacteria | 6715 |
| 197 | Ga0495653_0038671 | 3300046463 | Bacteria | 3744 |
| 198 | Ga0495653_0053706 | 3300046463 | Bacteria | 3081 |
| 199 | Ga0495650_0000015 | 3300046471 | Bacteria | 557595 |
| 200 | Ga0495650_0003039 | 3300046471 | Bacteria | 12659 |
| 201 | Ga0495650_0004274 | 3300046471 | Bacteria | 9866 |
| 202 | Ga0495650_0071793 | 3300046471 | Bacteria | 1356 |
| 203 | Ga0495580_0037665 | 3300046472 | Bacteria | 3468 |
| 204 | Ga0495582_0003653 | 3300046473 | Bacteria | 8664 |
| 205 | Ga0495582_0017446 | 3300046473 | Bacteria | 3928 |
| 206 | Ga0495582_0053789 | 3300046473 | Bacteria | 2220 |
| 207 | Ga0495605_0000063 | 3300046474 | Bacteria | 140789 |
| 208 | Ga0495605_0001463 | 3300046474 | Bacteria | 15423 |
| 209 | Ga0495605_0004805 | 3300046474 | Bacteria | 7902 |
| 210 | Ga0495605_0009267 | 3300046474 | Bacteria | 5532 |
| 211 | Ga0495605_0009791 | 3300046474 | Bacteria | 5379 |
| 212 | Ga0495605_0019410 | 3300046474 | Bacteria | 3629 |
| 213 | Ga0495605_0027346 | 3300046474 | Bacteria | 2956 |
| 214 | Ga0495605_0033087 | 3300046474 | Bacteria | 2627 |
| 215 | Ga0495605_0057925 | 3300046474 | Bacteria | 1863 |
| 216 | Ga0495605_0080682 | 3300046474 | Bacteria | 1522 |
| 217 | Ga0495605_0088203 | 3300046474 | Bacteria | 1441 |
| 218 | Ga0495639_0130860 | 3300046475 | Bacteria | 1201 |
| 219 | Ga0495584_0000010 | 3300046491 | Bacteria | 225095 |
| 220 | Ga0495584_0001432 | 3300046491 | Bacteria | 14361 |
| 221 | Ga0495584_0001842 | 3300046491 | Bacteria | 12301 |
| 222 | Ga0495584_0003242 | 3300046491 | Bacteria | 9023 |
| 223 | Ga0495584_0003373 | 3300046491 | Bacteria | 8826 |
| 224 | Ga0495584_0007972 | 3300046491 | Bacteria | 5503 |
| 225 | Ga0495584_0017789 | 3300046491 | Bacteria | 3615 |
| 226 | Ga0495584_0024692 | 3300046491 | Bacteria | 3047 |
| 227 | Ga0495584_0041712 | 3300046491 | Bacteria | 2316 |
| 228 | Ga0495584_0097060 | 3300046491 | Bacteria | 1488 |
| 229 | Ga0495584_0104550 | 3300046491 | Bacteria | 1431 |
| 230 | Ga0495584_0138080 | 3300046491 | Bacteria | 1237 |
| 231 | Ga0495584_0141090 | 3300046491 | Bacteria | 1223 |
| 232 | Ga0495584_0148095 | 3300046491 | Bacteria | 1192 |
| 233 | Ga0495584_0188015 | 3300046491 | Bacteria | 1049 |
| 234 | Ga0495584_0198743 | 3300046491 | Bacteria | 1019 |
| 235 | Ga0495585_0000004 | 3300046492 | Bacteria | 348260 |
| 236 | Ga0495585_0000006 | 3300046492 | Bacteria | 320556 |
| 237 | Ga0495585_0002703 | 3300046492 | Bacteria | 12422 |
| 238 | Ga0495585_0002955 | 3300046492 | Bacteria | 11739 |
| 239 | Ga0495585_0003583 | 3300046492 | Bacteria | 10422 |
| 240 | Ga0495585_0005077 | 3300046492 | Bacteria | 8388 |
| 241 | Ga0495585_0013671 | 3300046492 | Bacteria | 4746 |
| 242 | Ga0495585_0017931 | 3300046492 | Bacteria | 4085 |
| 243 | Ga0495585_0023393 | 3300046492 | Bacteria | 3544 |
| 244 | Ga0495585_0023995 | 3300046492 | Bacteria | 3498 |
| 245 | Ga0495585_0024714 | 3300046492 | Bacteria | 3443 |
| 246 | Ga0495585_0025881 | 3300046492 | Bacteria | 3356 |
| 247 | Ga0495585_0032808 | 3300046492 | Bacteria | 2940 |
| 248 | Ga0495585_0036963 | 3300046492 | Bacteria | 2751 |
| 249 | Ga0495585_0049421 | 3300046492 | Bacteria | 2335 |
| 250 | Ga0495585_0060250 | 3300046492 | Bacteria | 2089 |
| 251 | Ga0495585_0072883 | 3300046492 | Bacteria | 1870 |
| 252 | Ga0495585_0129020 | 3300046492 | Bacteria | 1332 |
| 253 | Ga0495585_0148923 | 3300046492 | Bacteria | 1221 |
| 254 | Ga0495585_0224484 | 3300046492 | Bacteria | 946 |
| 255 | Ga0495585_0269933 | 3300046492 | Bacteria | 843 |
| 256 | Ga0495594_0007141 | 3300046499 | Bacteria | 5747 |
| 257 | Ga0495594_0010522 | 3300046499 | Bacteria | 4798 |
| 258 | Ga0495594_0029798 | 3300046499 | Bacteria | 2950 |
| 259 | Ga0495594_0038423 | 3300046499 | Bacteria | 2614 |
| 260 | Ga0495594_0096569 | 3300046499 | Bacteria | 1660 |
| 261 | Ga0495596_0000217 | 3300046500 | Bacteria | 39881 |
| 262 | Ga0495596_0000720 | 3300046500 | Bacteria | 20418 |
| 263 | Ga0495596_0005367 | 3300046500 | Bacteria | 6064 |
| 264 | Ga0495596_0005533 | 3300046500 | Bacteria | 5947 |
| 265 | Ga0495596_0006913 | 3300046500 | Bacteria | 5169 |
| 266 | Ga0495596_0007419 | 3300046500 | Bacteria | 4948 |
| 267 | Ga0495596_0009980 | 3300046500 | Bacteria | 4155 |
| 268 | Ga0495596_0015057 | 3300046500 | Bacteria | 3248 |
| 269 | Ga0495596_0026768 | 3300046500 | Bacteria | 2322 |
| 270 | Ga0495596_0029712 | 3300046500 | Bacteria | 2190 |
| 271 | Ga0495596_0041659 | 3300046500 | Bacteria | 1810 |
| 272 | Ga0495596_0046388 | 3300046500 | Bacteria | 1707 |
| 273 | Ga0495596_0064465 | 3300046500 | Bacteria | 1425 |
| 274 | Ga0495596_0074026 | 3300046500 | Bacteria | 1322 |
| 275 | Ga0495596_0113436 | 3300046500 | Bacteria | 1052 |
| 276 | Ga0495607_0001518 | 3300046501 | Bacteria | 20423 |
| 277 | Ga0495607_0002839 | 3300046501 | Bacteria | 13749 |
| 278 | Ga0495607_0006211 | 3300046501 | Bacteria | 8430 |
| 279 | Ga0495607_0006855 | 3300046501 | Bacteria | 7945 |
| 280 | Ga0495607_0011149 | 3300046501 | Bacteria | 6002 |
| 281 | Ga0495607_0015837 | 3300046501 | Bacteria | 4876 |
| 282 | Ga0495607_0045841 | 3300046501 | Bacteria | 2569 |
| 283 | Ga0495607_0056736 | 3300046501 | Bacteria | 2247 |
| 284 | Ga0495607_0059368 | 3300046501 | Bacteria | 2182 |
| 285 | Ga0495607_0076367 | 3300046501 | Bacteria | 1853 |
| 286 | Ga0495607_0136073 | 3300046501 | Bacteria | 1272 |
| 287 | Ga0495607_0210026 | 3300046501 | Bacteria | 958 |
| 288 | Ga0495607_0212420 | 3300046501 | Bacteria | 951 |
| 289 | Ga0495607_0246409 | 3300046501 | Bacteria | 862 |
| 290 | Ga0495583_0000084 | 3300046506 | Bacteria | 165375 |
| 291 | Ga0495583_0001063 | 3300046506 | Bacteria | 30689 |
| 292 | Ga0495583_0001851 | 3300046506 | Bacteria | 19718 |
| 293 | Ga0495583_0002627 | 3300046506 | Bacteria | 15018 |
| 294 | Ga0495583_0003369 | 3300046506 | Bacteria | 12283 |
| 295 | Ga0495583_0003430 | 3300046506 | Bacteria | 12072 |
| 296 | Ga0495583_0010756 | 3300046506 | Bacteria | 5305 |
| 297 | Ga0495583_0023418 | 3300046506 | Bacteria | 3124 |
| 298 | Ga0495583_0037272 | 3300046506 | Bacteria | 2306 |
| 299 | Ga0495583_0045404 | 3300046506 | Bacteria | 2032 |
| 300 | Ga0495583_0081445 | 3300046506 | Bacteria | 1406 |
| 301 | Ga0495583_0109101 | 3300046506 | Bacteria | 1174 |
| 302 | Ga0495583_0109725 | 3300046506 | Bacteria | 1170 |
| 303 | Ga0495583_0153831 | 3300046506 | Bacteria | 952 |
| 304 | Ga0495606_0020128 | 3300046507 | Bacteria | 4933 |
| 305 | Ga0495606_0022863 | 3300046507 | Bacteria | 4542 |
| 306 | Ga0495606_0038230 | 3300046507 | Bacteria | 3249 |
| 307 | Ga0495606_0116723 | 3300046507 | Bacteria | 1602 |
| 308 | Ga0495606_0123910 | 3300046507 | Bacteria | 1543 |
| 309 | Ga0495610_0001723 | 3300046512 | Bacteria | 19165 |
| 310 | Ga0495616_0000081 | 3300046513 | Bacteria | 80720 |
| 311 | Ga0495616_0000396 | 3300046513 | Bacteria | 33637 |
| 312 | Ga0495616_0004088 | 3300046513 | Bacteria | 9258 |
| 313 | Ga0495616_0010211 | 3300046513 | Bacteria | 5447 |
| 314 | Ga0495616_0011083 | 3300046513 | Bacteria | 5180 |
| 315 | Ga0495616_0027090 | 3300046513 | Bacteria | 3043 |
| 316 | Ga0495616_0032757 | 3300046513 | Bacteria | 2712 |
| 317 | Ga0495616_0041446 | 3300046513 | Bacteria | 2348 |
| 318 | Ga0495616_0052478 | 3300046513 | Bacteria | 2030 |
| 319 | Ga0495616_0052785 | 3300046513 | Bacteria | 2023 |
| 320 | Ga0495616_0066570 | 3300046513 | Bacteria | 1752 |
| 321 | Ga0495616_0071488 | 3300046513 | Bacteria | 1677 |
| 322 | Ga0495616_0139568 | 3300046513 | Bacteria | 1104 |
| 323 | Ga0495620_0008818 | 3300046515 | Bacteria | 5395 |
| 324 | Ga0495630_0044204 | 3300046517 | Bacteria | 3328 |
| 325 | Ga0495631_0000208 | 3300046518 | Bacteria | 40242 |
| 326 | Ga0495631_0002880 | 3300046518 | Bacteria | 9542 |
| 327 | Ga0495631_0010249 | 3300046518 | Bacteria | 4645 |
| 328 | Ga0495631_0019364 | 3300046518 | Bacteria | 3192 |
| 329 | Ga0495631_0020558 | 3300046518 | Bacteria | 3083 |
| 330 | Ga0495631_0038500 | 3300046518 | Bacteria | 2125 |
| 331 | Ga0495631_0041231 | 3300046518 | Bacteria | 2043 |
| 332 | Ga0495631_0050890 | 3300046518 | Bacteria | 1811 |
| 333 | Ga0495631_0051052 | 3300046518 | Bacteria | 1807 |
| 334 | Ga0495631_0057448 | 3300046518 | Bacteria | 1693 |
| 335 | Ga0495631_0099831 | 3300046518 | Bacteria | 1249 |
| 336 | Ga0495631_0170387 | 3300046518 | Bacteria | 933 |
| 337 | Ga0495631_0187192 | 3300046518 | Bacteria | 886 |
| 338 | Ga0495631_0214282 | 3300046518 | Bacteria | 822 |
| 339 | Ga0495632_0000071 | 3300046519 | Bacteria | 105606 |
| 340 | Ga0495632_0001714 | 3300046519 | Bacteria | 17823 |
| 341 | Ga0495632_0003038 | 3300046519 | Bacteria | 12224 |
| 342 | Ga0495632_0006355 | 3300046519 | Bacteria | 7622 |
| 343 | Ga0495632_0006805 | 3300046519 | Bacteria | 7295 |
| 344 | Ga0495632_0009584 | 3300046519 | Bacteria | 5822 |
| 345 | Ga0495632_0039684 | 3300046519 | Bacteria | 2374 |
| 346 | Ga0495632_0052462 | 3300046519 | Bacteria | 2005 |
| 347 | Ga0495632_0053365 | 3300046519 | Bacteria | 1985 |
| 348 | Ga0495632_0074398 | 3300046519 | Bacteria | 1627 |
| 349 | Ga0495637_0000335 | 3300046520 | Bacteria | 36417 |
| 350 | Ga0495637_0012354 | 3300046520 | Bacteria | 4087 |
| 351 | Ga0495637_0056004 | 3300046520 | Bacteria | 1633 |
| 352 | Ga0495643_0000196 | 3300046522 | Bacteria | 95989 |
| 353 | Ga0495643_0000756 | 3300046522 | Bacteria | 36370 |
| 354 | Ga0495643_0008541 | 3300046522 | Bacteria | 6468 |
| 355 | Ga0495643_0009301 | 3300046522 | Bacteria | 6119 |
| 356 | Ga0495643_0022616 | 3300046522 | Bacteria | 3585 |
| 357 | Ga0495643_0047560 | 3300046522 | Bacteria | 2322 |
| 358 | Ga0495643_0048822 | 3300046522 | Bacteria | 2285 |
| 359 | Ga0495643_0061200 | 3300046522 | Bacteria | 1997 |
| 360 | Ga0495643_0085892 | 3300046522 | Bacteria | 1630 |
| 361 | Ga0495643_0121475 | 3300046522 | Bacteria | 1319 |
| 362 | Ga0495643_0146137 | 3300046522 | Bacteria | 1175 |
| 363 | Ga0495643_0325726 | 3300046522 | Bacteria | 693 |
| 364 | Ga0495644_0002322 | 3300046523 | Bacteria | 7607 |
| 365 | Ga0495644_0004209 | 3300046523 | Bacteria | 5652 |
| 366 | Ga0495644_0008001 | 3300046523 | Bacteria | 4067 |
| 367 | Ga0495644_0010531 | 3300046523 | Bacteria | 3562 |
| 368 | Ga0495644_0012701 | 3300046523 | Bacteria | 3238 |
| 369 | Ga0495644_0027406 | 3300046523 | Bacteria | 2158 |
| 370 | Ga0495644_0033282 | 3300046523 | Bacteria | 1947 |
| 371 | Ga0495644_0040490 | 3300046523 | Bacteria | 1756 |
| 372 | Ga0495648_0000007 | 3300046524 | Bacteria | 347305 |
| 373 | Ga0495648_0005051 | 3300046524 | Bacteria | 11081 |
| 374 | Ga0495648_0019005 | 3300046524 | Bacteria | 4846 |
| 375 | Ga0495648_0020402 | 3300046524 | Bacteria | 4623 |
| 376 | Ga0495648_0020616 | 3300046524 | Bacteria | 4590 |
| 377 | Ga0495648_0047464 | 3300046524 | Bacteria | 2653 |
| 378 | Ga0495648_0048191 | 3300046524 | Bacteria | 2625 |
| 379 | Ga0495648_0055100 | 3300046524 | Bacteria | 2398 |
| 380 | Ga0495648_0056925 | 3300046524 | Bacteria | 2348 |
| 381 | Ga0495648_0061676 | 3300046524 | Bacteria | 2225 |
| 382 | Ga0495648_0066627 | 3300046524 | Bacteria | 2110 |
| 383 | Ga0495648_0091471 | 3300046524 | Bacteria | 1702 |
| 384 | Ga0495663_0003406 | 3300046525 | Bacteria | 4589 |
| 385 | Ga0495663_0008216 | 3300046525 | Bacteria | 2887 |
| 386 | Ga0495666_0003041 | 3300046526 | Bacteria | 8427 |
| 387 | Ga0495666_0006057 | 3300046526 | Bacteria | 6091 |
| 388 | Ga0495666_0033003 | 3300046526 | Bacteria | 2531 |
| 389 | Ga0495666_0072367 | 3300046526 | Bacteria | 1637 |
| 390 | Ga0495666_0234483 | 3300046526 | Bacteria | 838 |
| 391 | Ga0495642_0000887 | 3300046528 | Bacteria | 14120 |
| 392 | Ga0495642_0000985 | 3300046528 | Bacteria | 13253 |
| 393 | Ga0495642_0003070 | 3300046528 | Bacteria | 6641 |
| 394 | Ga0495642_0004220 | 3300046528 | Bacteria | 5596 |
| 395 | Ga0495642_0007753 | 3300046528 | Bacteria | 4112 |
| 396 | Ga0495642_0011156 | 3300046528 | Bacteria | 3446 |
| 397 | Ga0495642_0011964 | 3300046528 | Bacteria | 3342 |
| 398 | Ga0495642_0015193 | 3300046528 | Bacteria | 2988 |
| 399 | Ga0495642_0030633 | 3300046528 | Bacteria | 2152 |
| 400 | Ga0495642_0041121 | 3300046528 | Bacteria | 1879 |
| 401 | Ga0495642_0043171 | 3300046528 | Bacteria | 1838 |
| 402 | Ga0495642_0053603 | 3300046528 | Bacteria | 1662 |
| 403 | Ga0495642_0056949 | 3300046528 | Bacteria | 1615 |
| 404 | Ga0495642_0064290 | 3300046528 | Bacteria | 1526 |
| 405 | Ga0495642_0095128 | 3300046528 | Bacteria | 1264 |
| 406 | Ga0495642_0162892 | 3300046528 | Bacteria | 967 |
| 407 | Ga0495642_0176382 | 3300046528 | Bacteria | 929 |
| 408 | Ga0495652_0005305 | 3300046529 | Bacteria | 12153 |
| 409 | Ga0495654_0019568 | 3300046530 | Bacteria | 3540 |
| 410 | Ga0495654_0032298 | 3300046530 | Bacteria | 2654 |
| 411 | Ga0495654_0047779 | 3300046530 | Bacteria | 2102 |
| 412 | Ga0495654_0082322 | 3300046530 | Bacteria | 1506 |
| 413 | Ga0495654_0117053 | 3300046530 | Bacteria | 1210 |
| 414 | Ga0495665_0011062 | 3300046531 | Bacteria | 4884 |
| 415 | Ga0495665_0017174 | 3300046531 | Bacteria | 3893 |
| 416 | Ga0495665_0179950 | 3300046531 | Bacteria | 1099 |
| 417 | Ga0495640_0017464 | 3300046533 | Bacteria | 5349 |
| 418 | Ga0495640_0106295 | 3300046533 | Bacteria | 1838 |
| 419 | Ga0495586_0030628 | 3300046535 | Bacteria | 2879 |
| 420 | Ga0495586_0032205 | 3300046535 | Bacteria | 2810 |
| 421 | Ga0495586_0561180 | 3300046535 | Bacteria | 659 |
| 422 | Ga0495587_0075548 | 3300046536 | Bacteria | 1956 |
| 423 | Ga0495609_0000002 | 3300046538 | Bacteria | 739816 |
| 424 | Ga0495609_0000639 | 3300046538 | Bacteria | 27254 |
| 425 | Ga0495609_0001669 | 3300046538 | Bacteria | 14418 |
| 426 | Ga0495609_0006038 | 3300046538 | Bacteria | 6240 |
| 427 | Ga0495609_0006189 | 3300046538 | Bacteria | 6153 |
| 428 | Ga0495609_0014288 | 3300046538 | Bacteria | 3736 |
| 429 | Ga0495609_0024847 | 3300046538 | Bacteria | 2746 |
| 430 | Ga0495609_0029952 | 3300046538 | Bacteria | 2477 |
| 431 | Ga0495609_0031536 | 3300046538 | Bacteria | 2408 |
| 432 | Ga0495609_0039743 | 3300046538 | Bacteria | 2117 |
| 433 | Ga0495609_0042134 | 3300046538 | Bacteria | 2050 |
| 434 | Ga0495609_0043417 | 3300046538 | Bacteria | 2018 |
| 435 | Ga0495609_0052974 | 3300046538 | Bacteria | 1805 |
| 436 | Ga0495609_0098264 | 3300046538 | Bacteria | 1269 |
| 437 | Ga0495609_0108770 | 3300046538 | Bacteria | 1197 |
| 438 | Ga0495609_0108804 | 3300046538 | Bacteria | 1197 |
| 439 | Ga0495621_0208854 | 3300046539 | Bacteria | 787 |
| 440 | Ga0495597_0000063 | 3300046542 | Bacteria | 91471 |
| 441 | Ga0495597_0001454 | 3300046542 | Bacteria | 16953 |
| 442 | Ga0495597_0001769 | 3300046542 | Bacteria | 14833 |
| 443 | Ga0495597_0002996 | 3300046542 | Bacteria | 10192 |
| 444 | Ga0495597_0005005 | 3300046542 | Bacteria | 7110 |
| 445 | Ga0495597_0012512 | 3300046542 | Bacteria | 4093 |
| 446 | Ga0495597_0014834 | 3300046542 | Bacteria | 3704 |
| 447 | Ga0495597_0022533 | 3300046542 | Bacteria | 2921 |
| 448 | Ga0495597_0030344 | 3300046542 | Bacteria | 2464 |
| 449 | Ga0495597_0050225 | 3300046542 | Bacteria | 1841 |
| 450 | Ga0495597_0102005 | 3300046542 | Bacteria | 1209 |
| 451 | Ga0495597_0124936 | 3300046542 | Bacteria | 1070 |
| 452 | Ga0495597_0138548 | 3300046542 | Bacteria | 1005 |
| 453 | Ga0495645_0056107 | 3300046543 | Bacteria | 2860 |
| 454 | Ga0495622_0028060 | 3300046557 | Bacteria | 2627 |
| 455 | Ga0495622_0042865 | 3300046557 | Bacteria | 2103 |
| 456 | Ga0495622_0046007 | 3300046557 | Bacteria | 2027 |
| 457 | Ga0495622_0104768 | 3300046557 | Bacteria | 1295 |
| 458 | Ga0495633_0009799 | 3300046558 | Bacteria | 5265 |
| 459 | Ga0495633_0011494 | 3300046558 | Bacteria | 4768 |
| 460 | Ga0495633_0036397 | 3300046558 | Bacteria | 2358 |
| 461 | Ga0495633_0046931 | 3300046558 | Bacteria | 2042 |
| 462 | Ga0495633_0048132 | 3300046558 | Bacteria | 2014 |
| 463 | Ga0495633_0056960 | 3300046558 | Bacteria | 1836 |
| 464 | Ga0495633_0072994 | 3300046558 | Bacteria | 1600 |
| 465 | Ga0495633_0110326 | 3300046558 | Bacteria | 1275 |
| 466 | Ga0495633_0206030 | 3300046558 | Bacteria | 902 |
| 467 | Ga0495656_0000811 | 3300046615 | Bacteria | 10078 |
| 468 | Ga0495656_0053744 | 3300046615 | Bacteria | 1731 |
| 469 | Ga0495656_0060101 | 3300046615 | Bacteria | 1655 |
| 470 | Ga0495656_0107139 | 3300046615 | Bacteria | 1301 |
| 471 | Ga0495656_0120595 | 3300046615 | Bacteria | 1237 |
| 472 | Ga0495656_0128328 | 3300046615 | Bacteria | 1204 |
| 473 | Ga0495668_0000158 | 3300046616 | Bacteria | 103075 |
| 474 | Ga0495668_0002726 | 3300046616 | Bacteria | 14151 |
| 475 | Ga0495668_0002953 | 3300046616 | Bacteria | 13379 |
| 476 | Ga0495668_0003351 | 3300046616 | Bacteria | 12079 |
| 477 | Ga0495668_0011571 | 3300046616 | Bacteria | 5276 |
| 478 | Ga0495668_0025427 | 3300046616 | Bacteria | 3364 |
| 479 | Ga0495668_0026093 | 3300046616 | Bacteria | 3317 |
| 480 | Ga0495668_0035973 | 3300046616 | Bacteria | 2775 |
| 481 | Ga0495668_0059905 | 3300046616 | Bacteria | 2100 |
| 482 | Ga0495668_0082440 | 3300046616 | Bacteria | 1764 |
| 483 | Ga0495668_0095784 | 3300046616 | Bacteria | 1624 |
| 484 | Ga0495668_0188505 | 3300046616 | Bacteria | 1129 |
| 485 | Ga0495668_0256880 | 3300046616 | Bacteria | 956 |
| 486 | Ga0495668_0327333 | 3300046616 | Bacteria | 840 |
| 487 | Ga0495634_0055235 | 3300046642 | Bacteria | 2655 |
| 488 | Ga0495611_0000658 | 3300046648 | Bacteria | 19719 |
| 489 | Ga0495611_0001035 | 3300046648 | Bacteria | 14726 |
| 490 | Ga0495611_0005119 | 3300046648 | Bacteria | 5617 |
| 491 | Ga0495611_0018385 | 3300046648 | Bacteria | 2997 |
| 492 | Ga0495611_0026598 | 3300046648 | Bacteria | 2524 |
| 493 | Ga0495611_0027627 | 3300046648 | Bacteria | 2481 |
| 494 | Ga0495611_0046324 | 3300046648 | Bacteria | 1949 |
| 495 | Ga0495611_0055046 | 3300046648 | Bacteria | 1799 |
| 496 | Ga0495611_0060171 | 3300046648 | Bacteria | 1725 |
| 497 | Ga0495611_0105496 | 3300046648 | Bacteria | 1310 |
| 498 | Ga0495611_0115389 | 3300046648 | Bacteria | 1251 |
| 499 | Ga0495611_0275865 | 3300046648 | Bacteria | 777 |
| 500 | Ga0495625_0014579 | 3300046660 | Bacteria | 6265 |
| 501 | Ga0495625_0043078 | 3300046660 | Bacteria | 3276 |
| 502 | Ga0495625_0076469 | 3300046660 | Bacteria | 2340 |
| 503 | Ga0495625_0079550 | 3300046660 | Bacteria | 2285 |
| 504 | Ga0495625_0129194 | 3300046660 | Bacteria | 1712 |
| 505 | Ga0495625_0150318 | 3300046660 | Bacteria | 1566 |
| 506 | Ga0495625_0187639 | 3300046660 | Bacteria | 1371 |
| 507 | Ga0495635_0070742 | 3300046663 | Bacteria | 2391 |
| 508 | Ga0495659_0004753 | 3300046664 | Bacteria | 4275 |
| 509 | Ga0495661_0000204 | 3300046665 | Bacteria | 68851 |
| 510 | Ga0495661_0000742 | 3300046665 | Bacteria | 31731 |
| 511 | Ga0495661_0002628 | 3300046665 | Bacteria | 13759 |
| 512 | Ga0495661_0003424 | 3300046665 | Bacteria | 11708 |
| 513 | Ga0495661_0010529 | 3300046665 | Bacteria | 6306 |
| 514 | Ga0495661_0012729 | 3300046665 | Bacteria | 5677 |
| 515 | Ga0495661_0014610 | 3300046665 | Bacteria | 5258 |
| 516 | Ga0495661_0017638 | 3300046665 | Bacteria | 4710 |
| 517 | Ga0495661_0024591 | 3300046665 | Bacteria | 3899 |
| 518 | Ga0495661_0029188 | 3300046665 | Bacteria | 3523 |
| 519 | Ga0495661_0030620 | 3300046665 | Bacteria | 3423 |
| 520 | Ga0495661_0040677 | 3300046665 | Bacteria | 2880 |
| 521 | Ga0495661_0042946 | 3300046665 | Bacteria | 2783 |
| 522 | Ga0495661_0049134 | 3300046665 | Bacteria | 2559 |
| 523 | Ga0495661_0071899 | 3300046665 | Bacteria | 2020 |
| 524 | Ga0495661_0072124 | 3300046665 | Bacteria | 2015 |
| 525 | Ga0495661_0074863 | 3300046665 | Bacteria | 1969 |
| 526 | Ga0495661_0075799 | 3300046665 | Bacteria | 1953 |
| 527 | Ga0495661_0081727 | 3300046665 | Bacteria | 1861 |
| 528 | Ga0495661_0127774 | 3300046665 | Bacteria | 1396 |
| 529 | Ga0495661_0162361 | 3300046665 | Bacteria | 1198 |
| 530 | Ga0495661_0174962 | 3300046665 | Bacteria | 1141 |
| 531 | Ga0495661_0244428 | 3300046665 | Bacteria | 919 |
| 532 | Ga0495588_0000208 | 3300046674 | Bacteria | 57550 |
| 533 | Ga0495588_0008870 | 3300046674 | Bacteria | 4626 |
| 534 | Ga0495588_0011201 | 3300046674 | Bacteria | 4201 |
| 535 | Ga0495588_0024716 | 3300046674 | Bacteria | 2986 |
| 536 | Ga0495588_0036455 | 3300046674 | Bacteria | 2495 |
| 537 | Ga0495588_0065622 | 3300046674 | Bacteria | 1883 |
| 538 | Ga0495588_0095775 | 3300046674 | Bacteria | 1556 |
| 539 | Ga0495588_0117514 | 3300046674 | Bacteria | 1401 |
| 540 | Ga0495588_0129041 | 3300046674 | Bacteria | 1333 |
| 541 | Ga0495588_0206511 | 3300046674 | Bacteria | 1037 |
| 542 | Ga0495588_0212897 | 3300046674 | Bacteria | 1020 |
| 543 | Ga0495623_0008692 | 3300046679 | Bacteria | 6592 |
| 544 | Ga0495623_0135463 | 3300046679 | Bacteria | 1470 |
| 545 | Ga0495646_0220121 | 3300046680 | Bacteria | 1027 |
| 546 | Ga0495669_0000036 | 3300046684 | Bacteria | 95830 |
| 547 | Ga0495669_0004461 | 3300046684 | Bacteria | 5782 |
| 548 | Ga0495669_0018382 | 3300046684 | Bacteria | 3005 |
| 549 | Ga0495669_0029252 | 3300046684 | Bacteria | 2415 |
| 550 | Ga0495669_0033456 | 3300046684 | Bacteria | 2262 |
| 551 | Ga0495669_0133959 | 3300046684 | Bacteria | 1167 |
| 552 | Ga0495669_0206270 | 3300046684 | Bacteria | 940 |
| 553 | Ga0495613_0135202 | 3300046689 | Bacteria | 1764 |
| 554 | Ga0495670_0002278 | 3300046691 | Bacteria | 9465 |
| 555 | Ga0495670_0004961 | 3300046691 | Bacteria | 6538 |
| 556 | Ga0495670_0005968 | 3300046691 | Bacteria | 5964 |
| 557 | Ga0495670_0007920 | 3300046691 | Bacteria | 5223 |
| 558 | Ga0495670_0009203 | 3300046691 | Bacteria | 4857 |
| 559 | Ga0495670_0009685 | 3300046691 | Bacteria | 4736 |
| 560 | Ga0495670_0015019 | 3300046691 | Bacteria | 3810 |
| 561 | Ga0495670_0040605 | 3300046691 | Bacteria | 2320 |
| 562 | Ga0495670_0067207 | 3300046691 | Bacteria | 1809 |
| 563 | Ga0495670_0086141 | 3300046691 | Bacteria | 1604 |
| 564 | Ga0495670_0114144 | 3300046691 | Bacteria | 1399 |
| 565 | Ga0495670_0195564 | 3300046691 | Bacteria | 1070 |
| 566 | Ga0495670_0337256 | 3300046691 | Bacteria | 810 |
| 567 | Ga0495671_0002020 | 3300046692 | Bacteria | 13021 |
| 568 | Ga0495671_0012088 | 3300046692 | Bacteria | 4719 |
| 569 | Ga0495671_0053931 | 3300046692 | Bacteria | 1994 |
| 570 | Ga0495671_0078818 | 3300046692 | Bacteria | 1615 |
| 571 | Ga0495671_0100712 | 3300046692 | Bacteria | 1412 |
| 572 | Ga0495671_0221589 | 3300046692 | Bacteria | 915 |
| 573 | Ga0495649_0001404 | 3300046694 | Bacteria | 18182 |
| 574 | Ga0495649_0016032 | 3300046694 | Bacteria | 4253 |
| 575 | Ga0495649_0031186 | 3300046694 | Bacteria | 2940 |
| 576 | Ga0495649_0036164 | 3300046694 | Bacteria | 2713 |
| 577 | Ga0495649_0052177 | 3300046694 | Bacteria | 2216 |
| 578 | Ga0495649_0072623 | 3300046694 | Bacteria | 1844 |
| 579 | Ga0495649_0194693 | 3300046694 | Bacteria | 1054 |
| 580 | Ga0495649_0306871 | 3300046694 | Bacteria | 807 |
| 581 | Ga0495589_0000275 | 3300046794 | Bacteria | 41938 |
| 582 | Ga0495589_0000491 | 3300046794 | Bacteria | 28250 |
| 583 | Ga0495589_0005559 | 3300046794 | Bacteria | 6649 |
| 584 | Ga0495589_0006649 | 3300046794 | Bacteria | 6091 |
| 585 | Ga0495589_0007968 | 3300046794 | Bacteria | 5544 |
| 586 | Ga0495589_0008429 | 3300046794 | Bacteria | 5386 |
| 587 | Ga0495589_0023954 | 3300046794 | Bacteria | 3105 |
| 588 | Ga0495589_0048182 | 3300046794 | Bacteria | 2110 |
| 589 | Ga0495589_0058095 | 3300046794 | Bacteria | 1902 |
| 590 | Ga0495589_0061236 | 3300046794 | Bacteria | 1847 |
| 591 | Ga0495589_0070279 | 3300046794 | Bacteria | 1711 |
| 592 | Ga0495589_0102080 | 3300046794 | Bacteria | 1387 |
| 593 | Ga0495660_0000322 | 3300046810 | Bacteria | 42498 |
| 594 | Ga0495660_0007438 | 3300046810 | Bacteria | 6430 |
| 595 | Ga0495660_0009527 | 3300046810 | Bacteria | 5661 |
| 596 | Ga0495660_0013960 | 3300046810 | Bacteria | 4656 |
| 597 | Ga0495660_0018521 | 3300046810 | Bacteria | 4004 |
| 598 | Ga0495660_0056287 | 3300046810 | Bacteria | 2125 |
| 599 | Ga0495581_0039005 | 3300047315 | Bacteria | 2750 |
| 600 | Ga0495604_0027320 | 3300047317 | Bacteria | 4540 |
| 601 | Ga0495604_0077469 | 3300047317 | Bacteria | 2498 |
| 602 | Ga0495604_0108343 | 3300047317 | Bacteria | 2029 |
| 603 | Ga0495636_0012469 | 3300047318 | Bacteria | 3366 |
| 604 | Ga0495636_0016936 | 3300047318 | Bacteria | 2914 |
| 605 | Ga0495636_0040330 | 3300047318 | Bacteria | 1936 |
| 606 | Ga0495636_0112046 | 3300047318 | Bacteria | 1201 |
| 607 | Ga0495636_0128242 | 3300047318 | Bacteria | 1127 |
| 608 | Ga0495636_0138986 | 3300047318 | Bacteria | 1084 |
| 609 | Ga0495674_0067631 | 3300047319 | Bacteria | 3094 |
| 610 | Ga0495672_0000041 | 3300047320 | Bacteria | 267545 |
| 611 | Ga0495672_0001268 | 3300047320 | Bacteria | 25254 |
| 612 | Ga0495672_0001324 | 3300047320 | Bacteria | 24612 |
| 613 | Ga0495672_0003105 | 3300047320 | Bacteria | 14503 |
| 614 | Ga0495672_0050114 | 3300047320 | Bacteria | 2468 |
| 615 | Ga0495672_0065404 | 3300047320 | Bacteria | 2078 |
| 616 | Ga0495672_0166406 | 3300047320 | Bacteria | 1128 |
| 617 | Ga0495676_0000014 | 3300047321 | Bacteria | 203356 |
| 618 | Ga0495676_0030259 | 3300047321 | Bacteria | 4599 |
| 619 | Ga0495676_0056542 | 3300047321 | Bacteria | 3102 |
| 620 | Ga0495676_0084149 | 3300047321 | Bacteria | 2401 |
| 621 | Ga0495676_0381644 | 3300047321 | Bacteria | 937 |
| 622 | Ga0495680_0038704 | 3300047322 | Bacteria | 3809 |
| 623 | Ga0495680_0039002 | 3300047322 | Bacteria | 3792 |
| 624 | Ga0495683_0000180 | 3300047323 | Bacteria | 62230 |
| 625 | Ga0495683_0001405 | 3300047323 | Bacteria | 15876 |
| 626 | Ga0495683_0002116 | 3300047323 | Bacteria | 12278 |
| 627 | Ga0495683_0018151 | 3300047323 | Bacteria | 3640 |
| 628 | Ga0495683_0028122 | 3300047323 | Bacteria | 2874 |
| 629 | Ga0495683_0029322 | 3300047323 | Bacteria | 2812 |
| 630 | Ga0495683_0039680 | 3300047323 | Bacteria | 2379 |
| 631 | Ga0495683_0068303 | 3300047323 | Bacteria | 1748 |
| 632 | Ga0495683_0073195 | 3300047323 | Bacteria | 1680 |
| 633 | Ga0495683_0122651 | 3300047323 | Bacteria | 1232 |
| 634 | Ga0495683_0174608 | 3300047323 | Bacteria | 985 |
| 635 | Ga0495683_0297976 | 3300047323 | Bacteria | 693 |
| 636 | Ga0495687_000049 | 3300047443 | Bacteria | 205432 |
| 637 | Ga0495687_000088 | 3300047443 | Bacteria | 142499 |
| 638 | Ga0495687_000605 | 3300047443 | Bacteria | 41942 |
| 639 | Ga0495687_001034 | 3300047443 | Bacteria | 27640 |
| 640 | Ga0495687_008194 | 3300047443 | Bacteria | 6019 |
| 641 | Ga0495687_070576 | 3300047443 | Bacteria | 1402 |
| 642 | Ga0495675_0004311 | 3300047444 | Bacteria | 8606 |
| 643 | Ga0495675_0006020 | 3300047444 | Bacteria | 7420 |
| 644 | Ga0495677_0000103 | 3300047445 | Bacteria | 41927 |
| 645 | Ga0495677_0000916 | 3300047445 | Bacteria | 11880 |
| 646 | Ga0495677_0001365 | 3300047445 | Bacteria | 9761 |
| 647 | Ga0495677_0003071 | 3300047445 | Bacteria | 6491 |
| 648 | Ga0495677_0003608 | 3300047445 | Bacteria | 6002 |
| 649 | Ga0495677_0006807 | 3300047445 | Bacteria | 4303 |
| 650 | Ga0495677_0007272 | 3300047445 | Bacteria | 4141 |
| 651 | Ga0495677_0019463 | 3300047445 | Bacteria | 2461 |
| 652 | Ga0495677_0031018 | 3300047445 | Bacteria | 1946 |
| 653 | Ga0495677_0031976 | 3300047445 | Bacteria | 1915 |
| 654 | Ga0495677_0038020 | 3300047445 | Bacteria | 1758 |
| 655 | Ga0495677_0057772 | 3300047445 | Bacteria | 1434 |
| 656 | Ga0495677_0091154 | 3300047445 | Bacteria | 1148 |
| 657 | Ga0495677_0128986 | 3300047445 | Bacteria | 967 |
| 658 | Ga0495679_006905 | 3300047446 | Bacteria | 4816 |
| 659 | Ga0495679_036002 | 3300047446 | Bacteria | 1565 |
| 660 | Ga0495685_004530 | 3300047447 | Bacteria | 4500 |
| 661 | Ga0495685_006113 | 3300047447 | Bacteria | 3939 |
| 662 | Ga0495685_018887 | 3300047447 | Bacteria | 2366 |
| 663 | Ga0495685_024819 | 3300047447 | Bacteria | 2063 |
| 664 | Ga0495685_030489 | 3300047447 | Bacteria | 1854 |
| 665 | Ga0495685_046122 | 3300047447 | Bacteria | 1483 |
| 666 | Ga0495685_219206 | 3300047447 | Bacteria | 607 |
| 667 | Ga0495673_0025881 | 3300047469 | Bacteria | 2812 |
| 668 | Ga0495681_0000120 | 3300047470 | Bacteria | 69257 |
| 669 | Ga0495681_0001681 | 3300047470 | Bacteria | 16398 |
| 670 | Ga0495681_0004617 | 3300047470 | Bacteria | 9357 |
| 671 | Ga0495681_0018681 | 3300047470 | Bacteria | 3810 |
| 672 | Ga0495681_0022912 | 3300047470 | Bacteria | 3331 |
| 673 | Ga0495681_0045314 | 3300047470 | Bacteria | 2105 |
| 674 | Ga0495681_0046780 | 3300047470 | Bacteria | 2060 |
| 675 | Ga0495681_0055690 | 3300047470 | Bacteria | 1843 |
| 676 | Ga0495681_0109868 | 3300047470 | Bacteria | 1195 |
| 677 | Ga0495681_0134816 | 3300047470 | Bacteria | 1048 |
| 678 | Ga0495686_0000400 | 3300047472 | Bacteria | 68842 |
| 679 | Ga0495686_0001135 | 3300047472 | Bacteria | 31457 |
| 680 | Ga0495686_0058923 | 3300047472 | Bacteria | 2392 |
| 681 | Ga0495686_0077535 | 3300047472 | Bacteria | 2034 |
| 682 | Ga0495686_0151029 | 3300047472 | Bacteria | 1363 |
| 683 | Ga0495686_0187949 | 3300047472 | Bacteria | 1192 |
| 684 | Ga0495593_0002003 | 3300047673 | Bacteria | 12148 |
| 685 | Ga0495593_0038031 | 3300047673 | Bacteria | 2600 |
| 686 | Ga0495614_0015720 | 3300048089 | Bacteria | 3296 |
| 687 | Ga0495614_0041834 | 3300048089 | Bacteria | 1965 |
| 688 | Ga0495614_0339264 | 3300048089 | Bacteria | 699 |
| 689 | Ga0495615_0004342 | 3300048090 | Bacteria | 2468 |
| 690 | Ga0495626_0000111 | 3300048091 | Bacteria | 105401 |
| 691 | Ga0495626_0000447 | 3300048091 | Bacteria | 41983 |
| 692 | Ga0495626_0000466 | 3300048091 | Bacteria | 41284 |
| 693 | Ga0495626_0004056 | 3300048091 | Bacteria | 9125 |
| 694 | Ga0495626_0011509 | 3300048091 | Bacteria | 4679 |
| 695 | Ga0495626_0013629 | 3300048091 | Bacteria | 4220 |
| 696 | Ga0495626_0014030 | 3300048091 | Bacteria | 4145 |
| 697 | Ga0495626_0016979 | 3300048091 | Bacteria | 3685 |
| 698 | Ga0495626_0024283 | 3300048091 | Bacteria | 2973 |
| 699 | Ga0495626_0027868 | 3300048091 | Bacteria | 2743 |
| 700 | Ga0495626_0043081 | 3300048091 | Bacteria | 2118 |
| 701 | Ga0495626_0046877 | 3300048091 | Bacteria | 2011 |
| 702 | Ga0495626_0050926 | 3300048091 | Bacteria | 1911 |
| 703 | Ga0495626_0107274 | 3300048091 | Bacteria | 1212 |
| 704 | Ga0495626_0132452 | 3300048091 | Bacteria | 1063 |
| 705 | Ga0495626_0138775 | 3300048091 | Bacteria | 1032 |
| 706 | Ga0495626_0143013 | 3300048091 | Bacteria | 1013 |
| 707 | Ga0495626_0158741 | 3300048091 | Bacteria | 949 |
| 708 | Ga0496100_0335507 | 3300048903 | Bacteria | 1139 |
| 709 | Ga0496101_0003310 | 3300048904 | Bacteria | 10020 |
| 710 | Ga0496101_0249859 | 3300048904 | Bacteria | 1382 |
| 711 | Ga0496101_0409653 | 3300048904 | Bacteria | 1068 |
| 712 | Ga0496102_0000695 | 3300048905 | Bacteria | 33460 |
| 713 | Ga0496102_0002110 | 3300048905 | Bacteria | 17093 |
| 714 | Ga0496102_0056926 | 3300048905 | Bacteria | 3567 |
| 715 | Ga0496102_0133535 | 3300048905 | Bacteria | 2325 |
| 716 | Ga0496102_0252024 | 3300048905 | Bacteria | 1665 |
| 717 | Ga0496102_0561120 | 3300048905 | Bacteria | 1064 |
| 718 | Ga0496102_1204142 | 3300048905 | Bacteria | 677 |
| 719 | Ga0496103_0015065 | 3300048906 | Bacteria | 4596 |
| 720 | Ga0496103_0032804 | 3300048906 | Bacteria | 3171 |
| 721 | Ga0496103_0146652 | 3300048906 | Bacteria | 1511 |
| 722 | Ga0496104_0267682 | 3300048907 | Bacteria | 1621 |
| 723 | Ga0496104_0467159 | 3300048907 | Bacteria | 1173 |
| 724 | Ga0496104_0541266 | 3300048907 | Bacteria | 1075 |
| 725 | Ga0496104_0576101 | 3300048907 | Bacteria | 1036 |
| 726 | Ga0496105_0141122 | 3300048908 | Bacteria | 1983 |
| 727 | Ga0496105_0251735 | 3300048908 | Bacteria | 1431 |
| 728 | Ga0496108_0091911 | 3300048911 | Bacteria | 2580 |
| 729 | Ga0496109_0027815 | 3300048912 | Bacteria | 5053 |
| 730 | Ga0496109_0162515 | 3300048912 | Bacteria | 2092 |
| 731 | Ga0496110_0000115 | 3300048913 | Bacteria | 44117 |
| 732 | Ga0496110_0005697 | 3300048913 | Bacteria | 9782 |
| 733 | Ga0496110_0131576 | 3300048913 | Bacteria | 2260 |
| 734 | Ga0496110_0803317 | 3300048913 | Bacteria | 845 |
| 735 | Ga0496111_0067867 | 3300048914 | Bacteria | 2591 |
| 736 | Ga0496111_0326231 | 3300048914 | Bacteria | 1137 |
| 737 | Ga0496112_0081152 | 3300048915 | Bacteria | 3207 |
| 738 | Ga0496113_0004780 | 3300048916 | Bacteria | 8367 |
| 739 | Ga0496113_0163382 | 3300048916 | Bacteria | 1761 |
| 740 | Ga0496113_0360005 | 3300048916 | Bacteria | 1167 |
| 741 | Ga0496115_0322572 | 3300048918 | Bacteria | 1263 |
| 742 | Ga0496115_0675142 | 3300048918 | Bacteria | 814 |
| 743 | Ga0496122_0000169 | 3300048925 | Bacteria | 155380 |
| 744 | Ga0496122_0014060 | 3300048925 | Bacteria | 7770 |
| 745 | Ga0496122_0097564 | 3300048925 | Bacteria | 1977 |
| 746 | Ga0496123_0001570 | 3300048926 | Bacteria | 31269 |
| 747 | Ga0496123_0015729 | 3300048926 | Bacteria | 6189 |
| 748 | Ga0496124_0003298 | 3300048927 | Bacteria | 19899 |
| 749 | Ga0496124_0060383 | 3300048927 | Bacteria | 3180 |
| 750 | Ga0496124_0069684 | 3300048927 | Bacteria | 2919 |
| 751 | Ga0496124_0212600 | 3300048927 | Bacteria | 1462 |
| 752 | Ga0496125_0005514 | 3300048928 | Bacteria | 14021 |
| 753 | Ga0496126_0940204 | 3300048929 | Bacteria | 653 |
| 754 | Ga0501310_000577 | 3300049130 | Bacteria | 3216 |
| 755 | Ga0501307_015555 | 3300049162 | Bacteria | 940 |
| 756 | Ga0495678_000056 | 3300049459 | Bacteria | 149598 |
| 757 | Ga0495678_001377 | 3300049459 | Bacteria | 19384 |
| 758 | Ga0495678_001405 | 3300049459 | Bacteria | 19063 |
| 759 | Ga0495678_001922 | 3300049459 | Bacteria | 15064 |
| 760 | Ga0495678_014321 | 3300049459 | Bacteria | 3690 |
| 761 | Ga0495678_037397 | 3300049459 | Bacteria | 1972 |
| 762 | Ga0495678_051711 | 3300049459 | Bacteria | 1586 |
| 763 | Ga0495678_079257 | 3300049459 | Bacteria | 1183 |
| 764 | Ga0495682_0010406 | 3300049460 | Bacteria | 3604 |
| 765 | Ga0495682_0014606 | 3300049460 | Bacteria | 2977 |
| 766 | Ga0495682_0024323 | 3300049460 | Bacteria | 2258 |
| 767 | Ga0495682_0025167 | 3300049460 | Bacteria | 2215 |
| 768 | Ga0495682_0031479 | 3300049460 | Bacteria | 1960 |
| 769 | Ga0495682_0056898 | 3300049460 | Bacteria | 1417 |
| 770 | Ga0501036_0267944 | 3300049572 | Bacteria | 1430 |
| 771 | Ga0501036_0812359 | 3300049572 | Bacteria | 770 |
| 772 | Ga0501257_098558 | 3300049686 | Bacteria | 766 |
| 773 | Ga0501263_008403 | 3300049760 | Bacteria | 1232 |
| 774 | Ga0501279_007981 | 3300049775 | Bacteria | 1407 |
| 775 | Ga0500643_013255 | 3300053087 | Bacteria | 2918 |
| 776 | Ga0500597_000138 | 3300053120 | Bacteria | 14745 |
| 777 | Ga0587083_0002271 | 3300059505 | Bacteria | 2362 |
| 778 | Ga0587106_005093 | 3300059605 | Bacteria | 1484 |
| 779 | 2643787622 | 2643221554 | Bacteria | 6603920 |
| 780 | 2643797947 | 2643221556 | Bacteria | 7251154 |
| 781 | 2644213495 | 2643221638 | Bacteria | 6579467 |
| 782 | 2644473126 | 2643221684 | Bacteria | 7145183 |
| 783 | 2809144412 | 2808606418 | Bacteria | 6724496 |
| 784 | 8047677943 | 8047673197 | Bacteria | 7395230 |
| 785 | Ga0316575_10004418 | |||
| 786 | JGI25152J39213_1017009 | |||
| 787 | JGI25159J45721_1011520 | |||
| 788 | JGI25159J45721_1017705 | |||
| 789 | JGI25153J46596_10016703 | |||
| 790 | JGI25160J50197_1001196 | |||
| 791 | JGI25161J50226_1008044 | |||
| 792 | JGI25161J50226_1008104 | |||
| 793 | Ga0007409J51694_1030117 | |||
| 794 | Ga0055525_1000009 | |||
| 795 | Ga0055526_1006308 | |||
| 796 | Ga0055524_1008902 | |||
| 797 | Ga0055528_1001071 | |||
| 798 | Ga0055530_10020167 | |||
| 799 | Ga0055543_1012566 | |||
| 800 | Ga0065165_1005080 | |||
| 801 | Ga0065165_1030708 | |||
| 802 | Ga0065165_1065443 | |||
| 803 | Ga0070658_10581000 | |||
| 804 | Ga0070690_100096753 | |||
| 805 | Ga0070660_100129005 | |||
| 806 | Ga0070660_100455364 | |||
| 807 | Ga0070659_100017739 | |||
| 808 | Ga0070667_100000012 | |||
| 809 | Ga0070663_100231623 | |||
| 810 | Ga0070662_100181434 | |||
| 811 | Ga0068855_100113722 | |||
| 812 | Ga0068855_100165633 | |||
| 813 | Ga0070664_100032141 | |||
| 814 | Ga0068852_100061672 | |||
| 815 | Ga0097621_100143978 | |||
| 816 | Ga0068871_100411846 | |||
| 817 | Ga0068865_100071882 | |||
| 818 | Ga0105240_10924312 | |||
| 819 | Ga0105243_10098754 | |||
| 820 | Ga0105241_10039397 | |||
| 821 | Ga0105242_10102219 | |||
| 822 | Ga0105242_10783172 | |||
| 823 | Ga0105237_10229421 | |||
| 824 | Ga0105239_10304910 | |||
| 825 | Ga0105246_10223272 | |||
| 826 | Ga0157371_10000001 | |||
| 827 | Ga0157371_10249628 | |||
| 828 | Ga0157372_10356019 | |||
| 829 | Ga0157372_10383363 | |||
| 830 | Ga0182008_10063856 | |||
| 831 | Ga0182006_1074199 | |||
| 832 | Ga0209436_100115 | |||
| 833 | Ga0209436_101923 | |||
| 834 | Ga0209563_100015 | |||
| 835 | Ga0207425_1000006 | |||
| 836 | Ga0207425_1000105 | |||
| 837 | Ga0209148_1000298 | |||
| 838 | Ga0209129_1000090 | |||
| 839 | Ga0209565_1000701 | |||
| 840 | Ga0209565_1009748 | |||
| 841 | Ga0209673_1003116 | |||
| 842 | Ga0209130_1001125 | |||
| 843 | Ga0209130_1017815 | |||
| 844 | Ga0209675_1000696 | |||
| 845 | Ga0209675_1017866 | |||
| 846 | Ga0209564_1000513 | |||
| 847 | Ga0209564_1003076 | |||
| 848 | Ga0209564_1010005 | |||
| 849 | Ga0209758_1000047 | |||
| 850 | Ga0209050_1000085 | |||
| 851 | Ga0209050_1000607 | |||
| 852 | Ga0209050_1001173 | |||
| 853 | Ga0209050_1001734 | |||
| 854 | Ga0209256_1000080 | |||
| 855 | Ga0209256_1000423 | |||
| 856 | Ga0209256_1021723 | |||
| 857 | Ga0207426_1000939 | |||
| 858 | Ga0209051_1011911 | |||
| 859 | Ga0209257_1000010 | |||
| 860 | Ga0207705_10016196 | |||
| 861 | Ga0207654_10001747 | |||
| 862 | Ga0207695_10607487 | |||
| 863 | Ga0207671_10164482 | |||
| 864 | Ga0207657_10085942 | |||
| 865 | Ga0207657_10106262 | |||
| 866 | Ga0207657_10398307 | |||
| 867 | Ga0207694_10090549 | |||
| 868 | Ga0207687_10122197 | |||
| 869 | Ga0207706_10275337 | |||
| 870 | Ga0207686_10017029 | |||
| 871 | Ga0207704_10085859 | |||
| 872 | Ga0207689_10076233 | |||
| 873 | Ga0207679_10094622 | |||
| 874 | Ga0207639_10543367 | |||
| 875 | Ga0207702_10274120 | |||
| 876 | Ga0207698_10040957 | |||
| 877 | Ga0207698_10169882 | |||
| 878 | Ga0316182_1315875 | |||
| 879 | Ga0307513_10586424 | |||
| 880 | Ga0307408_100000923 | |||
| 881 | Ga0307408_100000967 | |||
| 882 | Ga0265314_10157071 | |||
| 883 | Ga0307416_100326982 | |||
| 884 | Ga0395899_0000141 | |||
| 885 | Ga0395899_0073652 | |||
| 886 | Ga0395899_0119351 | |||
| 887 | Ga0395899_0213312 | |||
| 888 | Ga0395900_0000931 | |||
| 889 | Ga0395900_0001595 | |||
| 890 | Ga0395900_0041748 | |||
| 891 | Ga0395900_0058390 | |||
| 892 | Ga0395900_0160216 | |||
| 893 | Ga0395900_0326801 | |||
| 894 | Ga0395900_0334077 | |||
| 895 | Ga0395900_0562808 | |||
| 896 | Ga0395900_0617362 | |||
| 897 | Ga0395898_0108505 | |||
| 898 | Ga0395898_0174397 | |||
| 899 | Ga0395898_0350623 | |||
| 900 | Ga0395898_0352403 | |||
| 901 | Ga0395905_0022278 | |||
| 902 | Ga0395905_0050011 | |||
| 903 | Ga0395905_0269066 | |||
| 904 | Ga0395905_0742545 | |||
| 905 | Ga0395905_0777136 | |||
| 906 | Ga0395901_0031322 | |||
| 907 | Ga0395901_0056453 | |||
| 908 | Ga0395901_0235989 | |||
| 909 | Ga0395901_0524967 | |||
| 910 | Ga0395901_0867754 | |||
| 911 | Ga0439448_0000618 | |||
| 912 | Ga0439448_0019868 | |||
| 913 | Ga0439448_0022578 | |||
| 914 | Ga0439448_0027238 | |||
| 915 | Ga0439449_0016303 | |||
| 916 | Ga0439450_001788 | |||
| 917 | Ga0439450_004472 | |||
| 918 | Ga0439450_015568 | |||
| 919 | Ga0439455_0004613 | |||
| 920 | Ga0439455_0027460 | |||
| 921 | Ga0450897_012747 | |||
| 922 | Ga0450904_001280 | |||
| 923 | Ga0439458_0025328 | |||
| 924 | Ga0439458_0033940 | |||
| 925 | Ga0439458_0044640 | |||
| 926 | Ga0466969_0069802 | |||
| 927 | Ga0466969_0182509 | |||
| 928 | Ga0466972_0002165 | |||
| 929 | Ga0466972_0151200 | |||
| 930 | Ga0466965_0002517 | |||
| 931 | Ga0466965_0031809 | |||
| 932 | Ga0466965_0038242 | |||
| 933 | Ga0466966_0028615 | |||
| 934 | Ga0466966_0049635 | |||
| 935 | Ga0466966_0056424 | |||
| 936 | Ga0466966_0060100 | |||
| 937 | Ga0466961_0063166 | |||
| 938 | Ga0466963_0441823 | |||
| 939 | Ga0466964_0020947 | |||
| 940 | Ga0466964_0023461 | |||
| 941 | Ga0466964_0032348 | |||
| 942 | Ga0466971_0118610 | |||
| 943 | Ga0466971_0144912 | |||
| 944 | Ga0466968_0014325 | |||
| 945 | Ga0466968_0050562 | |||
| 946 | Ga0466970_0136669 | |||
| 947 | Ga0466957_0000115 | |||
| 948 | Ga0466957_0031414 | |||
| 949 | Ga0466957_0085085 | |||
| 950 | Ga0466957_0114782 | |||
| 951 | Ga0466960_0204464 | |||
| 952 | Ga0466959_0005620 | |||
| 953 | Ga0466958_0068494 | |||
| 954 | Ga0466958_0107439 | |||
| 955 | Ga0466958_0136340 | |||
| 956 | Ga0466967_0010104 | |||
| 957 | Ga0466967_0103801 | |||
| 958 | Ga0495617_000002 | |||
| 959 | Ga0495617_000503 | |||
| 960 | Ga0495627_001506 | |||
| 961 | Ga0495627_004155 | |||
| 962 | Ga0495627_005062 | |||
| 963 | Ga0495627_017741 | |||
| 964 | Ga0495603_0055000 | |||
| 965 | Ga0495603_0075579 | |||
| 966 | Ga0495603_0077126 | |||
| 967 | Ga0495590_0000007 | |||
| 968 | Ga0495590_0000136 | |||
| 969 | Ga0495591_000062 | |||
| 970 | Ga0495591_009009 | |||
| 971 | Ga0495591_054244 | |||
| 972 | Ga0495629_0045794 | |||
| 973 | Ga0495629_0137652 | |||
| 974 | Ga0495629_0139322 | |||
| 975 | Ga0495629_0170463 | |||
| 976 | Ga0495638_0005843 | |||
| 977 | Ga0495638_0015067 | |||
| 978 | Ga0495638_0062179 | |||
| 979 | Ga0495638_0226864 | |||
| 980 | Ga0495653_0013275 | |||
| 981 | Ga0495653_0038671 | |||
| 982 | Ga0495653_0053706 | |||
| 983 | Ga0495650_0000015 | |||
| 984 | Ga0495650_0003039 | |||
| 985 | Ga0495650_0004274 | |||
| 986 | Ga0495650_0071793 | |||
| 987 | Ga0495580_0037665 | |||
| 988 | Ga0495582_0003653 | |||
| 989 | Ga0495582_0017446 | |||
| 990 | Ga0495582_0053789 | |||
| 991 | Ga0495605_0000063 | |||
| 992 | Ga0495605_0001463 | |||
| 993 | Ga0495605_0004805 | |||
| 994 | Ga0495605_0009267 | |||
| 995 | Ga0495605_0009791 | |||
| 996 | Ga0495605_0019410 | |||
| 997 | Ga0495605_0027346 | |||
| 998 | Ga0495605_0033087 | |||
| 999 | Ga0495605_0057925 | |||
| 1000 | Ga0495605_0080682 | |||
| 1001 | Ga0495605_0088203 | |||
| 1002 | Ga0495639_0130860 | |||
| 1003 | Ga0495584_0000010 | |||
| 1004 | Ga0495584_0001432 | |||
| 1005 | Ga0495584_0001842 | |||
| 1006 | Ga0495584_0003242 | |||
| 1007 | Ga0495584_0003373 | |||
| 1008 | Ga0495584_0007972 | |||
| 1009 | Ga0495584_0017789 | |||
| 1010 | Ga0495584_0024692 | |||
| 1011 | Ga0495584_0041712 | |||
| 1012 | Ga0495584_0097060 | |||
| 1013 | Ga0495584_0104550 | |||
| 1014 | Ga0495584_0138080 | |||
| 1015 | Ga0495584_0141090 | |||
| 1016 | Ga0495584_0148095 | |||
| 1017 | Ga0495584_0188015 | |||
| 1018 | Ga0495584_0198743 | |||
| 1019 | Ga0495585_0000004 | |||
| 1020 | Ga0495585_0000006 | |||
| 1021 | Ga0495585_0002703 | |||
| 1022 | Ga0495585_0002955 | |||
| 1023 | Ga0495585_0003583 | |||
| 1024 | Ga0495585_0005077 | |||
| 1025 | Ga0495585_0013671 | |||
| 1026 | Ga0495585_0017931 | |||
| 1027 | Ga0495585_0023393 | |||
| 1028 | Ga0495585_0023995 | |||
| 1029 | Ga0495585_0024714 | |||
| 1030 | Ga0495585_0025881 | |||
| 1031 | Ga0495585_0032808 | |||
| 1032 | Ga0495585_0036963 | |||
| 1033 | Ga0495585_0049421 | |||
| 1034 | Ga0495585_0060250 | |||
| 1035 | Ga0495585_0072883 | |||
| 1036 | Ga0495585_0129020 | |||
| 1037 | Ga0495585_0148923 | |||
| 1038 | Ga0495585_0224484 | |||
| 1039 | Ga0495585_0269933 | |||
| 1040 | Ga0495594_0007141 | |||
| 1041 | Ga0495594_0010522 | |||
| 1042 | Ga0495594_0029798 | |||
| 1043 | Ga0495594_0038423 | |||
| 1044 | Ga0495594_0096569 | |||
| 1045 | Ga0495596_0000217 | |||
| 1046 | Ga0495596_0000720 | |||
| 1047 | Ga0495596_0005367 | |||
| 1048 | Ga0495596_0005533 | |||
| 1049 | Ga0495596_0006913 | |||
| 1050 | Ga0495596_0007419 | |||
| 1051 | Ga0495596_0009980 | |||
| 1052 | Ga0495596_0015057 | |||
| 1053 | Ga0495596_0026768 | |||
| 1054 | Ga0495596_0029712 | |||
| 1055 | Ga0495596_0041659 | |||
| 1056 | Ga0495596_0046388 | |||
| 1057 | Ga0495596_0064465 | |||
| 1058 | Ga0495596_0074026 | |||
| 1059 | Ga0495596_0113436 | |||
| 1060 | Ga0495607_0001518 | |||
| 1061 | Ga0495607_0002839 | |||
| 1062 | Ga0495607_0006211 | |||
| 1063 | Ga0495607_0006855 | |||
| 1064 | Ga0495607_0011149 | |||
| 1065 | Ga0495607_0015837 | |||
| 1066 | Ga0495607_0045841 | |||
| 1067 | Ga0495607_0056736 | |||
| 1068 | Ga0495607_0059368 | |||
| 1069 | Ga0495607_0076367 | |||
| 1070 | Ga0495607_0136073 | |||
| 1071 | Ga0495607_0210026 | |||
| 1072 | Ga0495607_0212420 | |||
| 1073 | Ga0495607_0246409 | |||
| 1074 | Ga0495583_0000084 | |||
| 1075 | Ga0495583_0001063 | |||
| 1076 | Ga0495583_0001851 | |||
| 1077 | Ga0495583_0002627 | |||
| 1078 | Ga0495583_0003369 | |||
| 1079 | Ga0495583_0003430 | |||
| 1080 | Ga0495583_0010756 | |||
| 1081 | Ga0495583_0023418 | |||
| 1082 | Ga0495583_0037272 | |||
| 1083 | Ga0495583_0045404 | |||
| 1084 | Ga0495583_0081445 | |||
| 1085 | Ga0495583_0109101 | |||
| 1086 | Ga0495583_0109725 | |||
| 1087 | Ga0495583_0153831 | |||
| 1088 | Ga0495606_0020128 | |||
| 1089 | Ga0495606_0022863 | |||
| 1090 | Ga0495606_0038230 | |||
| 1091 | Ga0495606_0116723 | |||
| 1092 | Ga0495606_0123910 | |||
| 1093 | Ga0495610_0001723 | |||
| 1094 | Ga0495616_0000081 | |||
| 1095 | Ga0495616_0000396 | |||
| 1096 | Ga0495616_0004088 | |||
| 1097 | Ga0495616_0010211 | |||
| 1098 | Ga0495616_0011083 | |||
| 1099 | Ga0495616_0027090 | |||
| 1100 | Ga0495616_0032757 | |||
| 1101 | Ga0495616_0041446 | |||
| 1102 | Ga0495616_0052478 | |||
| 1103 | Ga0495616_0052785 | |||
| 1104 | Ga0495616_0066570 | |||
| 1105 | Ga0495616_0071488 | |||
| 1106 | Ga0495616_0139568 | |||
| 1107 | Ga0495620_0008818 | |||
| 1108 | Ga0495630_0044204 | |||
| 1109 | Ga0495631_0000208 | |||
| 1110 | Ga0495631_0002880 | |||
| 1111 | Ga0495631_0010249 | |||
| 1112 | Ga0495631_0019364 | |||
| 1113 | Ga0495631_0020558 | |||
| 1114 | Ga0495631_0038500 | |||
| 1115 | Ga0495631_0041231 | |||
| 1116 | Ga0495631_0050890 | |||
| 1117 | Ga0495631_0051052 | |||
| 1118 | Ga0495631_0057448 | |||
| 1119 | Ga0495631_0099831 | |||
| 1120 | Ga0495631_0170387 | |||
| 1121 | Ga0495631_0187192 | |||
| 1122 | Ga0495631_0214282 | |||
| 1123 | Ga0495632_0000071 | |||
| 1124 | Ga0495632_0001714 | |||
| 1125 | Ga0495632_0003038 | |||
| 1126 | Ga0495632_0006355 | |||
| 1127 | Ga0495632_0006805 | |||
| 1128 | Ga0495632_0009584 | |||
| 1129 | Ga0495632_0039684 | |||
| 1130 | Ga0495632_0052462 | |||
| 1131 | Ga0495632_0053365 | |||
| 1132 | Ga0495632_0074398 | |||
| 1133 | Ga0495637_0000335 | |||
| 1134 | Ga0495637_0012354 | |||
| 1135 | Ga0495637_0056004 | |||
| 1136 | Ga0495643_0000196 | |||
| 1137 | Ga0495643_0000756 | |||
| 1138 | Ga0495643_0008541 | |||
| 1139 | Ga0495643_0009301 | |||
| 1140 | Ga0495643_0022616 | |||
| 1141 | Ga0495643_0047560 | |||
| 1142 | Ga0495643_0048822 | |||
| 1143 | Ga0495643_0061200 | |||
| 1144 | Ga0495643_0085892 | |||
| 1145 | Ga0495643_0121475 | |||
| 1146 | Ga0495643_0146137 | |||
| 1147 | Ga0495643_0325726 | |||
| 1148 | Ga0495644_0002322 | |||
| 1149 | Ga0495644_0004209 | |||
| 1150 | Ga0495644_0008001 | |||
| 1151 | Ga0495644_0010531 | |||
| 1152 | Ga0495644_0012701 | |||
| 1153 | Ga0495644_0027406 | |||
| 1154 | Ga0495644_0033282 | |||
| 1155 | Ga0495644_0040490 | |||
| 1156 | Ga0495648_0000007 | |||
| 1157 | Ga0495648_0005051 | |||
| 1158 | Ga0495648_0019005 | |||
| 1159 | Ga0495648_0020402 | |||
| 1160 | Ga0495648_0020616 | |||
| 1161 | Ga0495648_0047464 | |||
| 1162 | Ga0495648_0048191 | |||
| 1163 | Ga0495648_0055100 | |||
| 1164 | Ga0495648_0056925 | |||
| 1165 | Ga0495648_0061676 | |||
| 1166 | Ga0495648_0066627 | |||
| 1167 | Ga0495648_0091471 | |||
| 1168 | Ga0495663_0003406 | |||
| 1169 | Ga0495663_0008216 | |||
| 1170 | Ga0495666_0003041 | |||
| 1171 | Ga0495666_0006057 | |||
| 1172 | Ga0495666_0033003 | |||
| 1173 | Ga0495666_0072367 | |||
| 1174 | Ga0495666_0234483 | |||
| 1175 | Ga0495642_0000887 | |||
| 1176 | Ga0495642_0000985 | |||
| 1177 | Ga0495642_0003070 | |||
| 1178 | Ga0495642_0004220 | |||
| 1179 | Ga0495642_0007753 | |||
| 1180 | Ga0495642_0011156 | |||
| 1181 | Ga0495642_0011964 | |||
| 1182 | Ga0495642_0015193 | |||
| 1183 | Ga0495642_0030633 | |||
| 1184 | Ga0495642_0041121 | |||
| 1185 | Ga0495642_0043171 | |||
| 1186 | Ga0495642_0053603 | |||
| 1187 | Ga0495642_0056949 | |||
| 1188 | Ga0495642_0064290 | |||
| 1189 | Ga0495642_0095128 | |||
| 1190 | Ga0495642_0162892 | |||
| 1191 | Ga0495642_0176382 | |||
| 1192 | Ga0495652_0005305 | |||
| 1193 | Ga0495654_0019568 | |||
| 1194 | Ga0495654_0032298 | |||
| 1195 | Ga0495654_0047779 | |||
| 1196 | Ga0495654_0082322 | |||
| 1197 | Ga0495654_0117053 | |||
| 1198 | Ga0495665_0011062 | |||
| 1199 | Ga0495665_0017174 | |||
| 1200 | Ga0495665_0179950 | |||
| 1201 | Ga0495640_0017464 | |||
| 1202 | Ga0495640_0106295 | |||
| 1203 | Ga0495586_0030628 | |||
| 1204 | Ga0495586_0032205 | |||
| 1205 | Ga0495586_0561180 | |||
| 1206 | Ga0495587_0075548 | |||
| 1207 | Ga0495609_0000002 | |||
| 1208 | Ga0495609_0000639 | |||
| 1209 | Ga0495609_0001669 | |||
| 1210 | Ga0495609_0006038 | |||
| 1211 | Ga0495609_0006189 | |||
| 1212 | Ga0495609_0014288 | |||
| 1213 | Ga0495609_0024847 | |||
| 1214 | Ga0495609_0029952 | |||
| 1215 | Ga0495609_0031536 | |||
| 1216 | Ga0495609_0039743 | |||
| 1217 | Ga0495609_0042134 | |||
| 1218 | Ga0495609_0043417 | |||
| 1219 | Ga0495609_0052974 | |||
| 1220 | Ga0495609_0098264 | |||
| 1221 | Ga0495609_0108770 | |||
| 1222 | Ga0495609_0108804 | |||
| 1223 | Ga0495621_0208854 | |||
| 1224 | Ga0495597_0000063 | |||
| 1225 | Ga0495597_0001454 | |||
| 1226 | Ga0495597_0001769 | |||
| 1227 | Ga0495597_0002996 | |||
| 1228 | Ga0495597_0005005 | |||
| 1229 | Ga0495597_0012512 | |||
| 1230 | Ga0495597_0014834 | |||
| 1231 | Ga0495597_0022533 | |||
| 1232 | Ga0495597_0030344 | |||
| 1233 | Ga0495597_0050225 | |||
| 1234 | Ga0495597_0102005 | |||
| 1235 | Ga0495597_0124936 | |||
| 1236 | Ga0495597_0138548 | |||
| 1237 | Ga0495645_0056107 | |||
| 1238 | Ga0495622_0028060 | |||
| 1239 | Ga0495622_0042865 | |||
| 1240 | Ga0495622_0046007 | |||
| 1241 | Ga0495622_0104768 | |||
| 1242 | Ga0495633_0009799 | |||
| 1243 | Ga0495633_0011494 | |||
| 1244 | Ga0495633_0036397 | |||
| 1245 | Ga0495633_0046931 | |||
| 1246 | Ga0495633_0048132 | |||
| 1247 | Ga0495633_0056960 | |||
| 1248 | Ga0495633_0072994 | |||
| 1249 | Ga0495633_0110326 | |||
| 1250 | Ga0495633_0206030 | |||
| 1251 | Ga0495656_0000811 | |||
| 1252 | Ga0495656_0053744 | |||
| 1253 | Ga0495656_0060101 | |||
| 1254 | Ga0495656_0107139 | |||
| 1255 | Ga0495656_0120595 | |||
| 1256 | Ga0495656_0128328 | |||
| 1257 | Ga0495668_0000158 | |||
| 1258 | Ga0495668_0002726 | |||
| 1259 | Ga0495668_0002953 | |||
| 1260 | Ga0495668_0003351 | |||
| 1261 | Ga0495668_0011571 | |||
| 1262 | Ga0495668_0025427 | |||
| 1263 | Ga0495668_0026093 | |||
| 1264 | Ga0495668_0035973 | |||
| 1265 | Ga0495668_0059905 | |||
| 1266 | Ga0495668_0082440 | |||
| 1267 | Ga0495668_0095784 | |||
| 1268 | Ga0495668_0188505 | |||
| 1269 | Ga0495668_0256880 | |||
| 1270 | Ga0495668_0327333 | |||
| 1271 | Ga0495634_0055235 | |||
| 1272 | Ga0495611_0000658 | |||
| 1273 | Ga0495611_0001035 | |||
| 1274 | Ga0495611_0005119 | |||
| 1275 | Ga0495611_0018385 | |||
| 1276 | Ga0495611_0026598 | |||
| 1277 | Ga0495611_0027627 | |||
| 1278 | Ga0495611_0046324 | |||
| 1279 | Ga0495611_0055046 | |||
| 1280 | Ga0495611_0060171 | |||
| 1281 | Ga0495611_0105496 | |||
| 1282 | Ga0495611_0115389 | |||
| 1283 | Ga0495611_0275865 | |||
| 1284 | Ga0495625_0014579 | |||
| 1285 | Ga0495625_0043078 | |||
| 1286 | Ga0495625_0076469 | |||
| 1287 | Ga0495625_0079550 | |||
| 1288 | Ga0495625_0129194 | |||
| 1289 | Ga0495625_0150318 | |||
| 1290 | Ga0495625_0187639 | |||
| 1291 | Ga0495635_0070742 | |||
| 1292 | Ga0495659_0004753 | |||
| 1293 | Ga0495661_0000204 | |||
| 1294 | Ga0495661_0000742 | |||
| 1295 | Ga0495661_0002628 | |||
| 1296 | Ga0495661_0003424 | |||
| 1297 | Ga0495661_0010529 | |||
| 1298 | Ga0495661_0012729 | |||
| 1299 | Ga0495661_0014610 | |||
| 1300 | Ga0495661_0017638 | |||
| 1301 | Ga0495661_0024591 | |||
| 1302 | Ga0495661_0029188 | |||
| 1303 | Ga0495661_0030620 | |||
| 1304 | Ga0495661_0040677 | |||
| 1305 | Ga0495661_0042946 | |||
| 1306 | Ga0495661_0049134 | |||
| 1307 | Ga0495661_0071899 | |||
| 1308 | Ga0495661_0072124 | |||
| 1309 | Ga0495661_0074863 | |||
| 1310 | Ga0495661_0075799 | |||
| 1311 | Ga0495661_0081727 | |||
| 1312 | Ga0495661_0127774 | |||
| 1313 | Ga0495661_0162361 | |||
| 1314 | Ga0495661_0174962 | |||
| 1315 | Ga0495661_0244428 | |||
| 1316 | Ga0495588_0000208 | |||
| 1317 | Ga0495588_0008870 | |||
| 1318 | Ga0495588_0011201 | |||
| 1319 | Ga0495588_0024716 | |||
| 1320 | Ga0495588_0036455 | |||
| 1321 | Ga0495588_0065622 | |||
| 1322 | Ga0495588_0095775 | |||
| 1323 | Ga0495588_0117514 | |||
| 1324 | Ga0495588_0129041 | |||
| 1325 | Ga0495588_0206511 | |||
| 1326 | Ga0495588_0212897 | |||
| 1327 | Ga0495623_0008692 | |||
| 1328 | Ga0495623_0135463 | |||
| 1329 | Ga0495646_0220121 | |||
| 1330 | Ga0495669_0000036 | |||
| 1331 | Ga0495669_0004461 | |||
| 1332 | Ga0495669_0018382 | |||
| 1333 | Ga0495669_0029252 | |||
| 1334 | Ga0495669_0033456 | |||
| 1335 | Ga0495669_0133959 | |||
| 1336 | Ga0495669_0206270 | |||
| 1337 | Ga0495613_0135202 | |||
| 1338 | Ga0495670_0002278 | |||
| 1339 | Ga0495670_0004961 | |||
| 1340 | Ga0495670_0005968 | |||
| 1341 | Ga0495670_0007920 | |||
| 1342 | Ga0495670_0009203 | |||
| 1343 | Ga0495670_0009685 | |||
| 1344 | Ga0495670_0015019 | |||
| 1345 | Ga0495670_0040605 | |||
| 1346 | Ga0495670_0067207 | |||
| 1347 | Ga0495670_0086141 | |||
| 1348 | Ga0495670_0114144 | |||
| 1349 | Ga0495670_0195564 | |||
| 1350 | Ga0495670_0337256 | |||
| 1351 | Ga0495671_0002020 | |||
| 1352 | Ga0495671_0012088 | |||
| 1353 | Ga0495671_0053931 | |||
| 1354 | Ga0495671_0078818 | |||
| 1355 | Ga0495671_0100712 | |||
| 1356 | Ga0495671_0221589 | |||
| 1357 | Ga0495649_0001404 | |||
| 1358 | Ga0495649_0016032 | |||
| 1359 | Ga0495649_0031186 | |||
| 1360 | Ga0495649_0036164 | |||
| 1361 | Ga0495649_0052177 | |||
| 1362 | Ga0495649_0072623 | |||
| 1363 | Ga0495649_0194693 | |||
| 1364 | Ga0495649_0306871 | |||
| 1365 | Ga0495589_0000275 | |||
| 1366 | Ga0495589_0000491 | |||
| 1367 | Ga0495589_0005559 | |||
| 1368 | Ga0495589_0006649 | |||
| 1369 | Ga0495589_0007968 | |||
| 1370 | Ga0495589_0008429 | |||
| 1371 | Ga0495589_0023954 | |||
| 1372 | Ga0495589_0048182 | |||
| 1373 | Ga0495589_0058095 | |||
| 1374 | Ga0495589_0061236 | |||
| 1375 | Ga0495589_0070279 | |||
| 1376 | Ga0495589_0102080 | |||
| 1377 | Ga0495660_0000322 | |||
| 1378 | Ga0495660_0007438 | |||
| 1379 | Ga0495660_0009527 | |||
| 1380 | Ga0495660_0013960 | |||
| 1381 | Ga0495660_0018521 | |||
| 1382 | Ga0495660_0056287 | |||
| 1383 | Ga0495581_0039005 | |||
| 1384 | Ga0495604_0027320 | |||
| 1385 | Ga0495604_0077469 | |||
| 1386 | Ga0495604_0108343 | |||
| 1387 | Ga0495636_0012469 | |||
| 1388 | Ga0495636_0016936 | |||
| 1389 | Ga0495636_0040330 | |||
| 1390 | Ga0495636_0112046 | |||
| 1391 | Ga0495636_0128242 | |||
| 1392 | Ga0495636_0138986 | |||
| 1393 | Ga0495674_0067631 | |||
| 1394 | Ga0495672_0000041 | |||
| 1395 | Ga0495672_0001268 | |||
| 1396 | Ga0495672_0001324 | |||
| 1397 | Ga0495672_0003105 | |||
| 1398 | Ga0495672_0050114 | |||
| 1399 | Ga0495672_0065404 | |||
| 1400 | Ga0495672_0166406 | |||
| 1401 | Ga0495676_0000014 | |||
| 1402 | Ga0495676_0030259 | |||
| 1403 | Ga0495676_0056542 | |||
| 1404 | Ga0495676_0084149 | |||
| 1405 | Ga0495676_0381644 | |||
| 1406 | Ga0495680_0038704 | |||
| 1407 | Ga0495680_0039002 | |||
| 1408 | Ga0495683_0000180 | |||
| 1409 | Ga0495683_0001405 | |||
| 1410 | Ga0495683_0002116 | |||
| 1411 | Ga0495683_0018151 | |||
| 1412 | Ga0495683_0028122 | |||
| 1413 | Ga0495683_0029322 | |||
| 1414 | Ga0495683_0039680 | |||
| 1415 | Ga0495683_0068303 | |||
| 1416 | Ga0495683_0073195 | |||
| 1417 | Ga0495683_0122651 | |||
| 1418 | Ga0495683_0174608 | |||
| 1419 | Ga0495683_0297976 | |||
| 1420 | Ga0495687_000049 | |||
| 1421 | Ga0495687_000088 | |||
| 1422 | Ga0495687_000605 | |||
| 1423 | Ga0495687_001034 | |||
| 1424 | Ga0495687_008194 | |||
| 1425 | Ga0495687_070576 | |||
| 1426 | Ga0495675_0004311 | |||
| 1427 | Ga0495675_0006020 | |||
| 1428 | Ga0495677_0000103 | |||
| 1429 | Ga0495677_0000916 | |||
| 1430 | Ga0495677_0001365 | |||
| 1431 | Ga0495677_0003071 | |||
| 1432 | Ga0495677_0003608 | |||
| 1433 | Ga0495677_0006807 | |||
| 1434 | Ga0495677_0007272 | |||
| 1435 | Ga0495677_0019463 | |||
| 1436 | Ga0495677_0031018 | |||
| 1437 | Ga0495677_0031976 | |||
| 1438 | Ga0495677_0038020 | |||
| 1439 | Ga0495677_0057772 | |||
| 1440 | Ga0495677_0091154 | |||
| 1441 | Ga0495677_0128986 | |||
| 1442 | Ga0495679_006905 | |||
| 1443 | Ga0495679_036002 | |||
| 1444 | Ga0495685_004530 | |||
| 1445 | Ga0495685_006113 | |||
| 1446 | Ga0495685_018887 | |||
| 1447 | Ga0495685_024819 | |||
| 1448 | Ga0495685_030489 | |||
| 1449 | Ga0495685_046122 | |||
| 1450 | Ga0495685_219206 | |||
| 1451 | Ga0495673_0025881 | |||
| 1452 | Ga0495681_0000120 | |||
| 1453 | Ga0495681_0001681 | |||
| 1454 | Ga0495681_0004617 | |||
| 1455 | Ga0495681_0018681 | |||
| 1456 | Ga0495681_0022912 | |||
| 1457 | Ga0495681_0045314 | |||
| 1458 | Ga0495681_0046780 | |||
| 1459 | Ga0495681_0055690 | |||
| 1460 | Ga0495681_0109868 | |||
| 1461 | Ga0495681_0134816 | |||
| 1462 | Ga0495686_0000400 | |||
| 1463 | Ga0495686_0001135 | |||
| 1464 | Ga0495686_0058923 | |||
| 1465 | Ga0495686_0077535 | |||
| 1466 | Ga0495686_0151029 | |||
| 1467 | Ga0495686_0187949 | |||
| 1468 | Ga0495593_0002003 | |||
| 1469 | Ga0495593_0038031 | |||
| 1470 | Ga0495614_0015720 | |||
| 1471 | Ga0495614_0041834 | |||
| 1472 | Ga0495614_0339264 | |||
| 1473 | Ga0495615_0004342 | |||
| 1474 | Ga0495626_0000111 | |||
| 1475 | Ga0495626_0000447 | |||
| 1476 | Ga0495626_0000466 | |||
| 1477 | Ga0495626_0004056 | |||
| 1478 | Ga0495626_0011509 | |||
| 1479 | Ga0495626_0013629 | |||
| 1480 | Ga0495626_0014030 | |||
| 1481 | Ga0495626_0016979 | |||
| 1482 | Ga0495626_0024283 | |||
| 1483 | Ga0495626_0027868 | |||
| 1484 | Ga0495626_0043081 | |||
| 1485 | Ga0495626_0046877 | |||
| 1486 | Ga0495626_0050926 | |||
| 1487 | Ga0495626_0107274 | |||
| 1488 | Ga0495626_0132452 | |||
| 1489 | Ga0495626_0138775 | |||
| 1490 | Ga0495626_0143013 | |||
| 1491 | Ga0495626_0158741 | |||
| 1492 | Ga0496100_0335507 | |||
| 1493 | Ga0496101_0003310 | |||
| 1494 | Ga0496101_0249859 | |||
| 1495 | Ga0496101_0409653 | |||
| 1496 | Ga0496102_0000695 | |||
| 1497 | Ga0496102_0002110 | |||
| 1498 | Ga0496102_0056926 | |||
| 1499 | Ga0496102_0133535 | |||
| 1500 | Ga0496102_0252024 | |||
| 1501 | Ga0496102_0561120 | |||
| 1502 | Ga0496102_1204142 | |||
| 1503 | Ga0496103_0015065 | |||
| 1504 | Ga0496103_0032804 | |||
| 1505 | Ga0496103_0146652 | |||
| 1506 | Ga0496104_0267682 | |||
| 1507 | Ga0496104_0467159 | |||
| 1508 | Ga0496104_0541266 | |||
| 1509 | Ga0496104_0576101 | |||
| 1510 | Ga0496105_0141122 | |||
| 1511 | Ga0496105_0251735 | |||
| 1512 | Ga0496108_0091911 | |||
| 1513 | Ga0496109_0027815 | |||
| 1514 | Ga0496109_0162515 | |||
| 1515 | Ga0496110_0000115 | |||
| 1516 | Ga0496110_0005697 | |||
| 1517 | Ga0496110_0131576 | |||
| 1518 | Ga0496110_0803317 | |||
| 1519 | Ga0496111_0067867 | |||
| 1520 | Ga0496111_0326231 | |||
| 1521 | Ga0496112_0081152 | |||
| 1522 | Ga0496113_0004780 | |||
| 1523 | Ga0496113_0163382 | |||
| 1524 | Ga0496113_0360005 | |||
| 1525 | Ga0496115_0322572 | |||
| 1526 | Ga0496115_0675142 | |||
| 1527 | Ga0496122_0000169 | |||
| 1528 | Ga0496122_0014060 | |||
| 1529 | Ga0496122_0097564 | |||
| 1530 | Ga0496123_0001570 | |||
| 1531 | Ga0496123_0015729 | |||
| 1532 | Ga0496124_0003298 | |||
| 1533 | Ga0496124_0060383 | |||
| 1534 | Ga0496124_0069684 | |||
| 1535 | Ga0496124_0212600 | |||
| 1536 | Ga0496125_0005514 | |||
| 1537 | Ga0496126_0940204 | |||
| 1538 | Ga0501310_000577 | |||
| 1539 | Ga0501307_015555 | |||
| 1540 | Ga0495678_000056 | |||
| 1541 | Ga0495678_001377 | |||
| 1542 | Ga0495678_001405 | |||
| 1543 | Ga0495678_001922 | |||
| 1544 | Ga0495678_014321 | |||
| 1545 | Ga0495678_037397 | |||
| 1546 | Ga0495678_051711 | |||
| 1547 | Ga0495678_079257 | |||
| 1548 | Ga0495682_0010406 | |||
| 1549 | Ga0495682_0014606 | |||
| 1550 | Ga0495682_0024323 | |||
| 1551 | Ga0495682_0025167 | |||
| 1552 | Ga0495682_0031479 | |||
| 1553 | Ga0495682_0056898 | |||
| 1554 | Ga0501036_0267944 | |||
| 1555 | Ga0501036_0812359 | |||
| 1556 | Ga0501257_098558 | |||
| 1557 | Ga0501263_008403 | |||
| 1558 | Ga0501279_007981 | |||
| 1559 | Ga0500643_013255 | |||
| 1560 | Ga0500597_000138 | |||
| 1561 | Ga0587083_0002271 | |||
| 1562 | Ga0587106_005093 | |||
| 1563 | 2643787622 | |||
| 1564 | 2643797947 | |||
| 1565 | 2644213495 | |||
| 1566 | 2644473126 | |||
| 1567 | 2809144412 | |||
| 1568 | 8047677943 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4p0e-assembly1.cif.gz_A | yhde e33a (p212121 space group) | 0.9224 | 8 | 202 |
| 1exc-assembly1.cif.gz_A | crystal structure of b. subtilis maf protein complexed with d-(utp) | 0.9211 | 5 | 200 |
| 4heb-assembly1.cif.gz_A | the crystal structure of maf protein of bacillus subtilis | 0.9167 | 6 | 200 |
| 4heb-assembly1.cif.gz_A | the crystal structure of maf protein of bacillus subtilis | 0.9071 | 6 | 200 |
| 1exc-assembly1.cif.gz_A | crystal structure of b. subtilis maf protein complexed with d-(utp) | 0.907 | 5 | 200 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4p0uA00 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9417 | 8 | 202 | 3.90.950.10 |
| 4p0uA00 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9223 | 8 | 202 | 3.90.950.10 |
| 4hebA00 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9167 | 6 | 200 | 3.90.950.10 |
| 4hebA00 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9071 | 6 | 200 | 3.90.950.10 |
| af_Q18851_2_193_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9065 | 5 | 199 | 3.90.950.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A447RSM5-F1-model_v4 | Septum formation protein Maf | 0.9773 | 83 | 154 |
GO:0009117
GO:0047429 |
| AF-A0A3D2N2J4-F1-model_v4 | Septum formation inhibitor Maf | 0.9657 | 42 | 146 |
GO:0009117
GO:0047429 |
| AF-A0A1Y0G4R3-F1-model_v4 | dTTP/UTP pyrophosphatase (dTTPase/UTPase) (EC 3.6.1.9) (Nucleoside triphosphate pyrophosphatase) (Nucleotide pyrophosphatase) (Nucleotide PPase) | 0.957 | 8 | 205 |
GO:0005737
GO:0009117 GO:0036218 GO:0036221 GO:0106379 |
| AF-A0A6I3JYR9-F1-model_v4 | deleted | 0.9565 | 6 | 201 |
|
| AF-A0A2G8TEI1-F1-model_v4 | dTTP/UTP pyrophosphatase (dTTPase/UTPase) (EC 3.6.1.9) (Nucleoside triphosphate pyrophosphatase) (Nucleotide pyrophosphatase) (Nucleotide PPase) | 0.9558 | 1 | 206 |
GO:0005737
GO:0009117 GO:0036218 GO:0036221 GO:0106379 |