F480730
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 785 | 378 | 1568 | 224 |
Family's Representative Sequence
| Representative Sequence | 3300005616|Ga0068852_100341818|Ga0068852_1003418182 |
| Length | 259 |
| Sequence | MKTVACNTGNGPARQLEKLSGSARLSQKELAGRRSLKLLLTSAGIKNASIHQALVDLLGKPIADCSAMCIPTAGYGHPYAGPIRAWRFISGQEPECPMTELGWRSVGVLELTALTSIDKKRWVSWVRDADVLLVNGGDAMYLCHWMRQSGLAELLPSLERTVWVGLSGGSMVMTPRIGEDFVAWEPRLANDDRTLGIVDFSIFPHVDNPGLPSNTMAAAEKWAASLGGPAYAIDDQTAIKVEDGKVEVVSEGHWRFFAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 13 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 17 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 198 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 200 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 201 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 202 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 203 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 204 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 205 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 208 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 209 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 210 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 212 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 214 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 215 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 221 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 222 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 224 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 225 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 226 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 227 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 228 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 229 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 230 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 232 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 233 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 234 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 235 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 236 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 237 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 238 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 239 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 240 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 241 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 242 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 243 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 244 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 245 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 246 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 247 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 248 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 249 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 250 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 251 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 252 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 253 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 292 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 293 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 294 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 295 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 296 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 297 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 300 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 301 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 302 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 303 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 304 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 305 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 306 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 307 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 308 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 309 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 310 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 329 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 340 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 342 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 343 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 345 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 346 | 2512564039 | Paenibacillus mucilaginosus 3016 | Isolate | Rhizosphere |
| 347 | 2593339131 | Bacillus sp. UNCCL81 | Isolate | Unclassified |
| 348 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 349 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 350 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 351 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 352 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 353 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 354 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 355 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 356 | 2775507177 | Bacillus sp. AFS055030 | Isolate | Unclassified |
| 357 | 2775507192 | Bacillus sp. AFS041924 | Isolate | Unclassified |
| 358 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 359 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 360 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 361 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 362 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 363 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 364 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 365 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 366 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 367 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 368 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 369 | 2936340661 | Gottfriedia acidiceleris 1-17 | Isolate | Rhizosphere |
| 370 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 371 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 372 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 373 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 374 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 375 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 376 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 377 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 378 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.54 |
| Metatranscriptomes | 0.25 |
| Isolates | 4.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.18 |
| Nodule | 0 |
| Rhizoplane | 13.38 |
| Rhizosphere | 77.07 |
| Stem | 0 |
| Stem Tuber | 0.13 |
| Unclassified | 0.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068852_100341818 | 3300005616 | Bacteria | 1459 |
| 2 | JGI24740J21852_10078230 | 3300001979 | Bacteria | 871 |
| 3 | JGI24739J22299_10128270 | 3300001989 | Bacteria | 755 |
| 4 | JGI24737J22298_10017764 | 3300001990 | Bacteria | 2289 |
| 5 | JGI24735J21928_10000224 | 3300002067 | Bacteria | 19852 |
| 6 | JGI25162J39368_1010465 | 3300002737 | Bacteria | 1171 |
| 7 | JGI25164J39214_1000948 | 3300002772 | Bacteria | 9379 |
| 8 | JGI25151J46595_10010208 | 3300003187 | Bacteria | 4378 |
| 9 | JGI25165J46597_1000055 | 3300003214 | Bacteria | 224187 |
| 10 | rootL2_10207484 | 3300003322 | Bacteria | 1697 |
| 11 | rootH1_10001183 | 3300003323 | Bacteria | 2000 |
| 12 | rootH1_10156117 | 3300003323 | Bacteria | 3734 |
| 13 | Ga0006562J51391_1065468 | 3300003578 | Bacteria | 1381 |
| 14 | Ga0055532_1000126 | 3300003758 | Bacteria | 76489 |
| 15 | Ga0055535_1000039 | 3300003761 | Bacteria | 159377 |
| 16 | Ga0055529_1000135 | 3300003763 | Bacteria | 104238 |
| 17 | JGI25405J52794_10003995 | 3300003911 | Bacteria | 2612 |
| 18 | JGI25405J52794_10005185 | 3300003911 | Bacteria | 2343 |
| 19 | Ga0065715_10219328 | 3300005293 | Bacteria | 1270 |
| 20 | Ga0065707_10497809 | 3300005295 | Bacteria | 760 |
| 21 | Ga0070658_10044575 | 3300005327 | Bacteria | 3585 |
| 22 | Ga0070658_10048274 | 3300005327 | Bacteria | 3446 |
| 23 | Ga0070658_10057313 | 3300005327 | Bacteria | 3169 |
| 24 | Ga0070658_10142941 | 3300005327 | Bacteria | 1999 |
| 25 | Ga0070658_10150282 | 3300005327 | Bacteria | 1950 |
| 26 | Ga0070658_10710588 | 3300005327 | Bacteria | 872 |
| 27 | Ga0070676_10087329 | 3300005328 | Bacteria | 1903 |
| 28 | Ga0070676_10272391 | 3300005328 | Bacteria | 1138 |
| 29 | Ga0070683_100009712 | 3300005329 | Bacteria | 8239 |
| 30 | Ga0070683_100150985 | 3300005329 | Bacteria | 2202 |
| 31 | Ga0070683_100707296 | 3300005329 | Bacteria | 965 |
| 32 | Ga0070690_100045195 | 3300005330 | Bacteria | 2797 |
| 33 | Ga0070690_100060525 | 3300005330 | Bacteria | 2437 |
| 34 | Ga0070670_100009582 | 3300005331 | Bacteria | 8266 |
| 35 | Ga0070670_100025933 | 3300005331 | Bacteria | 5043 |
| 36 | Ga0070670_100043602 | 3300005331 | Bacteria | 3855 |
| 37 | Ga0070670_100141583 | 3300005331 | Bacteria | 2080 |
| 38 | Ga0070677_10033531 | 3300005333 | Bacteria | 1978 |
| 39 | Ga0070677_10279051 | 3300005333 | Bacteria | 841 |
| 40 | Ga0068869_100270187 | 3300005334 | Bacteria | 1364 |
| 41 | Ga0070666_10050917 | 3300005335 | Bacteria | 2787 |
| 42 | Ga0070666_10130525 | 3300005335 | Bacteria | 1746 |
| 43 | Ga0070680_100090903 | 3300005336 | Bacteria | 2527 |
| 44 | Ga0070680_100710803 | 3300005336 | Bacteria | 865 |
| 45 | Ga0070682_100021431 | 3300005337 | Bacteria | 3813 |
| 46 | Ga0068868_100059878 | 3300005338 | Bacteria | 3013 |
| 47 | Ga0068868_100564297 | 3300005338 | Bacteria | 1005 |
| 48 | Ga0068868_100803255 | 3300005338 | Bacteria | 849 |
| 49 | Ga0070691_10003906 | 3300005341 | Bacteria | 6745 |
| 50 | Ga0070687_100050198 | 3300005343 | Bacteria | 2153 |
| 51 | Ga0070661_100377431 | 3300005344 | Bacteria | 1117 |
| 52 | Ga0070692_10129332 | 3300005345 | Bacteria | 1417 |
| 53 | Ga0070692_10577987 | 3300005345 | Bacteria | 740 |
| 54 | Ga0070668_100001475 | 3300005347 | Bacteria | 16981 |
| 55 | Ga0070668_100035343 | 3300005347 | Bacteria | 3810 |
| 56 | Ga0070668_100044214 | 3300005347 | Bacteria | 3417 |
| 57 | Ga0070668_100365800 | 3300005347 | Bacteria | 1224 |
| 58 | Ga0070669_100027066 | 3300005353 | Bacteria | 4126 |
| 59 | Ga0070669_100091113 | 3300005353 | Bacteria | 2286 |
| 60 | Ga0070675_100009169 | 3300005354 | Bacteria | 7685 |
| 61 | Ga0070675_100667346 | 3300005354 | Bacteria | 945 |
| 62 | Ga0070671_100093445 | 3300005355 | Bacteria | 2520 |
| 63 | Ga0070671_100179701 | 3300005355 | Bacteria | 1791 |
| 64 | Ga0070671_100191022 | 3300005355 | Bacteria | 1736 |
| 65 | Ga0070671_100291163 | 3300005355 | Bacteria | 1390 |
| 66 | Ga0070671_100340387 | 3300005355 | Bacteria | 1280 |
| 67 | Ga0070674_100034386 | 3300005356 | Bacteria | 3385 |
| 68 | Ga0070674_100112115 | 3300005356 | Bacteria | 2004 |
| 69 | Ga0070673_100106973 | 3300005364 | Bacteria | 2313 |
| 70 | Ga0070673_100527185 | 3300005364 | Bacteria | 1071 |
| 71 | Ga0070659_100523511 | 3300005366 | Bacteria | 1012 |
| 72 | Ga0070659_100569770 | 3300005366 | Bacteria | 971 |
| 73 | Ga0070703_10040736 | 3300005406 | Bacteria | 1445 |
| 74 | Ga0070709_10062138 | 3300005434 | Bacteria | 2380 |
| 75 | Ga0070714_100003706 | 3300005435 | Bacteria | 11444 |
| 76 | Ga0070714_100004313 | 3300005435 | Bacteria | 10722 |
| 77 | Ga0070714_100559936 | 3300005435 | Bacteria | 1095 |
| 78 | Ga0070713_100002030 | 3300005436 | Bacteria | 13090 |
| 79 | Ga0070713_100154564 | 3300005436 | Bacteria | 2044 |
| 80 | Ga0070713_100238472 | 3300005436 | Bacteria | 1655 |
| 81 | Ga0070713_100904018 | 3300005436 | Bacteria | 849 |
| 82 | Ga0070710_10281982 | 3300005437 | Bacteria | 1078 |
| 83 | Ga0070694_100259857 | 3300005444 | Bacteria | 1317 |
| 84 | Ga0070708_100042662 | 3300005445 | Bacteria | 3984 |
| 85 | Ga0070708_100151683 | 3300005445 | Bacteria | 2155 |
| 86 | Ga0070663_100000256 | 3300005455 | Bacteria | 26565 |
| 87 | Ga0070663_100141030 | 3300005455 | Bacteria | 1840 |
| 88 | Ga0070663_100150751 | 3300005455 | Bacteria | 1783 |
| 89 | Ga0070678_100006989 | 3300005456 | Bacteria | 6663 |
| 90 | Ga0070678_100021719 | 3300005456 | Bacteria | 4238 |
| 91 | Ga0070678_100232562 | 3300005456 | Bacteria | 1537 |
| 92 | Ga0070678_100317700 | 3300005456 | Bacteria | 1329 |
| 93 | Ga0070662_100096520 | 3300005457 | Bacteria | 2230 |
| 94 | Ga0070662_100112349 | 3300005457 | Bacteria | 2077 |
| 95 | Ga0070662_100179568 | 3300005457 | Bacteria | 1668 |
| 96 | Ga0070681_10164369 | 3300005458 | Bacteria | 2142 |
| 97 | Ga0070681_10235269 | 3300005458 | Bacteria | 1746 |
| 98 | Ga0070685_10251455 | 3300005466 | Bacteria | 1171 |
| 99 | Ga0070706_100012058 | 3300005467 | Bacteria | 8019 |
| 100 | Ga0070706_100025024 | 3300005467 | Bacteria | 5495 |
| 101 | Ga0070706_100029759 | 3300005467 | Bacteria | 5030 |
| 102 | Ga0070706_100041719 | 3300005467 | Bacteria | 4237 |
| 103 | Ga0070706_100159584 | 3300005467 | Bacteria | 2105 |
| 104 | Ga0070679_100086435 | 3300005530 | Bacteria | 3122 |
| 105 | Ga0070679_100161515 | 3300005530 | Bacteria | 2215 |
| 106 | Ga0070679_100772065 | 3300005530 | Bacteria | 904 |
| 107 | Ga0070684_100001001 | 3300005535 | Bacteria | 20112 |
| 108 | Ga0070684_100006064 | 3300005535 | Bacteria | 9315 |
| 109 | Ga0070684_100007391 | 3300005535 | Bacteria | 8540 |
| 110 | Ga0070684_100020655 | 3300005535 | Bacteria | 5462 |
| 111 | Ga0070684_100230470 | 3300005535 | Bacteria | 1691 |
| 112 | Ga0070684_100518396 | 3300005535 | Bacteria | 1105 |
| 113 | Ga0068853_100043059 | 3300005539 | Bacteria | 3862 |
| 114 | Ga0068853_101071072 | 3300005539 | Bacteria | 777 |
| 115 | Ga0070672_100001029 | 3300005543 | Bacteria | 16970 |
| 116 | Ga0070672_100008699 | 3300005543 | Bacteria | 6964 |
| 117 | Ga0070686_100036578 | 3300005544 | Bacteria | 3041 |
| 118 | Ga0070686_100221456 | 3300005544 | Bacteria | 1368 |
| 119 | Ga0070686_100309300 | 3300005544 | Bacteria | 1175 |
| 120 | Ga0070686_100412714 | 3300005544 | Bacteria | 1030 |
| 121 | Ga0070686_100523313 | 3300005544 | Bacteria | 924 |
| 122 | Ga0070693_100289190 | 3300005547 | Bacteria | 1100 |
| 123 | Ga0070665_100151800 | 3300005548 | Bacteria | 2319 |
| 124 | Ga0068855_100337662 | 3300005563 | Bacteria | 1662 |
| 125 | Ga0070664_100018399 | 3300005564 | Bacteria | 5739 |
| 126 | Ga0070664_100122580 | 3300005564 | Bacteria | 2277 |
| 127 | Ga0070664_100194071 | 3300005564 | Bacteria | 1810 |
| 128 | Ga0070664_100212112 | 3300005564 | Bacteria | 1731 |
| 129 | Ga0070664_100555766 | 3300005564 | Bacteria | 1061 |
| 130 | Ga0068857_100008650 | 3300005577 | Bacteria | 8810 |
| 131 | Ga0068857_100020906 | 3300005577 | Bacteria | 5757 |
| 132 | Ga0068854_100530275 | 3300005578 | Bacteria | 996 |
| 133 | Ga0068856_100011581 | 3300005614 | Bacteria | 8555 |
| 134 | Ga0068856_100595329 | 3300005614 | Bacteria | 1127 |
| 135 | Ga0068856_100708029 | 3300005614 | Bacteria | 1027 |
| 136 | Ga0068852_100479955 | 3300005616 | Bacteria | 1235 |
| 137 | Ga0068864_100247518 | 3300005618 | Bacteria | 1653 |
| 138 | Ga0068864_100431970 | 3300005618 | Bacteria | 1256 |
| 139 | Ga0068861_100054019 | 3300005719 | Bacteria | 3059 |
| 140 | Ga0068861_100191382 | 3300005719 | Bacteria | 1710 |
| 141 | Ga0068870_10152410 | 3300005840 | Bacteria | 1363 |
| 142 | Ga0068870_10193255 | 3300005840 | Bacteria | 1229 |
| 143 | Ga0068863_100007193 | 3300005841 | Bacteria | 10917 |
| 144 | Ga0068863_100433487 | 3300005841 | Bacteria | 1288 |
| 145 | Ga0068860_100472011 | 3300005843 | Bacteria | 1250 |
| 146 | Ga0068862_100006998 | 3300005844 | Bacteria | 9364 |
| 147 | Ga0068862_100025953 | 3300005844 | Bacteria | 4923 |
| 148 | Ga0068862_100177340 | 3300005844 | Bacteria | 1911 |
| 149 | Ga0081455_10001241 | 3300005937 | Bacteria | 31870 |
| 150 | Ga0081540_1031249 | 3300005983 | Bacteria | 2932 |
| 151 | Ga0070717_10343667 | 3300006028 | Bacteria | 1333 |
| 152 | Ga0070717_10445123 | 3300006028 | Bacteria | 1167 |
| 153 | Ga0070717_10491475 | 3300006028 | Bacteria | 1108 |
| 154 | Ga0075365_10387182 | 3300006038 | Bacteria | 986 |
| 155 | Ga0075363_100041996 | 3300006048 | Bacteria | 2414 |
| 156 | Ga0075364_10160551 | 3300006051 | Bacteria | 1517 |
| 157 | Ga0070716_100172284 | 3300006173 | Bacteria | 1413 |
| 158 | Ga0070712_100260332 | 3300006175 | Bacteria | 1390 |
| 159 | Ga0070712_100459323 | 3300006175 | Bacteria | 1062 |
| 160 | Ga0075427_10010716 | 3300006194 | Bacteria | 1376 |
| 161 | Ga0097621_100166550 | 3300006237 | Bacteria | 1897 |
| 162 | Ga0097621_100236243 | 3300006237 | Bacteria | 1597 |
| 163 | Ga0097621_100324469 | 3300006237 | Bacteria | 1364 |
| 164 | Ga0068871_100411691 | 3300006358 | Bacteria | 1206 |
| 165 | Ga0068871_100504823 | 3300006358 | Bacteria | 1091 |
| 166 | Ga0075428_100007320 | 3300006844 | Bacteria | 12227 |
| 167 | Ga0075428_100140570 | 3300006844 | Bacteria | 2625 |
| 168 | Ga0075430_100017488 | 3300006846 | Bacteria | 6107 |
| 169 | Ga0075431_100015131 | 3300006847 | Bacteria | 7815 |
| 170 | Ga0075431_100054149 | 3300006847 | Bacteria | 4137 |
| 171 | Ga0075431_100763516 | 3300006847 | Bacteria | 942 |
| 172 | Ga0075434_100002284 | 3300006871 | Bacteria | 16769 |
| 173 | Ga0075434_100081535 | 3300006871 | Bacteria | 3232 |
| 174 | Ga0075429_100003274 | 3300006880 | Bacteria | 13803 |
| 175 | Ga0075429_100008178 | 3300006880 | Bacteria | 9091 |
| 176 | Ga0075429_100104862 | 3300006880 | Bacteria | 2469 |
| 177 | Ga0068865_100028806 | 3300006881 | Bacteria | 3679 |
| 178 | Ga0068865_100399351 | 3300006881 | Bacteria | 1126 |
| 179 | Ga0068865_100591834 | 3300006881 | Bacteria | 936 |
| 180 | Ga0075436_100447832 | 3300006914 | Bacteria | 940 |
| 181 | Ga0105244_10007172 | 3300009036 | Bacteria | 7113 |
| 182 | Ga0105244_10007296 | 3300009036 | Bacteria | 7032 |
| 183 | Ga0105244_10028404 | 3300009036 | Bacteria | 3001 |
| 184 | Ga0105240_10000006 | 3300009093 | Bacteria | 669662 |
| 185 | Ga0105240_10085663 | 3300009093 | Bacteria | 3860 |
| 186 | Ga0111539_10017610 | 3300009094 | Bacteria | 8843 |
| 187 | Ga0111539_10074845 | 3300009094 | Bacteria | 3990 |
| 188 | Ga0111539_10183599 | 3300009094 | Bacteria | 2443 |
| 189 | Ga0105245_10022927 | 3300009098 | Bacteria | 5478 |
| 190 | Ga0105245_10083060 | 3300009098 | Bacteria | 2931 |
| 191 | Ga0105245_10277782 | 3300009098 | Bacteria | 1636 |
| 192 | Ga0105245_10277855 | 3300009098 | Bacteria | 1636 |
| 193 | Ga0105245_10335713 | 3300009098 | Bacteria | 1493 |
| 194 | Ga0105245_10919738 | 3300009098 | Bacteria | 917 |
| 195 | Ga0105247_10112116 | 3300009101 | Bacteria | 1757 |
| 196 | Ga0105247_10216505 | 3300009101 | Bacteria | 1294 |
| 197 | Ga0114129_10810025 | 3300009147 | Bacteria | 1194 |
| 198 | Ga0105243_10000331 | 3300009148 | Bacteria | 51618 |
| 199 | Ga0105243_10029500 | 3300009148 | Bacteria | 4219 |
| 200 | Ga0105243_10085408 | 3300009148 | Bacteria | 2587 |
| 201 | Ga0105243_10117882 | 3300009148 | Bacteria | 2233 |
| 202 | Ga0105243_10677168 | 3300009148 | Bacteria | 1003 |
| 203 | Ga0105241_10017584 | 3300009174 | Bacteria | 5257 |
| 204 | Ga0105241_10725978 | 3300009174 | Bacteria | 909 |
| 205 | Ga0105241_10793880 | 3300009174 | Bacteria | 872 |
| 206 | Ga0105242_10124405 | 3300009176 | Bacteria | 2218 |
| 207 | Ga0105242_10126583 | 3300009176 | Bacteria | 2199 |
| 208 | Ga0105242_10133171 | 3300009176 | Bacteria | 2148 |
| 209 | Ga0105248_10000431 | 3300009177 | Bacteria | 47530 |
| 210 | Ga0105248_10125942 | 3300009177 | Bacteria | 2890 |
| 211 | Ga0105248_10160798 | 3300009177 | Bacteria | 2533 |
| 212 | Ga0105248_10570762 | 3300009177 | Bacteria | 1276 |
| 213 | Ga0105237_10087115 | 3300009545 | Bacteria | 3113 |
| 214 | Ga0105237_10161205 | 3300009545 | Bacteria | 2241 |
| 215 | Ga0105238_10055911 | 3300009551 | Bacteria | 3960 |
| 216 | Ga0105238_10272830 | 3300009551 | Bacteria | 1672 |
| 217 | Ga0105238_10450743 | 3300009551 | Bacteria | 1283 |
| 218 | Ga0105249_10000222 | 3300009553 | Bacteria | 64888 |
| 219 | Ga0105249_10157789 | 3300009553 | Bacteria | 2190 |
| 220 | Ga0105249_10873785 | 3300009553 | Bacteria | 965 |
| 221 | Ga0105239_10009542 | 3300010375 | Bacteria | 10921 |
| 222 | Ga0105239_10029425 | 3300010375 | Bacteria | 6039 |
| 223 | Ga0105239_10109750 | 3300010375 | Bacteria | 3058 |
| 224 | Ga0105239_10140519 | 3300010375 | Bacteria | 2690 |
| 225 | Ga0105239_10639588 | 3300010375 | Bacteria | 1215 |
| 226 | Ga0105239_11199547 | 3300010375 | Bacteria | 875 |
| 227 | Ga0105246_10356259 | 3300011119 | Bacteria | 1201 |
| 228 | Ga0105246_10826547 | 3300011119 | Bacteria | 824 |
| 229 | Ga0157373_10137889 | 3300013100 | Bacteria | 1715 |
| 230 | Ga0157371_10120458 | 3300013102 | Bacteria | 1865 |
| 231 | Ga0157371_10356597 | 3300013102 | Bacteria | 1065 |
| 232 | Ga0157371_10362620 | 3300013102 | Bacteria | 1056 |
| 233 | Ga0157371_10444489 | 3300013102 | Bacteria | 953 |
| 234 | Ga0157370_10173797 | 3300013104 | Bacteria | 2002 |
| 235 | Ga0157370_10485583 | 3300013104 | Bacteria | 1135 |
| 236 | Ga0157369_10005856 | 3300013105 | Bacteria | 14280 |
| 237 | Ga0157369_10029178 | 3300013105 | Bacteria | 6099 |
| 238 | Ga0157369_10030077 | 3300013105 | Bacteria | 5993 |
| 239 | Ga0157369_10491869 | 3300013105 | Bacteria | 1269 |
| 240 | Ga0157369_11248739 | 3300013105 | Bacteria | 758 |
| 241 | Ga0157374_10139808 | 3300013296 | Bacteria | 2350 |
| 242 | Ga0157374_10204601 | 3300013296 | Bacteria | 1934 |
| 243 | Ga0157378_10100223 | 3300013297 | Bacteria | 2644 |
| 244 | Ga0157378_10223200 | 3300013297 | Bacteria | 1792 |
| 245 | Ga0157378_11287040 | 3300013297 | Bacteria | 772 |
| 246 | Ga0163162_10000070 | 3300013306 | Bacteria | 96586 |
| 247 | Ga0163162_10010023 | 3300013306 | Bacteria | 9213 |
| 248 | Ga0163162_10278147 | 3300013306 | Bacteria | 1806 |
| 249 | Ga0163162_10417465 | 3300013306 | Bacteria | 1474 |
| 250 | Ga0157372_10026969 | 3300013307 | Bacteria | 6255 |
| 251 | Ga0157372_10114177 | 3300013307 | Bacteria | 3096 |
| 252 | Ga0157372_10192253 | 3300013307 | Bacteria | 2364 |
| 253 | Ga0157375_10232794 | 3300013308 | Bacteria | 2001 |
| 254 | Ga0157375_10387439 | 3300013308 | Bacteria | 1564 |
| 255 | Ga0157375_10391103 | 3300013308 | Bacteria | 1557 |
| 256 | Ga0157375_10532735 | 3300013308 | Bacteria | 1337 |
| 257 | Ga0157375_10550595 | 3300013308 | Bacteria | 1315 |
| 258 | Ga0163163_10010889 | 3300014325 | Bacteria | 8216 |
| 259 | Ga0163163_10096536 | 3300014325 | Bacteria | 2976 |
| 260 | Ga0163163_10519906 | 3300014325 | Bacteria | 1252 |
| 261 | Ga0163163_10821903 | 3300014325 | Bacteria | 993 |
| 262 | Ga0157377_10217116 | 3300014745 | Bacteria | 1222 |
| 263 | Ga0157379_10014975 | 3300014968 | Bacteria | 6803 |
| 264 | Ga0157379_10199642 | 3300014968 | Bacteria | 1809 |
| 265 | Ga0157379_10850113 | 3300014968 | Bacteria | 863 |
| 266 | Ga0157376_10132003 | 3300014969 | Bacteria | 2230 |
| 267 | Ga0157376_10152289 | 3300014969 | Bacteria | 2087 |
| 268 | Ga0157376_10152959 | 3300014969 | Bacteria | 2083 |
| 269 | Ga0163161_10006854 | 3300017792 | Bacteria | 7882 |
| 270 | Ga0206354_10106083 | 3300020081 | Bacteria | 1343 |
| 271 | Ga0209147_100182 | 3300025229 | Bacteria | 76541 |
| 272 | Ga0209563_100503 | 3300025230 | Bacteria | 13293 |
| 273 | Ga0207427_100054 | 3300025231 | Bacteria | 216315 |
| 274 | Ga0207427_101407 | 3300025231 | Bacteria | 8788 |
| 275 | Ga0209437_101027 | 3300025233 | Bacteria | 9499 |
| 276 | Ga0209258_100025 | 3300025242 | Bacteria | 534777 |
| 277 | Ga0209148_1004968 | 3300025254 | Bacteria | 3137 |
| 278 | Ga0209759_1002410 | 3300025256 | Bacteria | 8221 |
| 279 | Ga0209759_1009451 | 3300025256 | Bacteria | 2947 |
| 280 | Ga0209759_1028879 | 3300025256 | Bacteria | 1121 |
| 281 | Ga0209759_1034742 | 3300025256 | Bacteria | 938 |
| 282 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 283 | Ga0209455_1000089 | 3300025272 | Bacteria | 235612 |
| 284 | Ga0209676_1001904 | 3300025292 | Bacteria | 16990 |
| 285 | Ga0209025_1000626 | 3300025294 | Bacteria | 62584 |
| 286 | Ga0207697_10029007 | 3300025315 | Bacteria | 2264 |
| 287 | Ga0207656_10098382 | 3300025321 | Bacteria | 1338 |
| 288 | Ga0207655_1001384 | 3300025728 | Bacteria | 22650 |
| 289 | Ga0207655_1003194 | 3300025728 | Bacteria | 12337 |
| 290 | Ga0207682_10063822 | 3300025893 | Bacteria | 1547 |
| 291 | Ga0207692_10142534 | 3300025898 | Bacteria | 1364 |
| 292 | Ga0207642_10219454 | 3300025899 | Bacteria | 1062 |
| 293 | Ga0207642_10247976 | 3300025899 | Bacteria | 1009 |
| 294 | Ga0207688_10272690 | 3300025901 | Bacteria | 1029 |
| 295 | Ga0207680_10017139 | 3300025903 | Bacteria | 3821 |
| 296 | Ga0207680_10119715 | 3300025903 | Bacteria | 1720 |
| 297 | Ga0207699_10028044 | 3300025906 | Bacteria | 3125 |
| 298 | Ga0207699_10292478 | 3300025906 | Bacteria | 1135 |
| 299 | Ga0207645_10052717 | 3300025907 | Bacteria | 2599 |
| 300 | Ga0207645_10213986 | 3300025907 | Bacteria | 1270 |
| 301 | Ga0207643_10041061 | 3300025908 | Bacteria | 2606 |
| 302 | Ga0207643_10318850 | 3300025908 | Bacteria | 970 |
| 303 | Ga0207705_10152915 | 3300025909 | Bacteria | 1730 |
| 304 | Ga0207705_10530290 | 3300025909 | Bacteria | 915 |
| 305 | Ga0207684_10055195 | 3300025910 | Bacteria | 3370 |
| 306 | Ga0207684_10064156 | 3300025910 | Bacteria | 3119 |
| 307 | Ga0207684_10151102 | 3300025910 | Bacteria | 1998 |
| 308 | Ga0207707_10075958 | 3300025912 | Bacteria | 2932 |
| 309 | Ga0207707_10080972 | 3300025912 | Bacteria | 2835 |
| 310 | Ga0207695_10000017 | 3300025913 | Bacteria | 769384 |
| 311 | Ga0207695_10579075 | 3300025913 | Bacteria | 1004 |
| 312 | Ga0207695_10768591 | 3300025913 | Bacteria | 844 |
| 313 | Ga0207693_10201550 | 3300025915 | Bacteria | 1565 |
| 314 | Ga0207693_10398376 | 3300025915 | Bacteria | 1076 |
| 315 | Ga0207693_10411749 | 3300025915 | Bacteria | 1057 |
| 316 | Ga0207663_10063820 | 3300025916 | Bacteria | 2347 |
| 317 | Ga0207660_10075691 | 3300025917 | Bacteria | 2460 |
| 318 | Ga0207660_10221062 | 3300025917 | Bacteria | 1486 |
| 319 | Ga0207662_10004512 | 3300025918 | Bacteria | 7334 |
| 320 | Ga0207662_10137551 | 3300025918 | Bacteria | 1545 |
| 321 | Ga0207657_10010889 | 3300025919 | Bacteria | 9051 |
| 322 | Ga0207649_10060830 | 3300025920 | Bacteria | 2375 |
| 323 | Ga0207649_10418306 | 3300025920 | Bacteria | 1006 |
| 324 | Ga0207652_10127938 | 3300025921 | Bacteria | 2264 |
| 325 | Ga0207652_10302588 | 3300025921 | Bacteria | 1443 |
| 326 | Ga0207646_10141234 | 3300025922 | Bacteria | 2169 |
| 327 | Ga0207694_10195487 | 3300025924 | Bacteria | 1644 |
| 328 | Ga0207650_10049753 | 3300025925 | Bacteria | 3096 |
| 329 | Ga0207650_10121923 | 3300025925 | Bacteria | 2031 |
| 330 | Ga0207659_10022431 | 3300025926 | Bacteria | 4203 |
| 331 | Ga0207659_10114874 | 3300025926 | Bacteria | 2053 |
| 332 | Ga0207659_10626672 | 3300025926 | Bacteria | 918 |
| 333 | Ga0207687_10090253 | 3300025927 | Bacteria | 2233 |
| 334 | Ga0207700_10000679 | 3300025928 | Bacteria | 19805 |
| 335 | Ga0207700_10144196 | 3300025928 | Bacteria | 1961 |
| 336 | Ga0207700_10221320 | 3300025928 | Bacteria | 1605 |
| 337 | Ga0207700_10414526 | 3300025928 | Bacteria | 1182 |
| 338 | Ga0207664_10000334 | 3300025929 | Bacteria | 34782 |
| 339 | Ga0207664_10107005 | 3300025929 | Bacteria | 2320 |
| 340 | Ga0207664_10315571 | 3300025929 | Bacteria | 1378 |
| 341 | Ga0207664_10654655 | 3300025929 | Bacteria | 944 |
| 342 | Ga0207644_10154029 | 3300025931 | Bacteria | 1781 |
| 343 | Ga0207644_10181911 | 3300025931 | Bacteria | 1648 |
| 344 | Ga0207690_10113466 | 3300025932 | Bacteria | 1956 |
| 345 | Ga0207690_10129305 | 3300025932 | Bacteria | 1846 |
| 346 | Ga0207706_10024022 | 3300025933 | Bacteria | 5470 |
| 347 | Ga0207706_10025773 | 3300025933 | Bacteria | 5267 |
| 348 | Ga0207706_10049980 | 3300025933 | Bacteria | 3695 |
| 349 | Ga0207686_10076060 | 3300025934 | Bacteria | 2175 |
| 350 | Ga0207686_10392512 | 3300025934 | Bacteria | 1055 |
| 351 | Ga0207686_10808051 | 3300025934 | Bacteria | 752 |
| 352 | Ga0207709_10000796 | 3300025935 | Bacteria | 24560 |
| 353 | Ga0207709_10004329 | 3300025935 | Bacteria | 8217 |
| 354 | Ga0207709_10041288 | 3300025935 | Bacteria | 2767 |
| 355 | Ga0207709_10128787 | 3300025935 | Bacteria | 1721 |
| 356 | Ga0207709_10420124 | 3300025935 | Bacteria | 1027 |
| 357 | Ga0207669_10360616 | 3300025937 | Bacteria | 1126 |
| 358 | Ga0207669_10487265 | 3300025937 | Bacteria | 984 |
| 359 | Ga0207704_10334851 | 3300025938 | Bacteria | 1173 |
| 360 | Ga0207665_10029840 | 3300025939 | Bacteria | 3604 |
| 361 | Ga0207691_10009825 | 3300025940 | Bacteria | 9186 |
| 362 | Ga0207691_10018724 | 3300025940 | Bacteria | 6559 |
| 363 | Ga0207691_10094126 | 3300025940 | Bacteria | 2681 |
| 364 | Ga0207691_10281861 | 3300025940 | Bacteria | 1430 |
| 365 | Ga0207691_10336931 | 3300025940 | Bacteria | 1291 |
| 366 | Ga0207711_10007521 | 3300025941 | Bacteria | 9111 |
| 367 | Ga0207711_10285211 | 3300025941 | Bacteria | 1521 |
| 368 | Ga0207711_10374045 | 3300025941 | Bacteria | 1321 |
| 369 | Ga0207689_10048803 | 3300025942 | Bacteria | 3492 |
| 370 | Ga0207689_10148618 | 3300025942 | Bacteria | 1931 |
| 371 | Ga0207661_10003117 | 3300025944 | Bacteria | 11482 |
| 372 | Ga0207661_10012544 | 3300025944 | Bacteria | 6163 |
| 373 | Ga0207661_10180011 | 3300025944 | Bacteria | 1846 |
| 374 | Ga0207661_10689102 | 3300025944 | Bacteria | 940 |
| 375 | Ga0207679_10016133 | 3300025945 | Bacteria | 4954 |
| 376 | Ga0207679_10220497 | 3300025945 | Bacteria | 1595 |
| 377 | Ga0207679_10259279 | 3300025945 | Bacteria | 1482 |
| 378 | Ga0207679_10563754 | 3300025945 | Bacteria | 1023 |
| 379 | Ga0207679_10588793 | 3300025945 | Bacteria | 1001 |
| 380 | Ga0207667_10087206 | 3300025949 | Bacteria | 3229 |
| 381 | Ga0207667_10161964 | 3300025949 | Bacteria | 2301 |
| 382 | Ga0207651_10282859 | 3300025960 | Bacteria | 1372 |
| 383 | Ga0207651_10916710 | 3300025960 | Bacteria | 781 |
| 384 | Ga0207712_10000248 | 3300025961 | Bacteria | 52803 |
| 385 | Ga0207712_10065937 | 3300025961 | Bacteria | 2587 |
| 386 | Ga0207712_10315058 | 3300025961 | Bacteria | 1289 |
| 387 | Ga0207668_10000696 | 3300025972 | Bacteria | 20613 |
| 388 | Ga0207668_10002618 | 3300025972 | Bacteria | 10531 |
| 389 | Ga0207640_10039993 | 3300025981 | Bacteria | 2972 |
| 390 | Ga0207640_10697196 | 3300025981 | Bacteria | 870 |
| 391 | Ga0207658_10000006 | 3300025986 | Bacteria | 392309 |
| 392 | Ga0207658_10687251 | 3300025986 | Bacteria | 924 |
| 393 | Ga0207677_10203873 | 3300026023 | Bacteria | 1574 |
| 394 | Ga0207677_10236304 | 3300026023 | Bacteria | 1475 |
| 395 | Ga0207677_10405039 | 3300026023 | Bacteria | 1158 |
| 396 | Ga0207677_10473421 | 3300026023 | Bacteria | 1078 |
| 397 | Ga0207639_10594639 | 3300026041 | Bacteria | 1020 |
| 398 | Ga0207678_10000081 | 3300026067 | Bacteria | 77634 |
| 399 | Ga0207678_10046093 | 3300026067 | Bacteria | 3770 |
| 400 | Ga0207708_10071836 | 3300026075 | Bacteria | 2651 |
| 401 | Ga0207702_10007434 | 3300026078 | Bacteria | 9348 |
| 402 | Ga0207702_10059300 | 3300026078 | Bacteria | 3260 |
| 403 | Ga0207702_10116619 | 3300026078 | Bacteria | 2383 |
| 404 | Ga0207641_10549029 | 3300026088 | Bacteria | 1127 |
| 405 | Ga0207648_10077707 | 3300026089 | Bacteria | 2894 |
| 406 | Ga0207676_10781551 | 3300026095 | Bacteria | 930 |
| 407 | Ga0207676_11400049 | 3300026095 | Bacteria | 695 |
| 408 | Ga0207674_10005880 | 3300026116 | Bacteria | 14542 |
| 409 | Ga0207674_10021117 | 3300026116 | Bacteria | 7020 |
| 410 | Ga0207674_10057638 | 3300026116 | Bacteria | 3937 |
| 411 | Ga0207675_100022691 | 3300026118 | Bacteria | 5841 |
| 412 | Ga0207675_100201770 | 3300026118 | Bacteria | 1910 |
| 413 | Ga0207683_10003689 | 3300026121 | Bacteria | 13304 |
| 414 | Ga0207683_10010414 | 3300026121 | Bacteria | 7931 |
| 415 | Ga0207683_10122954 | 3300026121 | Bacteria | 2331 |
| 416 | Ga0207683_10279095 | 3300026121 | Bacteria | 1527 |
| 417 | Ga0207683_10433346 | 3300026121 | Bacteria | 1211 |
| 418 | Ga0207683_10743869 | 3300026121 | Bacteria | 910 |
| 419 | Ga0207698_10422453 | 3300026142 | Bacteria | 1279 |
| 420 | Ga0207698_11008306 | 3300026142 | Bacteria | 843 |
| 421 | Ga0209982_1007191 | 3300027552 | Bacteria | 1626 |
| 422 | Ga0209983_1016998 | 3300027665 | Bacteria | 1504 |
| 423 | Ga0209971_1034305 | 3300027682 | Bacteria | 1220 |
| 424 | Ga0209974_10004085 | 3300027876 | Bacteria | 5215 |
| 425 | Ga0207428_10005829 | 3300027907 | Bacteria | 11425 |
| 426 | Ga0268265_10008291 | 3300028380 | Bacteria | 7020 |
| 427 | Ga0268265_10032451 | 3300028380 | Bacteria | 3785 |
| 428 | Ga0268265_10122030 | 3300028380 | Bacteria | 2148 |
| 429 | Ga0268265_10411966 | 3300028380 | Bacteria | 1252 |
| 430 | Ga0307515_10079574 | 3300028794 | Bacteria | 4291 |
| 431 | Ga0307515_10214459 | 3300028794 | Bacteria | 1760 |
| 432 | Ga0265324_10021253 | 3300029957 | Bacteria | 2328 |
| 433 | Ga0307512_10044588 | 3300030522 | Bacteria | 3644 |
| 434 | Ga0307513_10015145 | 3300031456 | Bacteria | 9360 |
| 435 | Ga0307509_10083773 | 3300031507 | Bacteria | 3286 |
| 436 | Ga0307509_10175322 | 3300031507 | Bacteria | 2017 |
| 437 | Ga0307408_100019010 | 3300031548 | Bacteria | 4622 |
| 438 | Ga0307508_10092965 | 3300031616 | Bacteria | 2606 |
| 439 | Ga0316576_10004048 | 3300031727 | Bacteria | 8725 |
| 440 | Ga0307410_10001645 | 3300031852 | Bacteria | 10277 |
| 441 | Ga0307410_10029536 | 3300031852 | Bacteria | 3492 |
| 442 | Ga0307406_10023363 | 3300031901 | Bacteria | 3677 |
| 443 | Ga0307406_10239560 | 3300031901 | Bacteria | 1360 |
| 444 | Ga0307412_10516305 | 3300031911 | Bacteria | 997 |
| 445 | Ga0307409_100002779 | 3300031995 | Bacteria | 9249 |
| 446 | Ga0307409_100028713 | 3300031995 | Bacteria | 3968 |
| 447 | Ga0307409_100424275 | 3300031995 | Bacteria | 1277 |
| 448 | Ga0307409_100464327 | 3300031995 | Bacteria | 1225 |
| 449 | Ga0307409_100516720 | 3300031995 | Bacteria | 1166 |
| 450 | Ga0307416_100003733 | 3300032002 | Bacteria | 9037 |
| 451 | Ga0307416_100007009 | 3300032002 | Bacteria | 7109 |
| 452 | Ga0307416_100914524 | 3300032002 | Bacteria | 978 |
| 453 | Ga0373950_0007331 | 3300034818 | Bacteria | 1709 |
| 454 | Ga0373929_0038503 | 3300035085 | Bacteria | 1052 |
| 455 | Ga0373940_0004644 | 3300035088 | Bacteria | 2916 |
| 456 | Ga0373952_0061094 | 3300035092 | Bacteria | 922 |
| 457 | Ga0373936_0223839 | 3300035113 | Bacteria | 835 |
| 458 | Ga0373941_0015557 | 3300035115 | Bacteria | 2055 |
| 459 | Ga0373943_0037187 | 3300035170 | Bacteria | 2336 |
| 460 | Ga0373942_0000193 | 3300035207 | Bacteria | 15641 |
| 461 | Ga0373961_0079198 | 3300035241 | Bacteria | 1031 |
| 462 | Ga0373931_0048754 | 3300035691 | Bacteria | 2246 |
| 463 | Ga0373947_0000499 | 3300035725 | Bacteria | 22740 |
| 464 | Ga0316584_0004737 | 3300036712 | Bacteria | 9016 |
| 465 | Ga0373925_0034405 | 3300037068 | Bacteria | 3734 |
| 466 | Ga0373925_0419025 | 3300037068 | Bacteria | 1094 |
| 467 | Ga0395899_0134024 | 3300037312 | Bacteria | 1767 |
| 468 | Ga0395899_0168425 | 3300037312 | Bacteria | 1544 |
| 469 | Ga0395900_0055722 | 3300037418 | Bacteria | 4071 |
| 470 | Ga0395900_0099129 | 3300037418 | Bacteria | 2993 |
| 471 | Ga0395900_0915263 | 3300037418 | Bacteria | 800 |
| 472 | Ga0395898_0620617 | 3300037466 | Bacteria | 1024 |
| 473 | Ga0395901_0013899 | 3300038443 | Bacteria | 8192 |
| 474 | Ga0395901_0645835 | 3300038443 | Bacteria | 1062 |
| 475 | Ga0436365_0405671 | 3300039437 | Bacteria | 1108 |
| 476 | Ga0436365_0644389 | 3300039437 | Bacteria | 1570 |
| 477 | Ga0436363_0373467 | 3300039450 | Bacteria | 1915 |
| 478 | Ga0436363_1243520 | 3300039450 | Bacteria | 1308 |
| 479 | Ga0439465_0025585 | 3300041413 | Bacteria | 1863 |
| 480 | Ga0451791_0530061 | 3300041451 | Bacteria | 1115 |
| 481 | Ga0451841_0532751 | 3300041498 | Bacteria | 715 |
| 482 | Ga0451845_0173964 | 3300041501 | Bacteria | 731 |
| 483 | Ga0451843_1743438 | 3300041509 | Bacteria | 1698 |
| 484 | Ga0451853_1153975 | 3300041512 | Bacteria | 1237 |
| 485 | Ga0439448_0012760 | 3300042005 | Bacteria | 2518 |
| 486 | Ga0450910_012195 | 3300042147 | Bacteria | 1241 |
| 487 | Ga0453683_0075451 | 3300044673 | Bacteria | 2111 |
| 488 | Ga0466965_0020292 | 3300044683 | Bacteria | 3193 |
| 489 | Ga0466966_0040111 | 3300044684 | Bacteria | 3013 |
| 490 | Ga0466966_0043115 | 3300044684 | Bacteria | 2893 |
| 491 | Ga0466961_0012693 | 3300044693 | Bacteria | 5396 |
| 492 | Ga0466961_0014555 | 3300044693 | Bacteria | 5054 |
| 493 | Ga0466961_0030240 | 3300044693 | Bacteria | 3480 |
| 494 | Ga0466961_0116426 | 3300044693 | Bacteria | 1679 |
| 495 | Ga0466963_0005367 | 3300044694 | Bacteria | 7500 |
| 496 | Ga0466963_0008142 | 3300044694 | Bacteria | 6277 |
| 497 | Ga0466963_0013616 | 3300044694 | Bacteria | 4999 |
| 498 | Ga0466963_0018797 | 3300044694 | Bacteria | 4326 |
| 499 | Ga0466963_0054650 | 3300044694 | Bacteria | 2654 |
| 500 | Ga0466963_0143579 | 3300044694 | Bacteria | 1655 |
| 501 | Ga0466963_0160354 | 3300044694 | Bacteria | 1565 |
| 502 | Ga0466963_0196867 | 3300044694 | Bacteria | 1409 |
| 503 | Ga0466964_0053902 | 3300044706 | Bacteria | 1656 |
| 504 | Ga0466964_0080083 | 3300044706 | Bacteria | 1400 |
| 505 | Ga0453684_0314782 | 3300044712 | Bacteria | 1775 |
| 506 | Ga0466971_0031917 | 3300044719 | Bacteria | 2359 |
| 507 | Ga0466971_0047995 | 3300044719 | Bacteria | 1919 |
| 508 | Ga0466968_0004035 | 3300044735 | Bacteria | 5458 |
| 509 | Ga0466968_0024630 | 3300044735 | Bacteria | 2460 |
| 510 | Ga0466968_0037317 | 3300044735 | Bacteria | 2038 |
| 511 | Ga0466970_0114815 | 3300044765 | Bacteria | 1472 |
| 512 | Ga0466957_0076205 | 3300044842 | Bacteria | 2082 |
| 513 | Ga0466957_0076378 | 3300044842 | Bacteria | 2080 |
| 514 | Ga0466957_0130224 | 3300044842 | Bacteria | 1611 |
| 515 | Ga0466957_0253619 | 3300044842 | Bacteria | 1171 |
| 516 | Ga0466957_0725455 | 3300044842 | Bacteria | 703 |
| 517 | Ga0466960_0007002 | 3300044901 | Bacteria | 4554 |
| 518 | Ga0466959_0021777 | 3300045049 | Bacteria | 4731 |
| 519 | Ga0466959_0023956 | 3300045049 | Bacteria | 4519 |
| 520 | Ga0451576_0124242 | 3300045051 | Bacteria | 2688 |
| 521 | Ga0466958_0001569 | 3300045836 | Bacteria | 10963 |
| 522 | Ga0466958_0003106 | 3300045836 | Bacteria | 8528 |
| 523 | Ga0466958_0021073 | 3300045836 | Bacteria | 3805 |
| 524 | Ga0466958_0038834 | 3300045836 | Bacteria | 2858 |
| 525 | Ga0466958_0074848 | 3300045836 | Bacteria | 2076 |
| 526 | Ga0466967_0043588 | 3300045976 | Bacteria | 3885 |
| 527 | Ga0466967_0090309 | 3300045976 | Bacteria | 2782 |
| 528 | Ga0466967_0100477 | 3300045976 | Bacteria | 2643 |
| 529 | Ga0466967_0227045 | 3300045976 | Bacteria | 1776 |
| 530 | Ga0466967_0228834 | 3300045976 | Bacteria | 1769 |
| 531 | Ga0466967_0929383 | 3300045976 | Bacteria | 865 |
| 532 | Ga0495603_0000566 | 3300046455 | Bacteria | 20760 |
| 533 | Ga0495629_0154275 | 3300046459 | Bacteria | 1596 |
| 534 | Ga0495629_0155287 | 3300046459 | Bacteria | 1590 |
| 535 | Ga0495641_0000953 | 3300046461 | Bacteria | 24779 |
| 536 | Ga0495653_0188468 | 3300046463 | Bacteria | 1409 |
| 537 | Ga0495580_0247026 | 3300046472 | Bacteria | 1222 |
| 538 | Ga0495582_0061833 | 3300046473 | Bacteria | 2068 |
| 539 | Ga0495584_0093040 | 3300046491 | Bacteria | 1521 |
| 540 | Ga0495585_0024790 | 3300046492 | Bacteria | 3438 |
| 541 | Ga0495594_0002981 | 3300046499 | Bacteria | 8778 |
| 542 | Ga0495583_0000123 | 3300046506 | Bacteria | 131122 |
| 543 | Ga0495606_0002067 | 3300046507 | Bacteria | 24517 |
| 544 | Ga0495618_0005583 | 3300046514 | Bacteria | 7647 |
| 545 | Ga0495628_0064349 | 3300046516 | Bacteria | 2871 |
| 546 | Ga0495630_0028615 | 3300046517 | Bacteria | 4140 |
| 547 | Ga0495640_0129801 | 3300046533 | Bacteria | 1632 |
| 548 | Ga0495640_0292483 | 3300046533 | Bacteria | 1013 |
| 549 | Ga0495622_0205953 | 3300046557 | Bacteria | 875 |
| 550 | Ga0495668_0086410 | 3300046616 | Bacteria | 1720 |
| 551 | Ga0495634_0102309 | 3300046642 | Bacteria | 1850 |
| 552 | Ga0495634_0241460 | 3300046642 | Bacteria | 1108 |
| 553 | Ga0495625_0004740 | 3300046660 | Bacteria | 12727 |
| 554 | Ga0495625_0046617 | 3300046660 | Bacteria | 3127 |
| 555 | Ga0495588_0006311 | 3300046674 | Bacteria | 5335 |
| 556 | Ga0495657_0074053 | 3300046675 | Bacteria | 2216 |
| 557 | Ga0495657_0087995 | 3300046675 | Bacteria | 1998 |
| 558 | Ga0495623_0087009 | 3300046679 | Bacteria | 1925 |
| 559 | Ga0495646_0111571 | 3300046680 | Bacteria | 1556 |
| 560 | Ga0495647_0031777 | 3300046681 | Bacteria | 1965 |
| 561 | Ga0495658_0041185 | 3300046683 | Bacteria | 2572 |
| 562 | Ga0495669_0004784 | 3300046684 | Bacteria | 5617 |
| 563 | Ga0495613_0168638 | 3300046689 | Bacteria | 1555 |
| 564 | Ga0495613_0175337 | 3300046689 | Bacteria | 1520 |
| 565 | Ga0495649_0001360 | 3300046694 | Bacteria | 18578 |
| 566 | Ga0495589_0064337 | 3300046794 | Bacteria | 1798 |
| 567 | Ga0495600_0109840 | 3300046809 | Bacteria | 1796 |
| 568 | Ga0495604_0079471 | 3300047317 | Bacteria | 2459 |
| 569 | Ga0495604_0196850 | 3300047317 | Bacteria | 1401 |
| 570 | Ga0495604_0255527 | 3300047317 | Bacteria | 1193 |
| 571 | Ga0495676_0002630 | 3300047321 | Bacteria | 16056 |
| 572 | Ga0495676_0068789 | 3300047321 | Bacteria | 2734 |
| 573 | Ga0495680_0057968 | 3300047322 | Bacteria | 2994 |
| 574 | Ga0495683_0079185 | 3300047323 | Bacteria | 1605 |
| 575 | Ga0495686_0004062 | 3300047472 | Bacteria | 12222 |
| 576 | Ga0495686_0014244 | 3300047472 | Bacteria | 5480 |
| 577 | Ga0495602_0192279 | 3300048088 | Bacteria | 1564 |
| 578 | Ga0496100_0016134 | 3300048903 | Unclassified | 4379 |
| 579 | Ga0496100_0036844 | 3300048903 | Bacteria | 3088 |
| 580 | Ga0496100_0075172 | 3300048903 | Bacteria | 2265 |
| 581 | Ga0496100_0080988 | 3300048903 | Bacteria | 2192 |
| 582 | Ga0496100_0086062 | 3300048903 | Bacteria | 2134 |
| 583 | Ga0496100_0091970 | 3300048903 | Bacteria | 2072 |
| 584 | Ga0496100_0101060 | 3300048903 | Bacteria | 1987 |
| 585 | Ga0496101_0008899 | 3300048904 | Bacteria | 6576 |
| 586 | Ga0496101_0025608 | 3300048904 | Bacteria | 4094 |
| 587 | Ga0496101_0032436 | 3300048904 | Bacteria | 3677 |
| 588 | Ga0496101_0040734 | 3300048904 | Bacteria | 3309 |
| 589 | Ga0496101_0056324 | 3300048904 | Bacteria | 2842 |
| 590 | Ga0496101_0056842 | 3300048904 | Bacteria | 2828 |
| 591 | Ga0496101_0060570 | 3300048904 | Bacteria | 2747 |
| 592 | Ga0496101_0061407 | 3300048904 | Bacteria | 2729 |
| 593 | Ga0496101_0091283 | 3300048904 | Bacteria | 2267 |
| 594 | Ga0496101_0094004 | 3300048904 | Bacteria | 2234 |
| 595 | Ga0496101_0124465 | 3300048904 | Bacteria | 1952 |
| 596 | Ga0496102_0001352 | 3300048905 | Bacteria | 21953 |
| 597 | Ga0496102_0010015 | 3300048905 | Bacteria | 8150 |
| 598 | Ga0496102_0104524 | 3300048905 | Bacteria | 2634 |
| 599 | Ga0496102_0665657 | 3300048905 | Bacteria | 964 |
| 600 | Ga0496102_0964556 | 3300048905 | Bacteria | 774 |
| 601 | Ga0496103_0003096 | 3300048906 | Bacteria | 10221 |
| 602 | Ga0496103_0035666 | 3300048906 | Bacteria | 3045 |
| 603 | Ga0496103_0049589 | 3300048906 | Bacteria | 2596 |
| 604 | Ga0496103_0175331 | 3300048906 | Bacteria | 1377 |
| 605 | Ga0496103_0245090 | 3300048906 | Bacteria | 1153 |
| 606 | Ga0496104_0000776 | 3300048907 | Bacteria | 27305 |
| 607 | Ga0496104_0017872 | 3300048907 | Bacteria | 6465 |
| 608 | Ga0496104_0056951 | 3300048907 | Bacteria | 3698 |
| 609 | Ga0496104_0081689 | 3300048907 | Bacteria | 3082 |
| 610 | Ga0496104_0091550 | 3300048907 | Bacteria | 2907 |
| 611 | Ga0496104_0212333 | 3300048907 | Bacteria | 1847 |
| 612 | Ga0496104_0481457 | 3300048907 | Bacteria | 1152 |
| 613 | Ga0496105_0000249 | 3300048908 | Bacteria | 36253 |
| 614 | Ga0496105_0005452 | 3300048908 | Bacteria | 9652 |
| 615 | Ga0496105_0019597 | 3300048908 | Bacteria | 5457 |
| 616 | Ga0496105_0102527 | 3300048908 | Bacteria | 2363 |
| 617 | Ga0496105_0108276 | 3300048908 | Bacteria | 2294 |
| 618 | Ga0496105_0128703 | 3300048908 | Bacteria | 2088 |
| 619 | Ga0496105_0317169 | 3300048908 | Bacteria | 1250 |
| 620 | Ga0496105_0361953 | 3300048908 | Bacteria | 1157 |
| 621 | Ga0496106_0134660 | 3300048909 | Bacteria | 1939 |
| 622 | Ga0496106_0310012 | 3300048909 | Bacteria | 1266 |
| 623 | Ga0496107_0004795 | 3300048910 | Bacteria | 9184 |
| 624 | Ga0496107_0046502 | 3300048910 | Bacteria | 3123 |
| 625 | Ga0496107_0079680 | 3300048910 | Bacteria | 2388 |
| 626 | Ga0496108_0007775 | 3300048911 | Bacteria | 8685 |
| 627 | Ga0496108_0012358 | 3300048911 | Bacteria | 6947 |
| 628 | Ga0496108_0042949 | 3300048911 | Bacteria | 3775 |
| 629 | Ga0496108_0060419 | 3300048911 | Bacteria | 3189 |
| 630 | Ga0496108_0123368 | 3300048911 | Bacteria | 2223 |
| 631 | Ga0496109_0012502 | 3300048912 | Bacteria | 7329 |
| 632 | Ga0496109_0013737 | 3300048912 | Bacteria | 7035 |
| 633 | Ga0496109_0016666 | 3300048912 | Bacteria | 6427 |
| 634 | Ga0496109_0038857 | 3300048912 | Unclassified | 4305 |
| 635 | Ga0496109_0046373 | 3300048912 | Bacteria | 3947 |
| 636 | Ga0496109_0053817 | 3300048912 | Bacteria | 3672 |
| 637 | Ga0496109_0206663 | 3300048912 | Bacteria | 1846 |
| 638 | Ga0496109_0529183 | 3300048912 | Bacteria | 1112 |
| 639 | Ga0496109_0745760 | 3300048912 | Bacteria | 917 |
| 640 | Ga0496110_0000558 | 3300048913 | Bacteria | 25445 |
| 641 | Ga0496110_0013014 | 3300048913 | Bacteria | 6863 |
| 642 | Ga0496110_0021444 | 3300048913 | Bacteria | 5471 |
| 643 | Ga0496110_0058874 | 3300048913 | Bacteria | 3384 |
| 644 | Ga0496110_0184879 | 3300048913 | Bacteria | 1892 |
| 645 | Ga0496110_0424497 | 3300048913 | Bacteria | 1212 |
| 646 | Ga0496111_0000179 | 3300048914 | Bacteria | 28769 |
| 647 | Ga0496111_0059508 | 3300048914 | Unclassified | 2768 |
| 648 | Ga0496111_0072887 | 3300048914 | Bacteria | 2500 |
| 649 | Ga0496111_0142097 | 3300048914 | Bacteria | 1779 |
| 650 | Ga0496111_0148319 | 3300048914 | Bacteria | 1739 |
| 651 | Ga0496112_0000720 | 3300048915 | Bacteria | 22965 |
| 652 | Ga0496112_0008165 | 3300048915 | Bacteria | 9356 |
| 653 | Ga0496112_0039255 | 3300048915 | Bacteria | 4625 |
| 654 | Ga0496112_0100065 | 3300048915 | Bacteria | 2869 |
| 655 | Ga0496112_0153184 | 3300048915 | Bacteria | 2272 |
| 656 | Ga0496112_0255134 | 3300048915 | Bacteria | 1704 |
| 657 | Ga0496112_0383611 | 3300048915 | Bacteria | 1346 |
| 658 | Ga0496112_0976951 | 3300048915 | Bacteria | 767 |
| 659 | Ga0496113_0022997 | 3300048916 | Bacteria | 4417 |
| 660 | Ga0496113_0044165 | 3300048916 | Bacteria | 3300 |
| 661 | Ga0496113_0214526 | 3300048916 | Bacteria | 1533 |
| 662 | Ga0496113_0272750 | 3300048916 | Bacteria | 1352 |
| 663 | Ga0496114_0014049 | 3300048917 | Bacteria | 6421 |
| 664 | Ga0496114_0016663 | 3300048917 | Bacteria | 5926 |
| 665 | Ga0496114_0020686 | 3300048917 | Bacteria | 5341 |
| 666 | Ga0496114_0046712 | 3300048917 | Bacteria | 3599 |
| 667 | Ga0496114_0098946 | 3300048917 | Bacteria | 2487 |
| 668 | Ga0496114_0129565 | 3300048917 | Bacteria | 2177 |
| 669 | Ga0496114_0142068 | 3300048917 | Bacteria | 2079 |
| 670 | Ga0496114_0144339 | 3300048917 | Bacteria | 2063 |
| 671 | Ga0496114_0177714 | 3300048917 | Bacteria | 1858 |
| 672 | Ga0496114_0287066 | 3300048917 | Bacteria | 1451 |
| 673 | Ga0496114_0385631 | 3300048917 | Bacteria | 1241 |
| 674 | Ga0496114_0423794 | 3300048917 | Bacteria | 1179 |
| 675 | Ga0496114_0996883 | 3300048917 | Bacteria | 721 |
| 676 | Ga0496115_0070757 | 3300048918 | Bacteria | 2828 |
| 677 | Ga0496115_0089377 | 3300048918 | Bacteria | 2516 |
| 678 | Ga0496115_0102342 | 3300048918 | Bacteria | 2349 |
| 679 | Ga0496115_0185494 | 3300048918 | Bacteria | 1719 |
| 680 | Ga0496115_0186238 | 3300048918 | Bacteria | 1715 |
| 681 | Ga0496115_0512298 | 3300048918 | Bacteria | 963 |
| 682 | Ga0496117_0020000 | 3300048920 | Bacteria | 5475 |
| 683 | Ga0496117_0024391 | 3300048920 | Bacteria | 4785 |
| 684 | Ga0496120_0031106 | 3300048923 | Bacteria | 3237 |
| 685 | Ga0496122_0011269 | 3300048925 | Bacteria | 9082 |
| 686 | Ga0496123_0000325 | 3300048926 | Bacteria | 90905 |
| 687 | Ga0496126_0340456 | 3300048929 | Bacteria | 1229 |
| 688 | Ga0501031_0108038 | 3300049568 | Bacteria | 1816 |
| 689 | Ga0501034_0296470 | 3300049571 | Bacteria | 1554 |
| 690 | Ga0501039_0379150 | 3300049575 | Bacteria | 1111 |
| 691 | Ga0501041_0166758 | 3300049577 | Bacteria | 1378 |
| 692 | Ga0501041_0292665 | 3300049577 | Bacteria | 1026 |
| 693 | Ga0501042_0250487 | 3300049578 | Bacteria | 1278 |
| 694 | Ga0501047_0438145 | 3300049581 | Bacteria | 1137 |
| 695 | Ga0501067_0031654 | 3300049583 | Bacteria | 2935 |
| 696 | Ga0501067_0204633 | 3300049583 | Bacteria | 1099 |
| 697 | Ga0501068_0027585 | 3300049584 | Bacteria | 3354 |
| 698 | Ga0501068_0646350 | 3300049584 | Bacteria | 690 |
| 699 | Ga0501069_0009504 | 3300049585 | Bacteria | 5132 |
| 700 | Ga0501070_0000191 | 3300049586 | Bacteria | 57453 |
| 701 | Ga0501070_0000616 | 3300049586 | Bacteria | 32679 |
| 702 | Ga0501072_0136849 | 3300049588 | Bacteria | 1953 |
| 703 | Ga0501072_0416578 | 3300049588 | Bacteria | 1065 |
| 704 | Ga0501073_0118445 | 3300049589 | Bacteria | 1835 |
| 705 | Ga0501073_0272824 | 3300049589 | Bacteria | 1167 |
| 706 | Ga0501074_0337685 | 3300049590 | Bacteria | 1069 |
| 707 | Ga0501076_0531822 | 3300049592 | Bacteria | 969 |
| 708 | Ga0501076_0658654 | 3300049592 | Bacteria | 864 |
| 709 | Ga0501077_0270077 | 3300049593 | Bacteria | 1082 |
| 710 | Ga0501080_0027766 | 3300049742 | Bacteria | 5263 |
| 711 | Ga0501080_0083539 | 3300049742 | Bacteria | 2967 |
| 712 | Ga0501080_0168222 | 3300049742 | Bacteria | 2023 |
| 713 | Ga0501080_0623699 | 3300049742 | Bacteria | 956 |
| 714 | Ga0501044_0732840 | 3300049823 | Bacteria | 872 |
| 715 | Ga0501045_0914768 | 3300049824 | Bacteria | 644 |
| 716 | nmdc:mga00v17_169043_c1 | 3300050491 | Bacteria | 1409 |
| 717 | nmdc:mga05p37_1210_c1 | 3300050507 | Bacteria | 29876 |
| 718 | nmdc:mga05p37_184809_c1 | 3300050507 | Bacteria | 2535 |
| 719 | nmdc:mga09592_5973_c1 | 3300050508 | Bacteria | 9925 |
| 720 | nmdc:mga09592_86912_c1 | 3300050508 | Bacteria | 2669 |
| 721 | nmdc:mga0qj67_18060_c1 | 3300050509 | Bacteria | 5373 |
| 722 | nmdc:mga06r32_103_c1 | 3300050510 | Bacteria | 59117 |
| 723 | nmdc:mga06r32_71924_c1 | 3300050510 | Bacteria | 3348 |
| 724 | nmdc:mga08y16_398529_c1 | 3300050511 | Bacteria | 1409 |
| 725 | nmdc:mga08y16_52388_c1 | 3300050511 | Bacteria | 4270 |
| 726 | nmdc:mga08y16_74223_c1 | 3300050511 | Bacteria | 3544 |
| 727 | nmdc:mga08y16_771027_c1 | 3300050511 | Bacteria | 956 |
| 728 | nmdc:mga0n895_1296544_c1 | 3300050512 | Bacteria | 699 |
| 729 | nmdc:mga0n895_14015_c1 | 3300050512 | Bacteria | 7263 |
| 730 | nmdc:mga0n895_37878_c2 | 3300050512 | Bacteria | 3924 |
| 731 | nmdc:mga0n895_619329_c1 | 3300050512 | Bacteria | 1083 |
| 732 | nmdc:mga0rr50_47503_c1 | 3300050513 | Bacteria | 3167 |
| 733 | nmdc:mga0a205_49460_c1 | 3300050515 | Bacteria | 4058 |
| 734 | nmdc:mga0a205_545251_c1 | 3300050515 | Bacteria | 1015 |
| 735 | nmdc:mga0a205_79600_c1 | 3300050515 | Bacteria | 3166 |
| 736 | Ga0495601_0001791 | 3300053077 | Bacteria | 11919 |
| 737 | Ga0495601_0129362 | 3300053077 | Unclassified | 1644 |
| 738 | Ga0495612_0004643 | 3300053078 | Bacteria | 5688 |
| 739 | Ga0495612_0044354 | 3300053078 | Bacteria | 1819 |
| 740 | Ga0500635_0000006 | 3300053080 | Bacteria | 187108 |
| 741 | Ga0495619_0081457 | 3300053085 | Bacteria | 2179 |
| 742 | Ga0495619_0097497 | 3300053085 | Bacteria | 1998 |
| 743 | Ga0495619_0203555 | 3300053085 | Bacteria | 1370 |
| 744 | Ga0500643_003401 | 3300053087 | Bacteria | 7681 |
| 745 | Ga0500564_162565 | 3300053138 | Bacteria | 944 |
| 746 | Ga0501082_0567435 | 3300060353 | Bacteria | 993 |
| 747 | Ga0466962_0006426 | 3300061719 | Bacteria | 5641 |
| 748 | Ga0466962_0011375 | 3300061719 | Bacteria | 4286 |
| 749 | Ga0466962_0141556 | 3300061719 | Bacteria | 1165 |
| 750 | Ga0466962_0215934 | 3300061719 | Bacteria | 939 |
| 751 | Ga0530510_0385784 | 3300061734 | Bacteria | 1055 |
| 752 | 2512731047 | 2512564039 | Bacteria | 8739048 |
| 753 | 2595088405 | 2593339131 | Bacteria | 5116855 |
| 754 | 2643887354 | 2643221575 | Bacteria | 4022601 |
| 755 | 2643891435 | 2643221576 | Bacteria | 5214352 |
| 756 | 2643960483 | 2643221590 | Bacteria | 5214697 |
| 757 | 2644220968 | 2643221639 | Bacteria | 6649903 |
| 758 | 2644262292 | 2643221647 | Bacteria | 10741251 |
| 759 | 2676485687 | 2675903059 | Bacteria | 8644972 |
| 760 | 2739606808 | 2739367654 | Bacteria | 6049412 |
| 761 | 2760620886 | 2758568621 | Bacteria | 5967089 |
| 762 | 2777762972 | 2775507177 | Bacteria | 4384303 |
| 763 | 2777835554 | 2775507192 | Bacteria | 4622234 |
| 764 | 2785368912 | 2784746768 | Bacteria | 10036182 |
| 765 | 2786673960 | 2786546132 | Bacteria | 10419719 |
| 766 | 2809025673 | 2808606394 | Bacteria | 6248540 |
| 767 | 2831936221 | 2831935698 | Bacteria | 5963223 |
| 768 | 2833712849 | 2833709550 | Bacteria | 4008291 |
| 769 | 2867432952 | 2867428634 | Bacteria | 9590268 |
| 770 | 2877681094 | 2877676314 | Bacteria | 9512378 |
| 771 | 2884766676 | 2884763398 | Bacteria | 4091164 |
| 772 | 2919055455 | 2919055335 | Bacteria | 3875751 |
| 773 | 2919524695 | 2919523602 | Bacteria | 3788128 |
| 774 | 2928153604 | 2928153084 | Bacteria | 4020257 |
| 775 | 2936343826 | 2936340661 | Bacteria | 5139038 |
| 776 | 2946034467 | 2946033335 | Bacteria | 3835514 |
| 777 | 2954681457 | 2954673503 | Bacteria | 9685905 |
| 778 | 2954682701 | 2954682443 | Bacteria | 9862841 |
| 779 | 2954696861 | 2954691527 | Bacteria | 10720516 |
| 780 | 2954705275 | 2954701450 | Bacteria | 10834262 |
| 781 | 2995464429 | 2995463766 | Bacteria | 8577691 |
| 782 | 3006326754 | 3006321560 | Bacteria | 8247479 |
| 783 | 3006977331 | 3006973921 | Bacteria | 4423788 |
| 784 | 8046353242 | 8046352972 | Bacteria | 3613806 |
| 785 | Ga0068852_100341818 | |||
| 786 | JGI24740J21852_10078230 | |||
| 787 | JGI24739J22299_10128270 | |||
| 788 | JGI24737J22298_10017764 | |||
| 789 | JGI24735J21928_10000224 | |||
| 790 | JGI25162J39368_1010465 | |||
| 791 | JGI25164J39214_1000948 | |||
| 792 | JGI25151J46595_10010208 | |||
| 793 | JGI25165J46597_1000055 | |||
| 794 | rootL2_10207484 | |||
| 795 | rootH1_10001183 | |||
| 796 | rootH1_10156117 | |||
| 797 | Ga0006562J51391_1065468 | |||
| 798 | Ga0055532_1000126 | |||
| 799 | Ga0055535_1000039 | |||
| 800 | Ga0055529_1000135 | |||
| 801 | JGI25405J52794_10003995 | |||
| 802 | JGI25405J52794_10005185 | |||
| 803 | Ga0065715_10219328 | |||
| 804 | Ga0065707_10497809 | |||
| 805 | Ga0070658_10044575 | |||
| 806 | Ga0070658_10048274 | |||
| 807 | Ga0070658_10057313 | |||
| 808 | Ga0070658_10142941 | |||
| 809 | Ga0070658_10150282 | |||
| 810 | Ga0070658_10710588 | |||
| 811 | Ga0070676_10087329 | |||
| 812 | Ga0070676_10272391 | |||
| 813 | Ga0070683_100009712 | |||
| 814 | Ga0070683_100150985 | |||
| 815 | Ga0070683_100707296 | |||
| 816 | Ga0070690_100045195 | |||
| 817 | Ga0070690_100060525 | |||
| 818 | Ga0070670_100009582 | |||
| 819 | Ga0070670_100025933 | |||
| 820 | Ga0070670_100043602 | |||
| 821 | Ga0070670_100141583 | |||
| 822 | Ga0070677_10033531 | |||
| 823 | Ga0070677_10279051 | |||
| 824 | Ga0068869_100270187 | |||
| 825 | Ga0070666_10050917 | |||
| 826 | Ga0070666_10130525 | |||
| 827 | Ga0070680_100090903 | |||
| 828 | Ga0070680_100710803 | |||
| 829 | Ga0070682_100021431 | |||
| 830 | Ga0068868_100059878 | |||
| 831 | Ga0068868_100564297 | |||
| 832 | Ga0068868_100803255 | |||
| 833 | Ga0070691_10003906 | |||
| 834 | Ga0070687_100050198 | |||
| 835 | Ga0070661_100377431 | |||
| 836 | Ga0070692_10129332 | |||
| 837 | Ga0070692_10577987 | |||
| 838 | Ga0070668_100001475 | |||
| 839 | Ga0070668_100035343 | |||
| 840 | Ga0070668_100044214 | |||
| 841 | Ga0070668_100365800 | |||
| 842 | Ga0070669_100027066 | |||
| 843 | Ga0070669_100091113 | |||
| 844 | Ga0070675_100009169 | |||
| 845 | Ga0070675_100667346 | |||
| 846 | Ga0070671_100093445 | |||
| 847 | Ga0070671_100179701 | |||
| 848 | Ga0070671_100191022 | |||
| 849 | Ga0070671_100291163 | |||
| 850 | Ga0070671_100340387 | |||
| 851 | Ga0070674_100034386 | |||
| 852 | Ga0070674_100112115 | |||
| 853 | Ga0070673_100106973 | |||
| 854 | Ga0070673_100527185 | |||
| 855 | Ga0070659_100523511 | |||
| 856 | Ga0070659_100569770 | |||
| 857 | Ga0070703_10040736 | |||
| 858 | Ga0070709_10062138 | |||
| 859 | Ga0070714_100003706 | |||
| 860 | Ga0070714_100004313 | |||
| 861 | Ga0070714_100559936 | |||
| 862 | Ga0070713_100002030 | |||
| 863 | Ga0070713_100154564 | |||
| 864 | Ga0070713_100238472 | |||
| 865 | Ga0070713_100904018 | |||
| 866 | Ga0070710_10281982 | |||
| 867 | Ga0070694_100259857 | |||
| 868 | Ga0070708_100042662 | |||
| 869 | Ga0070708_100151683 | |||
| 870 | Ga0070663_100000256 | |||
| 871 | Ga0070663_100141030 | |||
| 872 | Ga0070663_100150751 | |||
| 873 | Ga0070678_100006989 | |||
| 874 | Ga0070678_100021719 | |||
| 875 | Ga0070678_100232562 | |||
| 876 | Ga0070678_100317700 | |||
| 877 | Ga0070662_100096520 | |||
| 878 | Ga0070662_100112349 | |||
| 879 | Ga0070662_100179568 | |||
| 880 | Ga0070681_10164369 | |||
| 881 | Ga0070681_10235269 | |||
| 882 | Ga0070685_10251455 | |||
| 883 | Ga0070706_100012058 | |||
| 884 | Ga0070706_100025024 | |||
| 885 | Ga0070706_100029759 | |||
| 886 | Ga0070706_100041719 | |||
| 887 | Ga0070706_100159584 | |||
| 888 | Ga0070679_100086435 | |||
| 889 | Ga0070679_100161515 | |||
| 890 | Ga0070679_100772065 | |||
| 891 | Ga0070684_100001001 | |||
| 892 | Ga0070684_100006064 | |||
| 893 | Ga0070684_100007391 | |||
| 894 | Ga0070684_100020655 | |||
| 895 | Ga0070684_100230470 | |||
| 896 | Ga0070684_100518396 | |||
| 897 | Ga0068853_100043059 | |||
| 898 | Ga0068853_101071072 | |||
| 899 | Ga0070672_100001029 | |||
| 900 | Ga0070672_100008699 | |||
| 901 | Ga0070686_100036578 | |||
| 902 | Ga0070686_100221456 | |||
| 903 | Ga0070686_100309300 | |||
| 904 | Ga0070686_100412714 | |||
| 905 | Ga0070686_100523313 | |||
| 906 | Ga0070693_100289190 | |||
| 907 | Ga0070665_100151800 | |||
| 908 | Ga0068855_100337662 | |||
| 909 | Ga0070664_100018399 | |||
| 910 | Ga0070664_100122580 | |||
| 911 | Ga0070664_100194071 | |||
| 912 | Ga0070664_100212112 | |||
| 913 | Ga0070664_100555766 | |||
| 914 | Ga0068857_100008650 | |||
| 915 | Ga0068857_100020906 | |||
| 916 | Ga0068854_100530275 | |||
| 917 | Ga0068856_100011581 | |||
| 918 | Ga0068856_100595329 | |||
| 919 | Ga0068856_100708029 | |||
| 920 | Ga0068852_100479955 | |||
| 921 | Ga0068864_100247518 | |||
| 922 | Ga0068864_100431970 | |||
| 923 | Ga0068861_100054019 | |||
| 924 | Ga0068861_100191382 | |||
| 925 | Ga0068870_10152410 | |||
| 926 | Ga0068870_10193255 | |||
| 927 | Ga0068863_100007193 | |||
| 928 | Ga0068863_100433487 | |||
| 929 | Ga0068860_100472011 | |||
| 930 | Ga0068862_100006998 | |||
| 931 | Ga0068862_100025953 | |||
| 932 | Ga0068862_100177340 | |||
| 933 | Ga0081455_10001241 | |||
| 934 | Ga0081540_1031249 | |||
| 935 | Ga0070717_10343667 | |||
| 936 | Ga0070717_10445123 | |||
| 937 | Ga0070717_10491475 | |||
| 938 | Ga0075365_10387182 | |||
| 939 | Ga0075363_100041996 | |||
| 940 | Ga0075364_10160551 | |||
| 941 | Ga0070716_100172284 | |||
| 942 | Ga0070712_100260332 | |||
| 943 | Ga0070712_100459323 | |||
| 944 | Ga0075427_10010716 | |||
| 945 | Ga0097621_100166550 | |||
| 946 | Ga0097621_100236243 | |||
| 947 | Ga0097621_100324469 | |||
| 948 | Ga0068871_100411691 | |||
| 949 | Ga0068871_100504823 | |||
| 950 | Ga0075428_100007320 | |||
| 951 | Ga0075428_100140570 | |||
| 952 | Ga0075430_100017488 | |||
| 953 | Ga0075431_100015131 | |||
| 954 | Ga0075431_100054149 | |||
| 955 | Ga0075431_100763516 | |||
| 956 | Ga0075434_100002284 | |||
| 957 | Ga0075434_100081535 | |||
| 958 | Ga0075429_100003274 | |||
| 959 | Ga0075429_100008178 | |||
| 960 | Ga0075429_100104862 | |||
| 961 | Ga0068865_100028806 | |||
| 962 | Ga0068865_100399351 | |||
| 963 | Ga0068865_100591834 | |||
| 964 | Ga0075436_100447832 | |||
| 965 | Ga0105244_10007172 | |||
| 966 | Ga0105244_10007296 | |||
| 967 | Ga0105244_10028404 | |||
| 968 | Ga0105240_10000006 | |||
| 969 | Ga0105240_10085663 | |||
| 970 | Ga0111539_10017610 | |||
| 971 | Ga0111539_10074845 | |||
| 972 | Ga0111539_10183599 | |||
| 973 | Ga0105245_10022927 | |||
| 974 | Ga0105245_10083060 | |||
| 975 | Ga0105245_10277782 | |||
| 976 | Ga0105245_10277855 | |||
| 977 | Ga0105245_10335713 | |||
| 978 | Ga0105245_10919738 | |||
| 979 | Ga0105247_10112116 | |||
| 980 | Ga0105247_10216505 | |||
| 981 | Ga0114129_10810025 | |||
| 982 | Ga0105243_10000331 | |||
| 983 | Ga0105243_10029500 | |||
| 984 | Ga0105243_10085408 | |||
| 985 | Ga0105243_10117882 | |||
| 986 | Ga0105243_10677168 | |||
| 987 | Ga0105241_10017584 | |||
| 988 | Ga0105241_10725978 | |||
| 989 | Ga0105241_10793880 | |||
| 990 | Ga0105242_10124405 | |||
| 991 | Ga0105242_10126583 | |||
| 992 | Ga0105242_10133171 | |||
| 993 | Ga0105248_10000431 | |||
| 994 | Ga0105248_10125942 | |||
| 995 | Ga0105248_10160798 | |||
| 996 | Ga0105248_10570762 | |||
| 997 | Ga0105237_10087115 | |||
| 998 | Ga0105237_10161205 | |||
| 999 | Ga0105238_10055911 | |||
| 1000 | Ga0105238_10272830 | |||
| 1001 | Ga0105238_10450743 | |||
| 1002 | Ga0105249_10000222 | |||
| 1003 | Ga0105249_10157789 | |||
| 1004 | Ga0105249_10873785 | |||
| 1005 | Ga0105239_10009542 | |||
| 1006 | Ga0105239_10029425 | |||
| 1007 | Ga0105239_10109750 | |||
| 1008 | Ga0105239_10140519 | |||
| 1009 | Ga0105239_10639588 | |||
| 1010 | Ga0105239_11199547 | |||
| 1011 | Ga0105246_10356259 | |||
| 1012 | Ga0105246_10826547 | |||
| 1013 | Ga0157373_10137889 | |||
| 1014 | Ga0157371_10120458 | |||
| 1015 | Ga0157371_10356597 | |||
| 1016 | Ga0157371_10362620 | |||
| 1017 | Ga0157371_10444489 | |||
| 1018 | Ga0157370_10173797 | |||
| 1019 | Ga0157370_10485583 | |||
| 1020 | Ga0157369_10005856 | |||
| 1021 | Ga0157369_10029178 | |||
| 1022 | Ga0157369_10030077 | |||
| 1023 | Ga0157369_10491869 | |||
| 1024 | Ga0157369_11248739 | |||
| 1025 | Ga0157374_10139808 | |||
| 1026 | Ga0157374_10204601 | |||
| 1027 | Ga0157378_10100223 | |||
| 1028 | Ga0157378_10223200 | |||
| 1029 | Ga0157378_11287040 | |||
| 1030 | Ga0163162_10000070 | |||
| 1031 | Ga0163162_10010023 | |||
| 1032 | Ga0163162_10278147 | |||
| 1033 | Ga0163162_10417465 | |||
| 1034 | Ga0157372_10026969 | |||
| 1035 | Ga0157372_10114177 | |||
| 1036 | Ga0157372_10192253 | |||
| 1037 | Ga0157375_10232794 | |||
| 1038 | Ga0157375_10387439 | |||
| 1039 | Ga0157375_10391103 | |||
| 1040 | Ga0157375_10532735 | |||
| 1041 | Ga0157375_10550595 | |||
| 1042 | Ga0163163_10010889 | |||
| 1043 | Ga0163163_10096536 | |||
| 1044 | Ga0163163_10519906 | |||
| 1045 | Ga0163163_10821903 | |||
| 1046 | Ga0157377_10217116 | |||
| 1047 | Ga0157379_10014975 | |||
| 1048 | Ga0157379_10199642 | |||
| 1049 | Ga0157379_10850113 | |||
| 1050 | Ga0157376_10132003 | |||
| 1051 | Ga0157376_10152289 | |||
| 1052 | Ga0157376_10152959 | |||
| 1053 | Ga0163161_10006854 | |||
| 1054 | Ga0206354_10106083 | |||
| 1055 | Ga0209147_100182 | |||
| 1056 | Ga0209563_100503 | |||
| 1057 | Ga0207427_100054 | |||
| 1058 | Ga0207427_101407 | |||
| 1059 | Ga0209437_101027 | |||
| 1060 | Ga0209258_100025 | |||
| 1061 | Ga0209148_1004968 | |||
| 1062 | Ga0209759_1002410 | |||
| 1063 | Ga0209759_1009451 | |||
| 1064 | Ga0209759_1028879 | |||
| 1065 | Ga0209759_1034742 | |||
| 1066 | Ga0209233_1000001 | |||
| 1067 | Ga0209455_1000089 | |||
| 1068 | Ga0209676_1001904 | |||
| 1069 | Ga0209025_1000626 | |||
| 1070 | Ga0207697_10029007 | |||
| 1071 | Ga0207656_10098382 | |||
| 1072 | Ga0207655_1001384 | |||
| 1073 | Ga0207655_1003194 | |||
| 1074 | Ga0207682_10063822 | |||
| 1075 | Ga0207692_10142534 | |||
| 1076 | Ga0207642_10219454 | |||
| 1077 | Ga0207642_10247976 | |||
| 1078 | Ga0207688_10272690 | |||
| 1079 | Ga0207680_10017139 | |||
| 1080 | Ga0207680_10119715 | |||
| 1081 | Ga0207699_10028044 | |||
| 1082 | Ga0207699_10292478 | |||
| 1083 | Ga0207645_10052717 | |||
| 1084 | Ga0207645_10213986 | |||
| 1085 | Ga0207643_10041061 | |||
| 1086 | Ga0207643_10318850 | |||
| 1087 | Ga0207705_10152915 | |||
| 1088 | Ga0207705_10530290 | |||
| 1089 | Ga0207684_10055195 | |||
| 1090 | Ga0207684_10064156 | |||
| 1091 | Ga0207684_10151102 | |||
| 1092 | Ga0207707_10075958 | |||
| 1093 | Ga0207707_10080972 | |||
| 1094 | Ga0207695_10000017 | |||
| 1095 | Ga0207695_10579075 | |||
| 1096 | Ga0207695_10768591 | |||
| 1097 | Ga0207693_10201550 | |||
| 1098 | Ga0207693_10398376 | |||
| 1099 | Ga0207693_10411749 | |||
| 1100 | Ga0207663_10063820 | |||
| 1101 | Ga0207660_10075691 | |||
| 1102 | Ga0207660_10221062 | |||
| 1103 | Ga0207662_10004512 | |||
| 1104 | Ga0207662_10137551 | |||
| 1105 | Ga0207657_10010889 | |||
| 1106 | Ga0207649_10060830 | |||
| 1107 | Ga0207649_10418306 | |||
| 1108 | Ga0207652_10127938 | |||
| 1109 | Ga0207652_10302588 | |||
| 1110 | Ga0207646_10141234 | |||
| 1111 | Ga0207694_10195487 | |||
| 1112 | Ga0207650_10049753 | |||
| 1113 | Ga0207650_10121923 | |||
| 1114 | Ga0207659_10022431 | |||
| 1115 | Ga0207659_10114874 | |||
| 1116 | Ga0207659_10626672 | |||
| 1117 | Ga0207687_10090253 | |||
| 1118 | Ga0207700_10000679 | |||
| 1119 | Ga0207700_10144196 | |||
| 1120 | Ga0207700_10221320 | |||
| 1121 | Ga0207700_10414526 | |||
| 1122 | Ga0207664_10000334 | |||
| 1123 | Ga0207664_10107005 | |||
| 1124 | Ga0207664_10315571 | |||
| 1125 | Ga0207664_10654655 | |||
| 1126 | Ga0207644_10154029 | |||
| 1127 | Ga0207644_10181911 | |||
| 1128 | Ga0207690_10113466 | |||
| 1129 | Ga0207690_10129305 | |||
| 1130 | Ga0207706_10024022 | |||
| 1131 | Ga0207706_10025773 | |||
| 1132 | Ga0207706_10049980 | |||
| 1133 | Ga0207686_10076060 | |||
| 1134 | Ga0207686_10392512 | |||
| 1135 | Ga0207686_10808051 | |||
| 1136 | Ga0207709_10000796 | |||
| 1137 | Ga0207709_10004329 | |||
| 1138 | Ga0207709_10041288 | |||
| 1139 | Ga0207709_10128787 | |||
| 1140 | Ga0207709_10420124 | |||
| 1141 | Ga0207669_10360616 | |||
| 1142 | Ga0207669_10487265 | |||
| 1143 | Ga0207704_10334851 | |||
| 1144 | Ga0207665_10029840 | |||
| 1145 | Ga0207691_10009825 | |||
| 1146 | Ga0207691_10018724 | |||
| 1147 | Ga0207691_10094126 | |||
| 1148 | Ga0207691_10281861 | |||
| 1149 | Ga0207691_10336931 | |||
| 1150 | Ga0207711_10007521 | |||
| 1151 | Ga0207711_10285211 | |||
| 1152 | Ga0207711_10374045 | |||
| 1153 | Ga0207689_10048803 | |||
| 1154 | Ga0207689_10148618 | |||
| 1155 | Ga0207661_10003117 | |||
| 1156 | Ga0207661_10012544 | |||
| 1157 | Ga0207661_10180011 | |||
| 1158 | Ga0207661_10689102 | |||
| 1159 | Ga0207679_10016133 | |||
| 1160 | Ga0207679_10220497 | |||
| 1161 | Ga0207679_10259279 | |||
| 1162 | Ga0207679_10563754 | |||
| 1163 | Ga0207679_10588793 | |||
| 1164 | Ga0207667_10087206 | |||
| 1165 | Ga0207667_10161964 | |||
| 1166 | Ga0207651_10282859 | |||
| 1167 | Ga0207651_10916710 | |||
| 1168 | Ga0207712_10000248 | |||
| 1169 | Ga0207712_10065937 | |||
| 1170 | Ga0207712_10315058 | |||
| 1171 | Ga0207668_10000696 | |||
| 1172 | Ga0207668_10002618 | |||
| 1173 | Ga0207640_10039993 | |||
| 1174 | Ga0207640_10697196 | |||
| 1175 | Ga0207658_10000006 | |||
| 1176 | Ga0207658_10687251 | |||
| 1177 | Ga0207677_10203873 | |||
| 1178 | Ga0207677_10236304 | |||
| 1179 | Ga0207677_10405039 | |||
| 1180 | Ga0207677_10473421 | |||
| 1181 | Ga0207639_10594639 | |||
| 1182 | Ga0207678_10000081 | |||
| 1183 | Ga0207678_10046093 | |||
| 1184 | Ga0207708_10071836 | |||
| 1185 | Ga0207702_10007434 | |||
| 1186 | Ga0207702_10059300 | |||
| 1187 | Ga0207702_10116619 | |||
| 1188 | Ga0207641_10549029 | |||
| 1189 | Ga0207648_10077707 | |||
| 1190 | Ga0207676_10781551 | |||
| 1191 | Ga0207676_11400049 | |||
| 1192 | Ga0207674_10005880 | |||
| 1193 | Ga0207674_10021117 | |||
| 1194 | Ga0207674_10057638 | |||
| 1195 | Ga0207675_100022691 | |||
| 1196 | Ga0207675_100201770 | |||
| 1197 | Ga0207683_10003689 | |||
| 1198 | Ga0207683_10010414 | |||
| 1199 | Ga0207683_10122954 | |||
| 1200 | Ga0207683_10279095 | |||
| 1201 | Ga0207683_10433346 | |||
| 1202 | Ga0207683_10743869 | |||
| 1203 | Ga0207698_10422453 | |||
| 1204 | Ga0207698_11008306 | |||
| 1205 | Ga0209982_1007191 | |||
| 1206 | Ga0209983_1016998 | |||
| 1207 | Ga0209971_1034305 | |||
| 1208 | Ga0209974_10004085 | |||
| 1209 | Ga0207428_10005829 | |||
| 1210 | Ga0268265_10008291 | |||
| 1211 | Ga0268265_10032451 | |||
| 1212 | Ga0268265_10122030 | |||
| 1213 | Ga0268265_10411966 | |||
| 1214 | Ga0307515_10079574 | |||
| 1215 | Ga0307515_10214459 | |||
| 1216 | Ga0265324_10021253 | |||
| 1217 | Ga0307512_10044588 | |||
| 1218 | Ga0307513_10015145 | |||
| 1219 | Ga0307509_10083773 | |||
| 1220 | Ga0307509_10175322 | |||
| 1221 | Ga0307408_100019010 | |||
| 1222 | Ga0307508_10092965 | |||
| 1223 | Ga0316576_10004048 | |||
| 1224 | Ga0307410_10001645 | |||
| 1225 | Ga0307410_10029536 | |||
| 1226 | Ga0307406_10023363 | |||
| 1227 | Ga0307406_10239560 | |||
| 1228 | Ga0307412_10516305 | |||
| 1229 | Ga0307409_100002779 | |||
| 1230 | Ga0307409_100028713 | |||
| 1231 | Ga0307409_100424275 | |||
| 1232 | Ga0307409_100464327 | |||
| 1233 | Ga0307409_100516720 | |||
| 1234 | Ga0307416_100003733 | |||
| 1235 | Ga0307416_100007009 | |||
| 1236 | Ga0307416_100914524 | |||
| 1237 | Ga0373950_0007331 | |||
| 1238 | Ga0373929_0038503 | |||
| 1239 | Ga0373940_0004644 | |||
| 1240 | Ga0373952_0061094 | |||
| 1241 | Ga0373936_0223839 | |||
| 1242 | Ga0373941_0015557 | |||
| 1243 | Ga0373943_0037187 | |||
| 1244 | Ga0373942_0000193 | |||
| 1245 | Ga0373961_0079198 | |||
| 1246 | Ga0373931_0048754 | |||
| 1247 | Ga0373947_0000499 | |||
| 1248 | Ga0316584_0004737 | |||
| 1249 | Ga0373925_0034405 | |||
| 1250 | Ga0373925_0419025 | |||
| 1251 | Ga0395899_0134024 | |||
| 1252 | Ga0395899_0168425 | |||
| 1253 | Ga0395900_0055722 | |||
| 1254 | Ga0395900_0099129 | |||
| 1255 | Ga0395900_0915263 | |||
| 1256 | Ga0395898_0620617 | |||
| 1257 | Ga0395901_0013899 | |||
| 1258 | Ga0395901_0645835 | |||
| 1259 | Ga0436365_0405671 | |||
| 1260 | Ga0436365_0644389 | |||
| 1261 | Ga0436363_0373467 | |||
| 1262 | Ga0436363_1243520 | |||
| 1263 | Ga0439465_0025585 | |||
| 1264 | Ga0451791_0530061 | |||
| 1265 | Ga0451841_0532751 | |||
| 1266 | Ga0451845_0173964 | |||
| 1267 | Ga0451843_1743438 | |||
| 1268 | Ga0451853_1153975 | |||
| 1269 | Ga0439448_0012760 | |||
| 1270 | Ga0450910_012195 | |||
| 1271 | Ga0453683_0075451 | |||
| 1272 | Ga0466965_0020292 | |||
| 1273 | Ga0466966_0040111 | |||
| 1274 | Ga0466966_0043115 | |||
| 1275 | Ga0466961_0012693 | |||
| 1276 | Ga0466961_0014555 | |||
| 1277 | Ga0466961_0030240 | |||
| 1278 | Ga0466961_0116426 | |||
| 1279 | Ga0466963_0005367 | |||
| 1280 | Ga0466963_0008142 | |||
| 1281 | Ga0466963_0013616 | |||
| 1282 | Ga0466963_0018797 | |||
| 1283 | Ga0466963_0054650 | |||
| 1284 | Ga0466963_0143579 | |||
| 1285 | Ga0466963_0160354 | |||
| 1286 | Ga0466963_0196867 | |||
| 1287 | Ga0466964_0053902 | |||
| 1288 | Ga0466964_0080083 | |||
| 1289 | Ga0453684_0314782 | |||
| 1290 | Ga0466971_0031917 | |||
| 1291 | Ga0466971_0047995 | |||
| 1292 | Ga0466968_0004035 | |||
| 1293 | Ga0466968_0024630 | |||
| 1294 | Ga0466968_0037317 | |||
| 1295 | Ga0466970_0114815 | |||
| 1296 | Ga0466957_0076205 | |||
| 1297 | Ga0466957_0076378 | |||
| 1298 | Ga0466957_0130224 | |||
| 1299 | Ga0466957_0253619 | |||
| 1300 | Ga0466957_0725455 | |||
| 1301 | Ga0466960_0007002 | |||
| 1302 | Ga0466959_0021777 | |||
| 1303 | Ga0466959_0023956 | |||
| 1304 | Ga0451576_0124242 | |||
| 1305 | Ga0466958_0001569 | |||
| 1306 | Ga0466958_0003106 | |||
| 1307 | Ga0466958_0021073 | |||
| 1308 | Ga0466958_0038834 | |||
| 1309 | Ga0466958_0074848 | |||
| 1310 | Ga0466967_0043588 | |||
| 1311 | Ga0466967_0090309 | |||
| 1312 | Ga0466967_0100477 | |||
| 1313 | Ga0466967_0227045 | |||
| 1314 | Ga0466967_0228834 | |||
| 1315 | Ga0466967_0929383 | |||
| 1316 | Ga0495603_0000566 | |||
| 1317 | Ga0495629_0154275 | |||
| 1318 | Ga0495629_0155287 | |||
| 1319 | Ga0495641_0000953 | |||
| 1320 | Ga0495653_0188468 | |||
| 1321 | Ga0495580_0247026 | |||
| 1322 | Ga0495582_0061833 | |||
| 1323 | Ga0495584_0093040 | |||
| 1324 | Ga0495585_0024790 | |||
| 1325 | Ga0495594_0002981 | |||
| 1326 | Ga0495583_0000123 | |||
| 1327 | Ga0495606_0002067 | |||
| 1328 | Ga0495618_0005583 | |||
| 1329 | Ga0495628_0064349 | |||
| 1330 | Ga0495630_0028615 | |||
| 1331 | Ga0495640_0129801 | |||
| 1332 | Ga0495640_0292483 | |||
| 1333 | Ga0495622_0205953 | |||
| 1334 | Ga0495668_0086410 | |||
| 1335 | Ga0495634_0102309 | |||
| 1336 | Ga0495634_0241460 | |||
| 1337 | Ga0495625_0004740 | |||
| 1338 | Ga0495625_0046617 | |||
| 1339 | Ga0495588_0006311 | |||
| 1340 | Ga0495657_0074053 | |||
| 1341 | Ga0495657_0087995 | |||
| 1342 | Ga0495623_0087009 | |||
| 1343 | Ga0495646_0111571 | |||
| 1344 | Ga0495647_0031777 | |||
| 1345 | Ga0495658_0041185 | |||
| 1346 | Ga0495669_0004784 | |||
| 1347 | Ga0495613_0168638 | |||
| 1348 | Ga0495613_0175337 | |||
| 1349 | Ga0495649_0001360 | |||
| 1350 | Ga0495589_0064337 | |||
| 1351 | Ga0495600_0109840 | |||
| 1352 | Ga0495604_0079471 | |||
| 1353 | Ga0495604_0196850 | |||
| 1354 | Ga0495604_0255527 | |||
| 1355 | Ga0495676_0002630 | |||
| 1356 | Ga0495676_0068789 | |||
| 1357 | Ga0495680_0057968 | |||
| 1358 | Ga0495683_0079185 | |||
| 1359 | Ga0495686_0004062 | |||
| 1360 | Ga0495686_0014244 | |||
| 1361 | Ga0495602_0192279 | |||
| 1362 | Ga0496100_0016134 | |||
| 1363 | Ga0496100_0036844 | |||
| 1364 | Ga0496100_0075172 | |||
| 1365 | Ga0496100_0080988 | |||
| 1366 | Ga0496100_0086062 | |||
| 1367 | Ga0496100_0091970 | |||
| 1368 | Ga0496100_0101060 | |||
| 1369 | Ga0496101_0008899 | |||
| 1370 | Ga0496101_0025608 | |||
| 1371 | Ga0496101_0032436 | |||
| 1372 | Ga0496101_0040734 | |||
| 1373 | Ga0496101_0056324 | |||
| 1374 | Ga0496101_0056842 | |||
| 1375 | Ga0496101_0060570 | |||
| 1376 | Ga0496101_0061407 | |||
| 1377 | Ga0496101_0091283 | |||
| 1378 | Ga0496101_0094004 | |||
| 1379 | Ga0496101_0124465 | |||
| 1380 | Ga0496102_0001352 | |||
| 1381 | Ga0496102_0010015 | |||
| 1382 | Ga0496102_0104524 | |||
| 1383 | Ga0496102_0665657 | |||
| 1384 | Ga0496102_0964556 | |||
| 1385 | Ga0496103_0003096 | |||
| 1386 | Ga0496103_0035666 | |||
| 1387 | Ga0496103_0049589 | |||
| 1388 | Ga0496103_0175331 | |||
| 1389 | Ga0496103_0245090 | |||
| 1390 | Ga0496104_0000776 | |||
| 1391 | Ga0496104_0017872 | |||
| 1392 | Ga0496104_0056951 | |||
| 1393 | Ga0496104_0081689 | |||
| 1394 | Ga0496104_0091550 | |||
| 1395 | Ga0496104_0212333 | |||
| 1396 | Ga0496104_0481457 | |||
| 1397 | Ga0496105_0000249 | |||
| 1398 | Ga0496105_0005452 | |||
| 1399 | Ga0496105_0019597 | |||
| 1400 | Ga0496105_0102527 | |||
| 1401 | Ga0496105_0108276 | |||
| 1402 | Ga0496105_0128703 | |||
| 1403 | Ga0496105_0317169 | |||
| 1404 | Ga0496105_0361953 | |||
| 1405 | Ga0496106_0134660 | |||
| 1406 | Ga0496106_0310012 | |||
| 1407 | Ga0496107_0004795 | |||
| 1408 | Ga0496107_0046502 | |||
| 1409 | Ga0496107_0079680 | |||
| 1410 | Ga0496108_0007775 | |||
| 1411 | Ga0496108_0012358 | |||
| 1412 | Ga0496108_0042949 | |||
| 1413 | Ga0496108_0060419 | |||
| 1414 | Ga0496108_0123368 | |||
| 1415 | Ga0496109_0012502 | |||
| 1416 | Ga0496109_0013737 | |||
| 1417 | Ga0496109_0016666 | |||
| 1418 | Ga0496109_0038857 | |||
| 1419 | Ga0496109_0046373 | |||
| 1420 | Ga0496109_0053817 | |||
| 1421 | Ga0496109_0206663 | |||
| 1422 | Ga0496109_0529183 | |||
| 1423 | Ga0496109_0745760 | |||
| 1424 | Ga0496110_0000558 | |||
| 1425 | Ga0496110_0013014 | |||
| 1426 | Ga0496110_0021444 | |||
| 1427 | Ga0496110_0058874 | |||
| 1428 | Ga0496110_0184879 | |||
| 1429 | Ga0496110_0424497 | |||
| 1430 | Ga0496111_0000179 | |||
| 1431 | Ga0496111_0059508 | |||
| 1432 | Ga0496111_0072887 | |||
| 1433 | Ga0496111_0142097 | |||
| 1434 | Ga0496111_0148319 | |||
| 1435 | Ga0496112_0000720 | |||
| 1436 | Ga0496112_0008165 | |||
| 1437 | Ga0496112_0039255 | |||
| 1438 | Ga0496112_0100065 | |||
| 1439 | Ga0496112_0153184 | |||
| 1440 | Ga0496112_0255134 | |||
| 1441 | Ga0496112_0383611 | |||
| 1442 | Ga0496112_0976951 | |||
| 1443 | Ga0496113_0022997 | |||
| 1444 | Ga0496113_0044165 | |||
| 1445 | Ga0496113_0214526 | |||
| 1446 | Ga0496113_0272750 | |||
| 1447 | Ga0496114_0014049 | |||
| 1448 | Ga0496114_0016663 | |||
| 1449 | Ga0496114_0020686 | |||
| 1450 | Ga0496114_0046712 | |||
| 1451 | Ga0496114_0098946 | |||
| 1452 | Ga0496114_0129565 | |||
| 1453 | Ga0496114_0142068 | |||
| 1454 | Ga0496114_0144339 | |||
| 1455 | Ga0496114_0177714 | |||
| 1456 | Ga0496114_0287066 | |||
| 1457 | Ga0496114_0385631 | |||
| 1458 | Ga0496114_0423794 | |||
| 1459 | Ga0496114_0996883 | |||
| 1460 | Ga0496115_0070757 | |||
| 1461 | Ga0496115_0089377 | |||
| 1462 | Ga0496115_0102342 | |||
| 1463 | Ga0496115_0185494 | |||
| 1464 | Ga0496115_0186238 | |||
| 1465 | Ga0496115_0512298 | |||
| 1466 | Ga0496117_0020000 | |||
| 1467 | Ga0496117_0024391 | |||
| 1468 | Ga0496120_0031106 | |||
| 1469 | Ga0496122_0011269 | |||
| 1470 | Ga0496123_0000325 | |||
| 1471 | Ga0496126_0340456 | |||
| 1472 | Ga0501031_0108038 | |||
| 1473 | Ga0501034_0296470 | |||
| 1474 | Ga0501039_0379150 | |||
| 1475 | Ga0501041_0166758 | |||
| 1476 | Ga0501041_0292665 | |||
| 1477 | Ga0501042_0250487 | |||
| 1478 | Ga0501047_0438145 | |||
| 1479 | Ga0501067_0031654 | |||
| 1480 | Ga0501067_0204633 | |||
| 1481 | Ga0501068_0027585 | |||
| 1482 | Ga0501068_0646350 | |||
| 1483 | Ga0501069_0009504 | |||
| 1484 | Ga0501070_0000191 | |||
| 1485 | Ga0501070_0000616 | |||
| 1486 | Ga0501072_0136849 | |||
| 1487 | Ga0501072_0416578 | |||
| 1488 | Ga0501073_0118445 | |||
| 1489 | Ga0501073_0272824 | |||
| 1490 | Ga0501074_0337685 | |||
| 1491 | Ga0501076_0531822 | |||
| 1492 | Ga0501076_0658654 | |||
| 1493 | Ga0501077_0270077 | |||
| 1494 | Ga0501080_0027766 | |||
| 1495 | Ga0501080_0083539 | |||
| 1496 | Ga0501080_0168222 | |||
| 1497 | Ga0501080_0623699 | |||
| 1498 | Ga0501044_0732840 | |||
| 1499 | Ga0501045_0914768 | |||
| 1500 | nmdc:mga00v17_169043_c1 | |||
| 1501 | nmdc:mga05p37_1210_c1 | |||
| 1502 | nmdc:mga05p37_184809_c1 | |||
| 1503 | nmdc:mga09592_5973_c1 | |||
| 1504 | nmdc:mga09592_86912_c1 | |||
| 1505 | nmdc:mga0qj67_18060_c1 | |||
| 1506 | nmdc:mga06r32_103_c1 | |||
| 1507 | nmdc:mga06r32_71924_c1 | |||
| 1508 | nmdc:mga08y16_398529_c1 | |||
| 1509 | nmdc:mga08y16_52388_c1 | |||
| 1510 | nmdc:mga08y16_74223_c1 | |||
| 1511 | nmdc:mga08y16_771027_c1 | |||
| 1512 | nmdc:mga0n895_1296544_c1 | |||
| 1513 | nmdc:mga0n895_14015_c1 | |||
| 1514 | nmdc:mga0n895_37878_c2 | |||
| 1515 | nmdc:mga0n895_619329_c1 | |||
| 1516 | nmdc:mga0rr50_47503_c1 | |||
| 1517 | nmdc:mga0a205_49460_c1 | |||
| 1518 | nmdc:mga0a205_545251_c1 | |||
| 1519 | nmdc:mga0a205_79600_c1 | |||
| 1520 | Ga0495601_0001791 | |||
| 1521 | Ga0495601_0129362 | |||
| 1522 | Ga0495612_0004643 | |||
| 1523 | Ga0495612_0044354 | |||
| 1524 | Ga0500635_0000006 | |||
| 1525 | Ga0495619_0081457 | |||
| 1526 | Ga0495619_0097497 | |||
| 1527 | Ga0495619_0203555 | |||
| 1528 | Ga0500643_003401 | |||
| 1529 | Ga0500564_162565 | |||
| 1530 | Ga0501082_0567435 | |||
| 1531 | Ga0466962_0006426 | |||
| 1532 | Ga0466962_0011375 | |||
| 1533 | Ga0466962_0141556 | |||
| 1534 | Ga0466962_0215934 | |||
| 1535 | Ga0530510_0385784 | |||
| 1536 | 2512731047 | |||
| 1537 | 2595088405 | |||
| 1538 | 2643887354 | |||
| 1539 | 2643891435 | |||
| 1540 | 2643960483 | |||
| 1541 | 2644220968 | |||
| 1542 | 2644262292 | |||
| 1543 | 2676485687 | |||
| 1544 | 2739606808 | |||
| 1545 | 2760620886 | |||
| 1546 | 2777762972 | |||
| 1547 | 2777835554 | |||
| 1548 | 2785368912 | |||
| 1549 | 2786673960 | |||
| 1550 | 2809025673 | |||
| 1551 | 2831936221 | |||
| 1552 | 2833712849 | |||
| 1553 | 2867432952 | |||
| 1554 | 2877681094 | |||
| 1555 | 2884766676 | |||
| 1556 | 2919055455 | |||
| 1557 | 2919524695 | |||
| 1558 | 2928153604 | |||
| 1559 | 2936343826 | |||
| 1560 | 2946034467 | |||
| 1561 | 2954681457 | |||
| 1562 | 2954682701 | |||
| 1563 | 2954696861 | |||
| 1564 | 2954705275 | |||
| 1565 | 2995464429 | |||
| 1566 | 3006326754 | |||
| 1567 | 3006977331 | |||
| 1568 | 8046353242 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3l4e-assembly1.cif.gz_A | 1.5a crystal structure of a putative peptidase e protein from listeria monocytogenes egd-e | 0.7901 | 2 | 216 |
| 3l4e-assembly1.cif.gz_A | 1.5a crystal structure of a putative peptidase e protein from listeria monocytogenes egd-e | 0.7762 | 2 | 216 |
| 6iru-assembly2.cif.gz_B | crystal structure of peptidase e from deinococcus radiodurans in p6422 space group | 0.7708 | 1 | 217 |
| 6iru-assembly2.cif.gz_B | crystal structure of peptidase e from deinococcus radiodurans in p6422 space group | 0.7674 | 1 | 217 |
| 6a4t-assembly1.cif.gz_B | crystal structure of peptidase e from deinococcus radiodurans r1 | 0.7551 | 1 | 214 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3l4eA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.794 | 2 | 216 | 3.40.50.880 |
| 3l4eA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.7834 | 2 | 216 | 3.40.50.880 |
| af_Q9VYH3_5_230_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.6902 | 1 | 222 | 3.40.50.880 |
| af_Q9VYH3_5_230_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.6696 | 1 | 222 | 3.40.50.880 |
| af_Q4DDW3_172_579_2.120.10.30 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.6533 | 194 | 216 | 2.120.10.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R4PSP3-F1-model_v4 | Peptidase E | 0.983 | 1 | 223 |
GO:0006508
GO:0008236 |
| AF-A0A0Q9NM15-F1-model_v4 | Peptidase S51 | 0.9786 | 1 | 221 |
GO:0006508
GO:0008236 |
| AF-A0A4R4PSP3-F1-model_v4 | Peptidase E | 0.9786 | 1 | 223 |
GO:0006508
GO:0008236 |
| AF-U5VYJ4-F1-model_v4 | Peptidase S51 dipeptidase E | 0.9767 | 1 | 220 |
GO:0006508
GO:0008236 |
| AF-A0A7W0YXE8-F1-model_v4 | Type 1 glutamine amidotransferase-like domain-containing protein | 0.9751 | 67 | 223 |
GO:0006508
GO:0008236 GO:0016740 |