F480762
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 785 | 327 | 766 | 263 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0290922|Ga0501034_0290922_75_1004 |
| Length | 309 |
| Sequence | VPAIELARRLGPRDGPRRLARIASSAPAKGIDATRGGGVPAAKQRLKGPPMKLPSRIVDISSPLDNETIYDHPFMRPKIEYLSNAQNAPMLLQSFPGLRQEDLPDGEGWAFELIQLSTHNGTHMDAPIHYHSTTIGGERMMTIDEVPLDWFFRPGVKFDFRAKPDGHVVSAAEVEAELKRIGHDLQPFDIVLVNTRASECIGTEEYLTAGCGMGREATLYLTSRGVRVCGIDAWGWDVPFVHMAKRWNETRDASIIWEGHKAGREIPYCHMEKLCNLEQLPATGFTVACFPTKIKAASAGWTRAVAMFD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 2 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 3 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 4 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 5 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 6 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 7 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 8 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 9 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 10 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 11 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 12 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 13 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 14 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 15 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 16 | 2984568884 | Acinetobacter baylyi SORGH_AS893 | Isolate | Aerial Root |
| 17 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 18 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 60 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 96 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 136 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 138 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 141 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 142 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 143 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 144 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 145 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 146 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 147 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 148 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 149 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 150 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 151 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 152 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 153 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 154 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 155 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 157 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 158 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 159 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 160 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 161 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 162 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 164 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 165 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 168 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 169 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 170 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 171 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 172 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 173 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 174 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 175 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 176 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 177 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 178 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 179 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 180 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 181 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 182 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 183 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 184 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 185 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 186 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 187 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 188 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 189 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 268 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 269 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 270 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 271 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 272 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 275 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 276 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 277 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 278 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 279 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 280 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 281 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 282 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 283 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 284 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 285 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 286 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 287 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 288 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 301 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 302 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 303 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 304 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 305 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 306 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 312 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 317 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 318 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 319 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 320 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 321 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 322 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 323 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 324 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 325 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 326 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 327 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.58 |
| Metatranscriptomes | 0 |
| Isolates | 2.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.13 |
| Bulb | 0 |
| Endosphere | 4.2 |
| Nodule | 0.76 |
| Rhizoplane | 4.33 |
| Rhizosphere | 85.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25158J39367_1005935 | 3300002739 | Bacteria | 1767 |
| 2 | Ga0065714_10002201 | 3300005288 | Bacteria | 61466 |
| 3 | Ga0065714_10007572 | 3300005288 | Bacteria | 5142 |
| 4 | Ga0065714_10020205 | 3300005288 | Bacteria | 1912 |
| 5 | Ga0065714_10065664 | 3300005288 | Bacteria | 8946 |
| 6 | Ga0065714_10073863 | 3300005288 | Bacteria | 3120 |
| 7 | Ga0065704_10071404 | 3300005289 | Bacteria | 11314 |
| 8 | Ga0070683_100367810 | 3300005329 | Bacteria | 1369 |
| 9 | Ga0070680_100007366 | 3300005336 | Bacteria | 8396 |
| 10 | Ga0070680_100091993 | 3300005336 | Bacteria | 2511 |
| 11 | Ga0070660_100342359 | 3300005339 | Bacteria | 1230 |
| 12 | Ga0070689_100045226 | 3300005340 | Bacteria | 3389 |
| 13 | Ga0070689_100121564 | 3300005340 | Bacteria | 2086 |
| 14 | Ga0070661_100021408 | 3300005344 | Bacteria | 4618 |
| 15 | Ga0070661_100200733 | 3300005344 | Bacteria | 1524 |
| 16 | Ga0070675_100053262 | 3300005354 | Bacteria | 3328 |
| 17 | Ga0070675_100149492 | 3300005354 | Bacteria | 2002 |
| 18 | Ga0070671_100017825 | 3300005355 | Bacteria | 5755 |
| 19 | Ga0070673_100000963 | 3300005364 | Bacteria | 16323 |
| 20 | Ga0070673_100498233 | 3300005364 | Bacteria | 1101 |
| 21 | Ga0070688_100012965 | 3300005365 | Bacteria | 4688 |
| 22 | Ga0070659_100090962 | 3300005366 | Bacteria | 2445 |
| 23 | Ga0070709_10064979 | 3300005434 | Bacteria | 2335 |
| 24 | Ga0070709_10223355 | 3300005434 | Bacteria | 1344 |
| 25 | Ga0070714_100133793 | 3300005435 | Bacteria | 2218 |
| 26 | Ga0070714_100934047 | 3300005435 | Bacteria | 843 |
| 27 | Ga0070713_100012832 | 3300005436 | Bacteria | 6162 |
| 28 | Ga0070713_100030829 | 3300005436 | Bacteria | 4264 |
| 29 | Ga0070713_100573863 | 3300005436 | Bacteria | 1070 |
| 30 | Ga0070710_10080381 | 3300005437 | Bacteria | 1902 |
| 31 | Ga0070710_10225102 | 3300005437 | Bacteria | 1195 |
| 32 | Ga0070711_100286915 | 3300005439 | Bacteria | 1304 |
| 33 | Ga0070705_100071926 | 3300005440 | Bacteria | 2093 |
| 34 | Ga0070708_100044695 | 3300005445 | Bacteria | 3896 |
| 35 | Ga0070678_100104382 | 3300005456 | Bacteria | 2204 |
| 36 | Ga0070662_100079327 | 3300005457 | Bacteria | 2441 |
| 37 | Ga0070706_100022710 | 3300005467 | Bacteria | 5777 |
| 38 | Ga0070698_100001145 | 3300005471 | Bacteria | 29366 |
| 39 | Ga0070699_100119010 | 3300005518 | Bacteria | 2322 |
| 40 | Ga0070679_100003811 | 3300005530 | Bacteria | 13841 |
| 41 | Ga0070679_100007804 | 3300005530 | Bacteria | 10029 |
| 42 | Ga0070684_100168370 | 3300005535 | Bacteria | 1990 |
| 43 | Ga0070697_100047256 | 3300005536 | Bacteria | 3490 |
| 44 | Ga0068853_100316694 | 3300005539 | Bacteria | 1445 |
| 45 | Ga0070695_100147102 | 3300005545 | Bacteria | 1640 |
| 46 | Ga0070665_100006359 | 3300005548 | Bacteria | 12045 |
| 47 | Ga0070704_100009792 | 3300005549 | Bacteria | 5811 |
| 48 | Ga0068855_100145232 | 3300005563 | Bacteria | 2701 |
| 49 | Ga0070664_100518667 | 3300005564 | Bacteria | 1100 |
| 50 | Ga0068856_100007129 | 3300005614 | Bacteria | 10906 |
| 51 | Ga0068852_100041706 | 3300005616 | Bacteria | 3880 |
| 52 | Ga0068852_100635049 | 3300005616 | Bacteria | 1074 |
| 53 | Ga0068858_100096863 | 3300005842 | Bacteria | 2750 |
| 54 | Ga0068860_100726695 | 3300005843 | Bacteria | 1004 |
| 55 | Ga0081455_10000780 | 3300005937 | Bacteria | 40974 |
| 56 | Ga0081538_10084129 | 3300005981 | Bacteria | 1678 |
| 57 | Ga0081539_10033308 | 3300005985 | Bacteria | 3140 |
| 58 | Ga0070717_10040838 | 3300006028 | Bacteria | 3781 |
| 59 | Ga0070717_10237706 | 3300006028 | Bacteria | 1605 |
| 60 | Ga0075368_10024403 | 3300006042 | Bacteria | 2316 |
| 61 | Ga0075432_10002265 | 3300006058 | Bacteria | 6400 |
| 62 | Ga0070715_10164644 | 3300006163 | Bacteria | 1099 |
| 63 | Ga0070716_100023817 | 3300006173 | Bacteria | 3253 |
| 64 | Ga0070716_100268668 | 3300006173 | Bacteria | 1171 |
| 65 | Ga0070712_100043772 | 3300006175 | Bacteria | 3084 |
| 66 | Ga0070712_100096249 | 3300006175 | Bacteria | 2179 |
| 67 | Ga0070712_100129070 | 3300006175 | Bacteria | 1914 |
| 68 | Ga0075367_10112616 | 3300006178 | Bacteria | 1671 |
| 69 | Ga0075369_10000557 | 3300006186 | Bacteria | 11747 |
| 70 | Ga0075369_10011093 | 3300006186 | Bacteria | 3535 |
| 71 | Ga0075366_10033745 | 3300006195 | Bacteria | 3015 |
| 72 | Ga0075428_100332433 | 3300006844 | Bacteria | 1632 |
| 73 | Ga0075431_100162304 | 3300006847 | Bacteria | 2297 |
| 74 | Ga0075433_10083227 | 3300006852 | Bacteria | 2824 |
| 75 | Ga0075434_100147309 | 3300006871 | Bacteria | 2374 |
| 76 | Ga0075436_100077667 | 3300006914 | Bacteria | 2300 |
| 77 | Ga0075436_100268989 | 3300006914 | Bacteria | 1217 |
| 78 | Ga0097620_100299653 | 3300006931 | Bacteria | 1701 |
| 79 | Ga0079104_1002009 | 3300006946 | Bacteria | 11878 |
| 80 | Ga0075435_100168288 | 3300007076 | Unclassified | 1849 |
| 81 | Ga0075435_100683145 | 3300007076 | Bacteria | 892 |
| 82 | Ga0105251_10000210 | 3300009011 | Bacteria | 59171 |
| 83 | Ga0105244_10003598 | 3300009036 | Bacteria | 11003 |
| 84 | Ga0105244_10027736 | 3300009036 | Bacteria | 3049 |
| 85 | Ga0105244_10038499 | 3300009036 | Bacteria | 2494 |
| 86 | Ga0105250_10000715 | 3300009092 | Bacteria | 20421 |
| 87 | Ga0105250_10073434 | 3300009092 | Bacteria | 1383 |
| 88 | Ga0105245_10046581 | 3300009098 | Bacteria | 3875 |
| 89 | Ga0114129_10108130 | 3300009147 | Bacteria | 3840 |
| 90 | Ga0114129_10271689 | 3300009147 | Bacteria | 2268 |
| 91 | Ga0105243_10004716 | 3300009148 | Bacteria | 10737 |
| 92 | Ga0105243_10215157 | 3300009148 | Bacteria | 1695 |
| 93 | Ga0105237_10129783 | 3300009545 | Bacteria | 2515 |
| 94 | Ga0105238_10271663 | 3300009551 | Bacteria | 1676 |
| 95 | Ga0105249_10095354 | 3300009553 | Bacteria | 2789 |
| 96 | Ga0105239_10324737 | 3300010375 | Bacteria | 1736 |
| 97 | Ga0105246_10150804 | 3300011119 | Bacteria | 1759 |
| 98 | Ga0157345_1000002 | 3300012498 | Bacteria | 123939 |
| 99 | Ga0157373_10000060 | 3300013100 | Bacteria | 95775 |
| 100 | Ga0157371_10046377 | 3300013102 | Bacteria | 3091 |
| 101 | Ga0157371_10068455 | 3300013102 | Bacteria | 2513 |
| 102 | Ga0157370_10000874 | 3300013104 | Bacteria | 38194 |
| 103 | Ga0157370_10001700 | 3300013104 | Bacteria | 27101 |
| 104 | Ga0157370_10047738 | 3300013104 | Bacteria | 4103 |
| 105 | Ga0157369_10000564 | 3300013105 | Bacteria | 48711 |
| 106 | Ga0163162_10000095 | 3300013306 | Bacteria | 80739 |
| 107 | Ga0163162_10000430 | 3300013306 | Bacteria | 38735 |
| 108 | Ga0157372_10808451 | 3300013307 | Bacteria | 1089 |
| 109 | Ga0157375_10396152 | 3300013308 | Bacteria | 1547 |
| 110 | Ga0163163_10161300 | 3300014325 | Bacteria | 2288 |
| 111 | Ga0163163_10465587 | 3300014325 | Bacteria | 1325 |
| 112 | Ga0182008_10001847 | 3300014497 | Bacteria | 13777 |
| 113 | Ga0182005_1000139 | 3300015265 | Bacteria | 51303 |
| 114 | Ga0163161_10003069 | 3300017792 | Bacteria | 11782 |
| 115 | Ga0163161_10012542 | 3300017792 | Bacteria | 5884 |
| 116 | Ga0163161_10043802 | 3300017792 | Bacteria | 3223 |
| 117 | Ga0209051_1000294 | 3300025303 | Bacteria | 79686 |
| 118 | Ga0207696_1008745 | 3300025711 | Bacteria | 3837 |
| 119 | Ga0207655_1000006 | 3300025728 | Bacteria | 861092 |
| 120 | Ga0207655_1000325 | 3300025728 | Bacteria | 70385 |
| 121 | Ga0207713_1001068 | 3300025735 | Bacteria | 23648 |
| 122 | Ga0207713_1009523 | 3300025735 | Bacteria | 5466 |
| 123 | Ga0207713_1016331 | 3300025735 | Bacteria | 3770 |
| 124 | Ga0207692_10040201 | 3300025898 | Bacteria | 2307 |
| 125 | Ga0207680_10193943 | 3300025903 | Bacteria | 1380 |
| 126 | Ga0207680_10412626 | 3300025903 | Bacteria | 955 |
| 127 | Ga0207645_10430857 | 3300025907 | Bacteria | 889 |
| 128 | Ga0207707_10101783 | 3300025912 | Bacteria | 2511 |
| 129 | Ga0207671_10095851 | 3300025914 | Bacteria | 2241 |
| 130 | Ga0207693_10011079 | 3300025915 | Bacteria | 7306 |
| 131 | Ga0207693_10117573 | 3300025915 | Bacteria | 2087 |
| 132 | Ga0207663_10165554 | 3300025916 | Bacteria | 1565 |
| 133 | Ga0207663_10206934 | 3300025916 | Bacteria | 1419 |
| 134 | Ga0207660_10016221 | 3300025917 | Bacteria | 4929 |
| 135 | Ga0207662_10114726 | 3300025918 | Bacteria | 1683 |
| 136 | Ga0207657_10312237 | 3300025919 | Bacteria | 1244 |
| 137 | Ga0207694_10409906 | 3300025924 | Bacteria | 1128 |
| 138 | Ga0207650_10000973 | 3300025925 | Bacteria | 21537 |
| 139 | Ga0207659_10057930 | 3300025926 | Bacteria | 2780 |
| 140 | Ga0207700_10010336 | 3300025928 | Bacteria | 5883 |
| 141 | Ga0207700_10028667 | 3300025928 | Bacteria | 3919 |
| 142 | Ga0207700_10186715 | 3300025928 | Bacteria | 1739 |
| 143 | Ga0207700_10667195 | 3300025928 | Bacteria | 927 |
| 144 | Ga0207664_10597353 | 3300025929 | Bacteria | 991 |
| 145 | Ga0207664_10717859 | 3300025929 | Bacteria | 899 |
| 146 | Ga0207644_10006443 | 3300025931 | Bacteria | 7650 |
| 147 | Ga0207706_10147801 | 3300025933 | Bacteria | 2067 |
| 148 | Ga0207709_10046186 | 3300025935 | Bacteria | 2641 |
| 149 | Ga0207670_10020102 | 3300025936 | Bacteria | 4095 |
| 150 | Ga0207669_10166475 | 3300025937 | Bacteria | 1564 |
| 151 | Ga0207665_10035886 | 3300025939 | Bacteria | 3294 |
| 152 | Ga0207691_10071696 | 3300025940 | Bacteria | 3125 |
| 153 | Ga0207661_10167485 | 3300025944 | Bacteria | 1910 |
| 154 | Ga0207679_10108025 | 3300025945 | Bacteria | 2190 |
| 155 | Ga0207667_10012596 | 3300025949 | Bacteria | 9726 |
| 156 | Ga0207667_10142421 | 3300025949 | Bacteria | 2468 |
| 157 | Ga0207651_10003178 | 3300025960 | Bacteria | 8017 |
| 158 | Ga0207712_10058911 | 3300025961 | Bacteria | 2716 |
| 159 | Ga0207658_10646682 | 3300025986 | Bacteria | 953 |
| 160 | Ga0207678_10056296 | 3300026067 | Bacteria | 3385 |
| 161 | Ga0207702_10013214 | 3300026078 | Bacteria | 6866 |
| 162 | Ga0207641_10036989 | 3300026088 | Bacteria | 4076 |
| 163 | Ga0207674_10313790 | 3300026116 | Bacteria | 1517 |
| 164 | Ga0207683_10016859 | 3300026121 | Bacteria | 6215 |
| 165 | Ga0209281_1001475 | 3300027111 | Bacteria | 13659 |
| 166 | Ga0209281_1013173 | 3300027111 | Bacteria | 1792 |
| 167 | Ga0209813_10007907 | 3300027866 | Bacteria | 2667 |
| 168 | Ga0207428_10039978 | 3300027907 | Bacteria | 3807 |
| 169 | Ga0268266_10027224 | 3300028379 | Bacteria | 4863 |
| 170 | Ga0268266_10297959 | 3300028379 | Bacteria | 1503 |
| 171 | Ga0268264_10468436 | 3300028381 | Bacteria | 1223 |
| 172 | Ga0265334_10003460 | 3300028573 | Bacteria | 7179 |
| 173 | Ga0307517_10046080 | 3300028786 | Bacteria | 4563 |
| 174 | Ga0307515_10274908 | 3300028794 | Bacteria | 1400 |
| 175 | Ga0316178_1084681 | 3300030735 | Bacteria | 16610 |
| 176 | Ga0265325_10046234 | 3300031241 | Bacteria | 2258 |
| 177 | Ga0265325_10182192 | 3300031241 | Bacteria | 978 |
| 178 | Ga0265340_10017269 | 3300031247 | Bacteria | 3731 |
| 179 | Ga0265339_10000080 | 3300031249 | Bacteria | 83570 |
| 180 | Ga0265339_10002697 | 3300031249 | Bacteria | 12627 |
| 181 | Ga0265339_10186818 | 3300031249 | Bacteria | 1030 |
| 182 | Ga0307513_10119147 | 3300031456 | Bacteria | 2612 |
| 183 | Ga0265313_10000330 | 3300031595 | Bacteria | 51547 |
| 184 | Ga0265313_10003192 | 3300031595 | Bacteria | 13508 |
| 185 | Ga0307508_10042465 | 3300031616 | Bacteria | 4079 |
| 186 | Ga0316579_10181087 | 3300031691 | Bacteria | 1019 |
| 187 | Ga0307516_10324918 | 3300031730 | Bacteria | 1209 |
| 188 | Ga0307416_100614074 | 3300032002 | Bacteria | 1169 |
| 189 | Ga0307510_10000175 | 3300033180 | Bacteria | 54436 |
| 190 | Ga0307510_10006092 | 3300033180 | Bacteria | 14371 |
| 191 | Ga0307510_10111196 | 3300033180 | Bacteria | 2481 |
| 192 | Ga0373944_0002685 | 3300035089 | Bacteria | 4535 |
| 193 | Ga0373932_0005736 | 3300035112 | Bacteria | 2922 |
| 194 | Ga0373936_0006239 | 3300035113 | Bacteria | 4495 |
| 195 | Ga0373945_0003970 | 3300035116 | Bacteria | 4676 |
| 196 | Ga0373954_0033929 | 3300035118 | Bacteria | 2362 |
| 197 | Ga0373943_0000765 | 3300035170 | Bacteria | 14011 |
| 198 | Ga0373946_0069132 | 3300035171 | Bacteria | 1520 |
| 199 | Ga0373924_0018072 | 3300035410 | Bacteria | 2714 |
| 200 | Ga0373935_0008313 | 3300035692 | Bacteria | 6207 |
| 201 | Ga0373933_0018374 | 3300035724 | Bacteria | 3930 |
| 202 | Ga0373933_0281335 | 3300035724 | Bacteria | 1075 |
| 203 | Ga0373947_0118639 | 3300035725 | Bacteria | 1679 |
| 204 | Ga0373947_0371344 | 3300035725 | Bacteria | 962 |
| 205 | Ga0373937_0077407 | 3300036401 | Bacteria | 3074 |
| 206 | Ga0373925_0081479 | 3300037068 | Bacteria | 2461 |
| 207 | Ga0373925_0389024 | 3300037068 | Bacteria | 1136 |
| 208 | Ga0373925_0507490 | 3300037068 | Bacteria | 990 |
| 209 | Ga0395899_0006801 | 3300037312 | Bacteria | 8862 |
| 210 | Ga0395899_0012729 | 3300037312 | Bacteria | 6444 |
| 211 | Ga0395899_0019036 | 3300037312 | Bacteria | 5217 |
| 212 | Ga0395900_0027375 | 3300037418 | Bacteria | 5838 |
| 213 | Ga0395900_0041853 | 3300037418 | Bacteria | 4721 |
| 214 | Ga0395898_0045281 | 3300037466 | Bacteria | 4325 |
| 215 | Ga0395905_0138852 | 3300037471 | Bacteria | 2287 |
| 216 | Ga0395901_0003281 | 3300038443 | Bacteria | 16284 |
| 217 | Ga0395901_0043222 | 3300038443 | Bacteria | 4674 |
| 218 | Ga0400490_44665 | 3300038726 | Bacteria | 9315 |
| 219 | Ga0400488_38992 | 3300038741 | Bacteria | 7452 |
| 220 | Ga0400488_50550 | 3300038741 | Bacteria | 3832 |
| 221 | Ga0400486_18736 | 3300038742 | Bacteria | 1210 |
| 222 | Ga0400487_05138 | 3300039110 | Bacteria | 6381 |
| 223 | Ga0439438_003161 | 3300041405 | Bacteria | 6756 |
| 224 | Ga0439447_008688 | 3300041407 | Bacteria | 3131 |
| 225 | Ga0439466_0001938 | 3300041411 | Bacteria | 8124 |
| 226 | Ga0439466_0004116 | 3300041411 | Bacteria | 5617 |
| 227 | Ga0450911_000223 | 3300042115 | Bacteria | 22106 |
| 228 | Ga0450902_000498 | 3300042137 | Bacteria | 4893 |
| 229 | Ga0450903_002793 | 3300042138 | Bacteria | 3072 |
| 230 | Ga0450905_000920 | 3300042142 | Bacteria | 3691 |
| 231 | Ga0466966_0043681 | 3300044684 | Bacteria | 2872 |
| 232 | Ga0466966_0060076 | 3300044684 | Bacteria | 2400 |
| 233 | Ga0466963_0004456 | 3300044694 | Bacteria | 8145 |
| 234 | Ga0466963_0044831 | 3300044694 | Bacteria | 2911 |
| 235 | Ga0466963_0377204 | 3300044694 | Bacteria | 999 |
| 236 | Ga0466970_0156306 | 3300044765 | Bacteria | 1260 |
| 237 | Ga0466957_0018387 | 3300044842 | Bacteria | 4104 |
| 238 | Ga0466959_0013438 | 3300045049 | Bacteria | 5933 |
| 239 | Ga0466959_0038118 | 3300045049 | Bacteria | 3552 |
| 240 | Ga0466967_0014375 | 3300045976 | Bacteria | 6164 |
| 241 | Ga0466967_0183572 | 3300045976 | Bacteria | 1974 |
| 242 | Ga0466967_0358346 | 3300045976 | Bacteria | 1413 |
| 243 | Ga0495617_003786 | 3300046452 | Bacteria | 5599 |
| 244 | Ga0495617_004391 | 3300046452 | Bacteria | 5139 |
| 245 | Ga0495617_007198 | 3300046452 | Bacteria | 3871 |
| 246 | Ga0495617_007380 | 3300046452 | Bacteria | 3814 |
| 247 | Ga0495617_011316 | 3300046452 | Bacteria | 3044 |
| 248 | Ga0495617_016846 | 3300046452 | Bacteria | 2471 |
| 249 | Ga0495617_016978 | 3300046452 | Bacteria | 2460 |
| 250 | Ga0495617_024367 | 3300046452 | Bacteria | 2042 |
| 251 | Ga0495617_054006 | 3300046452 | Bacteria | 1334 |
| 252 | Ga0495627_000014 | 3300046453 | Bacteria | 326114 |
| 253 | Ga0495627_000949 | 3300046453 | Bacteria | 19921 |
| 254 | Ga0495627_008087 | 3300046453 | Bacteria | 3965 |
| 255 | Ga0495627_013079 | 3300046453 | Bacteria | 2928 |
| 256 | Ga0495627_027570 | 3300046453 | Bacteria | 1821 |
| 257 | Ga0495627_029884 | 3300046453 | Bacteria | 1729 |
| 258 | Ga0495627_029888 | 3300046453 | Bacteria | 1729 |
| 259 | Ga0495603_0020106 | 3300046455 | Bacteria | 4046 |
| 260 | Ga0495603_0035107 | 3300046455 | Bacteria | 3013 |
| 261 | Ga0495603_0057011 | 3300046455 | Bacteria | 2312 |
| 262 | Ga0495603_0233077 | 3300046455 | Bacteria | 1061 |
| 263 | Ga0495590_0000260 | 3300046457 | Bacteria | 28843 |
| 264 | Ga0495590_0000454 | 3300046457 | Bacteria | 20209 |
| 265 | Ga0495590_0000735 | 3300046457 | Bacteria | 14948 |
| 266 | Ga0495591_000104 | 3300046458 | Bacteria | 98228 |
| 267 | Ga0495591_000660 | 3300046458 | Bacteria | 25510 |
| 268 | Ga0495591_000834 | 3300046458 | Bacteria | 21805 |
| 269 | Ga0495591_000930 | 3300046458 | Bacteria | 20078 |
| 270 | Ga0495591_008918 | 3300046458 | Bacteria | 4044 |
| 271 | Ga0495591_014116 | 3300046458 | Bacteria | 2886 |
| 272 | Ga0495638_0003266 | 3300046460 | Bacteria | 12795 |
| 273 | Ga0495638_0004246 | 3300046460 | Bacteria | 10902 |
| 274 | Ga0495638_0013059 | 3300046460 | Bacteria | 5669 |
| 275 | Ga0495638_0014697 | 3300046460 | Bacteria | 5281 |
| 276 | Ga0495638_0017100 | 3300046460 | Bacteria | 4843 |
| 277 | Ga0495638_0019386 | 3300046460 | Bacteria | 4501 |
| 278 | Ga0495638_0034279 | 3300046460 | Bacteria | 3241 |
| 279 | Ga0495638_0052590 | 3300046460 | Bacteria | 2536 |
| 280 | Ga0495638_0059789 | 3300046460 | Bacteria | 2358 |
| 281 | Ga0495638_0225336 | 3300046460 | Bacteria | 1046 |
| 282 | Ga0495653_0000147 | 3300046463 | Bacteria | 58379 |
| 283 | Ga0495653_0005900 | 3300046463 | Bacteria | 10025 |
| 284 | Ga0495650_0000476 | 3300046471 | Bacteria | 61528 |
| 285 | Ga0495650_0003400 | 3300046471 | Bacteria | 11650 |
| 286 | Ga0495650_0004794 | 3300046471 | Bacteria | 9076 |
| 287 | Ga0495650_0007569 | 3300046471 | Bacteria | 6502 |
| 288 | Ga0495580_0011707 | 3300046472 | Bacteria | 6779 |
| 289 | Ga0495605_0000001 | 3300046474 | Bacteria | 614538 |
| 290 | Ga0495605_0000350 | 3300046474 | Bacteria | 45096 |
| 291 | Ga0495605_0001061 | 3300046474 | Bacteria | 18351 |
| 292 | Ga0495605_0005332 | 3300046474 | Bacteria | 7492 |
| 293 | Ga0495605_0017544 | 3300046474 | Bacteria | 3850 |
| 294 | Ga0495605_0036044 | 3300046474 | Bacteria | 2497 |
| 295 | Ga0495605_0082053 | 3300046474 | Bacteria | 1507 |
| 296 | Ga0495662_0001229 | 3300046476 | Bacteria | 12618 |
| 297 | Ga0495664_0008759 | 3300046477 | Bacteria | 5651 |
| 298 | Ga0495584_0000503 | 3300046491 | Bacteria | 26779 |
| 299 | Ga0495584_0000639 | 3300046491 | Bacteria | 23311 |
| 300 | Ga0495584_0004664 | 3300046491 | Bacteria | 7346 |
| 301 | Ga0495584_0005154 | 3300046491 | Bacteria | 6935 |
| 302 | Ga0495584_0005264 | 3300046491 | Bacteria | 6854 |
| 303 | Ga0495584_0024054 | 3300046491 | Bacteria | 3088 |
| 304 | Ga0495584_0027629 | 3300046491 | Bacteria | 2874 |
| 305 | Ga0495584_0066511 | 3300046491 | Bacteria | 1812 |
| 306 | Ga0495584_0075512 | 3300046491 | Bacteria | 1694 |
| 307 | Ga0495584_0158875 | 3300046491 | Bacteria | 1148 |
| 308 | Ga0495585_0000047 | 3300046492 | Bacteria | 120650 |
| 309 | Ga0495585_0000203 | 3300046492 | Bacteria | 61972 |
| 310 | Ga0495585_0000749 | 3300046492 | Bacteria | 28764 |
| 311 | Ga0495585_0008686 | 3300046492 | Bacteria | 6141 |
| 312 | Ga0495585_0019164 | 3300046492 | Bacteria | 3948 |
| 313 | Ga0495585_0064478 | 3300046492 | Bacteria | 2009 |
| 314 | Ga0495585_0068130 | 3300046492 | Bacteria | 1945 |
| 315 | Ga0495585_0087518 | 3300046492 | Bacteria | 1681 |
| 316 | Ga0495585_0162248 | 3300046492 | Bacteria | 1159 |
| 317 | Ga0495594_0002066 | 3300046499 | Bacteria | 10454 |
| 318 | Ga0495596_0000330 | 3300046500 | Bacteria | 30845 |
| 319 | Ga0495596_0000490 | 3300046500 | Bacteria | 25151 |
| 320 | Ga0495596_0022012 | 3300046500 | Bacteria | 2597 |
| 321 | Ga0495607_0000025 | 3300046501 | Bacteria | 159379 |
| 322 | Ga0495607_0000251 | 3300046501 | Bacteria | 57660 |
| 323 | Ga0495607_0002009 | 3300046501 | Bacteria | 17070 |
| 324 | Ga0495607_0003285 | 3300046501 | Bacteria | 12426 |
| 325 | Ga0495607_0003796 | 3300046501 | Bacteria | 11413 |
| 326 | Ga0495607_0003826 | 3300046501 | Bacteria | 11353 |
| 327 | Ga0495607_0016327 | 3300046501 | Bacteria | 4792 |
| 328 | Ga0495607_0018120 | 3300046501 | Bacteria | 4497 |
| 329 | Ga0495607_0036086 | 3300046501 | Bacteria | 2983 |
| 330 | Ga0495607_0047823 | 3300046501 | Bacteria | 2503 |
| 331 | Ga0495607_0058473 | 3300046501 | Bacteria | 2203 |
| 332 | Ga0495607_0071260 | 3300046501 | Bacteria | 1938 |
| 333 | Ga0495607_0108094 | 3300046501 | Bacteria | 1478 |
| 334 | Ga0495607_0125086 | 3300046501 | Bacteria | 1345 |
| 335 | Ga0495583_0000924 | 3300046506 | Bacteria | 34532 |
| 336 | Ga0495583_0000980 | 3300046506 | Bacteria | 32777 |
| 337 | Ga0495583_0001029 | 3300046506 | Bacteria | 31649 |
| 338 | Ga0495583_0002276 | 3300046506 | Bacteria | 16834 |
| 339 | Ga0495583_0022822 | 3300046506 | Bacteria | 3182 |
| 340 | Ga0495583_0034658 | 3300046506 | Bacteria | 2415 |
| 341 | Ga0495606_0000022 | 3300046507 | Bacteria | 265567 |
| 342 | Ga0495606_0000023 | 3300046507 | Bacteria | 265019 |
| 343 | Ga0495606_0000047 | 3300046507 | Bacteria | 207892 |
| 344 | Ga0495606_0000238 | 3300046507 | Bacteria | 96877 |
| 345 | Ga0495606_0000640 | 3300046507 | Bacteria | 54916 |
| 346 | Ga0495606_0000694 | 3300046507 | Bacteria | 52273 |
| 347 | Ga0495606_0001284 | 3300046507 | Bacteria | 34796 |
| 348 | Ga0495606_0002425 | 3300046507 | Bacteria | 21734 |
| 349 | Ga0495606_0002703 | 3300046507 | Bacteria | 20021 |
| 350 | Ga0495606_0012895 | 3300046507 | Bacteria | 6652 |
| 351 | Ga0495606_0013155 | 3300046507 | Bacteria | 6567 |
| 352 | Ga0495606_0039360 | 3300046507 | Bacteria | 3187 |
| 353 | Ga0495606_0053514 | 3300046507 | Bacteria | 2619 |
| 354 | Ga0495606_0069192 | 3300046507 | Bacteria | 2230 |
| 355 | Ga0495610_0001246 | 3300046512 | Bacteria | 22848 |
| 356 | Ga0495610_0002056 | 3300046512 | Bacteria | 17196 |
| 357 | Ga0495610_0002489 | 3300046512 | Bacteria | 15407 |
| 358 | Ga0495610_0004146 | 3300046512 | Bacteria | 10842 |
| 359 | Ga0495610_0004318 | 3300046512 | Bacteria | 10553 |
| 360 | Ga0495610_0009099 | 3300046512 | Bacteria | 6327 |
| 361 | Ga0495610_0013798 | 3300046512 | Bacteria | 4780 |
| 362 | Ga0495610_0015388 | 3300046512 | Bacteria | 4447 |
| 363 | Ga0495610_0019157 | 3300046512 | Bacteria | 3837 |
| 364 | Ga0495610_0029454 | 3300046512 | Bacteria | 2891 |
| 365 | Ga0495610_0049707 | 3300046512 | Bacteria | 2052 |
| 366 | Ga0495610_0085776 | 3300046512 | Bacteria | 1436 |
| 367 | Ga0495616_0000121 | 3300046513 | Bacteria | 68406 |
| 368 | Ga0495616_0000225 | 3300046513 | Bacteria | 46536 |
| 369 | Ga0495616_0002944 | 3300046513 | Bacteria | 11073 |
| 370 | Ga0495616_0003961 | 3300046513 | Bacteria | 9423 |
| 371 | Ga0495616_0024156 | 3300046513 | Bacteria | 3262 |
| 372 | Ga0495616_0028408 | 3300046513 | Bacteria | 2961 |
| 373 | Ga0495616_0059708 | 3300046513 | Bacteria | 1875 |
| 374 | Ga0495620_0000612 | 3300046515 | Bacteria | 22323 |
| 375 | Ga0495620_0002846 | 3300046515 | Bacteria | 9939 |
| 376 | Ga0495620_0002950 | 3300046515 | Bacteria | 9785 |
| 377 | Ga0495620_0003098 | 3300046515 | Bacteria | 9549 |
| 378 | Ga0495620_0013624 | 3300046515 | Bacteria | 4157 |
| 379 | Ga0495620_0020748 | 3300046515 | Bacteria | 3202 |
| 380 | Ga0495620_0024639 | 3300046515 | Bacteria | 2858 |
| 381 | Ga0495630_0000428 | 3300046517 | Bacteria | 32182 |
| 382 | Ga0495631_0000003 | 3300046518 | Bacteria | 164714 |
| 383 | Ga0495631_0000011 | 3300046518 | Bacteria | 111733 |
| 384 | Ga0495631_0003012 | 3300046518 | Bacteria | 9319 |
| 385 | Ga0495631_0025513 | 3300046518 | Bacteria | 2721 |
| 386 | Ga0495631_0051738 | 3300046518 | Bacteria | 1794 |
| 387 | Ga0495632_0000340 | 3300046519 | Bacteria | 44360 |
| 388 | Ga0495632_0000777 | 3300046519 | Bacteria | 28653 |
| 389 | Ga0495632_0001696 | 3300046519 | Bacteria | 18014 |
| 390 | Ga0495632_0002036 | 3300046519 | Bacteria | 15921 |
| 391 | Ga0495632_0004500 | 3300046519 | Bacteria | 9447 |
| 392 | Ga0495632_0005539 | 3300046519 | Bacteria | 8323 |
| 393 | Ga0495632_0017902 | 3300046519 | Bacteria | 3898 |
| 394 | Ga0495632_0018302 | 3300046519 | Bacteria | 3847 |
| 395 | Ga0495632_0018892 | 3300046519 | Bacteria | 3766 |
| 396 | Ga0495632_0022800 | 3300046519 | Bacteria | 3351 |
| 397 | Ga0495632_0035429 | 3300046519 | Bacteria | 2546 |
| 398 | Ga0495632_0050687 | 3300046519 | Bacteria | 2045 |
| 399 | Ga0495637_0000017 | 3300046520 | Bacteria | 209676 |
| 400 | Ga0495637_0000092 | 3300046520 | Bacteria | 70294 |
| 401 | Ga0495637_0000910 | 3300046520 | Bacteria | 19021 |
| 402 | Ga0495637_0000999 | 3300046520 | Bacteria | 17872 |
| 403 | Ga0495637_0009380 | 3300046520 | Bacteria | 4774 |
| 404 | Ga0495637_0012811 | 3300046520 | Bacteria | 4000 |
| 405 | Ga0495637_0019280 | 3300046520 | Bacteria | 3155 |
| 406 | Ga0495637_0020167 | 3300046520 | Bacteria | 3070 |
| 407 | Ga0495637_0023186 | 3300046520 | Bacteria | 2824 |
| 408 | Ga0495637_0023309 | 3300046520 | Bacteria | 2815 |
| 409 | Ga0495637_0057487 | 3300046520 | Bacteria | 1606 |
| 410 | Ga0495637_0084564 | 3300046520 | Bacteria | 1260 |
| 411 | Ga0495643_0000017 | 3300046522 | Bacteria | 313381 |
| 412 | Ga0495643_0001044 | 3300046522 | Bacteria | 28024 |
| 413 | Ga0495643_0002559 | 3300046522 | Bacteria | 14208 |
| 414 | Ga0495643_0003191 | 3300046522 | Bacteria | 12176 |
| 415 | Ga0495643_0005129 | 3300046522 | Bacteria | 8951 |
| 416 | Ga0495643_0012853 | 3300046522 | Bacteria | 5035 |
| 417 | Ga0495643_0017698 | 3300046522 | Bacteria | 4160 |
| 418 | Ga0495643_0018681 | 3300046522 | Bacteria | 4021 |
| 419 | Ga0495643_0037900 | 3300046522 | Bacteria | 2642 |
| 420 | Ga0495643_0088262 | 3300046522 | Bacteria | 1603 |
| 421 | Ga0495643_0108374 | 3300046522 | Bacteria | 1415 |
| 422 | Ga0495643_0118201 | 3300046522 | Bacteria | 1341 |
| 423 | Ga0495644_0000199 | 3300046523 | Bacteria | 28283 |
| 424 | Ga0495644_0002564 | 3300046523 | Bacteria | 7225 |
| 425 | Ga0495644_0002955 | 3300046523 | Bacteria | 6754 |
| 426 | Ga0495644_0020807 | 3300046523 | Bacteria | 2502 |
| 427 | Ga0495644_0040617 | 3300046523 | Bacteria | 1753 |
| 428 | Ga0495648_0000278 | 3300046524 | Bacteria | 57881 |
| 429 | Ga0495648_0001209 | 3300046524 | Bacteria | 25891 |
| 430 | Ga0495648_0003252 | 3300046524 | Bacteria | 14386 |
| 431 | Ga0495648_0009203 | 3300046524 | Bacteria | 7685 |
| 432 | Ga0495648_0010377 | 3300046524 | Bacteria | 7098 |
| 433 | Ga0495648_0012839 | 3300046524 | Bacteria | 6219 |
| 434 | Ga0495648_0024230 | 3300046524 | Bacteria | 4138 |
| 435 | Ga0495648_0033766 | 3300046524 | Bacteria | 3338 |
| 436 | Ga0495648_0035759 | 3300046524 | Bacteria | 3216 |
| 437 | Ga0495648_0038142 | 3300046524 | Bacteria | 3077 |
| 438 | Ga0495648_0053632 | 3300046524 | Bacteria | 2441 |
| 439 | Ga0495666_0000020 | 3300046526 | Bacteria | 62268 |
| 440 | Ga0495666_0026193 | 3300046526 | Bacteria | 2877 |
| 441 | Ga0495642_0000008 | 3300046528 | Bacteria | 162190 |
| 442 | Ga0495654_0000158 | 3300046530 | Bacteria | 67310 |
| 443 | Ga0495654_0000531 | 3300046530 | Bacteria | 30861 |
| 444 | Ga0495654_0000601 | 3300046530 | Bacteria | 28625 |
| 445 | Ga0495654_0001466 | 3300046530 | Bacteria | 16137 |
| 446 | Ga0495654_0002554 | 3300046530 | Bacteria | 11652 |
| 447 | Ga0495654_0004196 | 3300046530 | Bacteria | 8623 |
| 448 | Ga0495654_0006804 | 3300046530 | Bacteria | 6456 |
| 449 | Ga0495654_0006938 | 3300046530 | Bacteria | 6383 |
| 450 | Ga0495654_0014629 | 3300046530 | Bacteria | 4172 |
| 451 | Ga0495654_0027921 | 3300046530 | Bacteria | 2888 |
| 452 | Ga0495654_0045232 | 3300046530 | Bacteria | 2173 |
| 453 | Ga0495654_0054675 | 3300046530 | Bacteria | 1935 |
| 454 | Ga0495654_0097015 | 3300046530 | Bacteria | 1361 |
| 455 | Ga0495654_0135946 | 3300046530 | Bacteria | 1099 |
| 456 | Ga0495654_0162195 | 3300046530 | Bacteria | 980 |
| 457 | Ga0495665_0019437 | 3300046531 | Bacteria | 3654 |
| 458 | Ga0495665_0059972 | 3300046531 | Bacteria | 2008 |
| 459 | Ga0495640_0269226 | 3300046533 | Bacteria | 1063 |
| 460 | Ga0495586_0005186 | 3300046535 | Bacteria | 6973 |
| 461 | Ga0495609_0000016 | 3300046538 | Bacteria | 312882 |
| 462 | Ga0495609_0000077 | 3300046538 | Bacteria | 119266 |
| 463 | Ga0495609_0007870 | 3300046538 | Bacteria | 5269 |
| 464 | Ga0495609_0011901 | 3300046538 | Bacteria | 4135 |
| 465 | Ga0495597_0000012 | 3300046542 | Bacteria | 212005 |
| 466 | Ga0495597_0000045 | 3300046542 | Bacteria | 105633 |
| 467 | Ga0495597_0003219 | 3300046542 | Bacteria | 9708 |
| 468 | Ga0495597_0005930 | 3300046542 | Bacteria | 6376 |
| 469 | Ga0495597_0020511 | 3300046542 | Bacteria | 3077 |
| 470 | Ga0495597_0033032 | 3300046542 | Bacteria | 2345 |
| 471 | Ga0495597_0079439 | 3300046542 | Bacteria | 1405 |
| 472 | Ga0495645_0013392 | 3300046543 | Bacteria | 5796 |
| 473 | Ga0495622_0000086 | 3300046557 | Bacteria | 83162 |
| 474 | Ga0495622_0000426 | 3300046557 | Bacteria | 27816 |
| 475 | Ga0495622_0051354 | 3300046557 | Bacteria | 1913 |
| 476 | Ga0495622_0060661 | 3300046557 | Bacteria | 1751 |
| 477 | Ga0495633_0000138 | 3300046558 | Bacteria | 96804 |
| 478 | Ga0495633_0033303 | 3300046558 | Bacteria | 2485 |
| 479 | Ga0495656_0021232 | 3300046615 | Bacteria | 2526 |
| 480 | Ga0495668_0000379 | 3300046616 | Bacteria | 58955 |
| 481 | Ga0495668_0007801 | 3300046616 | Bacteria | 6785 |
| 482 | Ga0495668_0025866 | 3300046616 | Bacteria | 3333 |
| 483 | Ga0495668_0028275 | 3300046616 | Bacteria | 3171 |
| 484 | Ga0495634_0001639 | 3300046642 | Bacteria | 19477 |
| 485 | Ga0495611_0000019 | 3300046648 | Bacteria | 126076 |
| 486 | Ga0495611_0001238 | 3300046648 | Bacteria | 13138 |
| 487 | Ga0495611_0004213 | 3300046648 | Bacteria | 6260 |
| 488 | Ga0495611_0010174 | 3300046648 | Bacteria | 3980 |
| 489 | Ga0495611_0012029 | 3300046648 | Bacteria | 3677 |
| 490 | Ga0495625_0001630 | 3300046660 | Bacteria | 26438 |
| 491 | Ga0495625_0002882 | 3300046660 | Bacteria | 17983 |
| 492 | Ga0495625_0005115 | 3300046660 | Bacteria | 12126 |
| 493 | Ga0495625_0005634 | 3300046660 | Bacteria | 11348 |
| 494 | Ga0495625_0007998 | 3300046660 | Bacteria | 9081 |
| 495 | Ga0495625_0017633 | 3300046660 | Bacteria | 5587 |
| 496 | Ga0495625_0069795 | 3300046660 | Bacteria | 2468 |
| 497 | Ga0495625_0119353 | 3300046660 | Bacteria | 1796 |
| 498 | Ga0495635_0016603 | 3300046663 | Bacteria | 5142 |
| 499 | Ga0495661_0000001 | 3300046665 | Bacteria | 898372 |
| 500 | Ga0495661_0000010 | 3300046665 | Bacteria | 284261 |
| 501 | Ga0495661_0001554 | 3300046665 | Bacteria | 18936 |
| 502 | Ga0495661_0003328 | 3300046665 | Bacteria | 11913 |
| 503 | Ga0495661_0006051 | 3300046665 | Bacteria | 8524 |
| 504 | Ga0495661_0010260 | 3300046665 | Bacteria | 6399 |
| 505 | Ga0495661_0032443 | 3300046665 | Bacteria | 3301 |
| 506 | Ga0495661_0038402 | 3300046665 | Bacteria | 2983 |
| 507 | Ga0495661_0039929 | 3300046665 | Bacteria | 2913 |
| 508 | Ga0495588_0002156 | 3300046674 | Bacteria | 8422 |
| 509 | Ga0495588_0011333 | 3300046674 | Bacteria | 4180 |
| 510 | Ga0495623_0000590 | 3300046679 | Bacteria | 24255 |
| 511 | Ga0495646_0238453 | 3300046680 | Bacteria | 978 |
| 512 | Ga0495647_0003997 | 3300046681 | Bacteria | 4761 |
| 513 | Ga0495669_0005004 | 3300046684 | Bacteria | 5510 |
| 514 | Ga0495613_0030196 | 3300046689 | Bacteria | 4026 |
| 515 | Ga0495624_0007173 | 3300046690 | Bacteria | 7844 |
| 516 | Ga0495624_0021857 | 3300046690 | Bacteria | 4238 |
| 517 | Ga0495670_0000311 | 3300046691 | Bacteria | 23109 |
| 518 | Ga0495670_0001278 | 3300046691 | Bacteria | 12295 |
| 519 | Ga0495670_0023098 | 3300046691 | Bacteria | 3071 |
| 520 | Ga0495671_0000419 | 3300046692 | Bacteria | 33808 |
| 521 | Ga0495671_0001653 | 3300046692 | Bacteria | 14601 |
| 522 | Ga0495671_0005071 | 3300046692 | Bacteria | 7752 |
| 523 | Ga0495671_0005698 | 3300046692 | Bacteria | 7263 |
| 524 | Ga0495671_0017185 | 3300046692 | Bacteria | 3850 |
| 525 | Ga0495671_0018909 | 3300046692 | Bacteria | 3649 |
| 526 | Ga0495671_0031681 | 3300046692 | Bacteria | 2703 |
| 527 | Ga0495671_0037025 | 3300046692 | Bacteria | 2469 |
| 528 | Ga0495671_0039845 | 3300046692 | Bacteria | 2370 |
| 529 | Ga0495671_0061632 | 3300046692 | Bacteria | 1850 |
| 530 | Ga0495671_0123164 | 3300046692 | Bacteria | 1264 |
| 531 | Ga0495649_0000087 | 3300046694 | Bacteria | 79929 |
| 532 | Ga0495649_0000663 | 3300046694 | Bacteria | 28139 |
| 533 | Ga0495649_0000677 | 3300046694 | Bacteria | 27719 |
| 534 | Ga0495649_0001278 | 3300046694 | Bacteria | 19346 |
| 535 | Ga0495649_0006059 | 3300046694 | Bacteria | 7560 |
| 536 | Ga0495649_0012605 | 3300046694 | Bacteria | 4907 |
| 537 | Ga0495649_0012796 | 3300046694 | Bacteria | 4865 |
| 538 | Ga0495649_0014712 | 3300046694 | Bacteria | 4473 |
| 539 | Ga0495649_0021486 | 3300046694 | Bacteria | 3614 |
| 540 | Ga0495649_0034187 | 3300046694 | Bacteria | 2797 |
| 541 | Ga0495589_0000406 | 3300046794 | Bacteria | 32461 |
| 542 | Ga0495589_0000649 | 3300046794 | Bacteria | 22825 |
| 543 | Ga0495589_0001844 | 3300046794 | Bacteria | 12023 |
| 544 | Ga0495589_0003264 | 3300046794 | Bacteria | 8839 |
| 545 | Ga0495589_0003909 | 3300046794 | Bacteria | 7998 |
| 546 | Ga0495589_0006298 | 3300046794 | Bacteria | 6267 |
| 547 | Ga0495589_0021377 | 3300046794 | Bacteria | 3306 |
| 548 | Ga0495589_0077901 | 3300046794 | Bacteria | 1615 |
| 549 | Ga0495589_0087214 | 3300046794 | Bacteria | 1515 |
| 550 | Ga0495600_0131548 | 3300046809 | Bacteria | 1626 |
| 551 | Ga0495660_0000258 | 3300046810 | Bacteria | 50737 |
| 552 | Ga0495660_0000500 | 3300046810 | Bacteria | 32433 |
| 553 | Ga0495660_0006189 | 3300046810 | Bacteria | 7104 |
| 554 | Ga0495660_0006795 | 3300046810 | Bacteria | 6745 |
| 555 | Ga0495660_0009870 | 3300046810 | Bacteria | 5554 |
| 556 | Ga0495660_0013046 | 3300046810 | Bacteria | 4817 |
| 557 | Ga0495660_0047704 | 3300046810 | Bacteria | 2344 |
| 558 | Ga0495660_0048807 | 3300046810 | Bacteria | 2313 |
| 559 | Ga0495660_0053475 | 3300046810 | Bacteria | 2191 |
| 560 | Ga0495660_0087329 | 3300046810 | Bacteria | 1626 |
| 561 | Ga0495581_0005956 | 3300047315 | Bacteria | 7069 |
| 562 | Ga0495581_0382697 | 3300047315 | Bacteria | 821 |
| 563 | Ga0495604_0000143 | 3300047317 | Bacteria | 61592 |
| 564 | Ga0495674_0001761 | 3300047319 | Bacteria | 21319 |
| 565 | Ga0495672_0000743 | 3300047320 | Bacteria | 35713 |
| 566 | Ga0495672_0001129 | 3300047320 | Bacteria | 27029 |
| 567 | Ga0495672_0001334 | 3300047320 | Bacteria | 24515 |
| 568 | Ga0495672_0005219 | 3300047320 | Bacteria | 10347 |
| 569 | Ga0495672_0005274 | 3300047320 | Bacteria | 10294 |
| 570 | Ga0495672_0014101 | 3300047320 | Bacteria | 5485 |
| 571 | Ga0495672_0033647 | 3300047320 | Bacteria | 3174 |
| 572 | Ga0495672_0043109 | 3300047320 | Bacteria | 2715 |
| 573 | Ga0495672_0133603 | 3300047320 | Bacteria | 1303 |
| 574 | Ga0495676_0033889 | 3300047321 | Bacteria | 4292 |
| 575 | Ga0495676_0035212 | 3300047321 | Bacteria | 4189 |
| 576 | Ga0495680_0094059 | 3300047322 | Bacteria | 2243 |
| 577 | Ga0495680_0463770 | 3300047322 | Bacteria | 865 |
| 578 | Ga0495683_0000022 | 3300047323 | Bacteria | 163268 |
| 579 | Ga0495683_0000062 | 3300047323 | Bacteria | 113926 |
| 580 | Ga0495683_0000110 | 3300047323 | Bacteria | 83927 |
| 581 | Ga0495683_0002570 | 3300047323 | Bacteria | 10900 |
| 582 | Ga0495683_0005022 | 3300047323 | Bacteria | 7412 |
| 583 | Ga0495683_0009227 | 3300047323 | Bacteria | 5256 |
| 584 | Ga0495683_0011625 | 3300047323 | Bacteria | 4632 |
| 585 | Ga0495683_0018099 | 3300047323 | Bacteria | 3646 |
| 586 | Ga0495683_0019463 | 3300047323 | Bacteria | 3502 |
| 587 | Ga0495683_0099619 | 3300047323 | Bacteria | 1398 |
| 588 | Ga0495675_0014794 | 3300047444 | Bacteria | 4933 |
| 589 | Ga0495677_0038713 | 3300047445 | Bacteria | 1742 |
| 590 | Ga0495679_000042 | 3300047446 | Bacteria | 143151 |
| 591 | Ga0495679_000799 | 3300047446 | Bacteria | 20002 |
| 592 | Ga0495679_002335 | 3300047446 | Bacteria | 9735 |
| 593 | Ga0495679_004608 | 3300047446 | Bacteria | 6290 |
| 594 | Ga0495673_0000192 | 3300047469 | Bacteria | 96394 |
| 595 | Ga0495673_0000429 | 3300047469 | Bacteria | 47646 |
| 596 | Ga0495673_0000769 | 3300047469 | Bacteria | 30385 |
| 597 | Ga0495673_0000847 | 3300047469 | Bacteria | 28434 |
| 598 | Ga0495673_0000998 | 3300047469 | Bacteria | 25147 |
| 599 | Ga0495673_0001144 | 3300047469 | Bacteria | 22678 |
| 600 | Ga0495673_0002309 | 3300047469 | Bacteria | 13635 |
| 601 | Ga0495673_0002777 | 3300047469 | Bacteria | 11975 |
| 602 | Ga0495673_0020288 | 3300047469 | Bacteria | 3311 |
| 603 | Ga0495673_0025756 | 3300047469 | Bacteria | 2819 |
| 604 | Ga0495681_0000441 | 3300047470 | Bacteria | 31744 |
| 605 | Ga0495681_0000802 | 3300047470 | Bacteria | 24208 |
| 606 | Ga0495681_0001036 | 3300047470 | Bacteria | 21248 |
| 607 | Ga0495681_0001322 | 3300047470 | Bacteria | 18757 |
| 608 | Ga0495681_0001338 | 3300047470 | Bacteria | 18589 |
| 609 | Ga0495681_0001427 | 3300047470 | Bacteria | 17963 |
| 610 | Ga0495681_0001859 | 3300047470 | Bacteria | 15489 |
| 611 | Ga0495681_0010314 | 3300047470 | Bacteria | 5659 |
| 612 | Ga0495681_0015921 | 3300047470 | Bacteria | 4242 |
| 613 | Ga0495681_0016012 | 3300047470 | Bacteria | 4226 |
| 614 | Ga0495681_0021071 | 3300047470 | Bacteria | 3520 |
| 615 | Ga0495681_0029952 | 3300047470 | Bacteria | 2778 |
| 616 | Ga0495681_0038781 | 3300047470 | Bacteria | 2332 |
| 617 | Ga0495684_0012633 | 3300047471 | Bacteria | 6516 |
| 618 | Ga0495684_0028216 | 3300047471 | Bacteria | 4309 |
| 619 | Ga0495684_0118219 | 3300047471 | Bacteria | 1998 |
| 620 | Ga0495686_0000246 | 3300047472 | Bacteria | 97501 |
| 621 | Ga0495686_0001403 | 3300047472 | Bacteria | 26593 |
| 622 | Ga0495686_0011982 | 3300047472 | Bacteria | 6093 |
| 623 | Ga0495686_0028125 | 3300047472 | Bacteria | 3662 |
| 624 | Ga0495686_0044614 | 3300047472 | Bacteria | 2807 |
| 625 | Ga0495686_0091729 | 3300047472 | Bacteria | 1844 |
| 626 | Ga0495686_0145512 | 3300047472 | Bacteria | 1395 |
| 627 | Ga0495686_0165259 | 3300047472 | Bacteria | 1290 |
| 628 | Ga0495593_0001134 | 3300047673 | Bacteria | 15514 |
| 629 | Ga0495593_0003121 | 3300047673 | Bacteria | 9957 |
| 630 | Ga0495626_0000002 | 3300048091 | Bacteria | 436012 |
| 631 | Ga0495626_0000035 | 3300048091 | Bacteria | 180770 |
| 632 | Ga0495626_0000112 | 3300048091 | Bacteria | 105221 |
| 633 | Ga0495626_0000199 | 3300048091 | Bacteria | 72605 |
| 634 | Ga0495626_0000243 | 3300048091 | Bacteria | 63145 |
| 635 | Ga0495626_0001716 | 3300048091 | Bacteria | 16780 |
| 636 | Ga0495626_0002727 | 3300048091 | Bacteria | 11900 |
| 637 | Ga0495626_0003751 | 3300048091 | Bacteria | 9572 |
| 638 | Ga0495626_0036865 | 3300048091 | Bacteria | 2327 |
| 639 | Ga0495626_0085260 | 3300048091 | Bacteria | 1397 |
| 640 | Ga0496100_0004216 | 3300048903 | Bacteria | 7593 |
| 641 | Ga0496101_0008482 | 3300048904 | Bacteria | 6715 |
| 642 | Ga0496102_0015342 | 3300048905 | Bacteria | 6672 |
| 643 | Ga0496102_0060844 | 3300048905 | Bacteria | 3455 |
| 644 | Ga0496104_0001979 | 3300048907 | Bacteria | 17749 |
| 645 | Ga0496105_0019780 | 3300048908 | Bacteria | 5433 |
| 646 | Ga0496106_0001612 | 3300048909 | Bacteria | 16945 |
| 647 | Ga0496106_0280750 | 3300048909 | Bacteria | 1334 |
| 648 | Ga0496107_0007347 | 3300048910 | Bacteria | 7597 |
| 649 | Ga0496108_0005122 | 3300048911 | Bacteria | 10595 |
| 650 | Ga0496108_0015651 | 3300048911 | Bacteria | 6186 |
| 651 | Ga0496108_0363000 | 3300048911 | Bacteria | 1264 |
| 652 | Ga0496109_0009300 | 3300048912 | Bacteria | 8373 |
| 653 | Ga0496109_0047425 | 3300048912 | Bacteria | 3906 |
| 654 | Ga0496109_0356830 | 3300048912 | Bacteria | 1381 |
| 655 | Ga0496109_0397596 | 3300048912 | Bacteria | 1302 |
| 656 | Ga0496110_0000756 | 3300048913 | Bacteria | 22392 |
| 657 | Ga0496110_0002693 | 3300048913 | Bacteria | 13418 |
| 658 | Ga0496110_0019801 | 3300048913 | Bacteria | 5670 |
| 659 | Ga0496110_0135591 | 3300048913 | Bacteria | 2224 |
| 660 | Ga0496110_0335528 | 3300048913 | Bacteria | 1377 |
| 661 | Ga0496111_0004067 | 3300048914 | Bacteria | 9190 |
| 662 | Ga0496111_0037305 | 3300048914 | Bacteria | 3478 |
| 663 | Ga0496111_0041913 | 3300048914 | Bacteria | 3286 |
| 664 | Ga0496112_0021703 | 3300048915 | Bacteria | 6108 |
| 665 | Ga0496112_0025004 | 3300048915 | Bacteria | 5730 |
| 666 | Ga0496112_0026080 | 3300048915 | Bacteria | 5619 |
| 667 | Ga0496113_0005557 | 3300048916 | Bacteria | 7877 |
| 668 | Ga0496114_0634958 | 3300048917 | Bacteria | 940 |
| 669 | Ga0496115_0434844 | 3300048918 | Bacteria | 1062 |
| 670 | Ga0496116_0000151 | 3300048919 | Bacteria | 141429 |
| 671 | Ga0496118_0087188 | 3300048921 | Bacteria | 2166 |
| 672 | Ga0496119_0057738 | 3300048922 | Bacteria | 2343 |
| 673 | Ga0496121_0002334 | 3300048924 | Bacteria | 29308 |
| 674 | Ga0496121_0003523 | 3300048924 | Bacteria | 22213 |
| 675 | Ga0496121_0064379 | 3300048924 | Bacteria | 2990 |
| 676 | Ga0496122_0092041 | 3300048925 | Bacteria | 2063 |
| 677 | Ga0496124_0000272 | 3300048927 | Bacteria | 99703 |
| 678 | Ga0496124_0000275 | 3300048927 | Bacteria | 98848 |
| 679 | Ga0496124_0001487 | 3300048927 | Bacteria | 34442 |
| 680 | Ga0496124_0002199 | 3300048927 | Bacteria | 26020 |
| 681 | Ga0496124_0156735 | 3300048927 | Bacteria | 1780 |
| 682 | Ga0496125_0012616 | 3300048928 | Bacteria | 8369 |
| 683 | Ga0496125_0019225 | 3300048928 | Bacteria | 6452 |
| 684 | Ga0496126_0010095 | 3300048929 | Bacteria | 9960 |
| 685 | Ga0496126_0179659 | 3300048929 | Bacteria | 1798 |
| 686 | Ga0496126_0602823 | 3300048929 | Bacteria | 865 |
| 687 | Ga0495678_000109 | 3300049459 | Bacteria | 98037 |
| 688 | Ga0495678_000177 | 3300049459 | Bacteria | 73172 |
| 689 | Ga0495678_001282 | 3300049459 | Bacteria | 20332 |
| 690 | Ga0495678_001486 | 3300049459 | Bacteria | 18326 |
| 691 | Ga0495678_001509 | 3300049459 | Bacteria | 18118 |
| 692 | Ga0495678_001612 | 3300049459 | Bacteria | 17261 |
| 693 | Ga0495678_004047 | 3300049459 | Bacteria | 8706 |
| 694 | Ga0495678_004309 | 3300049459 | Bacteria | 8291 |
| 695 | Ga0495678_012852 | 3300049459 | Bacteria | 3950 |
| 696 | Ga0495678_017621 | 3300049459 | Bacteria | 3230 |
| 697 | Ga0495678_028650 | 3300049459 | Bacteria | 2347 |
| 698 | Ga0495678_032193 | 3300049459 | Bacteria | 2177 |
| 699 | Ga0495678_065780 | 3300049459 | Bacteria | 1344 |
| 700 | Ga0495678_078662 | 3300049459 | Bacteria | 1190 |
| 701 | Ga0495678_121747 | 3300049459 | Bacteria | 875 |
| 702 | Ga0495682_0000075 | 3300049460 | Bacteria | 91041 |
| 703 | Ga0495682_0000223 | 3300049460 | Bacteria | 44502 |
| 704 | Ga0501031_0167646 | 3300049568 | Bacteria | 1435 |
| 705 | Ga0501033_0019821 | 3300049570 | Bacteria | 5084 |
| 706 | Ga0501034_0000055 | 3300049571 | Bacteria | 205427 |
| 707 | Ga0501034_0010898 | 3300049571 | Bacteria | 9443 |
| 708 | Ga0501034_0040170 | 3300049571 | Bacteria | 4737 |
| 709 | Ga0501034_0091279 | 3300049571 | Bacteria | 3044 |
| 710 | Ga0501034_0105037 | 3300049571 | Bacteria | 2818 |
| 711 | Ga0501034_0290922 | 3300049571 | Bacteria | 1572 |
| 712 | Ga0501034_0343487 | 3300049571 | Bacteria | 1422 |
| 713 | Ga0501038_0031707 | 3300049574 | Bacteria | 4668 |
| 714 | Ga0501043_0011219 | 3300049579 | Bacteria | 7019 |
| 715 | Ga0501047_0039677 | 3300049581 | Bacteria | 4553 |
| 716 | Ga0501047_0047185 | 3300049581 | Bacteria | 4161 |
| 717 | Ga0501047_0638322 | 3300049581 | Bacteria | 885 |
| 718 | Ga0501068_0144056 | 3300049584 | Bacteria | 1495 |
| 719 | Ga0501070_0232314 | 3300049586 | Bacteria | 1511 |
| 720 | Ga0501070_0311299 | 3300049586 | Bacteria | 1282 |
| 721 | Ga0501080_0101710 | 3300049742 | Bacteria | 2666 |
| 722 | Ga0501044_0002282 | 3300049823 | Bacteria | 21838 |
| 723 | Ga0501044_0202574 | 3300049823 | Bacteria | 1942 |
| 724 | Ga0501044_0207726 | 3300049823 | Bacteria | 1914 |
| 725 | Ga0501044_0487679 | 3300049823 | Bacteria | 1135 |
| 726 | nmdc:mga03683_18499_c1 | 3300050489 | Bacteria | 2649 |
| 727 | nmdc:mga03n38_12711_c1 | 3300050490 | Bacteria | 3177 |
| 728 | nmdc:mga00v17_294699_c1 | 3300050491 | Bacteria | 1053 |
| 729 | nmdc:mga0yw44_15259_c1 | 3300050492 | Bacteria | 4108 |
| 730 | nmdc:mga0yw44_160633_c1 | 3300050492 | Bacteria | 1471 |
| 731 | nmdc:mga0yw44_266902_c1 | 3300050492 | Bacteria | 1142 |
| 732 | nmdc:mga06z11_1828_c1 | 3300050494 | Bacteria | 8013 |
| 733 | nmdc:mga06z11_88117_c1 | 3300050494 | Bacteria | 1680 |
| 734 | nmdc:mga04h51_9211_c1 | 3300050495 | Bacteria | 2666 |
| 735 | nmdc:mga05p37_34840_c1 | 3300050507 | Bacteria | 6167 |
| 736 | nmdc:mga05p37_455865_c1 | 3300050507 | Bacteria | 1479 |
| 737 | nmdc:mga0qj67_36604_c1 | 3300050509 | Bacteria | 3841 |
| 738 | nmdc:mga0n895_56907_c1 | 3300050512 | Bacteria | 3854 |
| 739 | nmdc:mga0n895_63771_c1 | 3300050512 | Bacteria | 3644 |
| 740 | nmdc:mga0n895_748420_c1 | 3300050512 | Bacteria | 970 |
| 741 | nmdc:mga0n895_92055_c1 | 3300050512 | Bacteria | 3035 |
| 742 | nmdc:mga0rr50_321760_c1 | 3300050513 | Unclassified | 1297 |
| 743 | nmdc:mga08x19_276637_c1 | 3300050514 | Bacteria | 1163 |
| 744 | nmdc:mga0sz30_1116_c1 | 3300050516 | Bacteria | 9630 |
| 745 | Ga0495601_0000751 | 3300053077 | Bacteria | 17458 |
| 746 | Ga0495612_0000428 | 3300053078 | Bacteria | 16790 |
| 747 | Ga0495612_0027682 | 3300053078 | Bacteria | 2280 |
| 748 | Ga0495595_0023021 | 3300053084 | Bacteria | 2739 |
| 749 | Ga0495619_0021248 | 3300053085 | Bacteria | 4141 |
| 750 | Ga0495619_0068771 | 3300053085 | Bacteria | 2366 |
| 751 | Ga0495619_0192800 | 3300053085 | Bacteria | 1410 |
| 752 | Ga0500643_001519 | 3300053087 | Bacteria | 13238 |
| 753 | Ga0500643_003954 | 3300053087 | Bacteria | 6863 |
| 754 | Ga0500644_0051354 | 3300053088 | Bacteria | 1416 |
| 755 | Ga0500651_0035136 | 3300053093 | Bacteria | 3160 |
| 756 | Ga0500641_0008610 | 3300053096 | Bacteria | 3646 |
| 757 | Ga0500572_000005 | 3300053111 | Bacteria | 84950 |
| 758 | Ga0500652_047573 | 3300053131 | Bacteria | 1743 |
| 759 | Ga0500589_055234 | 3300053147 | Bacteria | 1833 |
| 760 | Ga0500616_0001240 | 3300053153 | Bacteria | 25589 |
| 761 | Ga0500616_0070071 | 3300053153 | Bacteria | 1791 |
| 762 | Ga0500627_0000217 | 3300053158 | Bacteria | 16618 |
| 763 | Ga0500627_0000776 | 3300053158 | Bacteria | 8504 |
| 764 | Ga0500627_0016406 | 3300053158 | Bacteria | 2887 |
| 765 | Ga0500657_136543 | 3300053728 | Bacteria | 940 |
| 766 | Ga0500552_001519 | 3300053733 | Bacteria | 2222 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044765 | Ga0466970_0156306 | Ga0466970_0156306_559_1239 | 219 |
| 2 | 3300048929 | Ga0496126_0602823 | Ga0496126_0602823_159_839 | 220 |
| 3 | 3300031241 | Ga0265325_10046234 | Ga0265325_100462343 | 247 |
| 4 | 3300031249 | Ga0265339_10002697 | Ga0265339_100026979 | 247 |
| 5 | 3300031595 | Ga0265313_10003192 | Ga0265313_100031927 | 247 |
| 6 | 3300006175 | Ga0070712_100043772 | Ga0070712_1000437723 | 248 |
| 7 | 3300013306 | Ga0163162_10000095 | Ga0163162_1000009526 | 248 |
| 8 | 3300025915 | Ga0207693_10011079 | Ga0207693_100110792 | 248 |
| 9 | 3300053087 | Ga0500643_001519 | Ga0500643_001519_10611_11375 | 248 |
| 10 | 3300053158 | Ga0500627_0000776 | Ga0500627_0000776_654_1415 | 248 |
| 11 | 3300053158 | Ga0500627_0016406 | Ga0500627_0016406_923_1684 | 248 |
| 12 | 3300042138 | Ga0450903_002793 | Ga0450903_002793_2142_2903 | 252 |
| 13 | 3300046492 | Ga0495585_0162248 | Ga0495585_0162248_104_865 | 252 |
| 14 | 3300046501 | Ga0495607_0002009 | Ga0495607_0002009_5245_6006 | 252 |
| 15 | 3300046501 | Ga0495607_0125086 | Ga0495607_0125086_468_1241 | 252 |
| 16 | 3300046507 | Ga0495606_0053514 | Ga0495606_0053514_1415_2191 | 252 |
| 17 | 3300046519 | Ga0495632_0050687 | Ga0495632_0050687_1069_1830 | 252 |
| 18 | 3300046520 | Ga0495637_0000999 | Ga0495637_0000999_13183_13944 | 252 |
| 19 | 3300046524 | Ga0495648_0033766 | Ga0495648_0033766_2567_3328 | 252 |
| 20 | iso_pu_bacteria | 2917736166 | 2917736784 | 252 |
| 21 | 3300005434 | Ga0070709_10223355 | Ga0070709_102233552 | 253 |
| 22 | 3300047315 | Ga0495581_0382697 | Ga0495581_0382697_17_778 | 253 |
| 23 | 3300048927 | Ga0496124_0000272 | Ga0496124_0000272_66475_67254 | 253 |
| 24 | iso_pu_bacteria | 2643221605 | 2644039160 | 254 |
| 25 | 3300005339 | Ga0070660_100342359 | Ga0070660_1003423591 | 255 |
| 26 | 3300005340 | Ga0070689_100121564 | Ga0070689_1001215643 | 255 |
| 27 | 3300005344 | Ga0070661_100200733 | Ga0070661_1002007331 | 255 |
| 28 | 3300005354 | Ga0070675_100149492 | Ga0070675_1001494922 | 255 |
| 29 | 3300005355 | Ga0070671_100017825 | Ga0070671_1000178254 | 255 |
| 30 | 3300005364 | Ga0070673_100000963 | Ga0070673_10000096312 | 255 |
| 31 | 3300005365 | Ga0070688_100012965 | Ga0070688_1000129654 | 255 |
| 32 | 3300005366 | Ga0070659_100090962 | Ga0070659_1000909623 | 255 |
| 33 | 3300005434 | Ga0070709_10064979 | Ga0070709_100649792 | 255 |
| 34 | 3300005435 | Ga0070714_100133793 | Ga0070714_1001337933 | 255 |
| 35 | 3300005436 | Ga0070713_100030829 | Ga0070713_1000308293 | 255 |
| 36 | 3300005457 | Ga0070662_100079327 | Ga0070662_1000793272 | 255 |
| 37 | 3300005616 | Ga0068852_100635049 | Ga0068852_1006350492 | 255 |
| 38 | 3300005842 | Ga0068858_100096863 | Ga0068858_1000968632 | 255 |
| 39 | 3300006028 | Ga0070717_10237706 | Ga0070717_102377062 | 255 |
| 40 | 3300006173 | Ga0070716_100023817 | Ga0070716_1000238174 | 255 |
| 41 | 3300006847 | Ga0075431_100162304 | Ga0075431_1001623042 | 255 |
| 42 | 3300009098 | Ga0105245_10046581 | Ga0105245_100465813 | 255 |
| 43 | 3300009147 | Ga0114129_10271689 | Ga0114129_102716892 | 255 |
| 44 | 3300010375 | Ga0105239_10324737 | Ga0105239_103247373 | 255 |
| 45 | 3300011119 | Ga0105246_10150804 | Ga0105246_101508042 | 255 |
| 46 | 3300014325 | Ga0163163_10161300 | Ga0163163_101613003 | 255 |
| 47 | 3300014325 | Ga0163163_10465587 | Ga0163163_104655871 | 255 |
| 48 | 3300025903 | Ga0207680_10412626 | Ga0207680_104126261 | 255 |
| 49 | 3300025916 | Ga0207663_10165554 | Ga0207663_101655541 | 255 |
| 50 | 3300025919 | Ga0207657_10312237 | Ga0207657_103122372 | 255 |
| 51 | 3300025925 | Ga0207650_10000973 | Ga0207650_100009734 | 255 |
| 52 | 3300025931 | Ga0207644_10006443 | Ga0207644_100064435 | 255 |
| 53 | 3300025933 | Ga0207706_10147801 | Ga0207706_101478012 | 255 |
| 54 | 3300025939 | Ga0207665_10035886 | Ga0207665_100358864 | 255 |
| 55 | 3300025960 | Ga0207651_10003178 | Ga0207651_100031783 | 255 |
| 56 | 3300025986 | Ga0207658_10646682 | Ga0207658_106466822 | 255 |
| 57 | 3300026067 | Ga0207678_10056296 | Ga0207678_100562962 | 255 |
| 58 | 3300028379 | Ga0268266_10027224 | Ga0268266_100272245 | 255 |
| 59 | 3300048909 | Ga0496106_0280750 | Ga0496106_0280750_120_890 | 255 |
| 60 | 3300048911 | Ga0496108_0363000 | Ga0496108_0363000_29_799 | 255 |
| 61 | 3300048912 | Ga0496109_0397596 | Ga0496109_0397596_68_838 | 255 |
| 62 | 3300048913 | Ga0496110_0019801 | Ga0496110_0019801_995_1765 | 255 |
| 63 | 3300048915 | Ga0496112_0026080 | Ga0496112_0026080_1475_2245 | 255 |
| 64 | 3300048917 | Ga0496114_0634958 | Ga0496114_0634958_151_921 | 255 |
| 65 | 3300050509 | nmdc:mga0qj67_36604_c1 | nmdc:mga0qj67_36604_c1_1641_2411 | 255 |
| 66 | 3300025303 | Ga0209051_1000294 | Ga0209051_100029445 | 256 |
| 67 | 3300028794 | Ga0307515_10274908 | Ga0307515_102749082 | 256 |
| 68 | 3300031616 | Ga0307508_10042465 | Ga0307508_100424653 | 256 |
| 69 | 3300032002 | Ga0307416_100614074 | Ga0307416_1006140741 | 256 |
| 70 | 3300033180 | Ga0307510_10006092 | Ga0307510_100060927 | 256 |
| 71 | 3300033180 | Ga0307510_10111196 | Ga0307510_101111962 | 256 |
| 72 | 3300046519 | Ga0495632_0000340 | Ga0495632_0000340_17832_18617 | 256 |
| 73 | 3300046522 | Ga0495643_0003191 | Ga0495643_0003191_731_1516 | 256 |
| 74 | 3300046694 | Ga0495649_0001278 | Ga0495649_0001278_1346_2131 | 256 |
| 75 | 3300048929 | Ga0496126_0010095 | Ga0496126_0010095_5426_6196 | 256 |
| 76 | 3300053131 | Ga0500652_047573 | Ga0500652_047573_455_1228 | 256 |
| 77 | iso_pu_bacteria | 2599185317 | 2600030809 | 256 |
| 78 | iso_pu_bacteria | 2599185317 | 2600032113 | 256 |
| 79 | iso_pu_bacteria | 2600254930 | 2600359957 | 256 |
| 80 | iso_pu_bacteria | 2600254930 | 2600360614 | 256 |
| 81 | iso_pu_bacteria | 2738541294 | 2738806960 | 256 |
| 82 | iso_pu_bacteria | 2738541309 | 2738894320 | 256 |
| 83 | iso_pu_bacteria | 2913036834 | 2913041626 | 256 |
| 84 | iso_pu_bacteria | 2984568884 | 2984569611 | 256 |
| 85 | 3300002739 | JGI25158J39367_1005935 | JGI25158J39367_10059351 | 257 |
| 86 | 3300005288 | Ga0065714_10002201 | Ga0065714_1000220132 | 257 |
| 87 | 3300005288 | Ga0065714_10007572 | Ga0065714_100075722 | 257 |
| 88 | 3300005288 | Ga0065714_10020205 | Ga0065714_100202052 | 257 |
| 89 | 3300005288 | Ga0065714_10065664 | Ga0065714_100656646 | 257 |
| 90 | 3300005288 | Ga0065714_10073863 | Ga0065714_100738632 | 257 |
| 91 | 3300005289 | Ga0065704_10071404 | Ga0065704_100714045 | 257 |
| 92 | 3300005329 | Ga0070683_100367810 | Ga0070683_1003678102 | 257 |
| 93 | 3300005336 | Ga0070680_100007366 | Ga0070680_1000073667 | 257 |
| 94 | 3300005336 | Ga0070680_100091993 | Ga0070680_1000919932 | 257 |
| 95 | 3300005340 | Ga0070689_100045226 | Ga0070689_1000452263 | 257 |
| 96 | 3300005344 | Ga0070661_100021408 | Ga0070661_1000214083 | 257 |
| 97 | 3300005354 | Ga0070675_100053262 | Ga0070675_1000532623 | 257 |
| 98 | 3300005364 | Ga0070673_100498233 | Ga0070673_1004982331 | 257 |
| 99 | 3300005435 | Ga0070714_100934047 | Ga0070714_1009340471 | 257 |
| 100 | 3300005436 | Ga0070713_100012832 | Ga0070713_1000128321 | 257 |
| 101 | 3300005436 | Ga0070713_100573863 | Ga0070713_1005738632 | 257 |
| 102 | 3300005437 | Ga0070710_10080381 | Ga0070710_100803812 | 257 |
| 103 | 3300005437 | Ga0070710_10225102 | Ga0070710_102251021 | 257 |
| 104 | 3300005439 | Ga0070711_100286915 | Ga0070711_1002869152 | 257 |
| 105 | 3300005440 | Ga0070705_100071926 | Ga0070705_1000719262 | 257 |
| 106 | 3300005445 | Ga0070708_100044695 | Ga0070708_1000446952 | 257 |
| 107 | 3300005456 | Ga0070678_100104382 | Ga0070678_1001043822 | 257 |
| 108 | 3300005467 | Ga0070706_100022710 | Ga0070706_1000227108 | 257 |
| 109 | 3300005471 | Ga0070698_100001145 | Ga0070698_10000114525 | 257 |
| 110 | 3300005518 | Ga0070699_100119010 | Ga0070699_1001190103 | 257 |
| 111 | 3300005530 | Ga0070679_100003811 | Ga0070679_1000038119 | 257 |
| 112 | 3300005530 | Ga0070679_100007804 | Ga0070679_1000078049 | 257 |
| 113 | 3300005535 | Ga0070684_100168370 | Ga0070684_1001683702 | 257 |
| 114 | 3300005536 | Ga0070697_100047256 | Ga0070697_1000472562 | 257 |
| 115 | 3300005539 | Ga0068853_100316694 | Ga0068853_1003166942 | 257 |
| 116 | 3300005545 | Ga0070695_100147102 | Ga0070695_1001471022 | 257 |
| 117 | 3300005548 | Ga0070665_100006359 | Ga0070665_10000635914 | 257 |
| 118 | 3300005549 | Ga0070704_100009792 | Ga0070704_1000097924 | 257 |
| 119 | 3300005563 | Ga0068855_100145232 | Ga0068855_1001452323 | 257 |
| 120 | 3300005564 | Ga0070664_100518667 | Ga0070664_1005186672 | 257 |
| 121 | 3300005614 | Ga0068856_100007129 | Ga0068856_1000071296 | 257 |
| 122 | 3300005616 | Ga0068852_100041706 | Ga0068852_1000417063 | 257 |
| 123 | 3300005843 | Ga0068860_100726695 | Ga0068860_1007266952 | 257 |
| 124 | 3300005937 | Ga0081455_10000780 | Ga0081455_1000078012 | 257 |
| 125 | 3300005981 | Ga0081538_10084129 | Ga0081538_100841292 | 257 |
| 126 | 3300005985 | Ga0081539_10033308 | Ga0081539_100333082 | 257 |
| 127 | 3300006028 | Ga0070717_10040838 | Ga0070717_100408385 | 257 |
| 128 | 3300006042 | Ga0075368_10024403 | Ga0075368_100244034 | 257 |
| 129 | 3300006058 | Ga0075432_10002265 | Ga0075432_100022653 | 257 |
| 130 | 3300006163 | Ga0070715_10164644 | Ga0070715_101646442 | 257 |
| 131 | 3300006173 | Ga0070716_100268668 | Ga0070716_1002686682 | 257 |
| 132 | 3300006175 | Ga0070712_100096249 | Ga0070712_1000962492 | 257 |
| 133 | 3300006175 | Ga0070712_100129070 | Ga0070712_1001290702 | 257 |
| 134 | 3300006178 | Ga0075367_10112616 | Ga0075367_101126162 | 257 |
| 135 | 3300006186 | Ga0075369_10000557 | Ga0075369_100005577 | 257 |
| 136 | 3300006186 | Ga0075369_10011093 | Ga0075369_100110932 | 257 |
| 137 | 3300006195 | Ga0075366_10033745 | Ga0075366_100337453 | 257 |
| 138 | 3300006844 | Ga0075428_100332433 | Ga0075428_1003324332 | 257 |
| 139 | 3300006852 | Ga0075433_10083227 | Ga0075433_100832272 | 257 |
| 140 | 3300006871 | Ga0075434_100147309 | Ga0075434_1001473092 | 257 |
| 141 | 3300006914 | Ga0075436_100077667 | Ga0075436_1000776672 | 257 |
| 142 | 3300006914 | Ga0075436_100268989 | Ga0075436_1002689892 | 257 |
| 143 | 3300006931 | Ga0097620_100299653 | Ga0097620_1002996532 | 257 |
| 144 | 3300006946 | Ga0079104_1002009 | Ga0079104_10020096 | 257 |
| 145 | 3300007076 | Ga0075435_100168288 | Ga0075435_1001682883 | 257 |
| 146 | 3300007076 | Ga0075435_100683145 | Ga0075435_1006831451 | 257 |
| 147 | 3300009011 | Ga0105251_10000210 | Ga0105251_1000021013 | 257 |
| 148 | 3300009036 | Ga0105244_10003598 | Ga0105244_100035986 | 257 |
| 149 | 3300009036 | Ga0105244_10027736 | Ga0105244_100277362 | 257 |
| 150 | 3300009036 | Ga0105244_10038499 | Ga0105244_100384992 | 257 |
| 151 | 3300009092 | Ga0105250_10000715 | Ga0105250_1000071510 | 257 |
| 152 | 3300009092 | Ga0105250_10073434 | Ga0105250_100734342 | 257 |
| 153 | 3300009147 | Ga0114129_10108130 | Ga0114129_101081303 | 257 |
| 154 | 3300009148 | Ga0105243_10004716 | Ga0105243_100047168 | 257 |
| 155 | 3300009148 | Ga0105243_10215157 | Ga0105243_102151572 | 257 |
| 156 | 3300009545 | Ga0105237_10129783 | Ga0105237_101297832 | 257 |
| 157 | 3300009551 | Ga0105238_10271663 | Ga0105238_102716632 | 257 |
| 158 | 3300009553 | Ga0105249_10095354 | Ga0105249_100953542 | 257 |
| 159 | 3300012498 | Ga0157345_1000002 | Ga0157345_100000237 | 257 |
| 160 | 3300013100 | Ga0157373_10000060 | Ga0157373_1000006032 | 257 |
| 161 | 3300013102 | Ga0157371_10046377 | Ga0157371_100463772 | 257 |
| 162 | 3300013102 | Ga0157371_10068455 | Ga0157371_100684554 | 257 |
| 163 | 3300013104 | Ga0157370_10000874 | Ga0157370_1000087414 | 257 |
| 164 | 3300013104 | Ga0157370_10001700 | Ga0157370_100017007 | 257 |
| 165 | 3300013104 | Ga0157370_10047738 | Ga0157370_100477387 | 257 |
| 166 | 3300013105 | Ga0157369_10000564 | Ga0157369_1000056426 | 257 |
| 167 | 3300013306 | Ga0163162_10000430 | Ga0163162_1000043022 | 257 |
| 168 | 3300013307 | Ga0157372_10808451 | Ga0157372_108084512 | 257 |
| 169 | 3300013308 | Ga0157375_10396152 | Ga0157375_103961522 | 257 |
| 170 | 3300014497 | Ga0182008_10001847 | Ga0182008_1000184710 | 257 |
| 171 | 3300015265 | Ga0182005_1000139 | Ga0182005_100013952 | 257 |
| 172 | 3300017792 | Ga0163161_10003069 | Ga0163161_100030695 | 257 |
| 173 | 3300017792 | Ga0163161_10012542 | Ga0163161_100125425 | 257 |
| 174 | 3300017792 | Ga0163161_10043802 | Ga0163161_100438023 | 257 |
| 175 | 3300025711 | Ga0207696_1008745 | Ga0207696_10087452 | 257 |
| 176 | 3300025728 | Ga0207655_1000006 | Ga0207655_1000006706 | 257 |
| 177 | 3300025728 | Ga0207655_1000325 | Ga0207655_10003257 | 257 |
| 178 | 3300025735 | Ga0207713_1001068 | Ga0207713_100106813 | 257 |
| 179 | 3300025735 | Ga0207713_1009523 | Ga0207713_10095233 | 257 |
| 180 | 3300025735 | Ga0207713_1016331 | Ga0207713_10163312 | 257 |
| 181 | 3300025898 | Ga0207692_10040201 | Ga0207692_100402012 | 257 |
| 182 | 3300025903 | Ga0207680_10193943 | Ga0207680_101939432 | 257 |
| 183 | 3300025907 | Ga0207645_10430857 | Ga0207645_104308571 | 257 |
| 184 | 3300025912 | Ga0207707_10101783 | Ga0207707_101017833 | 257 |
| 185 | 3300025914 | Ga0207671_10095851 | Ga0207671_100958513 | 257 |
| 186 | 3300025915 | Ga0207693_10117573 | Ga0207693_101175734 | 257 |
| 187 | 3300025916 | Ga0207663_10206934 | Ga0207663_102069342 | 257 |
| 188 | 3300025917 | Ga0207660_10016221 | Ga0207660_100162215 | 257 |
| 189 | 3300025918 | Ga0207662_10114726 | Ga0207662_101147262 | 257 |
| 190 | 3300025924 | Ga0207694_10409906 | Ga0207694_104099061 | 257 |
| 191 | 3300025926 | Ga0207659_10057930 | Ga0207659_100579302 | 257 |
| 192 | 3300025928 | Ga0207700_10010336 | Ga0207700_100103364 | 257 |
| 193 | 3300025928 | Ga0207700_10028667 | Ga0207700_100286671 | 257 |
| 194 | 3300025928 | Ga0207700_10186715 | Ga0207700_101867151 | 257 |
| 195 | 3300025928 | Ga0207700_10667195 | Ga0207700_106671951 | 257 |
| 196 | 3300025929 | Ga0207664_10597353 | Ga0207664_105973531 | 257 |
| 197 | 3300025929 | Ga0207664_10717859 | Ga0207664_107178591 | 257 |
| 198 | 3300025935 | Ga0207709_10046186 | Ga0207709_100461863 | 257 |
| 199 | 3300025936 | Ga0207670_10020102 | Ga0207670_100201023 | 257 |
| 200 | 3300025937 | Ga0207669_10166475 | Ga0207669_101664752 | 257 |
| 201 | 3300025940 | Ga0207691_10071696 | Ga0207691_100716962 | 257 |
| 202 | 3300025944 | Ga0207661_10167485 | Ga0207661_101674852 | 257 |
| 203 | 3300025945 | Ga0207679_10108025 | Ga0207679_101080252 | 257 |
| 204 | 3300025949 | Ga0207667_10012596 | Ga0207667_100125967 | 257 |
| 205 | 3300025949 | Ga0207667_10142421 | Ga0207667_101424213 | 257 |
| 206 | 3300025961 | Ga0207712_10058911 | Ga0207712_100589113 | 257 |
| 207 | 3300026078 | Ga0207702_10013214 | Ga0207702_100132148 | 257 |
| 208 | 3300026088 | Ga0207641_10036989 | Ga0207641_100369893 | 257 |
| 209 | 3300026116 | Ga0207674_10313790 | Ga0207674_103137902 | 257 |
| 210 | 3300026121 | Ga0207683_10016859 | Ga0207683_100168597 | 257 |
| 211 | 3300027111 | Ga0209281_1001475 | Ga0209281_10014758 | 257 |
| 212 | 3300027111 | Ga0209281_1013173 | Ga0209281_10131732 | 257 |
| 213 | 3300027866 | Ga0209813_10007907 | Ga0209813_100079072 | 257 |
| 214 | 3300027907 | Ga0207428_10039978 | Ga0207428_100399784 | 257 |
| 215 | 3300028379 | Ga0268266_10297959 | Ga0268266_102979592 | 257 |
| 216 | 3300028381 | Ga0268264_10468436 | Ga0268264_104684362 | 257 |
| 217 | 3300028573 | Ga0265334_10003460 | Ga0265334_100034605 | 257 |
| 218 | 3300028786 | Ga0307517_10046080 | Ga0307517_100460804 | 257 |
| 219 | 3300030735 | Ga0316178_1084681 | Ga0316178_108468113 | 257 |
| 220 | 3300031241 | Ga0265325_10182192 | Ga0265325_101821921 | 257 |
| 221 | 3300031247 | Ga0265340_10017269 | Ga0265340_100172694 | 257 |
| 222 | 3300031249 | Ga0265339_10000080 | Ga0265339_100000805 | 257 |
| 223 | 3300031249 | Ga0265339_10186818 | Ga0265339_101868181 | 257 |
| 224 | 3300031456 | Ga0307513_10119147 | Ga0307513_101191473 | 257 |
| 225 | 3300031595 | Ga0265313_10000330 | Ga0265313_1000033050 | 257 |
| 226 | 3300031691 | Ga0316579_10181087 | Ga0316579_101810872 | 257 |
| 227 | 3300031730 | Ga0307516_10324918 | Ga0307516_103249182 | 257 |
| 228 | 3300033180 | Ga0307510_10000175 | Ga0307510_1000017523 | 257 |
| 229 | 3300035089 | Ga0373944_0002685 | Ga0373944_0002685_3326_4210 | 257 |
| 230 | 3300035112 | Ga0373932_0005736 | Ga0373932_0005736_1084_1869 | 257 |
| 231 | 3300035113 | Ga0373936_0006239 | Ga0373936_0006239_484_1263 | 257 |
| 232 | 3300035116 | Ga0373945_0003970 | Ga0373945_0003970_3677_4561 | 257 |
| 233 | 3300035118 | Ga0373954_0033929 | Ga0373954_0033929_637_1416 | 257 |
| 234 | 3300035170 | Ga0373943_0000765 | Ga0373943_0000765_11097_11981 | 257 |
| 235 | 3300035171 | Ga0373946_0069132 | Ga0373946_0069132_12_896 | 257 |
| 236 | 3300035410 | Ga0373924_0018072 | Ga0373924_0018072_130_1014 | 257 |
| 237 | 3300035692 | Ga0373935_0008313 | Ga0373935_0008313_625_1509 | 257 |
| 238 | 3300035724 | Ga0373933_0018374 | Ga0373933_0018374_2289_3068 | 257 |
| 239 | 3300035724 | Ga0373933_0281335 | Ga0373933_0281335_197_973 | 257 |
| 240 | 3300035725 | Ga0373947_0118639 | Ga0373947_0118639_730_1506 | 257 |
| 241 | 3300035725 | Ga0373947_0371344 | Ga0373947_0371344_50_829 | 257 |
| 242 | 3300036401 | Ga0373937_0077407 | Ga0373937_0077407_1757_2536 | 257 |
| 243 | 3300037068 | Ga0373925_0081479 | Ga0373925_0081479_873_1652 | 257 |
| 244 | 3300037068 | Ga0373925_0389024 | Ga0373925_0389024_203_982 | 257 |
| 245 | 3300037068 | Ga0373925_0507490 | Ga0373925_0507490_155_931 | 257 |
| 246 | 3300037312 | Ga0395899_0006801 | Ga0395899_0006801_3921_4697 | 257 |
| 247 | 3300037312 | Ga0395899_0012729 | Ga0395899_0012729_4898_5677 | 257 |
| 248 | 3300037312 | Ga0395899_0019036 | Ga0395899_0019036_1438_2217 | 257 |
| 249 | 3300037418 | Ga0395900_0027375 | Ga0395900_0027375_1001_1780 | 257 |
| 250 | 3300037418 | Ga0395900_0041853 | Ga0395900_0041853_3266_4042 | 257 |
| 251 | 3300037466 | Ga0395898_0045281 | Ga0395898_0045281_542_1321 | 257 |
| 252 | 3300037471 | Ga0395905_0138852 | Ga0395905_0138852_976_1758 | 257 |
| 253 | 3300038443 | Ga0395901_0003281 | Ga0395901_0003281_7668_8444 | 257 |
| 254 | 3300038443 | Ga0395901_0043222 | Ga0395901_0043222_2043_2822 | 257 |
| 255 | 3300038726 | Ga0400490_44665 | Ga0400490_44665_1301_2137 | 257 |
| 256 | 3300038741 | Ga0400488_38992 | Ga0400488_38992_1429_2265 | 257 |
| 257 | 3300038741 | Ga0400488_50550 | Ga0400488_50550_1260_2099 | 257 |
| 258 | 3300038742 | Ga0400486_18736 | Ga0400486_18736_322_1158 | 257 |
| 259 | 3300039110 | Ga0400487_05138 | Ga0400487_05138_4123_4959 | 257 |
| 260 | 3300041405 | Ga0439438_003161 | Ga0439438_003161_213_998 | 257 |
| 261 | 3300041407 | Ga0439447_008688 | Ga0439447_008688_1786_2580 | 257 |
| 262 | 3300041411 | Ga0439466_0001938 | Ga0439466_0001938_2793_3578 | 257 |
| 263 | 3300041411 | Ga0439466_0004116 | Ga0439466_0004116_4737_5531 | 257 |
| 264 | 3300042115 | Ga0450911_000223 | Ga0450911_000223_16221_17015 | 257 |
| 265 | 3300042137 | Ga0450902_000498 | Ga0450902_000498_3048_3842 | 257 |
| 266 | 3300042142 | Ga0450905_000920 | Ga0450905_000920_1728_2522 | 257 |
| 267 | 3300044684 | Ga0466966_0043681 | Ga0466966_0043681_1105_1899 | 257 |
| 268 | 3300044684 | Ga0466966_0060076 | Ga0466966_0060076_44_823 | 257 |
| 269 | 3300044694 | Ga0466963_0004456 | Ga0466963_0004456_7098_7877 | 257 |
| 270 | 3300044694 | Ga0466963_0044831 | Ga0466963_0044831_22_801 | 257 |
| 271 | 3300044694 | Ga0466963_0377204 | Ga0466963_0377204_142_921 | 257 |
| 272 | 3300044842 | Ga0466957_0018387 | Ga0466957_0018387_2380_3159 | 257 |
| 273 | 3300045049 | Ga0466959_0013438 | Ga0466959_0013438_269_1063 | 257 |
| 274 | 3300045049 | Ga0466959_0038118 | Ga0466959_0038118_2060_2839 | 257 |
| 275 | 3300045976 | Ga0466967_0014375 | Ga0466967_0014375_4412_5191 | 257 |
| 276 | 3300045976 | Ga0466967_0183572 | Ga0466967_0183572_150_929 | 257 |
| 277 | 3300045976 | Ga0466967_0358346 | Ga0466967_0358346_401_1192 | 257 |
| 278 | 3300046452 | Ga0495617_003786 | Ga0495617_003786_4351_5145 | 257 |
| 279 | 3300046452 | Ga0495617_004391 | Ga0495617_004391_3679_4473 | 257 |
| 280 | 3300046452 | Ga0495617_007198 | Ga0495617_007198_462_1256 | 257 |
| 281 | 3300046452 | Ga0495617_007380 | Ga0495617_007380_156_950 | 257 |
| 282 | 3300046452 | Ga0495617_011316 | Ga0495617_011316_997_1791 | 257 |
| 283 | 3300046452 | Ga0495617_016846 | Ga0495617_016846_352_1146 | 257 |
| 284 | 3300046452 | Ga0495617_016978 | Ga0495617_016978_741_1535 | 257 |
| 285 | 3300046452 | Ga0495617_024367 | Ga0495617_024367_1207_2001 | 257 |
| 286 | 3300046452 | Ga0495617_054006 | Ga0495617_054006_22_816 | 257 |
| 287 | 3300046453 | Ga0495627_000014 | Ga0495627_000014_66959_67756 | 257 |
| 288 | 3300046453 | Ga0495627_000949 | Ga0495627_000949_14185_14979 | 257 |
| 289 | 3300046453 | Ga0495627_008087 | Ga0495627_008087_1128_1922 | 257 |
| 290 | 3300046453 | Ga0495627_013079 | Ga0495627_013079_229_1023 | 257 |
| 291 | 3300046453 | Ga0495627_027570 | Ga0495627_027570_857_1651 | 257 |
| 292 | 3300046453 | Ga0495627_029884 | Ga0495627_029884_263_1057 | 257 |
| 293 | 3300046453 | Ga0495627_029888 | Ga0495627_029888_263_1057 | 257 |
| 294 | 3300046455 | Ga0495603_0020106 | Ga0495603_0020106_2333_3127 | 257 |
| 295 | 3300046455 | Ga0495603_0035107 | Ga0495603_0035107_56_856 | 257 |
| 296 | 3300046455 | Ga0495603_0057011 | Ga0495603_0057011_1098_1892 | 257 |
| 297 | 3300046455 | Ga0495603_0233077 | Ga0495603_0233077_179_958 | 257 |
| 298 | 3300046457 | Ga0495590_0000260 | Ga0495590_0000260_23701_24495 | 257 |
| 299 | 3300046457 | Ga0495590_0000454 | Ga0495590_0000454_9098_9892 | 257 |
| 300 | 3300046457 | Ga0495590_0000735 | Ga0495590_0000735_5212_6006 | 257 |
| 301 | 3300046458 | Ga0495591_000104 | Ga0495591_000104_14483_15277 | 257 |
| 302 | 3300046458 | Ga0495591_000660 | Ga0495591_000660_904_1698 | 257 |
| 303 | 3300046458 | Ga0495591_000834 | Ga0495591_000834_12471_13265 | 257 |
| 304 | 3300046458 | Ga0495591_000930 | Ga0495591_000930_17408_18202 | 257 |
| 305 | 3300046458 | Ga0495591_008918 | Ga0495591_008918_2053_2847 | 257 |
| 306 | 3300046458 | Ga0495591_014116 | Ga0495591_014116_1274_2074 | 257 |
| 307 | 3300046460 | Ga0495638_0003266 | Ga0495638_0003266_4815_5609 | 257 |
| 308 | 3300046460 | Ga0495638_0004246 | Ga0495638_0004246_6321_7115 | 257 |
| 309 | 3300046460 | Ga0495638_0013059 | Ga0495638_0013059_1852_2646 | 257 |
| 310 | 3300046460 | Ga0495638_0014697 | Ga0495638_0014697_53_847 | 257 |
| 311 | 3300046460 | Ga0495638_0017100 | Ga0495638_0017100_3448_4242 | 257 |
| 312 | 3300046460 | Ga0495638_0019386 | Ga0495638_0019386_2897_3691 | 257 |
| 313 | 3300046460 | Ga0495638_0034279 | Ga0495638_0034279_1724_2518 | 257 |
| 314 | 3300046460 | Ga0495638_0052590 | Ga0495638_0052590_616_1410 | 257 |
| 315 | 3300046460 | Ga0495638_0059789 | Ga0495638_0059789_1036_1830 | 257 |
| 316 | 3300046460 | Ga0495638_0225336 | Ga0495638_0225336_158_940 | 257 |
| 317 | 3300046463 | Ga0495653_0000147 | Ga0495653_0000147_38004_38804 | 257 |
| 318 | 3300046463 | Ga0495653_0005900 | Ga0495653_0005900_4235_5080 | 257 |
| 319 | 3300046471 | Ga0495650_0000476 | Ga0495650_0000476_10243_11037 | 257 |
| 320 | 3300046471 | Ga0495650_0003400 | Ga0495650_0003400_2499_3293 | 257 |
| 321 | 3300046471 | Ga0495650_0004794 | Ga0495650_0004794_3257_4051 | 257 |
| 322 | 3300046471 | Ga0495650_0007569 | Ga0495650_0007569_2190_2984 | 257 |
| 323 | 3300046472 | Ga0495580_0011707 | Ga0495580_0011707_5984_6763 | 257 |
| 324 | 3300046474 | Ga0495605_0000001 | Ga0495605_0000001_86396_87196 | 257 |
| 325 | 3300046474 | Ga0495605_0000350 | Ga0495605_0000350_2668_3462 | 257 |
| 326 | 3300046474 | Ga0495605_0001061 | Ga0495605_0001061_15648_16442 | 257 |
| 327 | 3300046474 | Ga0495605_0005332 | Ga0495605_0005332_364_1158 | 257 |
| 328 | 3300046474 | Ga0495605_0017544 | Ga0495605_0017544_2221_3015 | 257 |
| 329 | 3300046474 | Ga0495605_0036044 | Ga0495605_0036044_690_1484 | 257 |
| 330 | 3300046474 | Ga0495605_0082053 | Ga0495605_0082053_183_977 | 257 |
| 331 | 3300046476 | Ga0495662_0001229 | Ga0495662_0001229_7145_7990 | 257 |
| 332 | 3300046477 | Ga0495664_0008759 | Ga0495664_0008759_3989_4834 | 257 |
| 333 | 3300046491 | Ga0495584_0000503 | Ga0495584_0000503_24715_25518 | 257 |
| 334 | 3300046491 | Ga0495584_0000639 | Ga0495584_0000639_16773_17576 | 257 |
| 335 | 3300046491 | Ga0495584_0004664 | Ga0495584_0004664_4352_5146 | 257 |
| 336 | 3300046491 | Ga0495584_0005154 | Ga0495584_0005154_3695_4489 | 257 |
| 337 | 3300046491 | Ga0495584_0005264 | Ga0495584_0005264_1273_2067 | 257 |
| 338 | 3300046491 | Ga0495584_0024054 | Ga0495584_0024054_1070_1864 | 257 |
| 339 | 3300046491 | Ga0495584_0027629 | Ga0495584_0027629_324_1118 | 257 |
| 340 | 3300046491 | Ga0495584_0066511 | Ga0495584_0066511_667_1461 | 257 |
| 341 | 3300046491 | Ga0495584_0075512 | Ga0495584_0075512_386_1180 | 257 |
| 342 | 3300046491 | Ga0495584_0158875 | Ga0495584_0158875_116_910 | 257 |
| 343 | 3300046492 | Ga0495585_0000047 | Ga0495585_0000047_76593_77387 | 257 |
| 344 | 3300046492 | Ga0495585_0000203 | Ga0495585_0000203_39176_39976 | 257 |
| 345 | 3300046492 | Ga0495585_0000749 | Ga0495585_0000749_20563_21357 | 257 |
| 346 | 3300046492 | Ga0495585_0008686 | Ga0495585_0008686_5080_5874 | 257 |
| 347 | 3300046492 | Ga0495585_0019164 | Ga0495585_0019164_1127_1921 | 257 |
| 348 | 3300046492 | Ga0495585_0064478 | Ga0495585_0064478_724_1518 | 257 |
| 349 | 3300046492 | Ga0495585_0068130 | Ga0495585_0068130_471_1271 | 257 |
| 350 | 3300046492 | Ga0495585_0087518 | Ga0495585_0087518_835_1629 | 257 |
| 351 | 3300046499 | Ga0495594_0002066 | Ga0495594_0002066_4228_5022 | 257 |
| 352 | 3300046500 | Ga0495596_0000330 | Ga0495596_0000330_14434_15228 | 257 |
| 353 | 3300046500 | Ga0495596_0000490 | Ga0495596_0000490_23901_24695 | 257 |
| 354 | 3300046500 | Ga0495596_0022012 | Ga0495596_0022012_982_1776 | 257 |
| 355 | 3300046501 | Ga0495607_0000025 | Ga0495607_0000025_58630_59421 | 257 |
| 356 | 3300046501 | Ga0495607_0000251 | Ga0495607_0000251_22354_23148 | 257 |
| 357 | 3300046501 | Ga0495607_0003285 | Ga0495607_0003285_320_1096 | 257 |
| 358 | 3300046501 | Ga0495607_0003796 | Ga0495607_0003796_5282_6076 | 257 |
| 359 | 3300046501 | Ga0495607_0003826 | Ga0495607_0003826_8762_9562 | 257 |
| 360 | 3300046501 | Ga0495607_0016327 | Ga0495607_0016327_69_863 | 257 |
| 361 | 3300046501 | Ga0495607_0018120 | Ga0495607_0018120_2725_3519 | 257 |
| 362 | 3300046501 | Ga0495607_0036086 | Ga0495607_0036086_410_1204 | 257 |
| 363 | 3300046501 | Ga0495607_0047823 | Ga0495607_0047823_1105_1905 | 257 |
| 364 | 3300046501 | Ga0495607_0058473 | Ga0495607_0058473_127_930 | 257 |
| 365 | 3300046501 | Ga0495607_0071260 | Ga0495607_0071260_95_889 | 257 |
| 366 | 3300046501 | Ga0495607_0108094 | Ga0495607_0108094_328_1131 | 257 |
| 367 | 3300046506 | Ga0495583_0000924 | Ga0495583_0000924_28589_29386 | 257 |
| 368 | 3300046506 | Ga0495583_0000980 | Ga0495583_0000980_7779_8579 | 257 |
| 369 | 3300046506 | Ga0495583_0001029 | Ga0495583_0001029_5679_6482 | 257 |
| 370 | 3300046506 | Ga0495583_0002276 | Ga0495583_0002276_6555_7349 | 257 |
| 371 | 3300046506 | Ga0495583_0022822 | Ga0495583_0022822_894_1676 | 257 |
| 372 | 3300046506 | Ga0495583_0034658 | Ga0495583_0034658_459_1253 | 257 |
| 373 | 3300046507 | Ga0495606_0000022 | Ga0495606_0000022_263001_263801 | 257 |
| 374 | 3300046507 | Ga0495606_0000023 | Ga0495606_0000023_179186_179971 | 257 |
| 375 | 3300046507 | Ga0495606_0000047 | Ga0495606_0000047_136706_137509 | 257 |
| 376 | 3300046507 | Ga0495606_0000238 | Ga0495606_0000238_5635_6429 | 257 |
| 377 | 3300046507 | Ga0495606_0000640 | Ga0495606_0000640_34979_35779 | 257 |
| 378 | 3300046507 | Ga0495606_0000694 | Ga0495606_0000694_8910_9704 | 257 |
| 379 | 3300046507 | Ga0495606_0001284 | Ga0495606_0001284_16428_17231 | 257 |
| 380 | 3300046507 | Ga0495606_0002425 | Ga0495606_0002425_12031_12825 | 257 |
| 381 | 3300046507 | Ga0495606_0002703 | Ga0495606_0002703_13231_14025 | 257 |
| 382 | 3300046507 | Ga0495606_0012895 | Ga0495606_0012895_1465_2259 | 257 |
| 383 | 3300046507 | Ga0495606_0013155 | Ga0495606_0013155_1109_1903 | 257 |
| 384 | 3300046507 | Ga0495606_0039360 | Ga0495606_0039360_1077_1871 | 257 |
| 385 | 3300046507 | Ga0495606_0069192 | Ga0495606_0069192_555_1349 | 257 |
| 386 | 3300046512 | Ga0495610_0001246 | Ga0495610_0001246_9460_10254 | 257 |
| 387 | 3300046512 | Ga0495610_0002056 | Ga0495610_0002056_2204_2998 | 257 |
| 388 | 3300046512 | Ga0495610_0002489 | Ga0495610_0002489_13893_14687 | 257 |
| 389 | 3300046512 | Ga0495610_0004146 | Ga0495610_0004146_6616_7410 | 257 |
| 390 | 3300046512 | Ga0495610_0004318 | Ga0495610_0004318_8715_9509 | 257 |
| 391 | 3300046512 | Ga0495610_0009099 | Ga0495610_0009099_4717_5511 | 257 |
| 392 | 3300046512 | Ga0495610_0013798 | Ga0495610_0013798_2908_3702 | 257 |
| 393 | 3300046512 | Ga0495610_0015388 | Ga0495610_0015388_927_1721 | 257 |
| 394 | 3300046512 | Ga0495610_0019157 | Ga0495610_0019157_1852_2646 | 257 |
| 395 | 3300046512 | Ga0495610_0029454 | Ga0495610_0029454_658_1452 | 257 |
| 396 | 3300046512 | Ga0495610_0049707 | Ga0495610_0049707_964_1758 | 257 |
| 397 | 3300046512 | Ga0495610_0085776 | Ga0495610_0085776_299_1099 | 257 |
| 398 | 3300046513 | Ga0495616_0000121 | Ga0495616_0000121_42532_43326 | 257 |
| 399 | 3300046513 | Ga0495616_0000225 | Ga0495616_0000225_22574_23368 | 257 |
| 400 | 3300046513 | Ga0495616_0002944 | Ga0495616_0002944_9531_10325 | 257 |
| 401 | 3300046513 | Ga0495616_0003961 | Ga0495616_0003961_3847_4641 | 257 |
| 402 | 3300046513 | Ga0495616_0024156 | Ga0495616_0024156_985_1779 | 257 |
| 403 | 3300046513 | Ga0495616_0028408 | Ga0495616_0028408_1462_2265 | 257 |
| 404 | 3300046513 | Ga0495616_0059708 | Ga0495616_0059708_284_1078 | 257 |
| 405 | 3300046515 | Ga0495620_0000612 | Ga0495620_0000612_14399_15193 | 257 |
| 406 | 3300046515 | Ga0495620_0002846 | Ga0495620_0002846_8396_9190 | 257 |
| 407 | 3300046515 | Ga0495620_0002950 | Ga0495620_0002950_5633_6427 | 257 |
| 408 | 3300046515 | Ga0495620_0003098 | Ga0495620_0003098_5394_6188 | 257 |
| 409 | 3300046515 | Ga0495620_0013624 | Ga0495620_0013624_645_1439 | 257 |
| 410 | 3300046515 | Ga0495620_0020748 | Ga0495620_0020748_1340_2134 | 257 |
| 411 | 3300046515 | Ga0495620_0024639 | Ga0495620_0024639_19_795 | 257 |
| 412 | 3300046517 | Ga0495630_0000428 | Ga0495630_0000428_10593_11387 | 257 |
| 413 | 3300046518 | Ga0495631_0000003 | Ga0495631_0000003_90678_91472 | 257 |
| 414 | 3300046518 | Ga0495631_0000011 | Ga0495631_0000011_34488_35282 | 257 |
| 415 | 3300046518 | Ga0495631_0003012 | Ga0495631_0003012_5396_6193 | 257 |
| 416 | 3300046518 | Ga0495631_0025513 | Ga0495631_0025513_1662_2465 | 257 |
| 417 | 3300046518 | Ga0495631_0051738 | Ga0495631_0051738_223_1023 | 257 |
| 418 | 3300046519 | Ga0495632_0000777 | Ga0495632_0000777_14635_15429 | 257 |
| 419 | 3300046519 | Ga0495632_0001696 | Ga0495632_0001696_14622_15422 | 257 |
| 420 | 3300046519 | Ga0495632_0002036 | Ga0495632_0002036_11640_12416 | 257 |
| 421 | 3300046519 | Ga0495632_0004500 | Ga0495632_0004500_5115_5912 | 257 |
| 422 | 3300046519 | Ga0495632_0005539 | Ga0495632_0005539_7498_8292 | 257 |
| 423 | 3300046519 | Ga0495632_0017902 | Ga0495632_0017902_487_1281 | 257 |
| 424 | 3300046519 | Ga0495632_0018302 | Ga0495632_0018302_1947_2741 | 257 |
| 425 | 3300046519 | Ga0495632_0018892 | Ga0495632_0018892_2204_2998 | 257 |
| 426 | 3300046519 | Ga0495632_0022800 | Ga0495632_0022800_2107_2901 | 257 |
| 427 | 3300046519 | Ga0495632_0035429 | Ga0495632_0035429_717_1511 | 257 |
| 428 | 3300046520 | Ga0495637_0000017 | Ga0495637_0000017_40395_41189 | 257 |
| 429 | 3300046520 | Ga0495637_0000092 | Ga0495637_0000092_24049_24852 | 257 |
| 430 | 3300046520 | Ga0495637_0000910 | Ga0495637_0000910_16114_16908 | 257 |
| 431 | 3300046520 | Ga0495637_0009380 | Ga0495637_0009380_378_1178 | 257 |
| 432 | 3300046520 | Ga0495637_0012811 | Ga0495637_0012811_2506_3300 | 257 |
| 433 | 3300046520 | Ga0495637_0019280 | Ga0495637_0019280_263_1057 | 257 |
| 434 | 3300046520 | Ga0495637_0020167 | Ga0495637_0020167_219_1013 | 257 |
| 435 | 3300046520 | Ga0495637_0023186 | Ga0495637_0023186_1262_2056 | 257 |
| 436 | 3300046520 | Ga0495637_0023309 | Ga0495637_0023309_662_1456 | 257 |
| 437 | 3300046520 | Ga0495637_0057487 | Ga0495637_0057487_687_1481 | 257 |
| 438 | 3300046520 | Ga0495637_0084564 | Ga0495637_0084564_447_1241 | 257 |
| 439 | 3300046522 | Ga0495643_0000017 | Ga0495643_0000017_288306_289097 | 257 |
| 440 | 3300046522 | Ga0495643_0001044 | Ga0495643_0001044_10563_11357 | 257 |
| 441 | 3300046522 | Ga0495643_0002559 | Ga0495643_0002559_13119_13904 | 257 |
| 442 | 3300046522 | Ga0495643_0005129 | Ga0495643_0005129_7180_7974 | 257 |
| 443 | 3300046522 | Ga0495643_0012853 | Ga0495643_0012853_1036_1830 | 257 |
| 444 | 3300046522 | Ga0495643_0017698 | Ga0495643_0017698_281_1075 | 257 |
| 445 | 3300046522 | Ga0495643_0018681 | Ga0495643_0018681_781_1575 | 257 |
| 446 | 3300046522 | Ga0495643_0037900 | Ga0495643_0037900_991_1794 | 257 |
| 447 | 3300046522 | Ga0495643_0088262 | Ga0495643_0088262_499_1293 | 257 |
| 448 | 3300046522 | Ga0495643_0108374 | Ga0495643_0108374_33_827 | 257 |
| 449 | 3300046522 | Ga0495643_0118201 | Ga0495643_0118201_267_1061 | 257 |
| 450 | 3300046523 | Ga0495644_0000199 | Ga0495644_0000199_15789_16583 | 257 |
| 451 | 3300046523 | Ga0495644_0002564 | Ga0495644_0002564_2094_2888 | 257 |
| 452 | 3300046523 | Ga0495644_0002955 | Ga0495644_0002955_1279_2073 | 257 |
| 453 | 3300046523 | Ga0495644_0020807 | Ga0495644_0020807_489_1292 | 257 |
| 454 | 3300046523 | Ga0495644_0040617 | Ga0495644_0040617_249_1043 | 257 |
| 455 | 3300046524 | Ga0495648_0000278 | Ga0495648_0000278_23906_24700 | 257 |
| 456 | 3300046524 | Ga0495648_0001209 | Ga0495648_0001209_16051_16845 | 257 |
| 457 | 3300046524 | Ga0495648_0003252 | Ga0495648_0003252_5493_6287 | 257 |
| 458 | 3300046524 | Ga0495648_0009203 | Ga0495648_0009203_5182_5976 | 257 |
| 459 | 3300046524 | Ga0495648_0010377 | Ga0495648_0010377_599_1399 | 257 |
| 460 | 3300046524 | Ga0495648_0012839 | Ga0495648_0012839_2445_3239 | 257 |
| 461 | 3300046524 | Ga0495648_0024230 | Ga0495648_0024230_322_1116 | 257 |
| 462 | 3300046524 | Ga0495648_0035759 | Ga0495648_0035759_1018_1812 | 257 |
| 463 | 3300046524 | Ga0495648_0038142 | Ga0495648_0038142_2270_3064 | 257 |
| 464 | 3300046524 | Ga0495648_0053632 | Ga0495648_0053632_1581_2375 | 257 |
| 465 | 3300046526 | Ga0495666_0000020 | Ga0495666_0000020_50908_51702 | 257 |
| 466 | 3300046526 | Ga0495666_0026193 | Ga0495666_0026193_350_1129 | 257 |
| 467 | 3300046528 | Ga0495642_0000008 | Ga0495642_0000008_144461_145255 | 257 |
| 468 | 3300046530 | Ga0495654_0000158 | Ga0495654_0000158_25096_25890 | 257 |
| 469 | 3300046530 | Ga0495654_0000531 | Ga0495654_0000531_19671_20468 | 257 |
| 470 | 3300046530 | Ga0495654_0000601 | Ga0495654_0000601_22379_23173 | 257 |
| 471 | 3300046530 | Ga0495654_0001466 | Ga0495654_0001466_13354_14148 | 257 |
| 472 | 3300046530 | Ga0495654_0002554 | Ga0495654_0002554_5558_6352 | 257 |
| 473 | 3300046530 | Ga0495654_0004196 | Ga0495654_0004196_2567_3361 | 257 |
| 474 | 3300046530 | Ga0495654_0006804 | Ga0495654_0006804_1610_2401 | 257 |
| 475 | 3300046530 | Ga0495654_0006938 | Ga0495654_0006938_4398_5192 | 257 |
| 476 | 3300046530 | Ga0495654_0014629 | Ga0495654_0014629_3186_3980 | 257 |
| 477 | 3300046530 | Ga0495654_0027921 | Ga0495654_0027921_365_1159 | 257 |
| 478 | 3300046530 | Ga0495654_0045232 | Ga0495654_0045232_282_1058 | 257 |
| 479 | 3300046530 | Ga0495654_0054675 | Ga0495654_0054675_792_1586 | 257 |
| 480 | 3300046530 | Ga0495654_0097015 | Ga0495654_0097015_279_1082 | 257 |
| 481 | 3300046530 | Ga0495654_0135946 | Ga0495654_0135946_193_987 | 257 |
| 482 | 3300046530 | Ga0495654_0162195 | Ga0495654_0162195_135_938 | 257 |
| 483 | 3300046531 | Ga0495665_0019437 | Ga0495665_0019437_1375_2154 | 257 |
| 484 | 3300046531 | Ga0495665_0059972 | Ga0495665_0059972_24_803 | 257 |
| 485 | 3300046533 | Ga0495640_0269226 | Ga0495640_0269226_72_851 | 257 |
| 486 | 3300046535 | Ga0495586_0005186 | Ga0495586_0005186_2616_3461 | 257 |
| 487 | 3300046538 | Ga0495609_0000016 | Ga0495609_0000016_61657_62451 | 257 |
| 488 | 3300046538 | Ga0495609_0000077 | Ga0495609_0000077_82073_82867 | 257 |
| 489 | 3300046538 | Ga0495609_0007870 | Ga0495609_0007870_3215_4009 | 257 |
| 490 | 3300046538 | Ga0495609_0011901 | Ga0495609_0011901_1012_1806 | 257 |
| 491 | 3300046542 | Ga0495597_0000012 | Ga0495597_0000012_35538_36338 | 257 |
| 492 | 3300046542 | Ga0495597_0000045 | Ga0495597_0000045_33271_34065 | 257 |
| 493 | 3300046542 | Ga0495597_0003219 | Ga0495597_0003219_809_1603 | 257 |
| 494 | 3300046542 | Ga0495597_0005930 | Ga0495597_0005930_2416_3210 | 257 |
| 495 | 3300046542 | Ga0495597_0020511 | Ga0495597_0020511_1829_2623 | 257 |
| 496 | 3300046542 | Ga0495597_0033032 | Ga0495597_0033032_1431_2225 | 257 |
| 497 | 3300046542 | Ga0495597_0079439 | Ga0495597_0079439_403_1197 | 257 |
| 498 | 3300046543 | Ga0495645_0013392 | Ga0495645_0013392_62_907 | 257 |
| 499 | 3300046557 | Ga0495622_0000086 | Ga0495622_0000086_34660_35454 | 257 |
| 500 | 3300046557 | Ga0495622_0000426 | Ga0495622_0000426_2388_3182 | 257 |
| 501 | 3300046557 | Ga0495622_0051354 | Ga0495622_0051354_825_1619 | 257 |
| 502 | 3300046557 | Ga0495622_0060661 | Ga0495622_0060661_172_966 | 257 |
| 503 | 3300046558 | Ga0495633_0000138 | Ga0495633_0000138_24311_25105 | 257 |
| 504 | 3300046558 | Ga0495633_0033303 | Ga0495633_0033303_205_999 | 257 |
| 505 | 3300046615 | Ga0495656_0021232 | Ga0495656_0021232_1035_1829 | 257 |
| 506 | 3300046616 | Ga0495668_0000379 | Ga0495668_0000379_14819_15613 | 257 |
| 507 | 3300046616 | Ga0495668_0007801 | Ga0495668_0007801_2766_3560 | 257 |
| 508 | 3300046616 | Ga0495668_0025866 | Ga0495668_0025866_2497_3300 | 257 |
| 509 | 3300046616 | Ga0495668_0028275 | Ga0495668_0028275_908_1702 | 257 |
| 510 | 3300046642 | Ga0495634_0001639 | Ga0495634_0001639_6016_6861 | 257 |
| 511 | 3300046648 | Ga0495611_0000019 | Ga0495611_0000019_76022_76816 | 257 |
| 512 | 3300046648 | Ga0495611_0001238 | Ga0495611_0001238_8142_8936 | 257 |
| 513 | 3300046648 | Ga0495611_0004213 | Ga0495611_0004213_3813_4607 | 257 |
| 514 | 3300046648 | Ga0495611_0010174 | Ga0495611_0010174_116_919 | 257 |
| 515 | 3300046648 | Ga0495611_0012029 | Ga0495611_0012029_483_1277 | 257 |
| 516 | 3300046660 | Ga0495625_0001630 | Ga0495625_0001630_15118_15912 | 257 |
| 517 | 3300046660 | Ga0495625_0002882 | Ga0495625_0002882_2535_3329 | 257 |
| 518 | 3300046660 | Ga0495625_0005115 | Ga0495625_0005115_5984_6766 | 257 |
| 519 | 3300046660 | Ga0495625_0005634 | Ga0495625_0005634_2452_3246 | 257 |
| 520 | 3300046660 | Ga0495625_0007998 | Ga0495625_0007998_2291_3085 | 257 |
| 521 | 3300046660 | Ga0495625_0017633 | Ga0495625_0017633_3201_3995 | 257 |
| 522 | 3300046660 | Ga0495625_0069795 | Ga0495625_0069795_937_1731 | 257 |
| 523 | 3300046660 | Ga0495625_0119353 | Ga0495625_0119353_982_1785 | 257 |
| 524 | 3300046663 | Ga0495635_0016603 | Ga0495635_0016603_2012_2857 | 257 |
| 525 | 3300046665 | Ga0495661_0000001 | Ga0495661_0000001_803175_803978 | 257 |
| 526 | 3300046665 | Ga0495661_0000010 | Ga0495661_0000010_33003_33803 | 257 |
| 527 | 3300046665 | Ga0495661_0001554 | Ga0495661_0001554_16283_17083 | 257 |
| 528 | 3300046665 | Ga0495661_0003328 | Ga0495661_0003328_4199_4993 | 257 |
| 529 | 3300046665 | Ga0495661_0006051 | Ga0495661_0006051_6373_7167 | 257 |
| 530 | 3300046665 | Ga0495661_0010260 | Ga0495661_0010260_773_1567 | 257 |
| 531 | 3300046665 | Ga0495661_0032443 | Ga0495661_0032443_2149_2943 | 257 |
| 532 | 3300046665 | Ga0495661_0038402 | Ga0495661_0038402_1771_2565 | 257 |
| 533 | 3300046665 | Ga0495661_0039929 | Ga0495661_0039929_78_872 | 257 |
| 534 | 3300046674 | Ga0495588_0002156 | Ga0495588_0002156_2472_3266 | 257 |
| 535 | 3300046674 | Ga0495588_0011333 | Ga0495588_0011333_1324_2118 | 257 |
| 536 | 3300046679 | Ga0495623_0000590 | Ga0495623_0000590_19883_20677 | 257 |
| 537 | 3300046680 | Ga0495646_0238453 | Ga0495646_0238453_86_931 | 257 |
| 538 | 3300046681 | Ga0495647_0003997 | Ga0495647_0003997_2759_3604 | 257 |
| 539 | 3300046684 | Ga0495669_0005004 | Ga0495669_0005004_2671_3465 | 257 |
| 540 | 3300046689 | Ga0495613_0030196 | Ga0495613_0030196_1645_2529 | 257 |
| 541 | 3300046690 | Ga0495624_0007173 | Ga0495624_0007173_6210_7004 | 257 |
| 542 | 3300046690 | Ga0495624_0021857 | Ga0495624_0021857_2747_3592 | 257 |
| 543 | 3300046691 | Ga0495670_0000311 | Ga0495670_0000311_13747_14541 | 257 |
| 544 | 3300046691 | Ga0495670_0001278 | Ga0495670_0001278_9862_10656 | 257 |
| 545 | 3300046691 | Ga0495670_0023098 | Ga0495670_0023098_1245_2039 | 257 |
| 546 | 3300046692 | Ga0495671_0000419 | Ga0495671_0000419_23346_24137 | 257 |
| 547 | 3300046692 | Ga0495671_0001653 | Ga0495671_0001653_8714_9508 | 257 |
| 548 | 3300046692 | Ga0495671_0005071 | Ga0495671_0005071_3960_4754 | 257 |
| 549 | 3300046692 | Ga0495671_0005698 | Ga0495671_0005698_5941_6726 | 257 |
| 550 | 3300046692 | Ga0495671_0017185 | Ga0495671_0017185_1781_2581 | 257 |
| 551 | 3300046692 | Ga0495671_0018909 | Ga0495671_0018909_722_1519 | 257 |
| 552 | 3300046692 | Ga0495671_0031681 | Ga0495671_0031681_1785_2579 | 257 |
| 553 | 3300046692 | Ga0495671_0037025 | Ga0495671_0037025_1353_2147 | 257 |
| 554 | 3300046692 | Ga0495671_0039845 | Ga0495671_0039845_1014_1808 | 257 |
| 555 | 3300046692 | Ga0495671_0061632 | Ga0495671_0061632_232_1032 | 257 |
| 556 | 3300046692 | Ga0495671_0123164 | Ga0495671_0123164_423_1217 | 257 |
| 557 | 3300046694 | Ga0495649_0000087 | Ga0495649_0000087_74232_75017 | 257 |
| 558 | 3300046694 | Ga0495649_0000663 | Ga0495649_0000663_22585_23379 | 257 |
| 559 | 3300046694 | Ga0495649_0000677 | Ga0495649_0000677_18939_19733 | 257 |
| 560 | 3300046694 | Ga0495649_0006059 | Ga0495649_0006059_3332_4126 | 257 |
| 561 | 3300046694 | Ga0495649_0012605 | Ga0495649_0012605_917_1711 | 257 |
| 562 | 3300046694 | Ga0495649_0012796 | Ga0495649_0012796_2809_3603 | 257 |
| 563 | 3300046694 | Ga0495649_0014712 | Ga0495649_0014712_2661_3455 | 257 |
| 564 | 3300046694 | Ga0495649_0021486 | Ga0495649_0021486_1254_2048 | 257 |
| 565 | 3300046694 | Ga0495649_0034187 | Ga0495649_0034187_994_1788 | 257 |
| 566 | 3300046794 | Ga0495589_0000406 | Ga0495589_0000406_19637_20431 | 257 |
| 567 | 3300046794 | Ga0495589_0000649 | Ga0495589_0000649_16666_17460 | 257 |
| 568 | 3300046794 | Ga0495589_0001844 | Ga0495589_0001844_2575_3369 | 257 |
| 569 | 3300046794 | Ga0495589_0003264 | Ga0495589_0003264_800_1594 | 257 |
| 570 | 3300046794 | Ga0495589_0003909 | Ga0495589_0003909_5352_6146 | 257 |
| 571 | 3300046794 | Ga0495589_0006298 | Ga0495589_0006298_2451_3245 | 257 |
| 572 | 3300046794 | Ga0495589_0021377 | Ga0495589_0021377_420_1214 | 257 |
| 573 | 3300046794 | Ga0495589_0077901 | Ga0495589_0077901_602_1396 | 257 |
| 574 | 3300046794 | Ga0495589_0087214 | Ga0495589_0087214_502_1296 | 257 |
| 575 | 3300046809 | Ga0495600_0131548 | Ga0495600_0131548_52_897 | 257 |
| 576 | 3300046810 | Ga0495660_0000258 | Ga0495660_0000258_25320_26114 | 257 |
| 577 | 3300046810 | Ga0495660_0000500 | Ga0495660_0000500_6340_7134 | 257 |
| 578 | 3300046810 | Ga0495660_0006189 | Ga0495660_0006189_2776_3570 | 257 |
| 579 | 3300046810 | Ga0495660_0006795 | Ga0495660_0006795_5665_6459 | 257 |
| 580 | 3300046810 | Ga0495660_0009870 | Ga0495660_0009870_4250_5044 | 257 |
| 581 | 3300046810 | Ga0495660_0013046 | Ga0495660_0013046_718_1512 | 257 |
| 582 | 3300046810 | Ga0495660_0047704 | Ga0495660_0047704_1035_1829 | 257 |
| 583 | 3300046810 | Ga0495660_0048807 | Ga0495660_0048807_1507_2301 | 257 |
| 584 | 3300046810 | Ga0495660_0053475 | Ga0495660_0053475_728_1522 | 257 |
| 585 | 3300046810 | Ga0495660_0087329 | Ga0495660_0087329_69_863 | 257 |
| 586 | 3300047315 | Ga0495581_0005956 | Ga0495581_0005956_5271_6155 | 257 |
| 587 | 3300047317 | Ga0495604_0000143 | Ga0495604_0000143_10572_11366 | 257 |
| 588 | 3300047319 | Ga0495674_0001761 | Ga0495674_0001761_5980_6825 | 257 |
| 589 | 3300047320 | Ga0495672_0000743 | Ga0495672_0000743_7142_7927 | 257 |
| 590 | 3300047320 | Ga0495672_0001129 | Ga0495672_0001129_23618_24412 | 257 |
| 591 | 3300047320 | Ga0495672_0001334 | Ga0495672_0001334_7432_8226 | 257 |
| 592 | 3300047320 | Ga0495672_0005219 | Ga0495672_0005219_2107_2901 | 257 |
| 593 | 3300047320 | Ga0495672_0005274 | Ga0495672_0005274_6585_7382 | 257 |
| 594 | 3300047320 | Ga0495672_0014101 | Ga0495672_0014101_3078_3872 | 257 |
| 595 | 3300047320 | Ga0495672_0033647 | Ga0495672_0033647_1653_2447 | 257 |
| 596 | 3300047320 | Ga0495672_0043109 | Ga0495672_0043109_1481_2284 | 257 |
| 597 | 3300047320 | Ga0495672_0133603 | Ga0495672_0133603_285_1079 | 257 |
| 598 | 3300047321 | Ga0495676_0033889 | Ga0495676_0033889_1063_1947 | 257 |
| 599 | 3300047321 | Ga0495676_0035212 | Ga0495676_0035212_1215_2015 | 257 |
| 600 | 3300047322 | Ga0495680_0094059 | Ga0495680_0094059_116_895 | 257 |
| 601 | 3300047322 | Ga0495680_0463770 | Ga0495680_0463770_45_824 | 257 |
| 602 | 3300047323 | Ga0495683_0000022 | Ga0495683_0000022_101556_102350 | 257 |
| 603 | 3300047323 | Ga0495683_0000062 | Ga0495683_0000062_22711_23505 | 257 |
| 604 | 3300047323 | Ga0495683_0000110 | Ga0495683_0000110_25198_25998 | 257 |
| 605 | 3300047323 | Ga0495683_0002570 | Ga0495683_0002570_4619_5413 | 257 |
| 606 | 3300047323 | Ga0495683_0005022 | Ga0495683_0005022_2726_3520 | 257 |
| 607 | 3300047323 | Ga0495683_0009227 | Ga0495683_0009227_1001_1795 | 257 |
| 608 | 3300047323 | Ga0495683_0011625 | Ga0495683_0011625_2343_3137 | 257 |
| 609 | 3300047323 | Ga0495683_0018099 | Ga0495683_0018099_440_1234 | 257 |
| 610 | 3300047323 | Ga0495683_0019463 | Ga0495683_0019463_585_1379 | 257 |
| 611 | 3300047323 | Ga0495683_0099619 | Ga0495683_0099619_425_1219 | 257 |
| 612 | 3300047444 | Ga0495675_0014794 | Ga0495675_0014794_3705_4499 | 257 |
| 613 | 3300047445 | Ga0495677_0038713 | Ga0495677_0038713_778_1572 | 257 |
| 614 | 3300047446 | Ga0495679_000042 | Ga0495679_000042_134195_134989 | 257 |
| 615 | 3300047446 | Ga0495679_000799 | Ga0495679_000799_14320_15114 | 257 |
| 616 | 3300047446 | Ga0495679_002335 | Ga0495679_002335_4889_5683 | 257 |
| 617 | 3300047446 | Ga0495679_004608 | Ga0495679_004608_826_1620 | 257 |
| 618 | 3300047469 | Ga0495673_0000192 | Ga0495673_0000192_61948_62742 | 257 |
| 619 | 3300047469 | Ga0495673_0000429 | Ga0495673_0000429_5400_6194 | 257 |
| 620 | 3300047469 | Ga0495673_0000769 | Ga0495673_0000769_1954_2748 | 257 |
| 621 | 3300047469 | Ga0495673_0000847 | Ga0495673_0000847_21933_22733 | 257 |
| 622 | 3300047469 | Ga0495673_0000998 | Ga0495673_0000998_19969_20763 | 257 |
| 623 | 3300047469 | Ga0495673_0001144 | Ga0495673_0001144_10110_10904 | 257 |
| 624 | 3300047469 | Ga0495673_0002309 | Ga0495673_0002309_7343_8137 | 257 |
| 625 | 3300047469 | Ga0495673_0002777 | Ga0495673_0002777_6968_7762 | 257 |
| 626 | 3300047469 | Ga0495673_0020288 | Ga0495673_0020288_2171_2965 | 257 |
| 627 | 3300047469 | Ga0495673_0025756 | Ga0495673_0025756_827_1621 | 257 |
| 628 | 3300047470 | Ga0495681_0000441 | Ga0495681_0000441_2227_3021 | 257 |
| 629 | 3300047470 | Ga0495681_0000802 | Ga0495681_0000802_11425_12213 | 257 |
| 630 | 3300047470 | Ga0495681_0001036 | Ga0495681_0001036_14804_15607 | 257 |
| 631 | 3300047470 | Ga0495681_0001322 | Ga0495681_0001322_13534_14328 | 257 |
| 632 | 3300047470 | Ga0495681_0001338 | Ga0495681_0001338_15984_16778 | 257 |
| 633 | 3300047470 | Ga0495681_0001427 | Ga0495681_0001427_1088_1882 | 257 |
| 634 | 3300047470 | Ga0495681_0001859 | Ga0495681_0001859_12109_12903 | 257 |
| 635 | 3300047470 | Ga0495681_0010314 | Ga0495681_0010314_4603_5397 | 257 |
| 636 | 3300047470 | Ga0495681_0015921 | Ga0495681_0015921_1003_1794 | 257 |
| 637 | 3300047470 | Ga0495681_0016012 | Ga0495681_0016012_2735_3511 | 257 |
| 638 | 3300047470 | Ga0495681_0021071 | Ga0495681_0021071_2266_3060 | 257 |
| 639 | 3300047470 | Ga0495681_0029952 | Ga0495681_0029952_85_879 | 257 |
| 640 | 3300047470 | Ga0495681_0038781 | Ga0495681_0038781_283_1077 | 257 |
| 641 | 3300047471 | Ga0495684_0012633 | Ga0495684_0012633_1669_2448 | 257 |
| 642 | 3300047471 | Ga0495684_0028216 | Ga0495684_0028216_3081_3875 | 257 |
| 643 | 3300047471 | Ga0495684_0118219 | Ga0495684_0118219_798_1577 | 257 |
| 644 | 3300047472 | Ga0495686_0000246 | Ga0495686_0000246_13142_13936 | 257 |
| 645 | 3300047472 | Ga0495686_0001403 | Ga0495686_0001403_19540_20334 | 257 |
| 646 | 3300047472 | Ga0495686_0011982 | Ga0495686_0011982_1042_1836 | 257 |
| 647 | 3300047472 | Ga0495686_0028125 | Ga0495686_0028125_1036_1830 | 257 |
| 648 | 3300047472 | Ga0495686_0044614 | Ga0495686_0044614_1421_2221 | 257 |
| 649 | 3300047472 | Ga0495686_0091729 | Ga0495686_0091729_931_1725 | 257 |
| 650 | 3300047472 | Ga0495686_0145512 | Ga0495686_0145512_327_1121 | 257 |
| 651 | 3300047472 | Ga0495686_0165259 | Ga0495686_0165259_376_1167 | 257 |
| 652 | 3300047673 | Ga0495593_0001134 | Ga0495593_0001134_3080_3874 | 257 |
| 653 | 3300047673 | Ga0495593_0003121 | Ga0495593_0003121_6325_7209 | 257 |
| 654 | 3300048091 | Ga0495626_0000002 | Ga0495626_0000002_243733_244527 | 257 |
| 655 | 3300048091 | Ga0495626_0000035 | Ga0495626_0000035_130640_131416 | 257 |
| 656 | 3300048091 | Ga0495626_0000112 | Ga0495626_0000112_66714_67508 | 257 |
| 657 | 3300048091 | Ga0495626_0000199 | Ga0495626_0000199_24025_24819 | 257 |
| 658 | 3300048091 | Ga0495626_0000243 | Ga0495626_0000243_55784_56578 | 257 |
| 659 | 3300048091 | Ga0495626_0001716 | Ga0495626_0001716_2052_2846 | 257 |
| 660 | 3300048091 | Ga0495626_0002727 | Ga0495626_0002727_11074_11868 | 257 |
| 661 | 3300048091 | Ga0495626_0003751 | Ga0495626_0003751_2628_3422 | 257 |
| 662 | 3300048091 | Ga0495626_0036865 | Ga0495626_0036865_1128_1922 | 257 |
| 663 | 3300048091 | Ga0495626_0085260 | Ga0495626_0085260_371_1165 | 257 |
| 664 | 3300048903 | Ga0496100_0004216 | Ga0496100_0004216_3516_4295 | 257 |
| 665 | 3300048904 | Ga0496101_0008482 | Ga0496101_0008482_2780_3559 | 257 |
| 666 | 3300048905 | Ga0496102_0015342 | Ga0496102_0015342_3205_3984 | 257 |
| 667 | 3300048905 | Ga0496102_0060844 | Ga0496102_0060844_2634_3434 | 257 |
| 668 | 3300048907 | Ga0496104_0001979 | Ga0496104_0001979_5944_6723 | 257 |
| 669 | 3300048908 | Ga0496105_0019780 | Ga0496105_0019780_3443_4222 | 257 |
| 670 | 3300048909 | Ga0496106_0001612 | Ga0496106_0001612_15827_16606 | 257 |
| 671 | 3300048910 | Ga0496107_0007347 | Ga0496107_0007347_1640_2419 | 257 |
| 672 | 3300048911 | Ga0496108_0005122 | Ga0496108_0005122_8158_8937 | 257 |
| 673 | 3300048911 | Ga0496108_0015651 | Ga0496108_0015651_2511_3290 | 257 |
| 674 | 3300048912 | Ga0496109_0009300 | Ga0496109_0009300_6597_7376 | 257 |
| 675 | 3300048912 | Ga0496109_0047425 | Ga0496109_0047425_1249_2028 | 257 |
| 676 | 3300048912 | Ga0496109_0356830 | Ga0496109_0356830_276_1055 | 257 |
| 677 | 3300048913 | Ga0496110_0000756 | Ga0496110_0000756_8521_9300 | 257 |
| 678 | 3300048913 | Ga0496110_0002693 | Ga0496110_0002693_8224_9003 | 257 |
| 679 | 3300048913 | Ga0496110_0135591 | Ga0496110_0135591_1023_1817 | 257 |
| 680 | 3300048913 | Ga0496110_0335528 | Ga0496110_0335528_489_1262 | 257 |
| 681 | 3300048914 | Ga0496111_0004067 | Ga0496111_0004067_1411_2190 | 257 |
| 682 | 3300048914 | Ga0496111_0037305 | Ga0496111_0037305_347_1141 | 257 |
| 683 | 3300048914 | Ga0496111_0041913 | Ga0496111_0041913_206_985 | 257 |
| 684 | 3300048915 | Ga0496112_0021703 | Ga0496112_0021703_2980_3759 | 257 |
| 685 | 3300048915 | Ga0496112_0025004 | Ga0496112_0025004_79_858 | 257 |
| 686 | 3300048916 | Ga0496113_0005557 | Ga0496113_0005557_5874_6653 | 257 |
| 687 | 3300048918 | Ga0496115_0434844 | Ga0496115_0434844_81_860 | 257 |
| 688 | 3300048919 | Ga0496116_0000151 | Ga0496116_0000151_59805_60599 | 257 |
| 689 | 3300048921 | Ga0496118_0087188 | Ga0496118_0087188_1181_1963 | 257 |
| 690 | 3300048922 | Ga0496119_0057738 | Ga0496119_0057738_729_1523 | 257 |
| 691 | 3300048924 | Ga0496121_0002334 | Ga0496121_0002334_9182_9958 | 257 |
| 692 | 3300048924 | Ga0496121_0003523 | Ga0496121_0003523_8992_9792 | 257 |
| 693 | 3300048924 | Ga0496121_0064379 | Ga0496121_0064379_1010_1804 | 257 |
| 694 | 3300048925 | Ga0496122_0092041 | Ga0496122_0092041_633_1433 | 257 |
| 695 | 3300048927 | Ga0496124_0000275 | Ga0496124_0000275_68608_69384 | 257 |
| 696 | 3300048927 | Ga0496124_0001487 | Ga0496124_0001487_12555_13349 | 257 |
| 697 | 3300048927 | Ga0496124_0002199 | Ga0496124_0002199_5166_5951 | 257 |
| 698 | 3300048927 | Ga0496124_0156735 | Ga0496124_0156735_756_1538 | 257 |
| 699 | 3300048928 | Ga0496125_0012616 | Ga0496125_0012616_2814_3608 | 257 |
| 700 | 3300048928 | Ga0496125_0019225 | Ga0496125_0019225_996_1790 | 257 |
| 701 | 3300048929 | Ga0496126_0179659 | Ga0496126_0179659_460_1251 | 257 |
| 702 | 3300049459 | Ga0495678_000109 | Ga0495678_000109_22589_23383 | 257 |
| 703 | 3300049459 | Ga0495678_000177 | Ga0495678_000177_24630_25406 | 257 |
| 704 | 3300049459 | Ga0495678_001282 | Ga0495678_001282_9112_9912 | 257 |
| 705 | 3300049459 | Ga0495678_001486 | Ga0495678_001486_9931_10725 | 257 |
| 706 | 3300049459 | Ga0495678_001509 | Ga0495678_001509_2959_3762 | 257 |
| 707 | 3300049459 | Ga0495678_001612 | Ga0495678_001612_2464_3258 | 257 |
| 708 | 3300049459 | Ga0495678_004047 | Ga0495678_004047_2416_3210 | 257 |
| 709 | 3300049459 | Ga0495678_004309 | Ga0495678_004309_5952_6746 | 257 |
| 710 | 3300049459 | Ga0495678_012852 | Ga0495678_012852_2298_3092 | 257 |
| 711 | 3300049459 | Ga0495678_017621 | Ga0495678_017621_1336_2136 | 257 |
| 712 | 3300049459 | Ga0495678_028650 | Ga0495678_028650_997_1791 | 257 |
| 713 | 3300049459 | Ga0495678_032193 | Ga0495678_032193_69_863 | 257 |
| 714 | 3300049459 | Ga0495678_065780 | Ga0495678_065780_443_1237 | 257 |
| 715 | 3300049459 | Ga0495678_078662 | Ga0495678_078662_141_941 | 257 |
| 716 | 3300049459 | Ga0495678_121747 | Ga0495678_121747_37_831 | 257 |
| 717 | 3300049460 | Ga0495682_0000075 | Ga0495682_0000075_16514_17299 | 257 |
| 718 | 3300049460 | Ga0495682_0000223 | Ga0495682_0000223_18906_19700 | 257 |
| 719 | 3300049568 | Ga0501031_0167646 | Ga0501031_0167646_175_960 | 257 |
| 720 | 3300049570 | Ga0501033_0019821 | Ga0501033_0019821_1784_2563 | 257 |
| 721 | 3300049571 | Ga0501034_0000055 | Ga0501034_0000055_160423_161205 | 257 |
| 722 | 3300049571 | Ga0501034_0010898 | Ga0501034_0010898_5895_6683 | 257 |
| 723 | 3300049571 | Ga0501034_0040170 | Ga0501034_0040170_2561_3340 | 257 |
| 724 | 3300049571 | Ga0501034_0091279 | Ga0501034_0091279_853_1632 | 257 |
| 725 | 3300049571 | Ga0501034_0105037 | Ga0501034_0105037_1435_2211 | 257 |
| 726 | 3300049571 | Ga0501034_0290922 | Ga0501034_0290922_75_1004 | 257 |
| 727 | 3300049571 | Ga0501034_0343487 | Ga0501034_0343487_263_1042 | 257 |
| 728 | 3300049574 | Ga0501038_0031707 | Ga0501038_0031707_164_1066 | 257 |
| 729 | 3300049579 | Ga0501043_0011219 | Ga0501043_0011219_4790_5698 | 257 |
| 730 | 3300049581 | Ga0501047_0039677 | Ga0501047_0039677_349_1128 | 257 |
| 731 | 3300049581 | Ga0501047_0047185 | Ga0501047_0047185_2992_3768 | 257 |
| 732 | 3300049581 | Ga0501047_0638322 | Ga0501047_0638322_34_813 | 257 |
| 733 | 3300049584 | Ga0501068_0144056 | Ga0501068_0144056_171_1073 | 257 |
| 734 | 3300049586 | Ga0501070_0232314 | Ga0501070_0232314_19_795 | 257 |
| 735 | 3300049586 | Ga0501070_0311299 | Ga0501070_0311299_158_937 | 257 |
| 736 | 3300049742 | Ga0501080_0101710 | Ga0501080_0101710_1596_2372 | 257 |
| 737 | 3300049823 | Ga0501044_0002282 | Ga0501044_0002282_1637_2539 | 257 |
| 738 | 3300049823 | Ga0501044_0202574 | Ga0501044_0202574_614_1393 | 257 |
| 739 | 3300049823 | Ga0501044_0207726 | Ga0501044_0207726_407_1183 | 257 |
| 740 | 3300049823 | Ga0501044_0487679 | Ga0501044_0487679_206_994 | 257 |
| 741 | 3300050489 | nmdc:mga03683_18499_c1 | nmdc:mga03683_18499_c1_264_1040 | 257 |
| 742 | 3300050490 | nmdc:mga03n38_12711_c1 | nmdc:mga03n38_12711_c1_2074_2850 | 257 |
| 743 | 3300050491 | nmdc:mga00v17_294699_c1 | nmdc:mga00v17_294699_c1_240_1034 | 257 |
| 744 | 3300050492 | nmdc:mga0yw44_15259_c1 | nmdc:mga0yw44_15259_c1_1368_2144 | 257 |
| 745 | 3300050492 | nmdc:mga0yw44_160633_c1 | nmdc:mga0yw44_160633_c1_511_1287 | 257 |
| 746 | 3300050492 | nmdc:mga0yw44_266902_c1 | nmdc:mga0yw44_266902_c1_159_935 | 257 |
| 747 | 3300050494 | nmdc:mga06z11_1828_c1 | nmdc:mga06z11_1828_c1_3582_4358 | 257 |
| 748 | 3300050494 | nmdc:mga06z11_88117_c1 | nmdc:mga06z11_88117_c1_738_1514 | 257 |
| 749 | 3300050495 | nmdc:mga04h51_9211_c1 | nmdc:mga04h51_9211_c1_421_1197 | 257 |
| 750 | 3300050507 | nmdc:mga05p37_34840_c1 | nmdc:mga05p37_34840_c1_3269_4048 | 257 |
| 751 | 3300050507 | nmdc:mga05p37_455865_c1 | nmdc:mga05p37_455865_c1_10_789 | 257 |
| 752 | 3300050512 | nmdc:mga0n895_56907_c1 | nmdc:mga0n895_56907_c1_1017_1799 | 257 |
| 753 | 3300050512 | nmdc:mga0n895_63771_c1 | nmdc:mga0n895_63771_c1_533_1312 | 257 |
| 754 | 3300050512 | nmdc:mga0n895_748420_c1 | nmdc:mga0n895_748420_c1_115_894 | 257 |
| 755 | 3300050512 | nmdc:mga0n895_92055_c1 | nmdc:mga0n895_92055_c1_720_1499 | 257 |
| 756 | 3300050513 | nmdc:mga0rr50_321760_c1 | nmdc:mga0rr50_321760_c1_364_1143 | 257 |
| 757 | 3300050514 | nmdc:mga08x19_276637_c1 | nmdc:mga08x19_276637_c1_133_927 | 257 |
| 758 | 3300050516 | nmdc:mga0sz30_1116_c1 | nmdc:mga0sz30_1116_c1_4494_5270 | 257 |
| 759 | 3300053077 | Ga0495601_0000751 | Ga0495601_0000751_13742_14587 | 257 |
| 760 | 3300053078 | Ga0495612_0000428 | Ga0495612_0000428_4985_5830 | 257 |
| 761 | 3300053078 | Ga0495612_0027682 | Ga0495612_0027682_665_1444 | 257 |
| 762 | 3300053084 | Ga0495595_0023021 | Ga0495595_0023021_358_1137 | 257 |
| 763 | 3300053085 | Ga0495619_0021248 | Ga0495619_0021248_2082_2927 | 257 |
| 764 | 3300053085 | Ga0495619_0068771 | Ga0495619_0068771_1434_2213 | 257 |
| 765 | 3300053085 | Ga0495619_0192800 | Ga0495619_0192800_194_973 | 257 |
| 766 | 3300053087 | Ga0500643_003954 | Ga0500643_003954_52_834 | 257 |
| 767 | 3300053088 | Ga0500644_0051354 | Ga0500644_0051354_378_1157 | 257 |
| 768 | 3300053093 | Ga0500651_0035136 | Ga0500651_0035136_1288_2064 | 257 |
| 769 | 3300053096 | Ga0500641_0008610 | Ga0500641_0008610_174_950 | 257 |
| 770 | 3300053111 | Ga0500572_000005 | Ga0500572_000005_49515_50309 | 257 |
| 771 | 3300053147 | Ga0500589_055234 | Ga0500589_055234_276_1070 | 257 |
| 772 | 3300053153 | Ga0500616_0001240 | Ga0500616_0001240_13861_14637 | 257 |
| 773 | 3300053153 | Ga0500616_0070071 | Ga0500616_0070071_27_815 | 257 |
| 774 | 3300053158 | Ga0500627_0000217 | Ga0500627_0000217_9851_10633 | 257 |
| 775 | 3300053728 | Ga0500657_136543 | Ga0500657_136543_136_915 | 257 |
| 776 | 3300053733 | Ga0500552_001519 | Ga0500552_001519_579_1355 | 257 |
| 777 | iso_pu_bacteria | 2511231008 | 2511280665 | 257 |
| 778 | iso_pu_bacteria | 2511231023 | 2511366771 | 257 |
| 779 | iso_pu_bacteria | 2511231031 | 2511411699 | 257 |
| 780 | iso_pu_bacteria | 2738543020 | 2739289985 | 257 |
| 781 | iso_pu_bacteria | 2738543021 | 2739295297 | 257 |
| 782 | iso_pu_bacteria | 2738543025 | 2739311775 | 257 |
| 783 | iso_pu_bacteria | 2842832357 | 2842834726 | 257 |
| 784 | iso_pu_bacteria | 2969304461 | 2969307569 | 257 |
| 785 | iso_pu_bacteria | 8056177738 | 8056182529 | 257 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3krv-assembly1.cif.gz_B | the structure of potential metal-dependent hydrolase with cyclase activity | 0.8571 | 4 | 256 |
| 4cog-assembly2.cif.gz_D | crystal structure of kynurenine formamidase from burkholderia cenocepacia | 0.8426 | 4 | 256 |
| 3krv-assembly1.cif.gz_B | the structure of potential metal-dependent hydrolase with cyclase activity | 0.8381 | 4 | 256 |
| 4cog-assembly2.cif.gz_D | crystal structure of kynurenine formamidase from burkholderia cenocepacia | 0.8351 | 4 | 256 |
| 4cob-assembly1.cif.gz_B | crystal structure kynurenine formamidase from pseudomonas aeruginosa | 0.8252 | 4 | 256 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3krvB00 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase | 0.8571 | 4 | 256 | 3.50.30.50 |
| 3krvB00 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase | 0.8381 | 4 | 256 | 3.50.30.50 |
| 4cobB00 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase | 0.8252 | 4 | 256 | 3.50.30.50 |
| 4cobB00 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase | 0.8178 | 4 | 256 | 3.50.30.50 |
| 4co9B00 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase | 0.8064 | 3 | 256 | 3.50.30.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A259IV91-F1-model_v4 | Cyclase | 0.9998 | 105 | 256 |
GO:0004061
GO:0019441 |
| AF-A0A839EXM6-F1-model_v4 | Kynurenine formamidase | 0.9996 | 63 | 256 |
GO:0004061
GO:0019441 |
| AF-A0A208XYD4-F1-model_v4 | ABC transmembrane type-1 domain-containing protein | 0.9964 | 4 | 256 |
GO:0004061
GO:0005886 GO:0019441 GO:0055085 |
| AF-K0EU77-F1-model_v4 | Cyclase | 0.996 | 4 | 256 |
GO:0004061
GO:0019441 |
| AF-A0A537TPW9-F1-model_v4 | Cyclase family protein | 0.9951 | 79 | 256 |
GO:0004061
GO:0019441 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar