F480762

General Info

Members Datasets Scaffolds Average Seq Length
785 327 766 263

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0290922|Ga0501034_0290922_75_1004
Length 309
Sequence VPAIELARRLGPRDGPRRLARIASSAPAKGIDATRGGGVPAAKQRLKGPPMKLPSRIVDISSPLDNETIYDHPFMRPKIEYLSNAQNAPMLLQSFPGLRQEDLPDGEGWAFELIQLSTHNGTHMDAPIHYHSTTIGGERMMTIDEVPLDWFFRPGVKFDFRAKPDGHVVSAAEVEAELKRIGHDLQPFDIVLVNTRASECIGTEEYLTAGCGMGREATLYLTSRGVRVCGIDAWGWDVPFVHMAKRWNETRDASIIWEGHKAGREIPYCHMEKLCNLEQLPATGFTVACFPTKIKAASAGWTRAVAMFD

Samples

Sample ID Description Type Environment
1 2511231008 Pseudomonas sp. GM21 Isolate Nodule
2 2511231023 Pseudomonas sp. GM80 Isolate Nodule
3 2511231031 Pseudomonas sp. GM16 Isolate Nodule
4 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
5 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
6 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
7 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
8 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
9 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
10 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
11 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
12 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
13 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
14 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
15 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
16 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
17 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
136 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
141 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
149 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
150 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
151 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
154 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
155 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
156 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
173 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
174 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
175 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
176 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
177 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
178 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
179 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
180 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
181 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
182 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
190 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
193 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
202 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
205 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
206 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
209 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
210 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
213 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
214 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
215 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
216 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
217 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
218 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
219 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
220 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
224 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
225 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
228 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
229 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
233 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
236 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
237 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
238 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
239 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
240 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
243 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
244 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
245 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
246 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
247 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
248 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
249 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
250 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
251 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
252 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
253 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
256 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
257 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
258 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
259 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
260 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
261 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
262 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
263 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
264 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
279 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
280 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
281 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
282 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
283 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
284 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
285 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
286 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
287 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
288 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
289 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
290 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
297 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
300 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
301 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
302 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
303 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
304 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
305 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
306 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
307 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
308 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
309 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
310 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
311 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
312 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
313 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
314 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
315 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
316 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
317 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
318 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
319 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
320 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
321 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
322 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
323 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
324 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
325 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
326 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
327 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.58
Metatranscriptomes 0
Isolates 2.42

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 4.2
Nodule 0.76
Rhizoplane 4.33
Rhizosphere 85.73
Stem 0
Stem Tuber 0
Unclassified 4.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1005935 3300002739 Bacteria 1767
2 Ga0065714_10002201 3300005288 Bacteria 61466
3 Ga0065714_10007572 3300005288 Bacteria 5142
4 Ga0065714_10020205 3300005288 Bacteria 1912
5 Ga0065714_10065664 3300005288 Bacteria 8946
6 Ga0065714_10073863 3300005288 Bacteria 3120
7 Ga0065704_10071404 3300005289 Bacteria 11314
8 Ga0070683_100367810 3300005329 Bacteria 1369
9 Ga0070680_100007366 3300005336 Bacteria 8396
10 Ga0070680_100091993 3300005336 Bacteria 2511
11 Ga0070660_100342359 3300005339 Bacteria 1230
12 Ga0070689_100045226 3300005340 Bacteria 3389
13 Ga0070689_100121564 3300005340 Bacteria 2086
14 Ga0070661_100021408 3300005344 Bacteria 4618
15 Ga0070661_100200733 3300005344 Bacteria 1524
16 Ga0070675_100053262 3300005354 Bacteria 3328
17 Ga0070675_100149492 3300005354 Bacteria 2002
18 Ga0070671_100017825 3300005355 Bacteria 5755
19 Ga0070673_100000963 3300005364 Bacteria 16323
20 Ga0070673_100498233 3300005364 Bacteria 1101
21 Ga0070688_100012965 3300005365 Bacteria 4688
22 Ga0070659_100090962 3300005366 Bacteria 2445
23 Ga0070709_10064979 3300005434 Bacteria 2335
24 Ga0070709_10223355 3300005434 Bacteria 1344
25 Ga0070714_100133793 3300005435 Bacteria 2218
26 Ga0070714_100934047 3300005435 Bacteria 843
27 Ga0070713_100012832 3300005436 Bacteria 6162
28 Ga0070713_100030829 3300005436 Bacteria 4264
29 Ga0070713_100573863 3300005436 Bacteria 1070
30 Ga0070710_10080381 3300005437 Bacteria 1902
31 Ga0070710_10225102 3300005437 Bacteria 1195
32 Ga0070711_100286915 3300005439 Bacteria 1304
33 Ga0070705_100071926 3300005440 Bacteria 2093
34 Ga0070708_100044695 3300005445 Bacteria 3896
35 Ga0070678_100104382 3300005456 Bacteria 2204
36 Ga0070662_100079327 3300005457 Bacteria 2441
37 Ga0070706_100022710 3300005467 Bacteria 5777
38 Ga0070698_100001145 3300005471 Bacteria 29366
39 Ga0070699_100119010 3300005518 Bacteria 2322
40 Ga0070679_100003811 3300005530 Bacteria 13841
41 Ga0070679_100007804 3300005530 Bacteria 10029
42 Ga0070684_100168370 3300005535 Bacteria 1990
43 Ga0070697_100047256 3300005536 Bacteria 3490
44 Ga0068853_100316694 3300005539 Bacteria 1445
45 Ga0070695_100147102 3300005545 Bacteria 1640
46 Ga0070665_100006359 3300005548 Bacteria 12045
47 Ga0070704_100009792 3300005549 Bacteria 5811
48 Ga0068855_100145232 3300005563 Bacteria 2701
49 Ga0070664_100518667 3300005564 Bacteria 1100
50 Ga0068856_100007129 3300005614 Bacteria 10906
51 Ga0068852_100041706 3300005616 Bacteria 3880
52 Ga0068852_100635049 3300005616 Bacteria 1074
53 Ga0068858_100096863 3300005842 Bacteria 2750
54 Ga0068860_100726695 3300005843 Bacteria 1004
55 Ga0081455_10000780 3300005937 Bacteria 40974
56 Ga0081538_10084129 3300005981 Bacteria 1678
57 Ga0081539_10033308 3300005985 Bacteria 3140
58 Ga0070717_10040838 3300006028 Bacteria 3781
59 Ga0070717_10237706 3300006028 Bacteria 1605
60 Ga0075368_10024403 3300006042 Bacteria 2316
61 Ga0075432_10002265 3300006058 Bacteria 6400
62 Ga0070715_10164644 3300006163 Bacteria 1099
63 Ga0070716_100023817 3300006173 Bacteria 3253
64 Ga0070716_100268668 3300006173 Bacteria 1171
65 Ga0070712_100043772 3300006175 Bacteria 3084
66 Ga0070712_100096249 3300006175 Bacteria 2179
67 Ga0070712_100129070 3300006175 Bacteria 1914
68 Ga0075367_10112616 3300006178 Bacteria 1671
69 Ga0075369_10000557 3300006186 Bacteria 11747
70 Ga0075369_10011093 3300006186 Bacteria 3535
71 Ga0075366_10033745 3300006195 Bacteria 3015
72 Ga0075428_100332433 3300006844 Bacteria 1632
73 Ga0075431_100162304 3300006847 Bacteria 2297
74 Ga0075433_10083227 3300006852 Bacteria 2824
75 Ga0075434_100147309 3300006871 Bacteria 2374
76 Ga0075436_100077667 3300006914 Bacteria 2300
77 Ga0075436_100268989 3300006914 Bacteria 1217
78 Ga0097620_100299653 3300006931 Bacteria 1701
79 Ga0079104_1002009 3300006946 Bacteria 11878
80 Ga0075435_100168288 3300007076 Unclassified 1849
81 Ga0075435_100683145 3300007076 Bacteria 892
82 Ga0105251_10000210 3300009011 Bacteria 59171
83 Ga0105244_10003598 3300009036 Bacteria 11003
84 Ga0105244_10027736 3300009036 Bacteria 3049
85 Ga0105244_10038499 3300009036 Bacteria 2494
86 Ga0105250_10000715 3300009092 Bacteria 20421
87 Ga0105250_10073434 3300009092 Bacteria 1383
88 Ga0105245_10046581 3300009098 Bacteria 3875
89 Ga0114129_10108130 3300009147 Bacteria 3840
90 Ga0114129_10271689 3300009147 Bacteria 2268
91 Ga0105243_10004716 3300009148 Bacteria 10737
92 Ga0105243_10215157 3300009148 Bacteria 1695
93 Ga0105237_10129783 3300009545 Bacteria 2515
94 Ga0105238_10271663 3300009551 Bacteria 1676
95 Ga0105249_10095354 3300009553 Bacteria 2789
96 Ga0105239_10324737 3300010375 Bacteria 1736
97 Ga0105246_10150804 3300011119 Bacteria 1759
98 Ga0157345_1000002 3300012498 Bacteria 123939
99 Ga0157373_10000060 3300013100 Bacteria 95775
100 Ga0157371_10046377 3300013102 Bacteria 3091
101 Ga0157371_10068455 3300013102 Bacteria 2513
102 Ga0157370_10000874 3300013104 Bacteria 38194
103 Ga0157370_10001700 3300013104 Bacteria 27101
104 Ga0157370_10047738 3300013104 Bacteria 4103
105 Ga0157369_10000564 3300013105 Bacteria 48711
106 Ga0163162_10000095 3300013306 Bacteria 80739
107 Ga0163162_10000430 3300013306 Bacteria 38735
108 Ga0157372_10808451 3300013307 Bacteria 1089
109 Ga0157375_10396152 3300013308 Bacteria 1547
110 Ga0163163_10161300 3300014325 Bacteria 2288
111 Ga0163163_10465587 3300014325 Bacteria 1325
112 Ga0182008_10001847 3300014497 Bacteria 13777
113 Ga0182005_1000139 3300015265 Bacteria 51303
114 Ga0163161_10003069 3300017792 Bacteria 11782
115 Ga0163161_10012542 3300017792 Bacteria 5884
116 Ga0163161_10043802 3300017792 Bacteria 3223
117 Ga0209051_1000294 3300025303 Bacteria 79686
118 Ga0207696_1008745 3300025711 Bacteria 3837
119 Ga0207655_1000006 3300025728 Bacteria 861092
120 Ga0207655_1000325 3300025728 Bacteria 70385
121 Ga0207713_1001068 3300025735 Bacteria 23648
122 Ga0207713_1009523 3300025735 Bacteria 5466
123 Ga0207713_1016331 3300025735 Bacteria 3770
124 Ga0207692_10040201 3300025898 Bacteria 2307
125 Ga0207680_10193943 3300025903 Bacteria 1380
126 Ga0207680_10412626 3300025903 Bacteria 955
127 Ga0207645_10430857 3300025907 Bacteria 889
128 Ga0207707_10101783 3300025912 Bacteria 2511
129 Ga0207671_10095851 3300025914 Bacteria 2241
130 Ga0207693_10011079 3300025915 Bacteria 7306
131 Ga0207693_10117573 3300025915 Bacteria 2087
132 Ga0207663_10165554 3300025916 Bacteria 1565
133 Ga0207663_10206934 3300025916 Bacteria 1419
134 Ga0207660_10016221 3300025917 Bacteria 4929
135 Ga0207662_10114726 3300025918 Bacteria 1683
136 Ga0207657_10312237 3300025919 Bacteria 1244
137 Ga0207694_10409906 3300025924 Bacteria 1128
138 Ga0207650_10000973 3300025925 Bacteria 21537
139 Ga0207659_10057930 3300025926 Bacteria 2780
140 Ga0207700_10010336 3300025928 Bacteria 5883
141 Ga0207700_10028667 3300025928 Bacteria 3919
142 Ga0207700_10186715 3300025928 Bacteria 1739
143 Ga0207700_10667195 3300025928 Bacteria 927
144 Ga0207664_10597353 3300025929 Bacteria 991
145 Ga0207664_10717859 3300025929 Bacteria 899
146 Ga0207644_10006443 3300025931 Bacteria 7650
147 Ga0207706_10147801 3300025933 Bacteria 2067
148 Ga0207709_10046186 3300025935 Bacteria 2641
149 Ga0207670_10020102 3300025936 Bacteria 4095
150 Ga0207669_10166475 3300025937 Bacteria 1564
151 Ga0207665_10035886 3300025939 Bacteria 3294
152 Ga0207691_10071696 3300025940 Bacteria 3125
153 Ga0207661_10167485 3300025944 Bacteria 1910
154 Ga0207679_10108025 3300025945 Bacteria 2190
155 Ga0207667_10012596 3300025949 Bacteria 9726
156 Ga0207667_10142421 3300025949 Bacteria 2468
157 Ga0207651_10003178 3300025960 Bacteria 8017
158 Ga0207712_10058911 3300025961 Bacteria 2716
159 Ga0207658_10646682 3300025986 Bacteria 953
160 Ga0207678_10056296 3300026067 Bacteria 3385
161 Ga0207702_10013214 3300026078 Bacteria 6866
162 Ga0207641_10036989 3300026088 Bacteria 4076
163 Ga0207674_10313790 3300026116 Bacteria 1517
164 Ga0207683_10016859 3300026121 Bacteria 6215
165 Ga0209281_1001475 3300027111 Bacteria 13659
166 Ga0209281_1013173 3300027111 Bacteria 1792
167 Ga0209813_10007907 3300027866 Bacteria 2667
168 Ga0207428_10039978 3300027907 Bacteria 3807
169 Ga0268266_10027224 3300028379 Bacteria 4863
170 Ga0268266_10297959 3300028379 Bacteria 1503
171 Ga0268264_10468436 3300028381 Bacteria 1223
172 Ga0265334_10003460 3300028573 Bacteria 7179
173 Ga0307517_10046080 3300028786 Bacteria 4563
174 Ga0307515_10274908 3300028794 Bacteria 1400
175 Ga0316178_1084681 3300030735 Bacteria 16610
176 Ga0265325_10046234 3300031241 Bacteria 2258
177 Ga0265325_10182192 3300031241 Bacteria 978
178 Ga0265340_10017269 3300031247 Bacteria 3731
179 Ga0265339_10000080 3300031249 Bacteria 83570
180 Ga0265339_10002697 3300031249 Bacteria 12627
181 Ga0265339_10186818 3300031249 Bacteria 1030
182 Ga0307513_10119147 3300031456 Bacteria 2612
183 Ga0265313_10000330 3300031595 Bacteria 51547
184 Ga0265313_10003192 3300031595 Bacteria 13508
185 Ga0307508_10042465 3300031616 Bacteria 4079
186 Ga0316579_10181087 3300031691 Bacteria 1019
187 Ga0307516_10324918 3300031730 Bacteria 1209
188 Ga0307416_100614074 3300032002 Bacteria 1169
189 Ga0307510_10000175 3300033180 Bacteria 54436
190 Ga0307510_10006092 3300033180 Bacteria 14371
191 Ga0307510_10111196 3300033180 Bacteria 2481
192 Ga0373944_0002685 3300035089 Bacteria 4535
193 Ga0373932_0005736 3300035112 Bacteria 2922
194 Ga0373936_0006239 3300035113 Bacteria 4495
195 Ga0373945_0003970 3300035116 Bacteria 4676
196 Ga0373954_0033929 3300035118 Bacteria 2362
197 Ga0373943_0000765 3300035170 Bacteria 14011
198 Ga0373946_0069132 3300035171 Bacteria 1520
199 Ga0373924_0018072 3300035410 Bacteria 2714
200 Ga0373935_0008313 3300035692 Bacteria 6207
201 Ga0373933_0018374 3300035724 Bacteria 3930
202 Ga0373933_0281335 3300035724 Bacteria 1075
203 Ga0373947_0118639 3300035725 Bacteria 1679
204 Ga0373947_0371344 3300035725 Bacteria 962
205 Ga0373937_0077407 3300036401 Bacteria 3074
206 Ga0373925_0081479 3300037068 Bacteria 2461
207 Ga0373925_0389024 3300037068 Bacteria 1136
208 Ga0373925_0507490 3300037068 Bacteria 990
209 Ga0395899_0006801 3300037312 Bacteria 8862
210 Ga0395899_0012729 3300037312 Bacteria 6444
211 Ga0395899_0019036 3300037312 Bacteria 5217
212 Ga0395900_0027375 3300037418 Bacteria 5838
213 Ga0395900_0041853 3300037418 Bacteria 4721
214 Ga0395898_0045281 3300037466 Bacteria 4325
215 Ga0395905_0138852 3300037471 Bacteria 2287
216 Ga0395901_0003281 3300038443 Bacteria 16284
217 Ga0395901_0043222 3300038443 Bacteria 4674
218 Ga0400490_44665 3300038726 Bacteria 9315
219 Ga0400488_38992 3300038741 Bacteria 7452
220 Ga0400488_50550 3300038741 Bacteria 3832
221 Ga0400486_18736 3300038742 Bacteria 1210
222 Ga0400487_05138 3300039110 Bacteria 6381
223 Ga0439438_003161 3300041405 Bacteria 6756
224 Ga0439447_008688 3300041407 Bacteria 3131
225 Ga0439466_0001938 3300041411 Bacteria 8124
226 Ga0439466_0004116 3300041411 Bacteria 5617
227 Ga0450911_000223 3300042115 Bacteria 22106
228 Ga0450902_000498 3300042137 Bacteria 4893
229 Ga0450903_002793 3300042138 Bacteria 3072
230 Ga0450905_000920 3300042142 Bacteria 3691
231 Ga0466966_0043681 3300044684 Bacteria 2872
232 Ga0466966_0060076 3300044684 Bacteria 2400
233 Ga0466963_0004456 3300044694 Bacteria 8145
234 Ga0466963_0044831 3300044694 Bacteria 2911
235 Ga0466963_0377204 3300044694 Bacteria 999
236 Ga0466970_0156306 3300044765 Bacteria 1260
237 Ga0466957_0018387 3300044842 Bacteria 4104
238 Ga0466959_0013438 3300045049 Bacteria 5933
239 Ga0466959_0038118 3300045049 Bacteria 3552
240 Ga0466967_0014375 3300045976 Bacteria 6164
241 Ga0466967_0183572 3300045976 Bacteria 1974
242 Ga0466967_0358346 3300045976 Bacteria 1413
243 Ga0495617_003786 3300046452 Bacteria 5599
244 Ga0495617_004391 3300046452 Bacteria 5139
245 Ga0495617_007198 3300046452 Bacteria 3871
246 Ga0495617_007380 3300046452 Bacteria 3814
247 Ga0495617_011316 3300046452 Bacteria 3044
248 Ga0495617_016846 3300046452 Bacteria 2471
249 Ga0495617_016978 3300046452 Bacteria 2460
250 Ga0495617_024367 3300046452 Bacteria 2042
251 Ga0495617_054006 3300046452 Bacteria 1334
252 Ga0495627_000014 3300046453 Bacteria 326114
253 Ga0495627_000949 3300046453 Bacteria 19921
254 Ga0495627_008087 3300046453 Bacteria 3965
255 Ga0495627_013079 3300046453 Bacteria 2928
256 Ga0495627_027570 3300046453 Bacteria 1821
257 Ga0495627_029884 3300046453 Bacteria 1729
258 Ga0495627_029888 3300046453 Bacteria 1729
259 Ga0495603_0020106 3300046455 Bacteria 4046
260 Ga0495603_0035107 3300046455 Bacteria 3013
261 Ga0495603_0057011 3300046455 Bacteria 2312
262 Ga0495603_0233077 3300046455 Bacteria 1061
263 Ga0495590_0000260 3300046457 Bacteria 28843
264 Ga0495590_0000454 3300046457 Bacteria 20209
265 Ga0495590_0000735 3300046457 Bacteria 14948
266 Ga0495591_000104 3300046458 Bacteria 98228
267 Ga0495591_000660 3300046458 Bacteria 25510
268 Ga0495591_000834 3300046458 Bacteria 21805
269 Ga0495591_000930 3300046458 Bacteria 20078
270 Ga0495591_008918 3300046458 Bacteria 4044
271 Ga0495591_014116 3300046458 Bacteria 2886
272 Ga0495638_0003266 3300046460 Bacteria 12795
273 Ga0495638_0004246 3300046460 Bacteria 10902
274 Ga0495638_0013059 3300046460 Bacteria 5669
275 Ga0495638_0014697 3300046460 Bacteria 5281
276 Ga0495638_0017100 3300046460 Bacteria 4843
277 Ga0495638_0019386 3300046460 Bacteria 4501
278 Ga0495638_0034279 3300046460 Bacteria 3241
279 Ga0495638_0052590 3300046460 Bacteria 2536
280 Ga0495638_0059789 3300046460 Bacteria 2358
281 Ga0495638_0225336 3300046460 Bacteria 1046
282 Ga0495653_0000147 3300046463 Bacteria 58379
283 Ga0495653_0005900 3300046463 Bacteria 10025
284 Ga0495650_0000476 3300046471 Bacteria 61528
285 Ga0495650_0003400 3300046471 Bacteria 11650
286 Ga0495650_0004794 3300046471 Bacteria 9076
287 Ga0495650_0007569 3300046471 Bacteria 6502
288 Ga0495580_0011707 3300046472 Bacteria 6779
289 Ga0495605_0000001 3300046474 Bacteria 614538
290 Ga0495605_0000350 3300046474 Bacteria 45096
291 Ga0495605_0001061 3300046474 Bacteria 18351
292 Ga0495605_0005332 3300046474 Bacteria 7492
293 Ga0495605_0017544 3300046474 Bacteria 3850
294 Ga0495605_0036044 3300046474 Bacteria 2497
295 Ga0495605_0082053 3300046474 Bacteria 1507
296 Ga0495662_0001229 3300046476 Bacteria 12618
297 Ga0495664_0008759 3300046477 Bacteria 5651
298 Ga0495584_0000503 3300046491 Bacteria 26779
299 Ga0495584_0000639 3300046491 Bacteria 23311
300 Ga0495584_0004664 3300046491 Bacteria 7346
301 Ga0495584_0005154 3300046491 Bacteria 6935
302 Ga0495584_0005264 3300046491 Bacteria 6854
303 Ga0495584_0024054 3300046491 Bacteria 3088
304 Ga0495584_0027629 3300046491 Bacteria 2874
305 Ga0495584_0066511 3300046491 Bacteria 1812
306 Ga0495584_0075512 3300046491 Bacteria 1694
307 Ga0495584_0158875 3300046491 Bacteria 1148
308 Ga0495585_0000047 3300046492 Bacteria 120650
309 Ga0495585_0000203 3300046492 Bacteria 61972
310 Ga0495585_0000749 3300046492 Bacteria 28764
311 Ga0495585_0008686 3300046492 Bacteria 6141
312 Ga0495585_0019164 3300046492 Bacteria 3948
313 Ga0495585_0064478 3300046492 Bacteria 2009
314 Ga0495585_0068130 3300046492 Bacteria 1945
315 Ga0495585_0087518 3300046492 Bacteria 1681
316 Ga0495585_0162248 3300046492 Bacteria 1159
317 Ga0495594_0002066 3300046499 Bacteria 10454
318 Ga0495596_0000330 3300046500 Bacteria 30845
319 Ga0495596_0000490 3300046500 Bacteria 25151
320 Ga0495596_0022012 3300046500 Bacteria 2597
321 Ga0495607_0000025 3300046501 Bacteria 159379
322 Ga0495607_0000251 3300046501 Bacteria 57660
323 Ga0495607_0002009 3300046501 Bacteria 17070
324 Ga0495607_0003285 3300046501 Bacteria 12426
325 Ga0495607_0003796 3300046501 Bacteria 11413
326 Ga0495607_0003826 3300046501 Bacteria 11353
327 Ga0495607_0016327 3300046501 Bacteria 4792
328 Ga0495607_0018120 3300046501 Bacteria 4497
329 Ga0495607_0036086 3300046501 Bacteria 2983
330 Ga0495607_0047823 3300046501 Bacteria 2503
331 Ga0495607_0058473 3300046501 Bacteria 2203
332 Ga0495607_0071260 3300046501 Bacteria 1938
333 Ga0495607_0108094 3300046501 Bacteria 1478
334 Ga0495607_0125086 3300046501 Bacteria 1345
335 Ga0495583_0000924 3300046506 Bacteria 34532
336 Ga0495583_0000980 3300046506 Bacteria 32777
337 Ga0495583_0001029 3300046506 Bacteria 31649
338 Ga0495583_0002276 3300046506 Bacteria 16834
339 Ga0495583_0022822 3300046506 Bacteria 3182
340 Ga0495583_0034658 3300046506 Bacteria 2415
341 Ga0495606_0000022 3300046507 Bacteria 265567
342 Ga0495606_0000023 3300046507 Bacteria 265019
343 Ga0495606_0000047 3300046507 Bacteria 207892
344 Ga0495606_0000238 3300046507 Bacteria 96877
345 Ga0495606_0000640 3300046507 Bacteria 54916
346 Ga0495606_0000694 3300046507 Bacteria 52273
347 Ga0495606_0001284 3300046507 Bacteria 34796
348 Ga0495606_0002425 3300046507 Bacteria 21734
349 Ga0495606_0002703 3300046507 Bacteria 20021
350 Ga0495606_0012895 3300046507 Bacteria 6652
351 Ga0495606_0013155 3300046507 Bacteria 6567
352 Ga0495606_0039360 3300046507 Bacteria 3187
353 Ga0495606_0053514 3300046507 Bacteria 2619
354 Ga0495606_0069192 3300046507 Bacteria 2230
355 Ga0495610_0001246 3300046512 Bacteria 22848
356 Ga0495610_0002056 3300046512 Bacteria 17196
357 Ga0495610_0002489 3300046512 Bacteria 15407
358 Ga0495610_0004146 3300046512 Bacteria 10842
359 Ga0495610_0004318 3300046512 Bacteria 10553
360 Ga0495610_0009099 3300046512 Bacteria 6327
361 Ga0495610_0013798 3300046512 Bacteria 4780
362 Ga0495610_0015388 3300046512 Bacteria 4447
363 Ga0495610_0019157 3300046512 Bacteria 3837
364 Ga0495610_0029454 3300046512 Bacteria 2891
365 Ga0495610_0049707 3300046512 Bacteria 2052
366 Ga0495610_0085776 3300046512 Bacteria 1436
367 Ga0495616_0000121 3300046513 Bacteria 68406
368 Ga0495616_0000225 3300046513 Bacteria 46536
369 Ga0495616_0002944 3300046513 Bacteria 11073
370 Ga0495616_0003961 3300046513 Bacteria 9423
371 Ga0495616_0024156 3300046513 Bacteria 3262
372 Ga0495616_0028408 3300046513 Bacteria 2961
373 Ga0495616_0059708 3300046513 Bacteria 1875
374 Ga0495620_0000612 3300046515 Bacteria 22323
375 Ga0495620_0002846 3300046515 Bacteria 9939
376 Ga0495620_0002950 3300046515 Bacteria 9785
377 Ga0495620_0003098 3300046515 Bacteria 9549
378 Ga0495620_0013624 3300046515 Bacteria 4157
379 Ga0495620_0020748 3300046515 Bacteria 3202
380 Ga0495620_0024639 3300046515 Bacteria 2858
381 Ga0495630_0000428 3300046517 Bacteria 32182
382 Ga0495631_0000003 3300046518 Bacteria 164714
383 Ga0495631_0000011 3300046518 Bacteria 111733
384 Ga0495631_0003012 3300046518 Bacteria 9319
385 Ga0495631_0025513 3300046518 Bacteria 2721
386 Ga0495631_0051738 3300046518 Bacteria 1794
387 Ga0495632_0000340 3300046519 Bacteria 44360
388 Ga0495632_0000777 3300046519 Bacteria 28653
389 Ga0495632_0001696 3300046519 Bacteria 18014
390 Ga0495632_0002036 3300046519 Bacteria 15921
391 Ga0495632_0004500 3300046519 Bacteria 9447
392 Ga0495632_0005539 3300046519 Bacteria 8323
393 Ga0495632_0017902 3300046519 Bacteria 3898
394 Ga0495632_0018302 3300046519 Bacteria 3847
395 Ga0495632_0018892 3300046519 Bacteria 3766
396 Ga0495632_0022800 3300046519 Bacteria 3351
397 Ga0495632_0035429 3300046519 Bacteria 2546
398 Ga0495632_0050687 3300046519 Bacteria 2045
399 Ga0495637_0000017 3300046520 Bacteria 209676
400 Ga0495637_0000092 3300046520 Bacteria 70294
401 Ga0495637_0000910 3300046520 Bacteria 19021
402 Ga0495637_0000999 3300046520 Bacteria 17872
403 Ga0495637_0009380 3300046520 Bacteria 4774
404 Ga0495637_0012811 3300046520 Bacteria 4000
405 Ga0495637_0019280 3300046520 Bacteria 3155
406 Ga0495637_0020167 3300046520 Bacteria 3070
407 Ga0495637_0023186 3300046520 Bacteria 2824
408 Ga0495637_0023309 3300046520 Bacteria 2815
409 Ga0495637_0057487 3300046520 Bacteria 1606
410 Ga0495637_0084564 3300046520 Bacteria 1260
411 Ga0495643_0000017 3300046522 Bacteria 313381
412 Ga0495643_0001044 3300046522 Bacteria 28024
413 Ga0495643_0002559 3300046522 Bacteria 14208
414 Ga0495643_0003191 3300046522 Bacteria 12176
415 Ga0495643_0005129 3300046522 Bacteria 8951
416 Ga0495643_0012853 3300046522 Bacteria 5035
417 Ga0495643_0017698 3300046522 Bacteria 4160
418 Ga0495643_0018681 3300046522 Bacteria 4021
419 Ga0495643_0037900 3300046522 Bacteria 2642
420 Ga0495643_0088262 3300046522 Bacteria 1603
421 Ga0495643_0108374 3300046522 Bacteria 1415
422 Ga0495643_0118201 3300046522 Bacteria 1341
423 Ga0495644_0000199 3300046523 Bacteria 28283
424 Ga0495644_0002564 3300046523 Bacteria 7225
425 Ga0495644_0002955 3300046523 Bacteria 6754
426 Ga0495644_0020807 3300046523 Bacteria 2502
427 Ga0495644_0040617 3300046523 Bacteria 1753
428 Ga0495648_0000278 3300046524 Bacteria 57881
429 Ga0495648_0001209 3300046524 Bacteria 25891
430 Ga0495648_0003252 3300046524 Bacteria 14386
431 Ga0495648_0009203 3300046524 Bacteria 7685
432 Ga0495648_0010377 3300046524 Bacteria 7098
433 Ga0495648_0012839 3300046524 Bacteria 6219
434 Ga0495648_0024230 3300046524 Bacteria 4138
435 Ga0495648_0033766 3300046524 Bacteria 3338
436 Ga0495648_0035759 3300046524 Bacteria 3216
437 Ga0495648_0038142 3300046524 Bacteria 3077
438 Ga0495648_0053632 3300046524 Bacteria 2441
439 Ga0495666_0000020 3300046526 Bacteria 62268
440 Ga0495666_0026193 3300046526 Bacteria 2877
441 Ga0495642_0000008 3300046528 Bacteria 162190
442 Ga0495654_0000158 3300046530 Bacteria 67310
443 Ga0495654_0000531 3300046530 Bacteria 30861
444 Ga0495654_0000601 3300046530 Bacteria 28625
445 Ga0495654_0001466 3300046530 Bacteria 16137
446 Ga0495654_0002554 3300046530 Bacteria 11652
447 Ga0495654_0004196 3300046530 Bacteria 8623
448 Ga0495654_0006804 3300046530 Bacteria 6456
449 Ga0495654_0006938 3300046530 Bacteria 6383
450 Ga0495654_0014629 3300046530 Bacteria 4172
451 Ga0495654_0027921 3300046530 Bacteria 2888
452 Ga0495654_0045232 3300046530 Bacteria 2173
453 Ga0495654_0054675 3300046530 Bacteria 1935
454 Ga0495654_0097015 3300046530 Bacteria 1361
455 Ga0495654_0135946 3300046530 Bacteria 1099
456 Ga0495654_0162195 3300046530 Bacteria 980
457 Ga0495665_0019437 3300046531 Bacteria 3654
458 Ga0495665_0059972 3300046531 Bacteria 2008
459 Ga0495640_0269226 3300046533 Bacteria 1063
460 Ga0495586_0005186 3300046535 Bacteria 6973
461 Ga0495609_0000016 3300046538 Bacteria 312882
462 Ga0495609_0000077 3300046538 Bacteria 119266
463 Ga0495609_0007870 3300046538 Bacteria 5269
464 Ga0495609_0011901 3300046538 Bacteria 4135
465 Ga0495597_0000012 3300046542 Bacteria 212005
466 Ga0495597_0000045 3300046542 Bacteria 105633
467 Ga0495597_0003219 3300046542 Bacteria 9708
468 Ga0495597_0005930 3300046542 Bacteria 6376
469 Ga0495597_0020511 3300046542 Bacteria 3077
470 Ga0495597_0033032 3300046542 Bacteria 2345
471 Ga0495597_0079439 3300046542 Bacteria 1405
472 Ga0495645_0013392 3300046543 Bacteria 5796
473 Ga0495622_0000086 3300046557 Bacteria 83162
474 Ga0495622_0000426 3300046557 Bacteria 27816
475 Ga0495622_0051354 3300046557 Bacteria 1913
476 Ga0495622_0060661 3300046557 Bacteria 1751
477 Ga0495633_0000138 3300046558 Bacteria 96804
478 Ga0495633_0033303 3300046558 Bacteria 2485
479 Ga0495656_0021232 3300046615 Bacteria 2526
480 Ga0495668_0000379 3300046616 Bacteria 58955
481 Ga0495668_0007801 3300046616 Bacteria 6785
482 Ga0495668_0025866 3300046616 Bacteria 3333
483 Ga0495668_0028275 3300046616 Bacteria 3171
484 Ga0495634_0001639 3300046642 Bacteria 19477
485 Ga0495611_0000019 3300046648 Bacteria 126076
486 Ga0495611_0001238 3300046648 Bacteria 13138
487 Ga0495611_0004213 3300046648 Bacteria 6260
488 Ga0495611_0010174 3300046648 Bacteria 3980
489 Ga0495611_0012029 3300046648 Bacteria 3677
490 Ga0495625_0001630 3300046660 Bacteria 26438
491 Ga0495625_0002882 3300046660 Bacteria 17983
492 Ga0495625_0005115 3300046660 Bacteria 12126
493 Ga0495625_0005634 3300046660 Bacteria 11348
494 Ga0495625_0007998 3300046660 Bacteria 9081
495 Ga0495625_0017633 3300046660 Bacteria 5587
496 Ga0495625_0069795 3300046660 Bacteria 2468
497 Ga0495625_0119353 3300046660 Bacteria 1796
498 Ga0495635_0016603 3300046663 Bacteria 5142
499 Ga0495661_0000001 3300046665 Bacteria 898372
500 Ga0495661_0000010 3300046665 Bacteria 284261
501 Ga0495661_0001554 3300046665 Bacteria 18936
502 Ga0495661_0003328 3300046665 Bacteria 11913
503 Ga0495661_0006051 3300046665 Bacteria 8524
504 Ga0495661_0010260 3300046665 Bacteria 6399
505 Ga0495661_0032443 3300046665 Bacteria 3301
506 Ga0495661_0038402 3300046665 Bacteria 2983
507 Ga0495661_0039929 3300046665 Bacteria 2913
508 Ga0495588_0002156 3300046674 Bacteria 8422
509 Ga0495588_0011333 3300046674 Bacteria 4180
510 Ga0495623_0000590 3300046679 Bacteria 24255
511 Ga0495646_0238453 3300046680 Bacteria 978
512 Ga0495647_0003997 3300046681 Bacteria 4761
513 Ga0495669_0005004 3300046684 Bacteria 5510
514 Ga0495613_0030196 3300046689 Bacteria 4026
515 Ga0495624_0007173 3300046690 Bacteria 7844
516 Ga0495624_0021857 3300046690 Bacteria 4238
517 Ga0495670_0000311 3300046691 Bacteria 23109
518 Ga0495670_0001278 3300046691 Bacteria 12295
519 Ga0495670_0023098 3300046691 Bacteria 3071
520 Ga0495671_0000419 3300046692 Bacteria 33808
521 Ga0495671_0001653 3300046692 Bacteria 14601
522 Ga0495671_0005071 3300046692 Bacteria 7752
523 Ga0495671_0005698 3300046692 Bacteria 7263
524 Ga0495671_0017185 3300046692 Bacteria 3850
525 Ga0495671_0018909 3300046692 Bacteria 3649
526 Ga0495671_0031681 3300046692 Bacteria 2703
527 Ga0495671_0037025 3300046692 Bacteria 2469
528 Ga0495671_0039845 3300046692 Bacteria 2370
529 Ga0495671_0061632 3300046692 Bacteria 1850
530 Ga0495671_0123164 3300046692 Bacteria 1264
531 Ga0495649_0000087 3300046694 Bacteria 79929
532 Ga0495649_0000663 3300046694 Bacteria 28139
533 Ga0495649_0000677 3300046694 Bacteria 27719
534 Ga0495649_0001278 3300046694 Bacteria 19346
535 Ga0495649_0006059 3300046694 Bacteria 7560
536 Ga0495649_0012605 3300046694 Bacteria 4907
537 Ga0495649_0012796 3300046694 Bacteria 4865
538 Ga0495649_0014712 3300046694 Bacteria 4473
539 Ga0495649_0021486 3300046694 Bacteria 3614
540 Ga0495649_0034187 3300046694 Bacteria 2797
541 Ga0495589_0000406 3300046794 Bacteria 32461
542 Ga0495589_0000649 3300046794 Bacteria 22825
543 Ga0495589_0001844 3300046794 Bacteria 12023
544 Ga0495589_0003264 3300046794 Bacteria 8839
545 Ga0495589_0003909 3300046794 Bacteria 7998
546 Ga0495589_0006298 3300046794 Bacteria 6267
547 Ga0495589_0021377 3300046794 Bacteria 3306
548 Ga0495589_0077901 3300046794 Bacteria 1615
549 Ga0495589_0087214 3300046794 Bacteria 1515
550 Ga0495600_0131548 3300046809 Bacteria 1626
551 Ga0495660_0000258 3300046810 Bacteria 50737
552 Ga0495660_0000500 3300046810 Bacteria 32433
553 Ga0495660_0006189 3300046810 Bacteria 7104
554 Ga0495660_0006795 3300046810 Bacteria 6745
555 Ga0495660_0009870 3300046810 Bacteria 5554
556 Ga0495660_0013046 3300046810 Bacteria 4817
557 Ga0495660_0047704 3300046810 Bacteria 2344
558 Ga0495660_0048807 3300046810 Bacteria 2313
559 Ga0495660_0053475 3300046810 Bacteria 2191
560 Ga0495660_0087329 3300046810 Bacteria 1626
561 Ga0495581_0005956 3300047315 Bacteria 7069
562 Ga0495581_0382697 3300047315 Bacteria 821
563 Ga0495604_0000143 3300047317 Bacteria 61592
564 Ga0495674_0001761 3300047319 Bacteria 21319
565 Ga0495672_0000743 3300047320 Bacteria 35713
566 Ga0495672_0001129 3300047320 Bacteria 27029
567 Ga0495672_0001334 3300047320 Bacteria 24515
568 Ga0495672_0005219 3300047320 Bacteria 10347
569 Ga0495672_0005274 3300047320 Bacteria 10294
570 Ga0495672_0014101 3300047320 Bacteria 5485
571 Ga0495672_0033647 3300047320 Bacteria 3174
572 Ga0495672_0043109 3300047320 Bacteria 2715
573 Ga0495672_0133603 3300047320 Bacteria 1303
574 Ga0495676_0033889 3300047321 Bacteria 4292
575 Ga0495676_0035212 3300047321 Bacteria 4189
576 Ga0495680_0094059 3300047322 Bacteria 2243
577 Ga0495680_0463770 3300047322 Bacteria 865
578 Ga0495683_0000022 3300047323 Bacteria 163268
579 Ga0495683_0000062 3300047323 Bacteria 113926
580 Ga0495683_0000110 3300047323 Bacteria 83927
581 Ga0495683_0002570 3300047323 Bacteria 10900
582 Ga0495683_0005022 3300047323 Bacteria 7412
583 Ga0495683_0009227 3300047323 Bacteria 5256
584 Ga0495683_0011625 3300047323 Bacteria 4632
585 Ga0495683_0018099 3300047323 Bacteria 3646
586 Ga0495683_0019463 3300047323 Bacteria 3502
587 Ga0495683_0099619 3300047323 Bacteria 1398
588 Ga0495675_0014794 3300047444 Bacteria 4933
589 Ga0495677_0038713 3300047445 Bacteria 1742
590 Ga0495679_000042 3300047446 Bacteria 143151
591 Ga0495679_000799 3300047446 Bacteria 20002
592 Ga0495679_002335 3300047446 Bacteria 9735
593 Ga0495679_004608 3300047446 Bacteria 6290
594 Ga0495673_0000192 3300047469 Bacteria 96394
595 Ga0495673_0000429 3300047469 Bacteria 47646
596 Ga0495673_0000769 3300047469 Bacteria 30385
597 Ga0495673_0000847 3300047469 Bacteria 28434
598 Ga0495673_0000998 3300047469 Bacteria 25147
599 Ga0495673_0001144 3300047469 Bacteria 22678
600 Ga0495673_0002309 3300047469 Bacteria 13635
601 Ga0495673_0002777 3300047469 Bacteria 11975
602 Ga0495673_0020288 3300047469 Bacteria 3311
603 Ga0495673_0025756 3300047469 Bacteria 2819
604 Ga0495681_0000441 3300047470 Bacteria 31744
605 Ga0495681_0000802 3300047470 Bacteria 24208
606 Ga0495681_0001036 3300047470 Bacteria 21248
607 Ga0495681_0001322 3300047470 Bacteria 18757
608 Ga0495681_0001338 3300047470 Bacteria 18589
609 Ga0495681_0001427 3300047470 Bacteria 17963
610 Ga0495681_0001859 3300047470 Bacteria 15489
611 Ga0495681_0010314 3300047470 Bacteria 5659
612 Ga0495681_0015921 3300047470 Bacteria 4242
613 Ga0495681_0016012 3300047470 Bacteria 4226
614 Ga0495681_0021071 3300047470 Bacteria 3520
615 Ga0495681_0029952 3300047470 Bacteria 2778
616 Ga0495681_0038781 3300047470 Bacteria 2332
617 Ga0495684_0012633 3300047471 Bacteria 6516
618 Ga0495684_0028216 3300047471 Bacteria 4309
619 Ga0495684_0118219 3300047471 Bacteria 1998
620 Ga0495686_0000246 3300047472 Bacteria 97501
621 Ga0495686_0001403 3300047472 Bacteria 26593
622 Ga0495686_0011982 3300047472 Bacteria 6093
623 Ga0495686_0028125 3300047472 Bacteria 3662
624 Ga0495686_0044614 3300047472 Bacteria 2807
625 Ga0495686_0091729 3300047472 Bacteria 1844
626 Ga0495686_0145512 3300047472 Bacteria 1395
627 Ga0495686_0165259 3300047472 Bacteria 1290
628 Ga0495593_0001134 3300047673 Bacteria 15514
629 Ga0495593_0003121 3300047673 Bacteria 9957
630 Ga0495626_0000002 3300048091 Bacteria 436012
631 Ga0495626_0000035 3300048091 Bacteria 180770
632 Ga0495626_0000112 3300048091 Bacteria 105221
633 Ga0495626_0000199 3300048091 Bacteria 72605
634 Ga0495626_0000243 3300048091 Bacteria 63145
635 Ga0495626_0001716 3300048091 Bacteria 16780
636 Ga0495626_0002727 3300048091 Bacteria 11900
637 Ga0495626_0003751 3300048091 Bacteria 9572
638 Ga0495626_0036865 3300048091 Bacteria 2327
639 Ga0495626_0085260 3300048091 Bacteria 1397
640 Ga0496100_0004216 3300048903 Bacteria 7593
641 Ga0496101_0008482 3300048904 Bacteria 6715
642 Ga0496102_0015342 3300048905 Bacteria 6672
643 Ga0496102_0060844 3300048905 Bacteria 3455
644 Ga0496104_0001979 3300048907 Bacteria 17749
645 Ga0496105_0019780 3300048908 Bacteria 5433
646 Ga0496106_0001612 3300048909 Bacteria 16945
647 Ga0496106_0280750 3300048909 Bacteria 1334
648 Ga0496107_0007347 3300048910 Bacteria 7597
649 Ga0496108_0005122 3300048911 Bacteria 10595
650 Ga0496108_0015651 3300048911 Bacteria 6186
651 Ga0496108_0363000 3300048911 Bacteria 1264
652 Ga0496109_0009300 3300048912 Bacteria 8373
653 Ga0496109_0047425 3300048912 Bacteria 3906
654 Ga0496109_0356830 3300048912 Bacteria 1381
655 Ga0496109_0397596 3300048912 Bacteria 1302
656 Ga0496110_0000756 3300048913 Bacteria 22392
657 Ga0496110_0002693 3300048913 Bacteria 13418
658 Ga0496110_0019801 3300048913 Bacteria 5670
659 Ga0496110_0135591 3300048913 Bacteria 2224
660 Ga0496110_0335528 3300048913 Bacteria 1377
661 Ga0496111_0004067 3300048914 Bacteria 9190
662 Ga0496111_0037305 3300048914 Bacteria 3478
663 Ga0496111_0041913 3300048914 Bacteria 3286
664 Ga0496112_0021703 3300048915 Bacteria 6108
665 Ga0496112_0025004 3300048915 Bacteria 5730
666 Ga0496112_0026080 3300048915 Bacteria 5619
667 Ga0496113_0005557 3300048916 Bacteria 7877
668 Ga0496114_0634958 3300048917 Bacteria 940
669 Ga0496115_0434844 3300048918 Bacteria 1062
670 Ga0496116_0000151 3300048919 Bacteria 141429
671 Ga0496118_0087188 3300048921 Bacteria 2166
672 Ga0496119_0057738 3300048922 Bacteria 2343
673 Ga0496121_0002334 3300048924 Bacteria 29308
674 Ga0496121_0003523 3300048924 Bacteria 22213
675 Ga0496121_0064379 3300048924 Bacteria 2990
676 Ga0496122_0092041 3300048925 Bacteria 2063
677 Ga0496124_0000272 3300048927 Bacteria 99703
678 Ga0496124_0000275 3300048927 Bacteria 98848
679 Ga0496124_0001487 3300048927 Bacteria 34442
680 Ga0496124_0002199 3300048927 Bacteria 26020
681 Ga0496124_0156735 3300048927 Bacteria 1780
682 Ga0496125_0012616 3300048928 Bacteria 8369
683 Ga0496125_0019225 3300048928 Bacteria 6452
684 Ga0496126_0010095 3300048929 Bacteria 9960
685 Ga0496126_0179659 3300048929 Bacteria 1798
686 Ga0496126_0602823 3300048929 Bacteria 865
687 Ga0495678_000109 3300049459 Bacteria 98037
688 Ga0495678_000177 3300049459 Bacteria 73172
689 Ga0495678_001282 3300049459 Bacteria 20332
690 Ga0495678_001486 3300049459 Bacteria 18326
691 Ga0495678_001509 3300049459 Bacteria 18118
692 Ga0495678_001612 3300049459 Bacteria 17261
693 Ga0495678_004047 3300049459 Bacteria 8706
694 Ga0495678_004309 3300049459 Bacteria 8291
695 Ga0495678_012852 3300049459 Bacteria 3950
696 Ga0495678_017621 3300049459 Bacteria 3230
697 Ga0495678_028650 3300049459 Bacteria 2347
698 Ga0495678_032193 3300049459 Bacteria 2177
699 Ga0495678_065780 3300049459 Bacteria 1344
700 Ga0495678_078662 3300049459 Bacteria 1190
701 Ga0495678_121747 3300049459 Bacteria 875
702 Ga0495682_0000075 3300049460 Bacteria 91041
703 Ga0495682_0000223 3300049460 Bacteria 44502
704 Ga0501031_0167646 3300049568 Bacteria 1435
705 Ga0501033_0019821 3300049570 Bacteria 5084
706 Ga0501034_0000055 3300049571 Bacteria 205427
707 Ga0501034_0010898 3300049571 Bacteria 9443
708 Ga0501034_0040170 3300049571 Bacteria 4737
709 Ga0501034_0091279 3300049571 Bacteria 3044
710 Ga0501034_0105037 3300049571 Bacteria 2818
711 Ga0501034_0290922 3300049571 Bacteria 1572
712 Ga0501034_0343487 3300049571 Bacteria 1422
713 Ga0501038_0031707 3300049574 Bacteria 4668
714 Ga0501043_0011219 3300049579 Bacteria 7019
715 Ga0501047_0039677 3300049581 Bacteria 4553
716 Ga0501047_0047185 3300049581 Bacteria 4161
717 Ga0501047_0638322 3300049581 Bacteria 885
718 Ga0501068_0144056 3300049584 Bacteria 1495
719 Ga0501070_0232314 3300049586 Bacteria 1511
720 Ga0501070_0311299 3300049586 Bacteria 1282
721 Ga0501080_0101710 3300049742 Bacteria 2666
722 Ga0501044_0002282 3300049823 Bacteria 21838
723 Ga0501044_0202574 3300049823 Bacteria 1942
724 Ga0501044_0207726 3300049823 Bacteria 1914
725 Ga0501044_0487679 3300049823 Bacteria 1135
726 nmdc:mga03683_18499_c1 3300050489 Bacteria 2649
727 nmdc:mga03n38_12711_c1 3300050490 Bacteria 3177
728 nmdc:mga00v17_294699_c1 3300050491 Bacteria 1053
729 nmdc:mga0yw44_15259_c1 3300050492 Bacteria 4108
730 nmdc:mga0yw44_160633_c1 3300050492 Bacteria 1471
731 nmdc:mga0yw44_266902_c1 3300050492 Bacteria 1142
732 nmdc:mga06z11_1828_c1 3300050494 Bacteria 8013
733 nmdc:mga06z11_88117_c1 3300050494 Bacteria 1680
734 nmdc:mga04h51_9211_c1 3300050495 Bacteria 2666
735 nmdc:mga05p37_34840_c1 3300050507 Bacteria 6167
736 nmdc:mga05p37_455865_c1 3300050507 Bacteria 1479
737 nmdc:mga0qj67_36604_c1 3300050509 Bacteria 3841
738 nmdc:mga0n895_56907_c1 3300050512 Bacteria 3854
739 nmdc:mga0n895_63771_c1 3300050512 Bacteria 3644
740 nmdc:mga0n895_748420_c1 3300050512 Bacteria 970
741 nmdc:mga0n895_92055_c1 3300050512 Bacteria 3035
742 nmdc:mga0rr50_321760_c1 3300050513 Unclassified 1297
743 nmdc:mga08x19_276637_c1 3300050514 Bacteria 1163
744 nmdc:mga0sz30_1116_c1 3300050516 Bacteria 9630
745 Ga0495601_0000751 3300053077 Bacteria 17458
746 Ga0495612_0000428 3300053078 Bacteria 16790
747 Ga0495612_0027682 3300053078 Bacteria 2280
748 Ga0495595_0023021 3300053084 Bacteria 2739
749 Ga0495619_0021248 3300053085 Bacteria 4141
750 Ga0495619_0068771 3300053085 Bacteria 2366
751 Ga0495619_0192800 3300053085 Bacteria 1410
752 Ga0500643_001519 3300053087 Bacteria 13238
753 Ga0500643_003954 3300053087 Bacteria 6863
754 Ga0500644_0051354 3300053088 Bacteria 1416
755 Ga0500651_0035136 3300053093 Bacteria 3160
756 Ga0500641_0008610 3300053096 Bacteria 3646
757 Ga0500572_000005 3300053111 Bacteria 84950
758 Ga0500652_047573 3300053131 Bacteria 1743
759 Ga0500589_055234 3300053147 Bacteria 1833
760 Ga0500616_0001240 3300053153 Bacteria 25589
761 Ga0500616_0070071 3300053153 Bacteria 1791
762 Ga0500627_0000217 3300053158 Bacteria 16618
763 Ga0500627_0000776 3300053158 Bacteria 8504
764 Ga0500627_0016406 3300053158 Bacteria 2887
765 Ga0500657_136543 3300053728 Bacteria 940
766 Ga0500552_001519 3300053733 Bacteria 2222

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044765 Ga0466970_0156306 Ga0466970_0156306_559_1239 219
2 3300048929 Ga0496126_0602823 Ga0496126_0602823_159_839 220
3 3300031241 Ga0265325_10046234 Ga0265325_100462343 247
4 3300031249 Ga0265339_10002697 Ga0265339_100026979 247
5 3300031595 Ga0265313_10003192 Ga0265313_100031927 247
6 3300006175 Ga0070712_100043772 Ga0070712_1000437723 248
7 3300013306 Ga0163162_10000095 Ga0163162_1000009526 248
8 3300025915 Ga0207693_10011079 Ga0207693_100110792 248
9 3300053087 Ga0500643_001519 Ga0500643_001519_10611_11375 248
10 3300053158 Ga0500627_0000776 Ga0500627_0000776_654_1415 248
11 3300053158 Ga0500627_0016406 Ga0500627_0016406_923_1684 248
12 3300042138 Ga0450903_002793 Ga0450903_002793_2142_2903 252
13 3300046492 Ga0495585_0162248 Ga0495585_0162248_104_865 252
14 3300046501 Ga0495607_0002009 Ga0495607_0002009_5245_6006 252
15 3300046501 Ga0495607_0125086 Ga0495607_0125086_468_1241 252
16 3300046507 Ga0495606_0053514 Ga0495606_0053514_1415_2191 252
17 3300046519 Ga0495632_0050687 Ga0495632_0050687_1069_1830 252
18 3300046520 Ga0495637_0000999 Ga0495637_0000999_13183_13944 252
19 3300046524 Ga0495648_0033766 Ga0495648_0033766_2567_3328 252
20 iso_pu_bacteria 2917736166 2917736784 252
21 3300005434 Ga0070709_10223355 Ga0070709_102233552 253
22 3300047315 Ga0495581_0382697 Ga0495581_0382697_17_778 253
23 3300048927 Ga0496124_0000272 Ga0496124_0000272_66475_67254 253
24 iso_pu_bacteria 2643221605 2644039160 254
25 3300005339 Ga0070660_100342359 Ga0070660_1003423591 255
26 3300005340 Ga0070689_100121564 Ga0070689_1001215643 255
27 3300005344 Ga0070661_100200733 Ga0070661_1002007331 255
28 3300005354 Ga0070675_100149492 Ga0070675_1001494922 255
29 3300005355 Ga0070671_100017825 Ga0070671_1000178254 255
30 3300005364 Ga0070673_100000963 Ga0070673_10000096312 255
31 3300005365 Ga0070688_100012965 Ga0070688_1000129654 255
32 3300005366 Ga0070659_100090962 Ga0070659_1000909623 255
33 3300005434 Ga0070709_10064979 Ga0070709_100649792 255
34 3300005435 Ga0070714_100133793 Ga0070714_1001337933 255
35 3300005436 Ga0070713_100030829 Ga0070713_1000308293 255
36 3300005457 Ga0070662_100079327 Ga0070662_1000793272 255
37 3300005616 Ga0068852_100635049 Ga0068852_1006350492 255
38 3300005842 Ga0068858_100096863 Ga0068858_1000968632 255
39 3300006028 Ga0070717_10237706 Ga0070717_102377062 255
40 3300006173 Ga0070716_100023817 Ga0070716_1000238174 255
41 3300006847 Ga0075431_100162304 Ga0075431_1001623042 255
42 3300009098 Ga0105245_10046581 Ga0105245_100465813 255
43 3300009147 Ga0114129_10271689 Ga0114129_102716892 255
44 3300010375 Ga0105239_10324737 Ga0105239_103247373 255
45 3300011119 Ga0105246_10150804 Ga0105246_101508042 255
46 3300014325 Ga0163163_10161300 Ga0163163_101613003 255
47 3300014325 Ga0163163_10465587 Ga0163163_104655871 255
48 3300025903 Ga0207680_10412626 Ga0207680_104126261 255
49 3300025916 Ga0207663_10165554 Ga0207663_101655541 255
50 3300025919 Ga0207657_10312237 Ga0207657_103122372 255
51 3300025925 Ga0207650_10000973 Ga0207650_100009734 255
52 3300025931 Ga0207644_10006443 Ga0207644_100064435 255
53 3300025933 Ga0207706_10147801 Ga0207706_101478012 255
54 3300025939 Ga0207665_10035886 Ga0207665_100358864 255
55 3300025960 Ga0207651_10003178 Ga0207651_100031783 255
56 3300025986 Ga0207658_10646682 Ga0207658_106466822 255
57 3300026067 Ga0207678_10056296 Ga0207678_100562962 255
58 3300028379 Ga0268266_10027224 Ga0268266_100272245 255
59 3300048909 Ga0496106_0280750 Ga0496106_0280750_120_890 255
60 3300048911 Ga0496108_0363000 Ga0496108_0363000_29_799 255
61 3300048912 Ga0496109_0397596 Ga0496109_0397596_68_838 255
62 3300048913 Ga0496110_0019801 Ga0496110_0019801_995_1765 255
63 3300048915 Ga0496112_0026080 Ga0496112_0026080_1475_2245 255
64 3300048917 Ga0496114_0634958 Ga0496114_0634958_151_921 255
65 3300050509 nmdc:mga0qj67_36604_c1 nmdc:mga0qj67_36604_c1_1641_2411 255
66 3300025303 Ga0209051_1000294 Ga0209051_100029445 256
67 3300028794 Ga0307515_10274908 Ga0307515_102749082 256
68 3300031616 Ga0307508_10042465 Ga0307508_100424653 256
69 3300032002 Ga0307416_100614074 Ga0307416_1006140741 256
70 3300033180 Ga0307510_10006092 Ga0307510_100060927 256
71 3300033180 Ga0307510_10111196 Ga0307510_101111962 256
72 3300046519 Ga0495632_0000340 Ga0495632_0000340_17832_18617 256
73 3300046522 Ga0495643_0003191 Ga0495643_0003191_731_1516 256
74 3300046694 Ga0495649_0001278 Ga0495649_0001278_1346_2131 256
75 3300048929 Ga0496126_0010095 Ga0496126_0010095_5426_6196 256
76 3300053131 Ga0500652_047573 Ga0500652_047573_455_1228 256
77 iso_pu_bacteria 2599185317 2600030809 256
78 iso_pu_bacteria 2599185317 2600032113 256
79 iso_pu_bacteria 2600254930 2600359957 256
80 iso_pu_bacteria 2600254930 2600360614 256
81 iso_pu_bacteria 2738541294 2738806960 256
82 iso_pu_bacteria 2738541309 2738894320 256
83 iso_pu_bacteria 2913036834 2913041626 256
84 iso_pu_bacteria 2984568884 2984569611 256
85 3300002739 JGI25158J39367_1005935 JGI25158J39367_10059351 257
86 3300005288 Ga0065714_10002201 Ga0065714_1000220132 257
87 3300005288 Ga0065714_10007572 Ga0065714_100075722 257
88 3300005288 Ga0065714_10020205 Ga0065714_100202052 257
89 3300005288 Ga0065714_10065664 Ga0065714_100656646 257
90 3300005288 Ga0065714_10073863 Ga0065714_100738632 257
91 3300005289 Ga0065704_10071404 Ga0065704_100714045 257
92 3300005329 Ga0070683_100367810 Ga0070683_1003678102 257
93 3300005336 Ga0070680_100007366 Ga0070680_1000073667 257
94 3300005336 Ga0070680_100091993 Ga0070680_1000919932 257
95 3300005340 Ga0070689_100045226 Ga0070689_1000452263 257
96 3300005344 Ga0070661_100021408 Ga0070661_1000214083 257
97 3300005354 Ga0070675_100053262 Ga0070675_1000532623 257
98 3300005364 Ga0070673_100498233 Ga0070673_1004982331 257
99 3300005435 Ga0070714_100934047 Ga0070714_1009340471 257
100 3300005436 Ga0070713_100012832 Ga0070713_1000128321 257
101 3300005436 Ga0070713_100573863 Ga0070713_1005738632 257
102 3300005437 Ga0070710_10080381 Ga0070710_100803812 257
103 3300005437 Ga0070710_10225102 Ga0070710_102251021 257
104 3300005439 Ga0070711_100286915 Ga0070711_1002869152 257
105 3300005440 Ga0070705_100071926 Ga0070705_1000719262 257
106 3300005445 Ga0070708_100044695 Ga0070708_1000446952 257
107 3300005456 Ga0070678_100104382 Ga0070678_1001043822 257
108 3300005467 Ga0070706_100022710 Ga0070706_1000227108 257
109 3300005471 Ga0070698_100001145 Ga0070698_10000114525 257
110 3300005518 Ga0070699_100119010 Ga0070699_1001190103 257
111 3300005530 Ga0070679_100003811 Ga0070679_1000038119 257
112 3300005530 Ga0070679_100007804 Ga0070679_1000078049 257
113 3300005535 Ga0070684_100168370 Ga0070684_1001683702 257
114 3300005536 Ga0070697_100047256 Ga0070697_1000472562 257
115 3300005539 Ga0068853_100316694 Ga0068853_1003166942 257
116 3300005545 Ga0070695_100147102 Ga0070695_1001471022 257
117 3300005548 Ga0070665_100006359 Ga0070665_10000635914 257
118 3300005549 Ga0070704_100009792 Ga0070704_1000097924 257
119 3300005563 Ga0068855_100145232 Ga0068855_1001452323 257
120 3300005564 Ga0070664_100518667 Ga0070664_1005186672 257
121 3300005614 Ga0068856_100007129 Ga0068856_1000071296 257
122 3300005616 Ga0068852_100041706 Ga0068852_1000417063 257
123 3300005843 Ga0068860_100726695 Ga0068860_1007266952 257
124 3300005937 Ga0081455_10000780 Ga0081455_1000078012 257
125 3300005981 Ga0081538_10084129 Ga0081538_100841292 257
126 3300005985 Ga0081539_10033308 Ga0081539_100333082 257
127 3300006028 Ga0070717_10040838 Ga0070717_100408385 257
128 3300006042 Ga0075368_10024403 Ga0075368_100244034 257
129 3300006058 Ga0075432_10002265 Ga0075432_100022653 257
130 3300006163 Ga0070715_10164644 Ga0070715_101646442 257
131 3300006173 Ga0070716_100268668 Ga0070716_1002686682 257
132 3300006175 Ga0070712_100096249 Ga0070712_1000962492 257
133 3300006175 Ga0070712_100129070 Ga0070712_1001290702 257
134 3300006178 Ga0075367_10112616 Ga0075367_101126162 257
135 3300006186 Ga0075369_10000557 Ga0075369_100005577 257
136 3300006186 Ga0075369_10011093 Ga0075369_100110932 257
137 3300006195 Ga0075366_10033745 Ga0075366_100337453 257
138 3300006844 Ga0075428_100332433 Ga0075428_1003324332 257
139 3300006852 Ga0075433_10083227 Ga0075433_100832272 257
140 3300006871 Ga0075434_100147309 Ga0075434_1001473092 257
141 3300006914 Ga0075436_100077667 Ga0075436_1000776672 257
142 3300006914 Ga0075436_100268989 Ga0075436_1002689892 257
143 3300006931 Ga0097620_100299653 Ga0097620_1002996532 257
144 3300006946 Ga0079104_1002009 Ga0079104_10020096 257
145 3300007076 Ga0075435_100168288 Ga0075435_1001682883 257
146 3300007076 Ga0075435_100683145 Ga0075435_1006831451 257
147 3300009011 Ga0105251_10000210 Ga0105251_1000021013 257
148 3300009036 Ga0105244_10003598 Ga0105244_100035986 257
149 3300009036 Ga0105244_10027736 Ga0105244_100277362 257
150 3300009036 Ga0105244_10038499 Ga0105244_100384992 257
151 3300009092 Ga0105250_10000715 Ga0105250_1000071510 257
152 3300009092 Ga0105250_10073434 Ga0105250_100734342 257
153 3300009147 Ga0114129_10108130 Ga0114129_101081303 257
154 3300009148 Ga0105243_10004716 Ga0105243_100047168 257
155 3300009148 Ga0105243_10215157 Ga0105243_102151572 257
156 3300009545 Ga0105237_10129783 Ga0105237_101297832 257
157 3300009551 Ga0105238_10271663 Ga0105238_102716632 257
158 3300009553 Ga0105249_10095354 Ga0105249_100953542 257
159 3300012498 Ga0157345_1000002 Ga0157345_100000237 257
160 3300013100 Ga0157373_10000060 Ga0157373_1000006032 257
161 3300013102 Ga0157371_10046377 Ga0157371_100463772 257
162 3300013102 Ga0157371_10068455 Ga0157371_100684554 257
163 3300013104 Ga0157370_10000874 Ga0157370_1000087414 257
164 3300013104 Ga0157370_10001700 Ga0157370_100017007 257
165 3300013104 Ga0157370_10047738 Ga0157370_100477387 257
166 3300013105 Ga0157369_10000564 Ga0157369_1000056426 257
167 3300013306 Ga0163162_10000430 Ga0163162_1000043022 257
168 3300013307 Ga0157372_10808451 Ga0157372_108084512 257
169 3300013308 Ga0157375_10396152 Ga0157375_103961522 257
170 3300014497 Ga0182008_10001847 Ga0182008_1000184710 257
171 3300015265 Ga0182005_1000139 Ga0182005_100013952 257
172 3300017792 Ga0163161_10003069 Ga0163161_100030695 257
173 3300017792 Ga0163161_10012542 Ga0163161_100125425 257
174 3300017792 Ga0163161_10043802 Ga0163161_100438023 257
175 3300025711 Ga0207696_1008745 Ga0207696_10087452 257
176 3300025728 Ga0207655_1000006 Ga0207655_1000006706 257
177 3300025728 Ga0207655_1000325 Ga0207655_10003257 257
178 3300025735 Ga0207713_1001068 Ga0207713_100106813 257
179 3300025735 Ga0207713_1009523 Ga0207713_10095233 257
180 3300025735 Ga0207713_1016331 Ga0207713_10163312 257
181 3300025898 Ga0207692_10040201 Ga0207692_100402012 257
182 3300025903 Ga0207680_10193943 Ga0207680_101939432 257
183 3300025907 Ga0207645_10430857 Ga0207645_104308571 257
184 3300025912 Ga0207707_10101783 Ga0207707_101017833 257
185 3300025914 Ga0207671_10095851 Ga0207671_100958513 257
186 3300025915 Ga0207693_10117573 Ga0207693_101175734 257
187 3300025916 Ga0207663_10206934 Ga0207663_102069342 257
188 3300025917 Ga0207660_10016221 Ga0207660_100162215 257
189 3300025918 Ga0207662_10114726 Ga0207662_101147262 257
190 3300025924 Ga0207694_10409906 Ga0207694_104099061 257
191 3300025926 Ga0207659_10057930 Ga0207659_100579302 257
192 3300025928 Ga0207700_10010336 Ga0207700_100103364 257
193 3300025928 Ga0207700_10028667 Ga0207700_100286671 257
194 3300025928 Ga0207700_10186715 Ga0207700_101867151 257
195 3300025928 Ga0207700_10667195 Ga0207700_106671951 257
196 3300025929 Ga0207664_10597353 Ga0207664_105973531 257
197 3300025929 Ga0207664_10717859 Ga0207664_107178591 257
198 3300025935 Ga0207709_10046186 Ga0207709_100461863 257
199 3300025936 Ga0207670_10020102 Ga0207670_100201023 257
200 3300025937 Ga0207669_10166475 Ga0207669_101664752 257
201 3300025940 Ga0207691_10071696 Ga0207691_100716962 257
202 3300025944 Ga0207661_10167485 Ga0207661_101674852 257
203 3300025945 Ga0207679_10108025 Ga0207679_101080252 257
204 3300025949 Ga0207667_10012596 Ga0207667_100125967 257
205 3300025949 Ga0207667_10142421 Ga0207667_101424213 257
206 3300025961 Ga0207712_10058911 Ga0207712_100589113 257
207 3300026078 Ga0207702_10013214 Ga0207702_100132148 257
208 3300026088 Ga0207641_10036989 Ga0207641_100369893 257
209 3300026116 Ga0207674_10313790 Ga0207674_103137902 257
210 3300026121 Ga0207683_10016859 Ga0207683_100168597 257
211 3300027111 Ga0209281_1001475 Ga0209281_10014758 257
212 3300027111 Ga0209281_1013173 Ga0209281_10131732 257
213 3300027866 Ga0209813_10007907 Ga0209813_100079072 257
214 3300027907 Ga0207428_10039978 Ga0207428_100399784 257
215 3300028379 Ga0268266_10297959 Ga0268266_102979592 257
216 3300028381 Ga0268264_10468436 Ga0268264_104684362 257
217 3300028573 Ga0265334_10003460 Ga0265334_100034605 257
218 3300028786 Ga0307517_10046080 Ga0307517_100460804 257
219 3300030735 Ga0316178_1084681 Ga0316178_108468113 257
220 3300031241 Ga0265325_10182192 Ga0265325_101821921 257
221 3300031247 Ga0265340_10017269 Ga0265340_100172694 257
222 3300031249 Ga0265339_10000080 Ga0265339_100000805 257
223 3300031249 Ga0265339_10186818 Ga0265339_101868181 257
224 3300031456 Ga0307513_10119147 Ga0307513_101191473 257
225 3300031595 Ga0265313_10000330 Ga0265313_1000033050 257
226 3300031691 Ga0316579_10181087 Ga0316579_101810872 257
227 3300031730 Ga0307516_10324918 Ga0307516_103249182 257
228 3300033180 Ga0307510_10000175 Ga0307510_1000017523 257
229 3300035089 Ga0373944_0002685 Ga0373944_0002685_3326_4210 257
230 3300035112 Ga0373932_0005736 Ga0373932_0005736_1084_1869 257
231 3300035113 Ga0373936_0006239 Ga0373936_0006239_484_1263 257
232 3300035116 Ga0373945_0003970 Ga0373945_0003970_3677_4561 257
233 3300035118 Ga0373954_0033929 Ga0373954_0033929_637_1416 257
234 3300035170 Ga0373943_0000765 Ga0373943_0000765_11097_11981 257
235 3300035171 Ga0373946_0069132 Ga0373946_0069132_12_896 257
236 3300035410 Ga0373924_0018072 Ga0373924_0018072_130_1014 257
237 3300035692 Ga0373935_0008313 Ga0373935_0008313_625_1509 257
238 3300035724 Ga0373933_0018374 Ga0373933_0018374_2289_3068 257
239 3300035724 Ga0373933_0281335 Ga0373933_0281335_197_973 257
240 3300035725 Ga0373947_0118639 Ga0373947_0118639_730_1506 257
241 3300035725 Ga0373947_0371344 Ga0373947_0371344_50_829 257
242 3300036401 Ga0373937_0077407 Ga0373937_0077407_1757_2536 257
243 3300037068 Ga0373925_0081479 Ga0373925_0081479_873_1652 257
244 3300037068 Ga0373925_0389024 Ga0373925_0389024_203_982 257
245 3300037068 Ga0373925_0507490 Ga0373925_0507490_155_931 257
246 3300037312 Ga0395899_0006801 Ga0395899_0006801_3921_4697 257
247 3300037312 Ga0395899_0012729 Ga0395899_0012729_4898_5677 257
248 3300037312 Ga0395899_0019036 Ga0395899_0019036_1438_2217 257
249 3300037418 Ga0395900_0027375 Ga0395900_0027375_1001_1780 257
250 3300037418 Ga0395900_0041853 Ga0395900_0041853_3266_4042 257
251 3300037466 Ga0395898_0045281 Ga0395898_0045281_542_1321 257
252 3300037471 Ga0395905_0138852 Ga0395905_0138852_976_1758 257
253 3300038443 Ga0395901_0003281 Ga0395901_0003281_7668_8444 257
254 3300038443 Ga0395901_0043222 Ga0395901_0043222_2043_2822 257
255 3300038726 Ga0400490_44665 Ga0400490_44665_1301_2137 257
256 3300038741 Ga0400488_38992 Ga0400488_38992_1429_2265 257
257 3300038741 Ga0400488_50550 Ga0400488_50550_1260_2099 257
258 3300038742 Ga0400486_18736 Ga0400486_18736_322_1158 257
259 3300039110 Ga0400487_05138 Ga0400487_05138_4123_4959 257
260 3300041405 Ga0439438_003161 Ga0439438_003161_213_998 257
261 3300041407 Ga0439447_008688 Ga0439447_008688_1786_2580 257
262 3300041411 Ga0439466_0001938 Ga0439466_0001938_2793_3578 257
263 3300041411 Ga0439466_0004116 Ga0439466_0004116_4737_5531 257
264 3300042115 Ga0450911_000223 Ga0450911_000223_16221_17015 257
265 3300042137 Ga0450902_000498 Ga0450902_000498_3048_3842 257
266 3300042142 Ga0450905_000920 Ga0450905_000920_1728_2522 257
267 3300044684 Ga0466966_0043681 Ga0466966_0043681_1105_1899 257
268 3300044684 Ga0466966_0060076 Ga0466966_0060076_44_823 257
269 3300044694 Ga0466963_0004456 Ga0466963_0004456_7098_7877 257
270 3300044694 Ga0466963_0044831 Ga0466963_0044831_22_801 257
271 3300044694 Ga0466963_0377204 Ga0466963_0377204_142_921 257
272 3300044842 Ga0466957_0018387 Ga0466957_0018387_2380_3159 257
273 3300045049 Ga0466959_0013438 Ga0466959_0013438_269_1063 257
274 3300045049 Ga0466959_0038118 Ga0466959_0038118_2060_2839 257
275 3300045976 Ga0466967_0014375 Ga0466967_0014375_4412_5191 257
276 3300045976 Ga0466967_0183572 Ga0466967_0183572_150_929 257
277 3300045976 Ga0466967_0358346 Ga0466967_0358346_401_1192 257
278 3300046452 Ga0495617_003786 Ga0495617_003786_4351_5145 257
279 3300046452 Ga0495617_004391 Ga0495617_004391_3679_4473 257
280 3300046452 Ga0495617_007198 Ga0495617_007198_462_1256 257
281 3300046452 Ga0495617_007380 Ga0495617_007380_156_950 257
282 3300046452 Ga0495617_011316 Ga0495617_011316_997_1791 257
283 3300046452 Ga0495617_016846 Ga0495617_016846_352_1146 257
284 3300046452 Ga0495617_016978 Ga0495617_016978_741_1535 257
285 3300046452 Ga0495617_024367 Ga0495617_024367_1207_2001 257
286 3300046452 Ga0495617_054006 Ga0495617_054006_22_816 257
287 3300046453 Ga0495627_000014 Ga0495627_000014_66959_67756 257
288 3300046453 Ga0495627_000949 Ga0495627_000949_14185_14979 257
289 3300046453 Ga0495627_008087 Ga0495627_008087_1128_1922 257
290 3300046453 Ga0495627_013079 Ga0495627_013079_229_1023 257
291 3300046453 Ga0495627_027570 Ga0495627_027570_857_1651 257
292 3300046453 Ga0495627_029884 Ga0495627_029884_263_1057 257
293 3300046453 Ga0495627_029888 Ga0495627_029888_263_1057 257
294 3300046455 Ga0495603_0020106 Ga0495603_0020106_2333_3127 257
295 3300046455 Ga0495603_0035107 Ga0495603_0035107_56_856 257
296 3300046455 Ga0495603_0057011 Ga0495603_0057011_1098_1892 257
297 3300046455 Ga0495603_0233077 Ga0495603_0233077_179_958 257
298 3300046457 Ga0495590_0000260 Ga0495590_0000260_23701_24495 257
299 3300046457 Ga0495590_0000454 Ga0495590_0000454_9098_9892 257
300 3300046457 Ga0495590_0000735 Ga0495590_0000735_5212_6006 257
301 3300046458 Ga0495591_000104 Ga0495591_000104_14483_15277 257
302 3300046458 Ga0495591_000660 Ga0495591_000660_904_1698 257
303 3300046458 Ga0495591_000834 Ga0495591_000834_12471_13265 257
304 3300046458 Ga0495591_000930 Ga0495591_000930_17408_18202 257
305 3300046458 Ga0495591_008918 Ga0495591_008918_2053_2847 257
306 3300046458 Ga0495591_014116 Ga0495591_014116_1274_2074 257
307 3300046460 Ga0495638_0003266 Ga0495638_0003266_4815_5609 257
308 3300046460 Ga0495638_0004246 Ga0495638_0004246_6321_7115 257
309 3300046460 Ga0495638_0013059 Ga0495638_0013059_1852_2646 257
310 3300046460 Ga0495638_0014697 Ga0495638_0014697_53_847 257
311 3300046460 Ga0495638_0017100 Ga0495638_0017100_3448_4242 257
312 3300046460 Ga0495638_0019386 Ga0495638_0019386_2897_3691 257
313 3300046460 Ga0495638_0034279 Ga0495638_0034279_1724_2518 257
314 3300046460 Ga0495638_0052590 Ga0495638_0052590_616_1410 257
315 3300046460 Ga0495638_0059789 Ga0495638_0059789_1036_1830 257
316 3300046460 Ga0495638_0225336 Ga0495638_0225336_158_940 257
317 3300046463 Ga0495653_0000147 Ga0495653_0000147_38004_38804 257
318 3300046463 Ga0495653_0005900 Ga0495653_0005900_4235_5080 257
319 3300046471 Ga0495650_0000476 Ga0495650_0000476_10243_11037 257
320 3300046471 Ga0495650_0003400 Ga0495650_0003400_2499_3293 257
321 3300046471 Ga0495650_0004794 Ga0495650_0004794_3257_4051 257
322 3300046471 Ga0495650_0007569 Ga0495650_0007569_2190_2984 257
323 3300046472 Ga0495580_0011707 Ga0495580_0011707_5984_6763 257
324 3300046474 Ga0495605_0000001 Ga0495605_0000001_86396_87196 257
325 3300046474 Ga0495605_0000350 Ga0495605_0000350_2668_3462 257
326 3300046474 Ga0495605_0001061 Ga0495605_0001061_15648_16442 257
327 3300046474 Ga0495605_0005332 Ga0495605_0005332_364_1158 257
328 3300046474 Ga0495605_0017544 Ga0495605_0017544_2221_3015 257
329 3300046474 Ga0495605_0036044 Ga0495605_0036044_690_1484 257
330 3300046474 Ga0495605_0082053 Ga0495605_0082053_183_977 257
331 3300046476 Ga0495662_0001229 Ga0495662_0001229_7145_7990 257
332 3300046477 Ga0495664_0008759 Ga0495664_0008759_3989_4834 257
333 3300046491 Ga0495584_0000503 Ga0495584_0000503_24715_25518 257
334 3300046491 Ga0495584_0000639 Ga0495584_0000639_16773_17576 257
335 3300046491 Ga0495584_0004664 Ga0495584_0004664_4352_5146 257
336 3300046491 Ga0495584_0005154 Ga0495584_0005154_3695_4489 257
337 3300046491 Ga0495584_0005264 Ga0495584_0005264_1273_2067 257
338 3300046491 Ga0495584_0024054 Ga0495584_0024054_1070_1864 257
339 3300046491 Ga0495584_0027629 Ga0495584_0027629_324_1118 257
340 3300046491 Ga0495584_0066511 Ga0495584_0066511_667_1461 257
341 3300046491 Ga0495584_0075512 Ga0495584_0075512_386_1180 257
342 3300046491 Ga0495584_0158875 Ga0495584_0158875_116_910 257
343 3300046492 Ga0495585_0000047 Ga0495585_0000047_76593_77387 257
344 3300046492 Ga0495585_0000203 Ga0495585_0000203_39176_39976 257
345 3300046492 Ga0495585_0000749 Ga0495585_0000749_20563_21357 257
346 3300046492 Ga0495585_0008686 Ga0495585_0008686_5080_5874 257
347 3300046492 Ga0495585_0019164 Ga0495585_0019164_1127_1921 257
348 3300046492 Ga0495585_0064478 Ga0495585_0064478_724_1518 257
349 3300046492 Ga0495585_0068130 Ga0495585_0068130_471_1271 257
350 3300046492 Ga0495585_0087518 Ga0495585_0087518_835_1629 257
351 3300046499 Ga0495594_0002066 Ga0495594_0002066_4228_5022 257
352 3300046500 Ga0495596_0000330 Ga0495596_0000330_14434_15228 257
353 3300046500 Ga0495596_0000490 Ga0495596_0000490_23901_24695 257
354 3300046500 Ga0495596_0022012 Ga0495596_0022012_982_1776 257
355 3300046501 Ga0495607_0000025 Ga0495607_0000025_58630_59421 257
356 3300046501 Ga0495607_0000251 Ga0495607_0000251_22354_23148 257
357 3300046501 Ga0495607_0003285 Ga0495607_0003285_320_1096 257
358 3300046501 Ga0495607_0003796 Ga0495607_0003796_5282_6076 257
359 3300046501 Ga0495607_0003826 Ga0495607_0003826_8762_9562 257
360 3300046501 Ga0495607_0016327 Ga0495607_0016327_69_863 257
361 3300046501 Ga0495607_0018120 Ga0495607_0018120_2725_3519 257
362 3300046501 Ga0495607_0036086 Ga0495607_0036086_410_1204 257
363 3300046501 Ga0495607_0047823 Ga0495607_0047823_1105_1905 257
364 3300046501 Ga0495607_0058473 Ga0495607_0058473_127_930 257
365 3300046501 Ga0495607_0071260 Ga0495607_0071260_95_889 257
366 3300046501 Ga0495607_0108094 Ga0495607_0108094_328_1131 257
367 3300046506 Ga0495583_0000924 Ga0495583_0000924_28589_29386 257
368 3300046506 Ga0495583_0000980 Ga0495583_0000980_7779_8579 257
369 3300046506 Ga0495583_0001029 Ga0495583_0001029_5679_6482 257
370 3300046506 Ga0495583_0002276 Ga0495583_0002276_6555_7349 257
371 3300046506 Ga0495583_0022822 Ga0495583_0022822_894_1676 257
372 3300046506 Ga0495583_0034658 Ga0495583_0034658_459_1253 257
373 3300046507 Ga0495606_0000022 Ga0495606_0000022_263001_263801 257
374 3300046507 Ga0495606_0000023 Ga0495606_0000023_179186_179971 257
375 3300046507 Ga0495606_0000047 Ga0495606_0000047_136706_137509 257
376 3300046507 Ga0495606_0000238 Ga0495606_0000238_5635_6429 257
377 3300046507 Ga0495606_0000640 Ga0495606_0000640_34979_35779 257
378 3300046507 Ga0495606_0000694 Ga0495606_0000694_8910_9704 257
379 3300046507 Ga0495606_0001284 Ga0495606_0001284_16428_17231 257
380 3300046507 Ga0495606_0002425 Ga0495606_0002425_12031_12825 257
381 3300046507 Ga0495606_0002703 Ga0495606_0002703_13231_14025 257
382 3300046507 Ga0495606_0012895 Ga0495606_0012895_1465_2259 257
383 3300046507 Ga0495606_0013155 Ga0495606_0013155_1109_1903 257
384 3300046507 Ga0495606_0039360 Ga0495606_0039360_1077_1871 257
385 3300046507 Ga0495606_0069192 Ga0495606_0069192_555_1349 257
386 3300046512 Ga0495610_0001246 Ga0495610_0001246_9460_10254 257
387 3300046512 Ga0495610_0002056 Ga0495610_0002056_2204_2998 257
388 3300046512 Ga0495610_0002489 Ga0495610_0002489_13893_14687 257
389 3300046512 Ga0495610_0004146 Ga0495610_0004146_6616_7410 257
390 3300046512 Ga0495610_0004318 Ga0495610_0004318_8715_9509 257
391 3300046512 Ga0495610_0009099 Ga0495610_0009099_4717_5511 257
392 3300046512 Ga0495610_0013798 Ga0495610_0013798_2908_3702 257
393 3300046512 Ga0495610_0015388 Ga0495610_0015388_927_1721 257
394 3300046512 Ga0495610_0019157 Ga0495610_0019157_1852_2646 257
395 3300046512 Ga0495610_0029454 Ga0495610_0029454_658_1452 257
396 3300046512 Ga0495610_0049707 Ga0495610_0049707_964_1758 257
397 3300046512 Ga0495610_0085776 Ga0495610_0085776_299_1099 257
398 3300046513 Ga0495616_0000121 Ga0495616_0000121_42532_43326 257
399 3300046513 Ga0495616_0000225 Ga0495616_0000225_22574_23368 257
400 3300046513 Ga0495616_0002944 Ga0495616_0002944_9531_10325 257
401 3300046513 Ga0495616_0003961 Ga0495616_0003961_3847_4641 257
402 3300046513 Ga0495616_0024156 Ga0495616_0024156_985_1779 257
403 3300046513 Ga0495616_0028408 Ga0495616_0028408_1462_2265 257
404 3300046513 Ga0495616_0059708 Ga0495616_0059708_284_1078 257
405 3300046515 Ga0495620_0000612 Ga0495620_0000612_14399_15193 257
406 3300046515 Ga0495620_0002846 Ga0495620_0002846_8396_9190 257
407 3300046515 Ga0495620_0002950 Ga0495620_0002950_5633_6427 257
408 3300046515 Ga0495620_0003098 Ga0495620_0003098_5394_6188 257
409 3300046515 Ga0495620_0013624 Ga0495620_0013624_645_1439 257
410 3300046515 Ga0495620_0020748 Ga0495620_0020748_1340_2134 257
411 3300046515 Ga0495620_0024639 Ga0495620_0024639_19_795 257
412 3300046517 Ga0495630_0000428 Ga0495630_0000428_10593_11387 257
413 3300046518 Ga0495631_0000003 Ga0495631_0000003_90678_91472 257
414 3300046518 Ga0495631_0000011 Ga0495631_0000011_34488_35282 257
415 3300046518 Ga0495631_0003012 Ga0495631_0003012_5396_6193 257
416 3300046518 Ga0495631_0025513 Ga0495631_0025513_1662_2465 257
417 3300046518 Ga0495631_0051738 Ga0495631_0051738_223_1023 257
418 3300046519 Ga0495632_0000777 Ga0495632_0000777_14635_15429 257
419 3300046519 Ga0495632_0001696 Ga0495632_0001696_14622_15422 257
420 3300046519 Ga0495632_0002036 Ga0495632_0002036_11640_12416 257
421 3300046519 Ga0495632_0004500 Ga0495632_0004500_5115_5912 257
422 3300046519 Ga0495632_0005539 Ga0495632_0005539_7498_8292 257
423 3300046519 Ga0495632_0017902 Ga0495632_0017902_487_1281 257
424 3300046519 Ga0495632_0018302 Ga0495632_0018302_1947_2741 257
425 3300046519 Ga0495632_0018892 Ga0495632_0018892_2204_2998 257
426 3300046519 Ga0495632_0022800 Ga0495632_0022800_2107_2901 257
427 3300046519 Ga0495632_0035429 Ga0495632_0035429_717_1511 257
428 3300046520 Ga0495637_0000017 Ga0495637_0000017_40395_41189 257
429 3300046520 Ga0495637_0000092 Ga0495637_0000092_24049_24852 257
430 3300046520 Ga0495637_0000910 Ga0495637_0000910_16114_16908 257
431 3300046520 Ga0495637_0009380 Ga0495637_0009380_378_1178 257
432 3300046520 Ga0495637_0012811 Ga0495637_0012811_2506_3300 257
433 3300046520 Ga0495637_0019280 Ga0495637_0019280_263_1057 257
434 3300046520 Ga0495637_0020167 Ga0495637_0020167_219_1013 257
435 3300046520 Ga0495637_0023186 Ga0495637_0023186_1262_2056 257
436 3300046520 Ga0495637_0023309 Ga0495637_0023309_662_1456 257
437 3300046520 Ga0495637_0057487 Ga0495637_0057487_687_1481 257
438 3300046520 Ga0495637_0084564 Ga0495637_0084564_447_1241 257
439 3300046522 Ga0495643_0000017 Ga0495643_0000017_288306_289097 257
440 3300046522 Ga0495643_0001044 Ga0495643_0001044_10563_11357 257
441 3300046522 Ga0495643_0002559 Ga0495643_0002559_13119_13904 257
442 3300046522 Ga0495643_0005129 Ga0495643_0005129_7180_7974 257
443 3300046522 Ga0495643_0012853 Ga0495643_0012853_1036_1830 257
444 3300046522 Ga0495643_0017698 Ga0495643_0017698_281_1075 257
445 3300046522 Ga0495643_0018681 Ga0495643_0018681_781_1575 257
446 3300046522 Ga0495643_0037900 Ga0495643_0037900_991_1794 257
447 3300046522 Ga0495643_0088262 Ga0495643_0088262_499_1293 257
448 3300046522 Ga0495643_0108374 Ga0495643_0108374_33_827 257
449 3300046522 Ga0495643_0118201 Ga0495643_0118201_267_1061 257
450 3300046523 Ga0495644_0000199 Ga0495644_0000199_15789_16583 257
451 3300046523 Ga0495644_0002564 Ga0495644_0002564_2094_2888 257
452 3300046523 Ga0495644_0002955 Ga0495644_0002955_1279_2073 257
453 3300046523 Ga0495644_0020807 Ga0495644_0020807_489_1292 257
454 3300046523 Ga0495644_0040617 Ga0495644_0040617_249_1043 257
455 3300046524 Ga0495648_0000278 Ga0495648_0000278_23906_24700 257
456 3300046524 Ga0495648_0001209 Ga0495648_0001209_16051_16845 257
457 3300046524 Ga0495648_0003252 Ga0495648_0003252_5493_6287 257
458 3300046524 Ga0495648_0009203 Ga0495648_0009203_5182_5976 257
459 3300046524 Ga0495648_0010377 Ga0495648_0010377_599_1399 257
460 3300046524 Ga0495648_0012839 Ga0495648_0012839_2445_3239 257
461 3300046524 Ga0495648_0024230 Ga0495648_0024230_322_1116 257
462 3300046524 Ga0495648_0035759 Ga0495648_0035759_1018_1812 257
463 3300046524 Ga0495648_0038142 Ga0495648_0038142_2270_3064 257
464 3300046524 Ga0495648_0053632 Ga0495648_0053632_1581_2375 257
465 3300046526 Ga0495666_0000020 Ga0495666_0000020_50908_51702 257
466 3300046526 Ga0495666_0026193 Ga0495666_0026193_350_1129 257
467 3300046528 Ga0495642_0000008 Ga0495642_0000008_144461_145255 257
468 3300046530 Ga0495654_0000158 Ga0495654_0000158_25096_25890 257
469 3300046530 Ga0495654_0000531 Ga0495654_0000531_19671_20468 257
470 3300046530 Ga0495654_0000601 Ga0495654_0000601_22379_23173 257
471 3300046530 Ga0495654_0001466 Ga0495654_0001466_13354_14148 257
472 3300046530 Ga0495654_0002554 Ga0495654_0002554_5558_6352 257
473 3300046530 Ga0495654_0004196 Ga0495654_0004196_2567_3361 257
474 3300046530 Ga0495654_0006804 Ga0495654_0006804_1610_2401 257
475 3300046530 Ga0495654_0006938 Ga0495654_0006938_4398_5192 257
476 3300046530 Ga0495654_0014629 Ga0495654_0014629_3186_3980 257
477 3300046530 Ga0495654_0027921 Ga0495654_0027921_365_1159 257
478 3300046530 Ga0495654_0045232 Ga0495654_0045232_282_1058 257
479 3300046530 Ga0495654_0054675 Ga0495654_0054675_792_1586 257
480 3300046530 Ga0495654_0097015 Ga0495654_0097015_279_1082 257
481 3300046530 Ga0495654_0135946 Ga0495654_0135946_193_987 257
482 3300046530 Ga0495654_0162195 Ga0495654_0162195_135_938 257
483 3300046531 Ga0495665_0019437 Ga0495665_0019437_1375_2154 257
484 3300046531 Ga0495665_0059972 Ga0495665_0059972_24_803 257
485 3300046533 Ga0495640_0269226 Ga0495640_0269226_72_851 257
486 3300046535 Ga0495586_0005186 Ga0495586_0005186_2616_3461 257
487 3300046538 Ga0495609_0000016 Ga0495609_0000016_61657_62451 257
488 3300046538 Ga0495609_0000077 Ga0495609_0000077_82073_82867 257
489 3300046538 Ga0495609_0007870 Ga0495609_0007870_3215_4009 257
490 3300046538 Ga0495609_0011901 Ga0495609_0011901_1012_1806 257
491 3300046542 Ga0495597_0000012 Ga0495597_0000012_35538_36338 257
492 3300046542 Ga0495597_0000045 Ga0495597_0000045_33271_34065 257
493 3300046542 Ga0495597_0003219 Ga0495597_0003219_809_1603 257
494 3300046542 Ga0495597_0005930 Ga0495597_0005930_2416_3210 257
495 3300046542 Ga0495597_0020511 Ga0495597_0020511_1829_2623 257
496 3300046542 Ga0495597_0033032 Ga0495597_0033032_1431_2225 257
497 3300046542 Ga0495597_0079439 Ga0495597_0079439_403_1197 257
498 3300046543 Ga0495645_0013392 Ga0495645_0013392_62_907 257
499 3300046557 Ga0495622_0000086 Ga0495622_0000086_34660_35454 257
500 3300046557 Ga0495622_0000426 Ga0495622_0000426_2388_3182 257
501 3300046557 Ga0495622_0051354 Ga0495622_0051354_825_1619 257
502 3300046557 Ga0495622_0060661 Ga0495622_0060661_172_966 257
503 3300046558 Ga0495633_0000138 Ga0495633_0000138_24311_25105 257
504 3300046558 Ga0495633_0033303 Ga0495633_0033303_205_999 257
505 3300046615 Ga0495656_0021232 Ga0495656_0021232_1035_1829 257
506 3300046616 Ga0495668_0000379 Ga0495668_0000379_14819_15613 257
507 3300046616 Ga0495668_0007801 Ga0495668_0007801_2766_3560 257
508 3300046616 Ga0495668_0025866 Ga0495668_0025866_2497_3300 257
509 3300046616 Ga0495668_0028275 Ga0495668_0028275_908_1702 257
510 3300046642 Ga0495634_0001639 Ga0495634_0001639_6016_6861 257
511 3300046648 Ga0495611_0000019 Ga0495611_0000019_76022_76816 257
512 3300046648 Ga0495611_0001238 Ga0495611_0001238_8142_8936 257
513 3300046648 Ga0495611_0004213 Ga0495611_0004213_3813_4607 257
514 3300046648 Ga0495611_0010174 Ga0495611_0010174_116_919 257
515 3300046648 Ga0495611_0012029 Ga0495611_0012029_483_1277 257
516 3300046660 Ga0495625_0001630 Ga0495625_0001630_15118_15912 257
517 3300046660 Ga0495625_0002882 Ga0495625_0002882_2535_3329 257
518 3300046660 Ga0495625_0005115 Ga0495625_0005115_5984_6766 257
519 3300046660 Ga0495625_0005634 Ga0495625_0005634_2452_3246 257
520 3300046660 Ga0495625_0007998 Ga0495625_0007998_2291_3085 257
521 3300046660 Ga0495625_0017633 Ga0495625_0017633_3201_3995 257
522 3300046660 Ga0495625_0069795 Ga0495625_0069795_937_1731 257
523 3300046660 Ga0495625_0119353 Ga0495625_0119353_982_1785 257
524 3300046663 Ga0495635_0016603 Ga0495635_0016603_2012_2857 257
525 3300046665 Ga0495661_0000001 Ga0495661_0000001_803175_803978 257
526 3300046665 Ga0495661_0000010 Ga0495661_0000010_33003_33803 257
527 3300046665 Ga0495661_0001554 Ga0495661_0001554_16283_17083 257
528 3300046665 Ga0495661_0003328 Ga0495661_0003328_4199_4993 257
529 3300046665 Ga0495661_0006051 Ga0495661_0006051_6373_7167 257
530 3300046665 Ga0495661_0010260 Ga0495661_0010260_773_1567 257
531 3300046665 Ga0495661_0032443 Ga0495661_0032443_2149_2943 257
532 3300046665 Ga0495661_0038402 Ga0495661_0038402_1771_2565 257
533 3300046665 Ga0495661_0039929 Ga0495661_0039929_78_872 257
534 3300046674 Ga0495588_0002156 Ga0495588_0002156_2472_3266 257
535 3300046674 Ga0495588_0011333 Ga0495588_0011333_1324_2118 257
536 3300046679 Ga0495623_0000590 Ga0495623_0000590_19883_20677 257
537 3300046680 Ga0495646_0238453 Ga0495646_0238453_86_931 257
538 3300046681 Ga0495647_0003997 Ga0495647_0003997_2759_3604 257
539 3300046684 Ga0495669_0005004 Ga0495669_0005004_2671_3465 257
540 3300046689 Ga0495613_0030196 Ga0495613_0030196_1645_2529 257
541 3300046690 Ga0495624_0007173 Ga0495624_0007173_6210_7004 257
542 3300046690 Ga0495624_0021857 Ga0495624_0021857_2747_3592 257
543 3300046691 Ga0495670_0000311 Ga0495670_0000311_13747_14541 257
544 3300046691 Ga0495670_0001278 Ga0495670_0001278_9862_10656 257
545 3300046691 Ga0495670_0023098 Ga0495670_0023098_1245_2039 257
546 3300046692 Ga0495671_0000419 Ga0495671_0000419_23346_24137 257
547 3300046692 Ga0495671_0001653 Ga0495671_0001653_8714_9508 257
548 3300046692 Ga0495671_0005071 Ga0495671_0005071_3960_4754 257
549 3300046692 Ga0495671_0005698 Ga0495671_0005698_5941_6726 257
550 3300046692 Ga0495671_0017185 Ga0495671_0017185_1781_2581 257
551 3300046692 Ga0495671_0018909 Ga0495671_0018909_722_1519 257
552 3300046692 Ga0495671_0031681 Ga0495671_0031681_1785_2579 257
553 3300046692 Ga0495671_0037025 Ga0495671_0037025_1353_2147 257
554 3300046692 Ga0495671_0039845 Ga0495671_0039845_1014_1808 257
555 3300046692 Ga0495671_0061632 Ga0495671_0061632_232_1032 257
556 3300046692 Ga0495671_0123164 Ga0495671_0123164_423_1217 257
557 3300046694 Ga0495649_0000087 Ga0495649_0000087_74232_75017 257
558 3300046694 Ga0495649_0000663 Ga0495649_0000663_22585_23379 257
559 3300046694 Ga0495649_0000677 Ga0495649_0000677_18939_19733 257
560 3300046694 Ga0495649_0006059 Ga0495649_0006059_3332_4126 257
561 3300046694 Ga0495649_0012605 Ga0495649_0012605_917_1711 257
562 3300046694 Ga0495649_0012796 Ga0495649_0012796_2809_3603 257
563 3300046694 Ga0495649_0014712 Ga0495649_0014712_2661_3455 257
564 3300046694 Ga0495649_0021486 Ga0495649_0021486_1254_2048 257
565 3300046694 Ga0495649_0034187 Ga0495649_0034187_994_1788 257
566 3300046794 Ga0495589_0000406 Ga0495589_0000406_19637_20431 257
567 3300046794 Ga0495589_0000649 Ga0495589_0000649_16666_17460 257
568 3300046794 Ga0495589_0001844 Ga0495589_0001844_2575_3369 257
569 3300046794 Ga0495589_0003264 Ga0495589_0003264_800_1594 257
570 3300046794 Ga0495589_0003909 Ga0495589_0003909_5352_6146 257
571 3300046794 Ga0495589_0006298 Ga0495589_0006298_2451_3245 257
572 3300046794 Ga0495589_0021377 Ga0495589_0021377_420_1214 257
573 3300046794 Ga0495589_0077901 Ga0495589_0077901_602_1396 257
574 3300046794 Ga0495589_0087214 Ga0495589_0087214_502_1296 257
575 3300046809 Ga0495600_0131548 Ga0495600_0131548_52_897 257
576 3300046810 Ga0495660_0000258 Ga0495660_0000258_25320_26114 257
577 3300046810 Ga0495660_0000500 Ga0495660_0000500_6340_7134 257
578 3300046810 Ga0495660_0006189 Ga0495660_0006189_2776_3570 257
579 3300046810 Ga0495660_0006795 Ga0495660_0006795_5665_6459 257
580 3300046810 Ga0495660_0009870 Ga0495660_0009870_4250_5044 257
581 3300046810 Ga0495660_0013046 Ga0495660_0013046_718_1512 257
582 3300046810 Ga0495660_0047704 Ga0495660_0047704_1035_1829 257
583 3300046810 Ga0495660_0048807 Ga0495660_0048807_1507_2301 257
584 3300046810 Ga0495660_0053475 Ga0495660_0053475_728_1522 257
585 3300046810 Ga0495660_0087329 Ga0495660_0087329_69_863 257
586 3300047315 Ga0495581_0005956 Ga0495581_0005956_5271_6155 257
587 3300047317 Ga0495604_0000143 Ga0495604_0000143_10572_11366 257
588 3300047319 Ga0495674_0001761 Ga0495674_0001761_5980_6825 257
589 3300047320 Ga0495672_0000743 Ga0495672_0000743_7142_7927 257
590 3300047320 Ga0495672_0001129 Ga0495672_0001129_23618_24412 257
591 3300047320 Ga0495672_0001334 Ga0495672_0001334_7432_8226 257
592 3300047320 Ga0495672_0005219 Ga0495672_0005219_2107_2901 257
593 3300047320 Ga0495672_0005274 Ga0495672_0005274_6585_7382 257
594 3300047320 Ga0495672_0014101 Ga0495672_0014101_3078_3872 257
595 3300047320 Ga0495672_0033647 Ga0495672_0033647_1653_2447 257
596 3300047320 Ga0495672_0043109 Ga0495672_0043109_1481_2284 257
597 3300047320 Ga0495672_0133603 Ga0495672_0133603_285_1079 257
598 3300047321 Ga0495676_0033889 Ga0495676_0033889_1063_1947 257
599 3300047321 Ga0495676_0035212 Ga0495676_0035212_1215_2015 257
600 3300047322 Ga0495680_0094059 Ga0495680_0094059_116_895 257
601 3300047322 Ga0495680_0463770 Ga0495680_0463770_45_824 257
602 3300047323 Ga0495683_0000022 Ga0495683_0000022_101556_102350 257
603 3300047323 Ga0495683_0000062 Ga0495683_0000062_22711_23505 257
604 3300047323 Ga0495683_0000110 Ga0495683_0000110_25198_25998 257
605 3300047323 Ga0495683_0002570 Ga0495683_0002570_4619_5413 257
606 3300047323 Ga0495683_0005022 Ga0495683_0005022_2726_3520 257
607 3300047323 Ga0495683_0009227 Ga0495683_0009227_1001_1795 257
608 3300047323 Ga0495683_0011625 Ga0495683_0011625_2343_3137 257
609 3300047323 Ga0495683_0018099 Ga0495683_0018099_440_1234 257
610 3300047323 Ga0495683_0019463 Ga0495683_0019463_585_1379 257
611 3300047323 Ga0495683_0099619 Ga0495683_0099619_425_1219 257
612 3300047444 Ga0495675_0014794 Ga0495675_0014794_3705_4499 257
613 3300047445 Ga0495677_0038713 Ga0495677_0038713_778_1572 257
614 3300047446 Ga0495679_000042 Ga0495679_000042_134195_134989 257
615 3300047446 Ga0495679_000799 Ga0495679_000799_14320_15114 257
616 3300047446 Ga0495679_002335 Ga0495679_002335_4889_5683 257
617 3300047446 Ga0495679_004608 Ga0495679_004608_826_1620 257
618 3300047469 Ga0495673_0000192 Ga0495673_0000192_61948_62742 257
619 3300047469 Ga0495673_0000429 Ga0495673_0000429_5400_6194 257
620 3300047469 Ga0495673_0000769 Ga0495673_0000769_1954_2748 257
621 3300047469 Ga0495673_0000847 Ga0495673_0000847_21933_22733 257
622 3300047469 Ga0495673_0000998 Ga0495673_0000998_19969_20763 257
623 3300047469 Ga0495673_0001144 Ga0495673_0001144_10110_10904 257
624 3300047469 Ga0495673_0002309 Ga0495673_0002309_7343_8137 257
625 3300047469 Ga0495673_0002777 Ga0495673_0002777_6968_7762 257
626 3300047469 Ga0495673_0020288 Ga0495673_0020288_2171_2965 257
627 3300047469 Ga0495673_0025756 Ga0495673_0025756_827_1621 257
628 3300047470 Ga0495681_0000441 Ga0495681_0000441_2227_3021 257
629 3300047470 Ga0495681_0000802 Ga0495681_0000802_11425_12213 257
630 3300047470 Ga0495681_0001036 Ga0495681_0001036_14804_15607 257
631 3300047470 Ga0495681_0001322 Ga0495681_0001322_13534_14328 257
632 3300047470 Ga0495681_0001338 Ga0495681_0001338_15984_16778 257
633 3300047470 Ga0495681_0001427 Ga0495681_0001427_1088_1882 257
634 3300047470 Ga0495681_0001859 Ga0495681_0001859_12109_12903 257
635 3300047470 Ga0495681_0010314 Ga0495681_0010314_4603_5397 257
636 3300047470 Ga0495681_0015921 Ga0495681_0015921_1003_1794 257
637 3300047470 Ga0495681_0016012 Ga0495681_0016012_2735_3511 257
638 3300047470 Ga0495681_0021071 Ga0495681_0021071_2266_3060 257
639 3300047470 Ga0495681_0029952 Ga0495681_0029952_85_879 257
640 3300047470 Ga0495681_0038781 Ga0495681_0038781_283_1077 257
641 3300047471 Ga0495684_0012633 Ga0495684_0012633_1669_2448 257
642 3300047471 Ga0495684_0028216 Ga0495684_0028216_3081_3875 257
643 3300047471 Ga0495684_0118219 Ga0495684_0118219_798_1577 257
644 3300047472 Ga0495686_0000246 Ga0495686_0000246_13142_13936 257
645 3300047472 Ga0495686_0001403 Ga0495686_0001403_19540_20334 257
646 3300047472 Ga0495686_0011982 Ga0495686_0011982_1042_1836 257
647 3300047472 Ga0495686_0028125 Ga0495686_0028125_1036_1830 257
648 3300047472 Ga0495686_0044614 Ga0495686_0044614_1421_2221 257
649 3300047472 Ga0495686_0091729 Ga0495686_0091729_931_1725 257
650 3300047472 Ga0495686_0145512 Ga0495686_0145512_327_1121 257
651 3300047472 Ga0495686_0165259 Ga0495686_0165259_376_1167 257
652 3300047673 Ga0495593_0001134 Ga0495593_0001134_3080_3874 257
653 3300047673 Ga0495593_0003121 Ga0495593_0003121_6325_7209 257
654 3300048091 Ga0495626_0000002 Ga0495626_0000002_243733_244527 257
655 3300048091 Ga0495626_0000035 Ga0495626_0000035_130640_131416 257
656 3300048091 Ga0495626_0000112 Ga0495626_0000112_66714_67508 257
657 3300048091 Ga0495626_0000199 Ga0495626_0000199_24025_24819 257
658 3300048091 Ga0495626_0000243 Ga0495626_0000243_55784_56578 257
659 3300048091 Ga0495626_0001716 Ga0495626_0001716_2052_2846 257
660 3300048091 Ga0495626_0002727 Ga0495626_0002727_11074_11868 257
661 3300048091 Ga0495626_0003751 Ga0495626_0003751_2628_3422 257
662 3300048091 Ga0495626_0036865 Ga0495626_0036865_1128_1922 257
663 3300048091 Ga0495626_0085260 Ga0495626_0085260_371_1165 257
664 3300048903 Ga0496100_0004216 Ga0496100_0004216_3516_4295 257
665 3300048904 Ga0496101_0008482 Ga0496101_0008482_2780_3559 257
666 3300048905 Ga0496102_0015342 Ga0496102_0015342_3205_3984 257
667 3300048905 Ga0496102_0060844 Ga0496102_0060844_2634_3434 257
668 3300048907 Ga0496104_0001979 Ga0496104_0001979_5944_6723 257
669 3300048908 Ga0496105_0019780 Ga0496105_0019780_3443_4222 257
670 3300048909 Ga0496106_0001612 Ga0496106_0001612_15827_16606 257
671 3300048910 Ga0496107_0007347 Ga0496107_0007347_1640_2419 257
672 3300048911 Ga0496108_0005122 Ga0496108_0005122_8158_8937 257
673 3300048911 Ga0496108_0015651 Ga0496108_0015651_2511_3290 257
674 3300048912 Ga0496109_0009300 Ga0496109_0009300_6597_7376 257
675 3300048912 Ga0496109_0047425 Ga0496109_0047425_1249_2028 257
676 3300048912 Ga0496109_0356830 Ga0496109_0356830_276_1055 257
677 3300048913 Ga0496110_0000756 Ga0496110_0000756_8521_9300 257
678 3300048913 Ga0496110_0002693 Ga0496110_0002693_8224_9003 257
679 3300048913 Ga0496110_0135591 Ga0496110_0135591_1023_1817 257
680 3300048913 Ga0496110_0335528 Ga0496110_0335528_489_1262 257
681 3300048914 Ga0496111_0004067 Ga0496111_0004067_1411_2190 257
682 3300048914 Ga0496111_0037305 Ga0496111_0037305_347_1141 257
683 3300048914 Ga0496111_0041913 Ga0496111_0041913_206_985 257
684 3300048915 Ga0496112_0021703 Ga0496112_0021703_2980_3759 257
685 3300048915 Ga0496112_0025004 Ga0496112_0025004_79_858 257
686 3300048916 Ga0496113_0005557 Ga0496113_0005557_5874_6653 257
687 3300048918 Ga0496115_0434844 Ga0496115_0434844_81_860 257
688 3300048919 Ga0496116_0000151 Ga0496116_0000151_59805_60599 257
689 3300048921 Ga0496118_0087188 Ga0496118_0087188_1181_1963 257
690 3300048922 Ga0496119_0057738 Ga0496119_0057738_729_1523 257
691 3300048924 Ga0496121_0002334 Ga0496121_0002334_9182_9958 257
692 3300048924 Ga0496121_0003523 Ga0496121_0003523_8992_9792 257
693 3300048924 Ga0496121_0064379 Ga0496121_0064379_1010_1804 257
694 3300048925 Ga0496122_0092041 Ga0496122_0092041_633_1433 257
695 3300048927 Ga0496124_0000275 Ga0496124_0000275_68608_69384 257
696 3300048927 Ga0496124_0001487 Ga0496124_0001487_12555_13349 257
697 3300048927 Ga0496124_0002199 Ga0496124_0002199_5166_5951 257
698 3300048927 Ga0496124_0156735 Ga0496124_0156735_756_1538 257
699 3300048928 Ga0496125_0012616 Ga0496125_0012616_2814_3608 257
700 3300048928 Ga0496125_0019225 Ga0496125_0019225_996_1790 257
701 3300048929 Ga0496126_0179659 Ga0496126_0179659_460_1251 257
702 3300049459 Ga0495678_000109 Ga0495678_000109_22589_23383 257
703 3300049459 Ga0495678_000177 Ga0495678_000177_24630_25406 257
704 3300049459 Ga0495678_001282 Ga0495678_001282_9112_9912 257
705 3300049459 Ga0495678_001486 Ga0495678_001486_9931_10725 257
706 3300049459 Ga0495678_001509 Ga0495678_001509_2959_3762 257
707 3300049459 Ga0495678_001612 Ga0495678_001612_2464_3258 257
708 3300049459 Ga0495678_004047 Ga0495678_004047_2416_3210 257
709 3300049459 Ga0495678_004309 Ga0495678_004309_5952_6746 257
710 3300049459 Ga0495678_012852 Ga0495678_012852_2298_3092 257
711 3300049459 Ga0495678_017621 Ga0495678_017621_1336_2136 257
712 3300049459 Ga0495678_028650 Ga0495678_028650_997_1791 257
713 3300049459 Ga0495678_032193 Ga0495678_032193_69_863 257
714 3300049459 Ga0495678_065780 Ga0495678_065780_443_1237 257
715 3300049459 Ga0495678_078662 Ga0495678_078662_141_941 257
716 3300049459 Ga0495678_121747 Ga0495678_121747_37_831 257
717 3300049460 Ga0495682_0000075 Ga0495682_0000075_16514_17299 257
718 3300049460 Ga0495682_0000223 Ga0495682_0000223_18906_19700 257
719 3300049568 Ga0501031_0167646 Ga0501031_0167646_175_960 257
720 3300049570 Ga0501033_0019821 Ga0501033_0019821_1784_2563 257
721 3300049571 Ga0501034_0000055 Ga0501034_0000055_160423_161205 257
722 3300049571 Ga0501034_0010898 Ga0501034_0010898_5895_6683 257
723 3300049571 Ga0501034_0040170 Ga0501034_0040170_2561_3340 257
724 3300049571 Ga0501034_0091279 Ga0501034_0091279_853_1632 257
725 3300049571 Ga0501034_0105037 Ga0501034_0105037_1435_2211 257
726 3300049571 Ga0501034_0290922 Ga0501034_0290922_75_1004 257
727 3300049571 Ga0501034_0343487 Ga0501034_0343487_263_1042 257
728 3300049574 Ga0501038_0031707 Ga0501038_0031707_164_1066 257
729 3300049579 Ga0501043_0011219 Ga0501043_0011219_4790_5698 257
730 3300049581 Ga0501047_0039677 Ga0501047_0039677_349_1128 257
731 3300049581 Ga0501047_0047185 Ga0501047_0047185_2992_3768 257
732 3300049581 Ga0501047_0638322 Ga0501047_0638322_34_813 257
733 3300049584 Ga0501068_0144056 Ga0501068_0144056_171_1073 257
734 3300049586 Ga0501070_0232314 Ga0501070_0232314_19_795 257
735 3300049586 Ga0501070_0311299 Ga0501070_0311299_158_937 257
736 3300049742 Ga0501080_0101710 Ga0501080_0101710_1596_2372 257
737 3300049823 Ga0501044_0002282 Ga0501044_0002282_1637_2539 257
738 3300049823 Ga0501044_0202574 Ga0501044_0202574_614_1393 257
739 3300049823 Ga0501044_0207726 Ga0501044_0207726_407_1183 257
740 3300049823 Ga0501044_0487679 Ga0501044_0487679_206_994 257
741 3300050489 nmdc:mga03683_18499_c1 nmdc:mga03683_18499_c1_264_1040 257
742 3300050490 nmdc:mga03n38_12711_c1 nmdc:mga03n38_12711_c1_2074_2850 257
743 3300050491 nmdc:mga00v17_294699_c1 nmdc:mga00v17_294699_c1_240_1034 257
744 3300050492 nmdc:mga0yw44_15259_c1 nmdc:mga0yw44_15259_c1_1368_2144 257
745 3300050492 nmdc:mga0yw44_160633_c1 nmdc:mga0yw44_160633_c1_511_1287 257
746 3300050492 nmdc:mga0yw44_266902_c1 nmdc:mga0yw44_266902_c1_159_935 257
747 3300050494 nmdc:mga06z11_1828_c1 nmdc:mga06z11_1828_c1_3582_4358 257
748 3300050494 nmdc:mga06z11_88117_c1 nmdc:mga06z11_88117_c1_738_1514 257
749 3300050495 nmdc:mga04h51_9211_c1 nmdc:mga04h51_9211_c1_421_1197 257
750 3300050507 nmdc:mga05p37_34840_c1 nmdc:mga05p37_34840_c1_3269_4048 257
751 3300050507 nmdc:mga05p37_455865_c1 nmdc:mga05p37_455865_c1_10_789 257
752 3300050512 nmdc:mga0n895_56907_c1 nmdc:mga0n895_56907_c1_1017_1799 257
753 3300050512 nmdc:mga0n895_63771_c1 nmdc:mga0n895_63771_c1_533_1312 257
754 3300050512 nmdc:mga0n895_748420_c1 nmdc:mga0n895_748420_c1_115_894 257
755 3300050512 nmdc:mga0n895_92055_c1 nmdc:mga0n895_92055_c1_720_1499 257
756 3300050513 nmdc:mga0rr50_321760_c1 nmdc:mga0rr50_321760_c1_364_1143 257
757 3300050514 nmdc:mga08x19_276637_c1 nmdc:mga08x19_276637_c1_133_927 257
758 3300050516 nmdc:mga0sz30_1116_c1 nmdc:mga0sz30_1116_c1_4494_5270 257
759 3300053077 Ga0495601_0000751 Ga0495601_0000751_13742_14587 257
760 3300053078 Ga0495612_0000428 Ga0495612_0000428_4985_5830 257
761 3300053078 Ga0495612_0027682 Ga0495612_0027682_665_1444 257
762 3300053084 Ga0495595_0023021 Ga0495595_0023021_358_1137 257
763 3300053085 Ga0495619_0021248 Ga0495619_0021248_2082_2927 257
764 3300053085 Ga0495619_0068771 Ga0495619_0068771_1434_2213 257
765 3300053085 Ga0495619_0192800 Ga0495619_0192800_194_973 257
766 3300053087 Ga0500643_003954 Ga0500643_003954_52_834 257
767 3300053088 Ga0500644_0051354 Ga0500644_0051354_378_1157 257
768 3300053093 Ga0500651_0035136 Ga0500651_0035136_1288_2064 257
769 3300053096 Ga0500641_0008610 Ga0500641_0008610_174_950 257
770 3300053111 Ga0500572_000005 Ga0500572_000005_49515_50309 257
771 3300053147 Ga0500589_055234 Ga0500589_055234_276_1070 257
772 3300053153 Ga0500616_0001240 Ga0500616_0001240_13861_14637 257
773 3300053153 Ga0500616_0070071 Ga0500616_0070071_27_815 257
774 3300053158 Ga0500627_0000217 Ga0500627_0000217_9851_10633 257
775 3300053728 Ga0500657_136543 Ga0500657_136543_136_915 257
776 3300053733 Ga0500552_001519 Ga0500552_001519_579_1355 257
777 iso_pu_bacteria 2511231008 2511280665 257
778 iso_pu_bacteria 2511231023 2511366771 257
779 iso_pu_bacteria 2511231031 2511411699 257
780 iso_pu_bacteria 2738543020 2739289985 257
781 iso_pu_bacteria 2738543021 2739295297 257
782 iso_pu_bacteria 2738543025 2739311775 257
783 iso_pu_bacteria 2842832357 2842834726 257
784 iso_pu_bacteria 2969304461 2969307569 257
785 iso_pu_bacteria 8056177738 8056182529 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04199

Cyclase

Putative cyclase

58

238

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3krv-assembly1.cif.gz_B the structure of potential metal-dependent hydrolase with cyclase activity 0.8571 4 256
4cog-assembly2.cif.gz_D crystal structure of kynurenine formamidase from burkholderia cenocepacia 0.8426 4 256
3krv-assembly1.cif.gz_B the structure of potential metal-dependent hydrolase with cyclase activity 0.8381 4 256
4cog-assembly2.cif.gz_D crystal structure of kynurenine formamidase from burkholderia cenocepacia 0.8351 4 256
4cob-assembly1.cif.gz_B crystal structure kynurenine formamidase from pseudomonas aeruginosa 0.8252 4 256
ID Description Score Start End Superfamily
3krvB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.8571 4 256 3.50.30.50
3krvB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.8381 4 256 3.50.30.50
4cobB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.8252 4 256 3.50.30.50
4cobB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.8178 4 256 3.50.30.50
4co9B00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.8064 3 256 3.50.30.50
ID Description Score Start End GO Terms
AF-A0A259IV91-F1-model_v4 Cyclase 0.9998 105 256 GO:0004061
GO:0019441
AF-A0A839EXM6-F1-model_v4 Kynurenine formamidase 0.9996 63 256 GO:0004061
GO:0019441
AF-A0A208XYD4-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9964 4 256 GO:0004061
GO:0005886
GO:0019441
GO:0055085
AF-K0EU77-F1-model_v4 Cyclase 0.996 4 256 GO:0004061
GO:0019441
AF-A0A537TPW9-F1-model_v4 Cyclase family protein 0.9951 79 256 GO:0004061
GO:0019441

Feature Viewer

pLDDT pTM Quality
95.69 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map