F480786

General Info

Members Datasets Scaffolds Average Seq Length
786 345 772 155

Family's Representative Sequence

Representative Sequence 3300025933|Ga0207706_10197484|Ga0207706_101974841
Length 184
Sequence MLRLKILASVVPLAVAALFARGEFLVGQRPCIEIAGRSVQIATLSWQAHRHVSFTSDPGRATVRVQISDSADAADFTVIDDVDTAESGACESNSPPALVAISGKPGEGDPVIYLTRDGPADYRIFVSSKSFSVRDAAALIVGARGQHHRVEAASLSILEHGLRANAFRVCREGKPASTFPGHAG

Samples

Sample ID Description Type Environment
1 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
2 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
3 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
4 2791355199
5 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
6 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
7 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
8 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
9 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
10 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
188 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
199 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
200 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
204 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
205 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
206 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
207 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
208 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
209 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
210 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
211 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
212 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
213 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
214 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
215 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
216 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
217 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
218 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
221 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
226 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
227 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
228 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
229 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
230 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
231 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
232 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
233 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
234 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
235 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
236 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
237 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
238 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
239 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
240 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
241 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
242 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
243 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
244 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
245 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
246 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
247 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
248 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
249 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
250 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
251 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
252 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
253 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
254 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
255 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
256 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
259 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
260 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
261 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
262 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
266 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
267 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
268 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
269 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
270 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
271 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
272 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
288 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
289 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
290 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
291 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
292 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
293 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
294 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
295 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
296 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
297 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
298 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
299 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
300 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
301 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
302 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
303 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
304 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
305 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
306 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
307 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
308 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
309 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
310 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
311 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
312 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
313 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
314 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
315 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
316 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
317 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
318 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
319 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
320 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
321 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
322 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
323 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
324 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
325 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
326 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
327 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
328 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
329 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
330 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
331 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
332 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
333 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
334 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
335 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
336 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
337 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
338 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
339 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
340 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
341 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
342 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
343 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
344 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
345 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.34
Metatranscriptomes 0
Isolates 1.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.09
Nodule 1.27
Rhizoplane 7.51
Rhizosphere 73.41
Stem 0
Stem Tuber 0
Unclassified 5.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10104916 3300003320 Bacteria 2516
2 rootL2_10144200 3300003322 Bacteria 1811
3 JGI25404J52841_10021953 3300003659 Bacteria 1381
4 Ga0070658_10495004 3300005327 Bacteria 1055
5 Ga0070676_10155196 3300005328 Bacteria 1469
6 Ga0070676_11003131 3300005328 Bacteria 627
7 Ga0070683_100386523 3300005329 Bacteria 1334
8 Ga0070690_100056075 3300005330 Bacteria 2525
9 Ga0070690_100319261 3300005330 Bacteria 1119
10 Ga0070690_100697566 3300005330 Bacteria 779
11 Ga0070670_100101019 3300005331 Bacteria 2483
12 Ga0068869_100050231 3300005334 Bacteria 3022
13 Ga0068869_100058856 3300005334 Bacteria 2811
14 Ga0070666_10093735 3300005335 Bacteria 2065
15 Ga0070666_10267595 3300005335 Bacteria 1213
16 Ga0070666_10913934 3300005335 Bacteria 649
17 Ga0070680_101447424 3300005336 Bacteria 595
18 Ga0070682_100162240 3300005337 Bacteria 1545
19 Ga0068868_100052909 3300005338 Bacteria 3197
20 Ga0068868_100260799 3300005338 Bacteria 1461
21 Ga0068868_100341923 3300005338 Bacteria 1280
22 Ga0068868_100483960 3300005338 Bacteria 1082
23 Ga0068868_101067994 3300005338 Bacteria 741
24 Ga0070660_100603394 3300005339 Bacteria 918
25 Ga0070689_100417446 3300005340 Bacteria 1137
26 Ga0070689_100870624 3300005340 Bacteria 796
27 Ga0070687_100353829 3300005343 Bacteria 949
28 Ga0070687_100579408 3300005343 Bacteria 768
29 Ga0070661_100171457 3300005344 Bacteria 1648
30 Ga0070661_100210671 3300005344 Bacteria 1487
31 Ga0070661_100283003 3300005344 Bacteria 1287
32 Ga0070661_100363693 3300005344 Bacteria 1137
33 Ga0070661_100466839 3300005344 Bacteria 1006
34 Ga0070668_100062410 3300005347 Bacteria 2887
35 Ga0070668_100066909 3300005347 Bacteria 2789
36 Ga0070668_100175674 3300005347 Bacteria 1746
37 Ga0070668_100182406 3300005347 Bacteria 1715
38 Ga0070668_100836420 3300005347 Bacteria 820
39 Ga0070669_100252431 3300005353 Bacteria 1405
40 Ga0070669_100277603 3300005353 Bacteria 1342
41 Ga0070675_100395138 3300005354 Bacteria 1233
42 Ga0070675_100595130 3300005354 Bacteria 1003
43 Ga0070675_100634740 3300005354 Bacteria 970
44 Ga0070675_101528615 3300005354 Bacteria 616
45 Ga0070671_100115922 3300005355 Bacteria 2252
46 Ga0070671_100534927 3300005355 Bacteria 1010
47 Ga0070674_100167286 3300005356 Bacteria 1673
48 Ga0070674_100316513 3300005356 Bacteria 1250
49 Ga0070674_100446419 3300005356 Bacteria 1067
50 Ga0070674_100723884 3300005356 Bacteria 853
51 Ga0070673_100289473 3300005364 Bacteria 1439
52 Ga0070673_100359545 3300005364 Bacteria 1294
53 Ga0070659_100148359 3300005366 Bacteria 1912
54 Ga0070659_100429066 3300005366 Bacteria 1119
55 Ga0070659_101395384 3300005366 Bacteria 623
56 Ga0070667_100060591 3300005367 Bacteria 3202
57 Ga0070667_101251627 3300005367 Bacteria 695
58 Ga0070667_101459083 3300005367 Bacteria 642
59 Ga0070710_10086088 3300005437 Bacteria 1845
60 Ga0070710_10662303 3300005437 Bacteria 733
61 Ga0070701_10369462 3300005438 Bacteria 901
62 Ga0070711_100023422 3300005439 Bacteria 4015
63 Ga0070700_100149576 3300005441 Bacteria 1595
64 Ga0070700_100150235 3300005441 Bacteria 1592
65 Ga0070700_100552038 3300005441 Bacteria 895
66 Ga0070663_100012307 3300005455 Bacteria 5407
67 Ga0070663_100073868 3300005455 Bacteria 2488
68 Ga0070663_100078350 3300005455 Bacteria 2422
69 Ga0070663_100235132 3300005455 Bacteria 1444
70 Ga0070678_100031128 3300005456 Bacteria 3676
71 Ga0070678_100093597 3300005456 Bacteria 2311
72 Ga0070678_100103337 3300005456 Bacteria 2213
73 Ga0070678_101579375 3300005456 Bacteria 616
74 Ga0070662_100222143 3300005457 Bacteria 1508
75 Ga0070662_100390710 3300005457 Bacteria 1147
76 Ga0070706_100316926 3300005467 Bacteria 1455
77 Ga0070684_101944343 3300005535 Bacteria 555
78 Ga0068853_100170181 3300005539 Bacteria 1971
79 Ga0068853_100225066 3300005539 Bacteria 1714
80 Ga0070672_100270710 3300005543 Bacteria 1434
81 Ga0070672_100670420 3300005543 Bacteria 907
82 Ga0070672_100827451 3300005543 Bacteria 815
83 Ga0070686_100020047 3300005544 Bacteria 3953
84 Ga0070695_100732684 3300005545 Bacteria 787
85 Ga0070696_100058612 3300005546 Bacteria 2689
86 Ga0070665_100004203 3300005548 Bacteria 15155
87 Ga0070665_100009471 3300005548 Bacteria 9855
88 Ga0070665_100077521 3300005548 Bacteria 3330
89 Ga0070665_100112322 3300005548 Bacteria 2727
90 Ga0070665_100124827 3300005548 Bacteria 2576
91 Ga0070665_100151199 3300005548 Bacteria 2324
92 Ga0070665_100184209 3300005548 Bacteria 2089
93 Ga0070665_100227808 3300005548 Bacteria 1864
94 Ga0070665_100305738 3300005548 Bacteria 1593
95 Ga0070665_100577963 3300005548 Bacteria 1136
96 Ga0070665_101698096 3300005548 Bacteria 639
97 Ga0068855_100102902 3300005563 Bacteria 3287
98 Ga0068855_100699865 3300005563 Bacteria 1084
99 Ga0068855_101015023 3300005563 Bacteria 871
100 Ga0070664_100057841 3300005564 Bacteria 3297
101 Ga0070664_100819432 3300005564 Bacteria 871
102 Ga0070664_100929488 3300005564 Bacteria 816
103 Ga0070664_101620012 3300005564 Bacteria 613
104 Ga0068857_100431555 3300005577 Bacteria 1230
105 Ga0068856_100043240 3300005614 Bacteria 4433
106 Ga0068856_100412336 3300005614 Bacteria 1371
107 Ga0068856_100629511 3300005614 Bacteria 1093
108 Ga0068856_101095015 3300005614 Bacteria 814
109 Ga0068852_100189509 3300005616 Bacteria 1939
110 Ga0068852_100278437 3300005616 Bacteria 1612
111 Ga0068852_100906621 3300005616 Bacteria 899
112 Ga0068852_101108698 3300005616 Bacteria 812
113 Ga0068859_100066012 3300005617 Bacteria 3653
114 Ga0068859_100172003 3300005617 Bacteria 2247
115 Ga0068859_100609553 3300005617 Bacteria 1184
116 Ga0068864_100028662 3300005618 Bacteria 4709
117 Ga0068864_100059050 3300005618 Bacteria 3317
118 Ga0068864_101977029 3300005618 Bacteria 589
119 Ga0068866_10067059 3300005718 Bacteria 1883
120 Ga0068866_10072159 3300005718 Bacteria 1828
121 Ga0068866_10077238 3300005718 Bacteria 1778
122 Ga0068866_10146133 3300005718 Bacteria 1363
123 Ga0068861_100082824 3300005719 Bacteria 2515
124 Ga0068861_100090685 3300005719 Bacteria 2412
125 Ga0068861_100250660 3300005719 Bacteria 1510
126 Ga0068861_100337141 3300005719 Bacteria 1318
127 Ga0068861_100423535 3300005719 Bacteria 1187
128 Ga0068851_10204645 3300005834 Bacteria 1103
129 Ga0068851_10461885 3300005834 Bacteria 756
130 Ga0068851_10848868 3300005834 Bacteria 570
131 Ga0068870_10083541 3300005840 Bacteria 1770
132 Ga0068870_10261051 3300005840 Bacteria 1078
133 Ga0068870_10340807 3300005840 Bacteria 959
134 Ga0068870_10735087 3300005840 Bacteria 684
135 Ga0068863_100105012 3300005841 Bacteria 2687
136 Ga0068863_100391160 3300005841 Bacteria 1359
137 Ga0068863_100732803 3300005841 Bacteria 984
138 Ga0068858_100049881 3300005842 Bacteria 3875
139 Ga0068858_100192587 3300005842 Bacteria 1927
140 Ga0068858_100201825 3300005842 Bacteria 1881
141 Ga0068858_100581291 3300005842 Bacteria 1086
142 Ga0068858_101319456 3300005842 Unclassified 710
143 Ga0068860_100058803 3300005843 Bacteria 3655
144 Ga0068860_100108629 3300005843 Bacteria 2651
145 Ga0068860_100359890 3300005843 Bacteria 1433
146 Ga0068860_100378241 3300005843 Bacteria 1397
147 Ga0068862_100177803 3300005844 Bacteria 1908
148 Ga0068862_100214213 3300005844 Bacteria 1741
149 Ga0068862_100279144 3300005844 Bacteria 1530
150 Ga0068862_100314700 3300005844 Bacteria 1443
151 Ga0068862_100642660 3300005844 Bacteria 1023
152 Ga0068862_100676855 3300005844 Bacteria 997
153 Ga0081455_10007513 3300005937 Bacteria 11465
154 Ga0081455_10080276 3300005937 Bacteria 2675
155 Ga0081540_1002549 3300005983 Bacteria 14782
156 Ga0081540_1003522 3300005983 Bacteria 12352
157 Ga0081540_1009485 3300005983 Bacteria 6704
158 Ga0081540_1029221 3300005983 Bacteria 3076
159 Ga0081540_1034399 3300005983 Bacteria 2734
160 Ga0081540_1035227 3300005983 Bacteria 2687
161 Ga0081540_1037441 3300005983 Bacteria 2572
162 Ga0081540_1058840 3300005983 Bacteria 1848
163 Ga0081540_1065600 3300005983 Bacteria 1706
164 Ga0081540_1070927 3300005983 Bacteria 1612
165 Ga0081539_10002259 3300005985 Bacteria 28018
166 Ga0081539_10040454 3300005985 Bacteria 2736
167 Ga0075365_10050170 3300006038 Bacteria 2753
168 Ga0075365_10063990 3300006038 Bacteria 2463
169 Ga0075365_10071281 3300006038 Bacteria 2339
170 Ga0075365_10148595 3300006038 Bacteria 1629
171 Ga0075365_10358692 3300006038 Bacteria 1028
172 Ga0075365_10362240 3300006038 Bacteria 1022
173 Ga0075368_10031546 3300006042 Bacteria 2055
174 Ga0075368_10148456 3300006042 Bacteria 979
175 Ga0075363_100009597 3300006048 Bacteria 4555
176 Ga0075363_100170012 3300006048 Bacteria 1237
177 Ga0075363_100219133 3300006048 Bacteria 1090
178 Ga0075363_100256158 3300006048 Bacteria 1008
179 Ga0075364_10121037 3300006051 Bacteria 1752
180 Ga0075364_10205693 3300006051 Bacteria 1335
181 Ga0070716_100441956 3300006173 Bacteria 946
182 Ga0070712_100168632 3300006175 Bacteria 1697
183 Ga0075362_10036045 3300006177 Bacteria 2162
184 Ga0075367_10003520 3300006178 Bacteria 7484
185 Ga0075367_10029963 3300006178 Bacteria 3116
186 Ga0075367_10130645 3300006178 Bacteria 1552
187 Ga0075367_10150157 3300006178 Bacteria 1446
188 Ga0075367_10541823 3300006178 Bacteria 739
189 Ga0075369_10029004 3300006186 Bacteria 2322
190 Ga0075369_10150151 3300006186 Bacteria 1065
191 Ga0075366_10057761 3300006195 Bacteria 2305
192 Ga0075366_10155797 3300006195 Bacteria 1383
193 Ga0075366_10341244 3300006195 Bacteria 919
194 Ga0097621_102263669 3300006237 Bacteria 520
195 Ga0075370_10018348 3300006353 Bacteria 3797
196 Ga0075370_10034805 3300006353 Bacteria 2824
197 Ga0075370_10052957 3300006353 Bacteria 2303
198 Ga0075370_10104761 3300006353 Bacteria 1639
199 Ga0068871_100012150 3300006358 Bacteria 6338
200 Ga0068871_100457600 3300006358 Bacteria 1145
201 Ga0068871_101477952 3300006358 Bacteria 642
202 Ga0075428_101350500 3300006844 Bacteria 749
203 Ga0075428_101397160 3300006844 Bacteria 735
204 Ga0075430_100300783 3300006846 Bacteria 1327
205 Ga0075431_101010994 3300006847 Bacteria 798
206 Ga0075433_10826858 3300006852 Bacteria 809
207 Ga0075434_100249710 3300006871 Bacteria 1793
208 Ga0068865_100105024 3300006881 Bacteria 2074
209 Ga0068865_100210589 3300006881 Bacteria 1514
210 Ga0068865_100400911 3300006881 Bacteria 1123
211 Ga0068865_100513870 3300006881 Bacteria 1001
212 Ga0068865_100521519 3300006881 Bacteria 994
213 Ga0075436_101181741 3300006914 Bacteria 577
214 Ga0097620_100066005 3300006931 Bacteria 3653
215 Ga0097620_100171999 3300006931 Bacteria 2247
216 Ga0097620_100609529 3300006931 Bacteria 1184
217 Ga0075435_100102763 3300007076 Bacteria 2369
218 Ga0099794_10182284 3300007265 Bacteria 1072
219 Ga0099795_10030957 3300007788 Bacteria 1840
220 Ga0105250_10010709 3300009092 Bacteria 3817
221 Ga0105240_10232630 3300009093 Bacteria 2141
222 Ga0105240_10289820 3300009093 Bacteria 1877
223 Ga0105240_10732734 3300009093 Bacteria 1076
224 Ga0111539_10632735 3300009094 Bacteria 1246
225 Ga0111539_10687070 3300009094 Bacteria 1191
226 Ga0105245_10154221 3300009098 Bacteria 2174
227 Ga0105245_10660941 3300009098 Bacteria 1076
228 Ga0105245_11037840 3300009098 Bacteria 865
229 Ga0105245_11737719 3300009098 Bacteria 676
230 Ga0105245_11809873 3300009098 Bacteria 663
231 Ga0105247_10056856 3300009101 Bacteria 2417
232 Ga0105247_10094995 3300009101 Bacteria 1898
233 Ga0105247_10218005 3300009101 Bacteria 1290
234 Ga0105247_10224527 3300009101 Bacteria 1273
235 Ga0114129_10340226 3300009147 Bacteria 1990
236 Ga0114129_10520407 3300009147 Bacteria 1551
237 Ga0105243_10191923 3300009148 Bacteria 1785
238 Ga0105243_10274048 3300009148 Bacteria 1516
239 Ga0105243_10500350 3300009148 Bacteria 1151
240 Ga0105241_10031978 3300009174 Bacteria 3941
241 Ga0105241_10583277 3300009174 Bacteria 1008
242 Ga0105241_10608832 3300009174 Bacteria 988
243 Ga0105242_10820502 3300009176 Bacteria 922
244 Ga0105248_10056455 3300009177 Bacteria 4405
245 Ga0105248_10284047 3300009177 Bacteria 1863
246 Ga0105248_10555013 3300009177 Bacteria 1296
247 Ga0105248_10989167 3300009177 Bacteria 950
248 Ga0105237_10277008 3300009545 Bacteria 1680
249 Ga0105237_10321090 3300009545 Bacteria 1552
250 Ga0105237_10349091 3300009545 Bacteria 1484
251 Ga0105237_10388607 3300009545 Bacteria 1400
252 Ga0105237_11533107 3300009545 Bacteria 673
253 Ga0105238_10056480 3300009551 Bacteria 3938
254 Ga0105238_10515559 3300009551 Bacteria 1198
255 Ga0105238_10910579 3300009551 Bacteria 898
256 Ga0105238_11003259 3300009551 Bacteria 856
257 Ga0105249_10235264 3300009553 Bacteria 1808
258 Ga0105249_11527778 3300009553 Bacteria 740
259 Ga0105239_10110518 3300010375 Bacteria 3047
260 Ga0105239_10123043 3300010375 Bacteria 2883
261 Ga0105239_10273304 3300010375 Bacteria 1901
262 Ga0105239_10306637 3300010375 Bacteria 1789
263 Ga0105239_10605370 3300010375 Bacteria 1250
264 Ga0105239_10919938 3300010375 Bacteria 1004
265 Ga0105246_10050528 3300011119 Bacteria 2852
266 Ga0105246_10081082 3300011119 Bacteria 2311
267 Ga0105246_10231528 3300011119 Bacteria 1455
268 Ga0105246_10480243 3300011119 Bacteria 1051
269 Ga0105246_10512460 3300011119 Bacteria 1021
270 Ga0105246_10586606 3300011119 Bacteria 961
271 Ga0157371_10757451 3300013102 Bacteria 729
272 Ga0157374_10018731 3300013296 Bacteria 6116
273 Ga0157374_10051454 3300013296 Bacteria 3833
274 Ga0157374_10433261 3300013296 Bacteria 1315
275 Ga0157378_10266102 3300013297 Bacteria 1647
276 Ga0157378_10271398 3300013297 Bacteria 1631
277 Ga0157378_11112613 3300013297 Bacteria 827
278 Ga0157378_11596446 3300013297 Bacteria 698
279 Ga0163162_10117403 3300013306 Bacteria 2762
280 Ga0163162_10219593 3300013306 Bacteria 2031
281 Ga0163162_10322849 3300013306 Bacteria 1676
282 Ga0163162_10544588 3300013306 Bacteria 1289
283 Ga0157372_12243697 3300013307 Bacteria 627
284 Ga0157372_12626389 3300013307 Bacteria 578
285 Ga0157375_10231676 3300013308 Bacteria 2006
286 Ga0157375_10472529 3300013308 Bacteria 1419
287 Ga0157375_10499816 3300013308 Bacteria 1380
288 Ga0157375_11103194 3300013308 Bacteria 929
289 Ga0157375_11385422 3300013308 Bacteria 828
290 Ga0163163_10382437 3300014325 Bacteria 1465
291 Ga0163163_10390701 3300014325 Bacteria 1449
292 Ga0163163_10412706 3300014325 Bacteria 1409
293 Ga0163163_10554950 3300014325 Bacteria 1211
294 Ga0163163_10786188 3300014325 Bacteria 1015
295 Ga0163163_11229493 3300014325 Bacteria 812
296 Ga0157380_10346838 3300014326 Bacteria 1387
297 Ga0157380_10535167 3300014326 Bacteria 1146
298 Ga0157380_10549582 3300014326 Bacteria 1132
299 Ga0157380_10592666 3300014326 Bacteria 1095
300 Ga0157380_10648775 3300014326 Bacteria 1052
301 Ga0157380_11161973 3300014326 Bacteria 814
302 Ga0157377_10067494 3300014745 Bacteria 2059
303 Ga0157377_10197473 3300014745 Bacteria 1275
304 Ga0157377_10368717 3300014745 Bacteria 969
305 Ga0157379_10121241 3300014968 Bacteria 2352
306 Ga0157379_10183366 3300014968 Bacteria 1891
307 Ga0157379_10548665 3300014968 Bacteria 1075
308 Ga0157379_10869370 3300014968 Bacteria 854
309 Ga0157379_11518385 3300014968 Bacteria 652
310 Ga0157379_11808138 3300014968 Bacteria 600
311 Ga0157376_10209764 3300014969 Bacteria 1798
312 Ga0157376_10282923 3300014969 Bacteria 1563
313 Ga0157376_10531823 3300014969 Bacteria 1160
314 Ga0157376_11237757 3300014969 Bacteria 775
315 Ga0163161_10171195 3300017792 Bacteria 1661
316 Ga0163161_10652617 3300017792 Bacteria 872
317 Ga0209758_1006620 3300025297 Bacteria 8210
318 Ga0209758_1023273 3300025297 Bacteria 2808
319 Ga0207697_10062544 3300025315 Bacteria 1550
320 Ga0207696_1058404 3300025711 Bacteria 1089
321 Ga0207692_10040762 3300025898 Bacteria 2294
322 Ga0207642_10093257 3300025899 Bacteria 1493
323 Ga0207642_10112362 3300025899 Bacteria 1390
324 Ga0207642_10162989 3300025899 Bacteria 1199
325 Ga0207642_10191577 3300025899 Bacteria 1122
326 Ga0207642_10457645 3300025899 Bacteria 774
327 Ga0207710_10456559 3300025900 Bacteria 660
328 Ga0207688_10053044 3300025901 Bacteria 2273
329 Ga0207688_10509250 3300025901 Bacteria 754
330 Ga0207680_10065184 3300025903 Bacteria 2235
331 Ga0207680_10148456 3300025903 Bacteria 1561
332 Ga0207647_10117577 3300025904 Bacteria 1569
333 Ga0207645_10050155 3300025907 Bacteria 2665
334 Ga0207645_10195363 3300025907 Bacteria 1330
335 Ga0207643_10027031 3300025908 Bacteria 3180
336 Ga0207643_10093287 3300025908 Bacteria 1757
337 Ga0207643_10185199 3300025908 Bacteria 1262
338 Ga0207643_10591296 3300025908 Bacteria 714
339 Ga0207705_10949218 3300025909 Bacteria 665
340 Ga0207654_10043586 3300025911 Bacteria 2544
341 Ga0207695_10208430 3300025913 Bacteria 1866
342 Ga0207671_10183049 3300025914 Bacteria 1631
343 Ga0207671_10299962 3300025914 Bacteria 1269
344 Ga0207671_10393774 3300025914 Bacteria 1101
345 Ga0207693_10392760 3300025915 Bacteria 1085
346 Ga0207663_10029308 3300025916 Bacteria 3231
347 Ga0207662_10124258 3300025918 Bacteria 1621
348 Ga0207657_10243596 3300025919 Bacteria 1435
349 Ga0207657_10832443 3300025919 Bacteria 713
350 Ga0207649_10091707 3300025920 Bacteria 1991
351 Ga0207649_10206911 3300025920 Bacteria 1390
352 Ga0207649_10279398 3300025920 Bacteria 1213
353 Ga0207649_10329072 3300025920 Bacteria 1125
354 Ga0207652_10044564 3300025921 Bacteria 3779
355 Ga0207681_10077879 3300025923 Bacteria 2332
356 Ga0207681_10123131 3300025923 Bacteria 1905
357 Ga0207694_10708790 3300025924 Bacteria 849
358 Ga0207694_10867886 3300025924 Bacteria 763
359 Ga0207650_10693470 3300025925 Bacteria 860
360 Ga0207659_10148531 3300025926 Bacteria 1828
361 Ga0207659_11305647 3300025926 Bacteria 623
362 Ga0207687_10112630 3300025927 Bacteria 2022
363 Ga0207687_10157950 3300025927 Bacteria 1737
364 Ga0207687_10551840 3300025927 Bacteria 967
365 Ga0207644_10061288 3300025931 Bacteria 2724
366 Ga0207644_10373537 3300025931 Bacteria 1162
367 Ga0207644_10763078 3300025931 Bacteria 808
368 Ga0207690_10070494 3300025932 Bacteria 2408
369 Ga0207690_10841313 3300025932 Bacteria 759
370 Ga0207706_10169596 3300025933 Bacteria 1918
371 Ga0207706_10197484 3300025933 Bacteria 1764
372 Ga0207706_10326947 3300025933 Bacteria 1334
373 Ga0207706_10381971 3300025933 Bacteria 1222
374 Ga0207706_10997141 3300025933 Bacteria 704
375 Ga0207706_11016156 3300025933 Bacteria 696
376 Ga0207686_10625219 3300025934 Bacteria 850
377 Ga0207709_10010739 3300025935 Bacteria 5044
378 Ga0207709_10228373 3300025935 Bacteria 1347
379 Ga0207709_10436611 3300025935 Bacteria 1009
380 Ga0207709_11196915 3300025935 Bacteria 626
381 Ga0207670_10433982 3300025936 Bacteria 1056
382 Ga0207669_10053603 3300025937 Bacteria 2431
383 Ga0207669_10558324 3300025937 Bacteria 925
384 Ga0207669_10672711 3300025937 Bacteria 848
385 Ga0207704_10094491 3300025938 Bacteria 1974
386 Ga0207704_10350533 3300025938 Bacteria 1149
387 Ga0207704_10566371 3300025938 Bacteria 925
388 Ga0207704_10637672 3300025938 Bacteria 876
389 Ga0207665_10104988 3300025939 Bacteria 1978
390 Ga0207665_10394179 3300025939 Bacteria 1053
391 Ga0207691_10208471 3300025940 Bacteria 1699
392 Ga0207691_10336219 3300025940 Bacteria 1293
393 Ga0207691_11075556 3300025940 Bacteria 670
394 Ga0207711_10041759 3300025941 Bacteria 3907
395 Ga0207711_10216117 3300025941 Bacteria 1752
396 Ga0207711_10362056 3300025941 Bacteria 1344
397 Ga0207711_10629547 3300025941 Bacteria 1001
398 Ga0207689_10039433 3300025942 Bacteria 3910
399 Ga0207689_10067712 3300025942 Bacteria 2934
400 Ga0207689_10354933 3300025942 Bacteria 1219
401 Ga0207689_10553420 3300025942 Bacteria 966
402 Ga0207661_10105656 3300025944 Bacteria 2373
403 Ga0207679_10062689 3300025945 Bacteria 2772
404 Ga0207679_10117734 3300025945 Bacteria 2109
405 Ga0207679_10265087 3300025945 Bacteria 1467
406 Ga0207679_10424614 3300025945 Bacteria 1174
407 Ga0207679_10512255 3300025945 Bacteria 1072
408 Ga0207667_10080731 3300025949 Bacteria 3369
409 Ga0207667_10209621 3300025949 Bacteria 1997
410 Ga0207651_10245093 3300025960 Bacteria 1463
411 Ga0207651_11159151 3300025960 Bacteria 693
412 Ga0207712_10036980 3300025961 Bacteria 3328
413 Ga0207712_10089813 3300025961 Bacteria 2259
414 Ga0207668_10019940 3300025972 Bacteria 4250
415 Ga0207668_10023124 3300025972 Bacteria 3989
416 Ga0207668_10065657 3300025972 Bacteria 2569
417 Ga0207668_10246095 3300025972 Bacteria 1449
418 Ga0207668_10253503 3300025972 Bacteria 1430
419 Ga0207668_10265918 3300025972 Bacteria 1400
420 Ga0207668_10386500 3300025972 Bacteria 1179
421 Ga0207668_10700088 3300025972 Bacteria 890
422 Ga0207668_10826863 3300025972 Bacteria 821
423 Ga0207668_10828184 3300025972 Bacteria 820
424 Ga0207640_10349913 3300025981 Bacteria 1187
425 Ga0207658_10095459 3300025986 Bacteria 2317
426 Ga0207658_10369273 3300025986 Bacteria 1254
427 Ga0207677_10020729 3300026023 Bacteria 3998
428 Ga0207677_10097727 3300026023 Bacteria 2152
429 Ga0207677_10250716 3300026023 Bacteria 1437
430 Ga0207677_10699397 3300026023 Bacteria 899
431 Ga0207703_10114655 3300026035 Bacteria 2305
432 Ga0207703_10138276 3300026035 Bacteria 2111
433 Ga0207703_10219206 3300026035 Bacteria 1700
434 Ga0207639_10123795 3300026041 Bacteria 2129
435 Ga0207639_10226335 3300026041 Bacteria 1618
436 Ga0207639_10539757 3300026041 Bacteria 1070
437 Ga0207639_10970615 3300026041 Bacteria 795
438 Ga0207678_10032526 3300026067 Bacteria 4545
439 Ga0207678_10043098 3300026067 Bacteria 3906
440 Ga0207678_10061848 3300026067 Bacteria 3220
441 Ga0207678_10271563 3300026067 Bacteria 1454
442 Ga0207678_10577766 3300026067 Bacteria 984
443 Ga0207678_10756362 3300026067 Bacteria 857
444 Ga0207708_10077375 3300026075 Bacteria 2553
445 Ga0207708_10237664 3300026075 Bacteria 1464
446 Ga0207708_10423269 3300026075 Bacteria 1104
447 Ga0207708_10507752 3300026075 Bacteria 1011
448 Ga0207708_10675935 3300026075 Bacteria 881
449 Ga0207702_10046401 3300026078 Bacteria 3657
450 Ga0207702_11619720 3300026078 Bacteria 641
451 Ga0207641_10230182 3300026088 Bacteria 1722
452 Ga0207641_10233998 3300026088 Bacteria 1709
453 Ga0207641_10988089 3300026088 Bacteria 838
454 Ga0207648_10056377 3300026089 Bacteria 3430
455 Ga0207648_10277663 3300026089 Bacteria 1498
456 Ga0207648_10509395 3300026089 Bacteria 1102
457 Ga0207676_10040090 3300026095 Bacteria 3587
458 Ga0207676_10064028 3300026095 Bacteria 2922
459 Ga0207676_10508424 3300026095 Bacteria 1145
460 Ga0207676_11833737 3300026095 Bacteria 605
461 Ga0207674_10529027 3300026116 Bacteria 1139
462 Ga0207674_11490176 3300026116 Bacteria 646
463 Ga0207675_100028928 3300026118 Bacteria 5162
464 Ga0207675_100063858 3300026118 Bacteria 3440
465 Ga0207675_100195014 3300026118 Bacteria 1944
466 Ga0207675_100504980 3300026118 Bacteria 1204
467 Ga0207675_101547370 3300026118 Bacteria 684
468 Ga0207683_10027677 3300026121 Bacteria 4898
469 Ga0207683_10030892 3300026121 Bacteria 4645
470 Ga0207683_10117220 3300026121 Bacteria 2388
471 Ga0207683_10269089 3300026121 Bacteria 1556
472 Ga0207683_10410557 3300026121 Bacteria 1246
473 Ga0207683_10500174 3300026121 Bacteria 1123
474 Ga0207683_10770452 3300026121 Bacteria 893
475 Ga0207698_10137494 3300026142 Bacteria 2099
476 Ga0207698_11265862 3300026142 Bacteria 752
477 Ga0207698_11279665 3300026142 Bacteria 748
478 Ga0207698_12170278 3300026142 Bacteria 568
479 Ga0209588_1000800 3300027671 Bacteria 7985
480 Ga0209813_10066460 3300027866 Bacteria 1163
481 Ga0207428_10402407 3300027907 Bacteria 1002
482 Ga0268266_10006104 3300028379 Bacteria 11096
483 Ga0268266_10099968 3300028379 Bacteria 2554
484 Ga0268266_10168235 3300028379 Bacteria 1988
485 Ga0268266_10928574 3300028379 Bacteria 842
486 Ga0268265_10048108 3300028380 Bacteria 3199
487 Ga0268265_10093002 3300028380 Bacteria 2415
488 Ga0268265_10111628 3300028380 Bacteria 2233
489 Ga0268265_10141673 3300028380 Bacteria 2013
490 Ga0268265_10317726 3300028380 Bacteria 1409
491 Ga0268265_10478001 3300028380 Bacteria 1169
492 Ga0268265_10803871 3300028380 Bacteria 917
493 Ga0268264_10066935 3300028381 Bacteria 3031
494 Ga0268264_10516701 3300028381 Bacteria 1167
495 Ga0268264_10565213 3300028381 Bacteria 1117
496 Ga0268264_10851582 3300028381 Bacteria 913
497 Ga0307517_10001338 3300028786 Bacteria 41372
498 Ga0307515_10036525 3300028794 Bacteria 7944
499 Ga0307515_10448358 3300028794 Bacteria 906
500 Ga0307511_10212060 3300030521 Bacteria 987
501 Ga0307513_10340745 3300031456 Bacteria 1250
502 Ga0307408_100384323 3300031548 Bacteria 1201
503 Ga0307408_100431421 3300031548 Bacteria 1139
504 Ga0307516_10008231 3300031730 Bacteria 11840
505 Ga0307516_10029188 3300031730 Bacteria 5577
506 Ga0307516_10287509 3300031730 Bacteria 1324
507 Ga0307516_10634793 3300031730 Bacteria 723
508 Ga0307413_10034084 3300031824 Bacteria 2906
509 Ga0307413_11166642 3300031824 Bacteria 668
510 Ga0307406_10044603 3300031901 Bacteria 2780
511 Ga0307406_10587394 3300031901 Bacteria 917
512 Ga0307406_11072533 3300031901 Bacteria 694
513 Ga0307412_10090963 3300031911 Bacteria 2135
514 Ga0307412_10141464 3300031911 Bacteria 1763
515 Ga0307412_10645814 3300031911 Bacteria 902
516 Ga0307409_100267377 3300031995 Bacteria 1573
517 Ga0307416_100150540 3300032002 Bacteria 2133
518 Ga0307416_100293588 3300032002 Bacteria 1611
519 Ga0307416_100499659 3300032002 Bacteria 1280
520 Ga0307411_10241558 3300032005 Bacteria 1414
521 Ga0307411_11488467 3300032005 Bacteria 622
522 Ga0307415_100042079 3300032126 Bacteria 3038
523 Ga0307415_100066547 3300032126 Bacteria 2515
524 Ga0307415_100472074 3300032126 Bacteria 1090
525 Ga0307415_100832057 3300032126 Bacteria 845
526 Ga0307415_101200304 3300032126 Bacteria 715
527 Ga0307510_10001271 3300033180 Bacteria 27493
528 Ga0307510_10164389 3300033180 Bacteria 1810
529 Ga0373928_0120693 3300035084 Bacteria 702
530 Ga0373936_0040480 3300035113 Bacteria 1867
531 Ga0373927_0067522 3300035695 Bacteria 2314
532 Ga0373925_0383771 3300037068 Bacteria 1144
533 Ga0439465_0019851 3300041413 Bacteria 2102
534 Ga0451789_0204474 3300041443 Bacteria 880
535 Ga0451791_0697653 3300041451 Bacteria 875
536 Ga0451797_1323973 3300041453 Bacteria 779
537 Ga0451795_0306874 3300041456 Bacteria 958
538 Ga0451798_1097871 3300041458 Bacteria 727
539 Ga0451800_1593314 3300041459 Bacteria 900
540 Ga0451802_1059125 3300041460 Bacteria 859
541 Ga0451833_0077301 3300041491 Bacteria 829
542 Ga0451839_1189050 3300041496 Bacteria 597
543 Ga0451841_0118866 3300041498 Bacteria 618
544 Ga0451847_0131072 3300041503 Bacteria 725
545 Ga0451855_0645708 3300041511 Bacteria 555
546 Ga0451853_2093545 3300041512 Bacteria 683
547 Ga0451853_3973549 3300041512 Bacteria 1256
548 Ga0439431_0096058 3300041997 Bacteria 811
549 Ga0439459_0057244 3300042438 Bacteria 872
550 Ga0495603_0012846 3300046455 Bacteria 5063
551 Ga0495603_0063011 3300046455 Bacteria 2188
552 Ga0495590_0122970 3300046457 Bacteria 930
553 Ga0495638_0049454 3300046460 Bacteria 2628
554 Ga0495638_0056441 3300046460 Bacteria 2437
555 Ga0495638_0164633 3300046460 Bacteria 1277
556 Ga0495638_0337811 3300046460 Bacteria 799
557 Ga0495580_0724786 3300046472 Bacteria 649
558 Ga0495605_0112127 3300046474 Bacteria 1243
559 Ga0495605_0248588 3300046474 Bacteria 761
560 Ga0495639_0196217 3300046475 Bacteria 987
561 Ga0495584_0388112 3300046491 Bacteria 709
562 Ga0495585_0025931 3300046492 Bacteria 3352
563 Ga0495596_0115283 3300046500 Bacteria 1043
564 Ga0495607_0224148 3300046501 Bacteria 918
565 Ga0495606_0651257 3300046507 Bacteria 509
566 Ga0495616_0102165 3300046513 Bacteria 1343
567 Ga0495620_0067877 3300046515 Bacteria 1466
568 Ga0495620_0187352 3300046515 Bacteria 799
569 Ga0495631_0153362 3300046518 Bacteria 988
570 Ga0495631_0245149 3300046518 Bacteria 764
571 Ga0495632_0069355 3300046519 Bacteria 1697
572 Ga0495643_0294638 3300046522 Bacteria 742
573 Ga0495644_0081779 3300046523 Bacteria 1218
574 Ga0495644_0087035 3300046523 Bacteria 1178
575 Ga0495648_0313929 3300046524 Bacteria 729
576 Ga0495663_0133922 3300046525 Bacteria 837
577 Ga0495666_0159917 3300046526 Bacteria 1045
578 Ga0495642_0334175 3300046528 Bacteria 665
579 Ga0495665_0135927 3300046531 Bacteria 1286
580 Ga0495598_0017737 3300046537 Bacteria 1839
581 Ga0495609_0223398 3300046538 Bacteria 781
582 Ga0495621_0021383 3300046539 Bacteria 2132
583 Ga0495622_0118482 3300046557 Bacteria 1210
584 Ga0495622_0323091 3300046557 Bacteria 670
585 Ga0495633_0123773 3300046558 Bacteria 1197
586 Ga0495656_0030045 3300046615 Bacteria 2193
587 Ga0495656_0063752 3300046615 Bacteria 1616
588 Ga0495668_0300981 3300046616 Bacteria 879
589 Ga0495611_0058435 3300046648 Bacteria 1749
590 Ga0495611_0115176 3300046648 Bacteria 1252
591 Ga0495625_0153785 3300046660 Bacteria 1545
592 Ga0495625_0637374 3300046660 Bacteria 636
593 Ga0495635_0795537 3300046663 Bacteria 609
594 Ga0495659_0195683 3300046664 Bacteria 827
595 Ga0495661_0096281 3300046665 Bacteria 1674
596 Ga0495588_0213977 3300046674 Bacteria 1017
597 Ga0495647_0478380 3300046681 Bacteria 578
598 Ga0495658_0156962 3300046683 Bacteria 1401
599 Ga0495658_0542700 3300046683 Bacteria 744
600 Ga0495669_0020508 3300046684 Bacteria 2862
601 Ga0495669_0131600 3300046684 Bacteria 1177
602 Ga0495613_0430161 3300046689 Bacteria 897
603 Ga0495670_0305380 3300046691 Bacteria 853
604 Ga0495671_0126575 3300046692 Bacteria 1246
605 Ga0495589_0072700 3300046794 Bacteria 1679
606 Ga0495589_0086022 3300046794 Bacteria 1527
607 Ga0495589_0142507 3300046794 Bacteria 1147
608 Ga0495660_0384487 3300046810 Bacteria 618
609 Ga0495581_0011636 3300047315 Bacteria 5093
610 Ga0495581_0127403 3300047315 Bacteria 1483
611 Ga0495581_0223174 3300047315 Bacteria 1102
612 Ga0495581_0318460 3300047315 Bacteria 909
613 Ga0495581_0327529 3300047315 Bacteria 895
614 Ga0495604_0842035 3300047317 Bacteria 576
615 Ga0495636_0049548 3300047318 Bacteria 1756
616 Ga0495636_0058864 3300047318 Bacteria 1621
617 Ga0495636_0089460 3300047318 Bacteria 1335
618 Ga0495636_0224001 3300047318 Bacteria 864
619 Ga0495674_0489472 3300047319 Bacteria 985
620 Ga0495672_0013417 3300047320 Bacteria 5654
621 Ga0495676_0098498 3300047321 Bacteria 2169
622 Ga0495680_0684864 3300047322 Bacteria 678
623 Ga0495673_0019319 3300047469 Bacteria 3415
624 Ga0495673_0221110 3300047469 Bacteria 701
625 Ga0495686_0041319 3300047472 Bacteria 2937
626 Ga0495626_0231595 3300048091 Bacteria 747
627 Ga0496100_0507350 3300048903 Bacteria 930
628 Ga0496100_1376761 3300048903 Bacteria 557
629 Ga0496101_0023371 3300048904 Bacteria 4270
630 Ga0496101_0239352 3300048904 Bacteria 1412
631 Ga0496101_0280213 3300048904 Bacteria 1303
632 Ga0496101_0823504 3300048904 Bacteria 732
633 Ga0496102_0017911 3300048905 Bacteria 6213
634 Ga0496102_0213461 3300048905 Bacteria 1819
635 Ga0496102_0256941 3300048905 Bacteria 1647
636 Ga0496102_0265852 3300048905 Bacteria 1617
637 Ga0496102_0415197 3300048905 Bacteria 1264
638 Ga0496102_0864138 3300048905 Bacteria 827
639 Ga0496103_0071587 3300048906 Bacteria 2170
640 Ga0496103_0082938 3300048906 Bacteria 2018
641 Ga0496103_0186298 3300048906 Bacteria 1334
642 Ga0496104_0411505 3300048907 Bacteria 1264
643 Ga0496104_0623369 3300048907 Bacteria 988
644 Ga0496104_0900353 3300048907 Bacteria 790
645 Ga0496105_0014175 3300048908 Bacteria 6344
646 Ga0496105_0412879 3300048908 Bacteria 1070
647 Ga0496105_0615052 3300048908 Bacteria 842
648 Ga0496106_0001014 3300048909 Bacteria 20581
649 Ga0496106_0030569 3300048909 Bacteria 4014
650 Ga0496106_0094937 3300048909 Bacteria 2306
651 Ga0496106_0213387 3300048909 Bacteria 1538
652 Ga0496107_0073340 3300048910 Bacteria 2489
653 Ga0496107_0129708 3300048910 Bacteria 1861
654 Ga0496107_0218747 3300048910 Bacteria 1417
655 Ga0496108_0050866 3300048911 Bacteria 3470
656 Ga0496108_0071509 3300048911 Bacteria 2927
657 Ga0496108_0463217 3300048911 Bacteria 1107
658 Ga0496109_0186380 3300048912 Bacteria 1949
659 Ga0496109_0538515 3300048912 Bacteria 1102
660 Ga0496110_0142157 3300048913 Bacteria 2169
661 Ga0496111_0033983 3300048914 Bacteria 3639
662 Ga0496111_0064866 3300048914 Bacteria 2650
663 Ga0496112_0277580 3300048915 Bacteria 1623
664 Ga0496112_0448601 3300048915 Bacteria 1228
665 Ga0496113_0103626 3300048916 Bacteria 2207
666 Ga0496113_0482690 3300048916 Bacteria 995
667 Ga0496114_0008301 3300048917 Bacteria 8230
668 Ga0496114_0032009 3300048917 Bacteria 4327
669 Ga0496114_0035932 3300048917 Bacteria 4094
670 Ga0496114_0594040 3300048917 Bacteria 976
671 Ga0496114_0604744 3300048917 Bacteria 967
672 Ga0496114_0679275 3300048917 Bacteria 904
673 Ga0496114_0928793 3300048917 Bacteria 752
674 Ga0496115_0004376 3300048918 Bacteria 10231
675 Ga0496115_0230254 3300048918 Bacteria 1528
676 Ga0496115_0286128 3300048918 Bacteria 1353
677 Ga0496115_0378341 3300048918 Bacteria 1152
678 Ga0496115_0501252 3300048918 Bacteria 976
679 Ga0496118_0153486 3300048921 Bacteria 1437
680 Ga0496119_0124996 3300048922 Bacteria 1408
681 Ga0496121_0175233 3300048924 Bacteria 1553
682 Ga0496121_0193014 3300048924 Bacteria 1458
683 Ga0496121_0195571 3300048924 Bacteria 1446
684 Ga0496121_0296112 3300048924 Bacteria 1100
685 Ga0496121_0722042 3300048924 Bacteria 596
686 Ga0496124_0082915 3300048927 Bacteria 2631
687 Ga0496124_0168126 3300048927 Bacteria 1702
688 Ga0496124_0445202 3300048927 Bacteria 885
689 Ga0496124_0567626 3300048927 Bacteria 745
690 Ga0496125_0090129 3300048928 Bacteria 2303
691 Ga0496125_0242471 3300048928 Bacteria 1143
692 Ga0496125_0437223 3300048928 Bacteria 753
693 Ga0496126_0002460 3300048929 Bacteria 24974
694 Ga0496126_0056061 3300048929 Bacteria 3563
695 Ga0496126_0103546 3300048929 Bacteria 2487
696 Ga0496126_0132946 3300048929 Bacteria 2148
697 Ga0496126_0135890 3300048929 Bacteria 2121
698 Ga0496126_0441969 3300048929 Bacteria 1048
699 Ga0496126_1125551 3300048929 Bacteria 582
700 Ga0495682_0285903 3300049460 Bacteria 582
701 Ga0501039_1090913 3300049575 Bacteria 619
702 nmdc:mga03683_27750_c1 3300050489 Bacteria 2245
703 nmdc:mga03683_29035_c1 3300050489 Bacteria 2203
704 nmdc:mga03n38_533221_c1 3300050490 Bacteria 662
705 nmdc:mga03n38_84131_c1 3300050490 Bacteria 1501
706 nmdc:mga03n38_93190_c1 3300050490 Bacteria 1438
707 nmdc:mga03n38_983_c1 3300050490 Bacteria 7778
708 nmdc:mga00v17_141946_c1 3300050491 Bacteria 1540
709 nmdc:mga00v17_171470_c1 3300050491 Bacteria 1399
710 nmdc:mga00v17_195751_c1 3300050491 Bacteria 1306
711 nmdc:mga00v17_38844_c1 3300050491 Bacteria 2848
712 nmdc:mga00v17_96637_c1 3300050491 Bacteria 1861
713 nmdc:mga0yw44_18229_c1 3300050492 Bacteria 3839
714 nmdc:mga0yw44_184596_c1 3300050492 Bacteria 1374
715 nmdc:mga0yw44_201729_c1 3300050492 Bacteria 1314
716 nmdc:mga0yw44_218528_c1 3300050492 Bacteria 1262
717 nmdc:mga0k408_31768_c1 3300050493 Bacteria 3017
718 nmdc:mga0k408_66541_c1 3300050493 Bacteria 2099
719 nmdc:mga0k408_857948_c1 3300050493 Bacteria 528
720 nmdc:mga06z11_112434_c1 3300050494 Bacteria 1510
721 nmdc:mga06z11_37966_c1 3300050494 Bacteria 2389
722 nmdc:mga06z11_80134_c1 3300050494 Bacteria 1750
723 nmdc:mga04h51_74902_c1 3300050495 Bacteria 1190
724 nmdc:mga04h51_85263_c1 3300050495 Bacteria 1128
725 nmdc:mga07m45_156015_c1 3300050496 Bacteria 1324
726 nmdc:mga07m45_76608_c1 3300050496 Bacteria 1907
727 nmdc:mga05p37_624977_c1 3300050507 Bacteria 1211
728 nmdc:mga08y16_320063_c1 3300050511 Bacteria 1597
729 nmdc:mga0n895_306810_c1 3300050512 Bacteria 1609
730 nmdc:mga0rr50_175827_c1 3300050513 Bacteria 1747
731 nmdc:mga08x19_703636_c1 3300050514 Bacteria 717
732 nmdc:mga0a205_295163_c1 3300050515 Bacteria 1494
733 nmdc:mga0a205_785997_c1 3300050515 Bacteria 800
734 nmdc:mga0sz30_43832_c1 3300050516 Bacteria 1884
735 Ga0500610_0317223 3300053079 Bacteria 678
736 Ga0495655_0042595 3300053083 Bacteria 1167
737 Ga0500578_0195299 3300053086 Bacteria 1241
738 Ga0500643_042060 3300053087 Bacteria 1339
739 Ga0500643_186881 3300053087 Bacteria 556
740 Ga0500644_0177051 3300053088 Bacteria 871
741 Ga0500646_0162299 3300053090 Bacteria 747
742 Ga0500646_0276771 3300053090 Bacteria 597
743 Ga0500583_0168680 3300053092 Bacteria 1090
744 Ga0500566_0311815 3300053094 Bacteria 736
745 Ga0500641_0001979 3300053096 Bacteria 7275
746 Ga0500641_0004753 3300053096 Bacteria 4806
747 Ga0500641_0048387 3300053096 Bacteria 1741
748 Ga0500569_077676 3300053109 Bacteria 1057
749 Ga0500592_081340 3300053116 Bacteria 539
750 Ga0500594_0137620 3300053118 Bacteria 777
751 Ga0500595_067699 3300053119 Bacteria 1064
752 Ga0500621_192249 3300053126 Bacteria 730
753 Ga0500642_0165832 3300053130 Bacteria 1035
754 Ga0500642_0177611 3300053130 Bacteria 996
755 Ga0500655_019362 3300053133 Bacteria 1268
756 Ga0500658_0298125 3300053134 Bacteria 741
757 Ga0500561_0221398 3300053137 Bacteria 600
758 Ga0500589_027270 3300053147 Bacteria 2650
759 Ga0500589_188955 3300053147 Bacteria 802
760 Ga0500589_193055 3300053147 Bacteria 789
761 Ga0500590_092717 3300053148 Bacteria 1464
762 Ga0500603_190334 3300053150 Bacteria 648
763 Ga0500604_0029825 3300053151 Bacteria 1592
764 Ga0500616_0000127 3300053153 Bacteria 134777
765 Ga0500622_0285217 3300053156 Bacteria 710
766 Ga0500633_0142958 3300053160 Bacteria 896
767 Ga0500634_0056200 3300053161 Bacteria 2103
768 Ga0500638_163195 3300053162 Bacteria 979
769 Ga0500637_0309310 3300053178 Bacteria 858
770 Ga0500611_034917 3300053727 Bacteria 1068
771 Ga0500645_147305 3300053730 Bacteria 649
772 Ga0500609_038710 3300053731 Bacteria 659

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031824 Ga0307413_10034084 Ga0307413_100340842 148
2 iso_pu_bacteria 2513237101 2513695083 151
3 iso_pu_bacteria 2721755755 2723841615 151
4 iso_pu_bacteria 2728368998 2728754962 151
5 iso_pu_bacteria 2791355199 2793081654 151
6 iso_pu_bacteria 2874604998 2874608091 151
7 iso_pu_bacteria 2876808645 2876810823 151
8 iso_pu_bacteria 2879110137 2879112142 151
9 iso_pu_bacteria 2889033259 2889035520 151
10 iso_pu_bacteria 2922361189 2922364029 151
11 iso_pu_bacteria 2922386360 2922392538 151
12 iso_pu_bacteria 8006964411 8006969332 151
13 iso_pu_bacteria 8006984368 8006990894 151
14 iso_pu_bacteria 8006994254 8006996538 151
15 iso_pu_bacteria 8056673599 8056675715 151
16 3300005842 Ga0068858_101319456 Ga0068858_1013194561 153
17 3300009093 Ga0105240_10232630 Ga0105240_102326302 153
18 3300014968 Ga0157379_11808138 Ga0157379_118081381 153
19 3300025903 Ga0207680_10148456 Ga0207680_101484562 153
20 3300026089 Ga0207648_10277663 Ga0207648_102776631 153
21 3300053153 Ga0500616_0000127 Ga0500616_0000127_53666_54130 153
22 3300005328 Ga0070676_11003131 Ga0070676_110031311 154
23 3300005347 Ga0070668_100175674 Ga0070668_1001756742 154
24 3300005353 Ga0070669_100277603 Ga0070669_1002776032 154
25 3300005354 Ga0070675_100595130 Ga0070675_1005951302 154
26 3300005356 Ga0070674_100446419 Ga0070674_1004464192 154
27 3300005364 Ga0070673_100359545 Ga0070673_1003595451 154
28 3300005456 Ga0070678_100093597 Ga0070678_1000935972 154
29 3300005457 Ga0070662_100390710 Ga0070662_1003907101 154
30 3300005564 Ga0070664_100819432 Ga0070664_1008194322 154
31 3300005719 Ga0068861_100082824 Ga0068861_1000828242 154
32 3300005840 Ga0068870_10083541 Ga0068870_100835412 154
33 3300005844 Ga0068862_100279144 Ga0068862_1002791441 154
34 3300006881 Ga0068865_100513870 Ga0068865_1005138701 154
35 3300009094 Ga0111539_10687070 Ga0111539_106870701 154
36 3300013307 Ga0157372_12626389 Ga0157372_126263891 154
37 3300014325 Ga0163163_11229493 Ga0163163_112294931 154
38 3300014326 Ga0157380_10592666 Ga0157380_105926661 154
39 3300017792 Ga0163161_10652617 Ga0163161_106526171 154
40 3300025908 Ga0207643_10027031 Ga0207643_100270312 154
41 3300025933 Ga0207706_11016156 Ga0207706_110161561 154
42 3300025960 Ga0207651_10245093 Ga0207651_102450932 154
43 3300025972 Ga0207668_10386500 Ga0207668_103865001 154
44 3300026067 Ga0207678_10577766 Ga0207678_105777662 154
45 3300026118 Ga0207675_100195014 Ga0207675_1001950142 154
46 3300026121 Ga0207683_10410557 Ga0207683_104105571 154
47 3300031824 Ga0307413_11166642 Ga0307413_111666421 154
48 3300031911 Ga0307412_10141464 Ga0307412_101414642 154
49 3300032126 Ga0307415_100832057 Ga0307415_1008320571 154
50 3300035084 Ga0373928_0120693 Ga0373928_0120693_55_519 154
51 3300041451 Ga0451791_0697653 Ga0451791_0697653_166_630 154
52 3300047315 Ga0495581_0327529 Ga0495581_0327529_365_832 154
53 3300047322 Ga0495680_0684864 Ga0495680_0684864_177_641 154
54 3300048908 Ga0496105_0615052 Ga0496105_0615052_101_565 154
55 3300053162 Ga0500638_163195 Ga0500638_163195_57_524 154
56 3300003659 JGI25404J52841_10021953 JGI25404J52841_100219532 155
57 3300005327 Ga0070658_10495004 Ga0070658_104950041 155
58 3300005328 Ga0070676_10155196 Ga0070676_101551961 155
59 3300005329 Ga0070683_100386523 Ga0070683_1003865231 155
60 3300005330 Ga0070690_100056075 Ga0070690_1000560753 155
61 3300005330 Ga0070690_100319261 Ga0070690_1003192612 155
62 3300005330 Ga0070690_100697566 Ga0070690_1006975661 155
63 3300005331 Ga0070670_100101019 Ga0070670_1001010192 155
64 3300005334 Ga0068869_100050231 Ga0068869_1000502312 155
65 3300005334 Ga0068869_100058856 Ga0068869_1000588562 155
66 3300005335 Ga0070666_10093735 Ga0070666_100937351 155
67 3300005335 Ga0070666_10267595 Ga0070666_102675951 155
68 3300005335 Ga0070666_10913934 Ga0070666_109139341 155
69 3300005336 Ga0070680_101447424 Ga0070680_1014474241 155
70 3300005337 Ga0070682_100162240 Ga0070682_1001622402 155
71 3300005338 Ga0068868_100052909 Ga0068868_1000529092 155
72 3300005338 Ga0068868_100260799 Ga0068868_1002607991 155
73 3300005338 Ga0068868_100341923 Ga0068868_1003419232 155
74 3300005338 Ga0068868_100483960 Ga0068868_1004839601 155
75 3300005338 Ga0068868_101067994 Ga0068868_1010679941 155
76 3300005339 Ga0070660_100603394 Ga0070660_1006033941 155
77 3300005340 Ga0070689_100417446 Ga0070689_1004174461 155
78 3300005340 Ga0070689_100870624 Ga0070689_1008706242 155
79 3300005343 Ga0070687_100353829 Ga0070687_1003538291 155
80 3300005343 Ga0070687_100579408 Ga0070687_1005794081 155
81 3300005344 Ga0070661_100171457 Ga0070661_1001714572 155
82 3300005344 Ga0070661_100210671 Ga0070661_1002106712 155
83 3300005344 Ga0070661_100283003 Ga0070661_1002830032 155
84 3300005344 Ga0070661_100363693 Ga0070661_1003636932 155
85 3300005344 Ga0070661_100466839 Ga0070661_1004668392 155
86 3300005347 Ga0070668_100062410 Ga0070668_1000624102 155
87 3300005347 Ga0070668_100066909 Ga0070668_1000669092 155
88 3300005347 Ga0070668_100182406 Ga0070668_1001824062 155
89 3300005347 Ga0070668_100836420 Ga0070668_1008364202 155
90 3300005353 Ga0070669_100252431 Ga0070669_1002524312 155
91 3300005354 Ga0070675_100395138 Ga0070675_1003951382 155
92 3300005354 Ga0070675_100634740 Ga0070675_1006347401 155
93 3300005354 Ga0070675_101528615 Ga0070675_1015286151 155
94 3300005355 Ga0070671_100115922 Ga0070671_1001159223 155
95 3300005355 Ga0070671_100534927 Ga0070671_1005349271 155
96 3300005356 Ga0070674_100167286 Ga0070674_1001672862 155
97 3300005356 Ga0070674_100316513 Ga0070674_1003165132 155
98 3300005356 Ga0070674_100723884 Ga0070674_1007238841 155
99 3300005364 Ga0070673_100289473 Ga0070673_1002894731 155
100 3300005366 Ga0070659_100148359 Ga0070659_1001483591 155
101 3300005366 Ga0070659_100429066 Ga0070659_1004290661 155
102 3300005366 Ga0070659_101395384 Ga0070659_1013953841 155
103 3300005367 Ga0070667_100060591 Ga0070667_1000605911 155
104 3300005367 Ga0070667_101251627 Ga0070667_1012516271 155
105 3300005367 Ga0070667_101459083 Ga0070667_1014590831 155
106 3300005437 Ga0070710_10086088 Ga0070710_100860882 155
107 3300005437 Ga0070710_10662303 Ga0070710_106623031 155
108 3300005438 Ga0070701_10369462 Ga0070701_103694622 155
109 3300005439 Ga0070711_100023422 Ga0070711_1000234223 155
110 3300005441 Ga0070700_100149576 Ga0070700_1001495762 155
111 3300005441 Ga0070700_100150235 Ga0070700_1001502352 155
112 3300005441 Ga0070700_100552038 Ga0070700_1005520381 155
113 3300005455 Ga0070663_100012307 Ga0070663_1000123073 155
114 3300005455 Ga0070663_100073868 Ga0070663_1000738682 155
115 3300005455 Ga0070663_100078350 Ga0070663_1000783502 155
116 3300005455 Ga0070663_100235132 Ga0070663_1002351322 155
117 3300005456 Ga0070678_100031128 Ga0070678_1000311281 155
118 3300005456 Ga0070678_100103337 Ga0070678_1001033372 155
119 3300005456 Ga0070678_101579375 Ga0070678_1015793751 155
120 3300005457 Ga0070662_100222143 Ga0070662_1002221431 155
121 3300005467 Ga0070706_100316926 Ga0070706_1003169262 155
122 3300005535 Ga0070684_101944343 Ga0070684_1019443431 155
123 3300005539 Ga0068853_100170181 Ga0068853_1001701812 155
124 3300005539 Ga0068853_100225066 Ga0068853_1002250663 155
125 3300005543 Ga0070672_100270710 Ga0070672_1002707102 155
126 3300005543 Ga0070672_100670420 Ga0070672_1006704202 155
127 3300005543 Ga0070672_100827451 Ga0070672_1008274511 155
128 3300005544 Ga0070686_100020047 Ga0070686_1000200472 155
129 3300005545 Ga0070695_100732684 Ga0070695_1007326841 155
130 3300005546 Ga0070696_100058612 Ga0070696_1000586122 155
131 3300005548 Ga0070665_100004203 Ga0070665_1000042032 155
132 3300005548 Ga0070665_100009471 Ga0070665_1000094716 155
133 3300005548 Ga0070665_100077521 Ga0070665_1000775212 155
134 3300005548 Ga0070665_100112322 Ga0070665_1001123223 155
135 3300005548 Ga0070665_100124827 Ga0070665_1001248272 155
136 3300005548 Ga0070665_100151199 Ga0070665_1001511992 155
137 3300005548 Ga0070665_100184209 Ga0070665_1001842091 155
138 3300005548 Ga0070665_100227808 Ga0070665_1002278082 155
139 3300005548 Ga0070665_100305738 Ga0070665_1003057382 155
140 3300005548 Ga0070665_100577963 Ga0070665_1005779632 155
141 3300005548 Ga0070665_101698096 Ga0070665_1016980961 155
142 3300005563 Ga0068855_100102902 Ga0068855_1001029022 155
143 3300005563 Ga0068855_100699865 Ga0068855_1006998651 155
144 3300005563 Ga0068855_101015023 Ga0068855_1010150231 155
145 3300005564 Ga0070664_100057841 Ga0070664_1000578413 155
146 3300005564 Ga0070664_100929488 Ga0070664_1009294882 155
147 3300005564 Ga0070664_101620012 Ga0070664_1016200121 155
148 3300005577 Ga0068857_100431555 Ga0068857_1004315552 155
149 3300005614 Ga0068856_100043240 Ga0068856_1000432402 155
150 3300005614 Ga0068856_100412336 Ga0068856_1004123362 155
151 3300005614 Ga0068856_100629511 Ga0068856_1006295112 155
152 3300005614 Ga0068856_101095015 Ga0068856_1010950151 155
153 3300005616 Ga0068852_100189509 Ga0068852_1001895092 155
154 3300005616 Ga0068852_100278437 Ga0068852_1002784371 155
155 3300005616 Ga0068852_100906621 Ga0068852_1009066212 155
156 3300005616 Ga0068852_101108698 Ga0068852_1011086981 155
157 3300005617 Ga0068859_100066012 Ga0068859_1000660123 155
158 3300005617 Ga0068859_100172003 Ga0068859_1001720032 155
159 3300005617 Ga0068859_100609553 Ga0068859_1006095532 155
160 3300005618 Ga0068864_100028662 Ga0068864_1000286624 155
161 3300005618 Ga0068864_100059050 Ga0068864_1000590502 155
162 3300005618 Ga0068864_101977029 Ga0068864_1019770291 155
163 3300005718 Ga0068866_10067059 Ga0068866_100670592 155
164 3300005718 Ga0068866_10072159 Ga0068866_100721593 155
165 3300005718 Ga0068866_10077238 Ga0068866_100772382 155
166 3300005718 Ga0068866_10146133 Ga0068866_101461332 155
167 3300005719 Ga0068861_100090685 Ga0068861_1000906852 155
168 3300005719 Ga0068861_100250660 Ga0068861_1002506602 155
169 3300005719 Ga0068861_100337141 Ga0068861_1003371411 155
170 3300005719 Ga0068861_100423535 Ga0068861_1004235352 155
171 3300005834 Ga0068851_10204645 Ga0068851_102046452 155
172 3300005834 Ga0068851_10461885 Ga0068851_104618851 155
173 3300005834 Ga0068851_10848868 Ga0068851_108488681 155
174 3300005840 Ga0068870_10261051 Ga0068870_102610512 155
175 3300005840 Ga0068870_10340807 Ga0068870_103408071 155
176 3300005840 Ga0068870_10735087 Ga0068870_107350871 155
177 3300005841 Ga0068863_100105012 Ga0068863_1001050122 155
178 3300005841 Ga0068863_100391160 Ga0068863_1003911601 155
179 3300005841 Ga0068863_100732803 Ga0068863_1007328031 155
180 3300005842 Ga0068858_100049881 Ga0068858_1000498812 155
181 3300005842 Ga0068858_100192587 Ga0068858_1001925872 155
182 3300005842 Ga0068858_100201825 Ga0068858_1002018252 155
183 3300005842 Ga0068858_100581291 Ga0068858_1005812911 155
184 3300005843 Ga0068860_100058803 Ga0068860_1000588034 155
185 3300005843 Ga0068860_100108629 Ga0068860_1001086291 155
186 3300005843 Ga0068860_100359890 Ga0068860_1003598902 155
187 3300005843 Ga0068860_100378241 Ga0068860_1003782412 155
188 3300005844 Ga0068862_100177803 Ga0068862_1001778032 155
189 3300005844 Ga0068862_100214213 Ga0068862_1002142132 155
190 3300005844 Ga0068862_100314700 Ga0068862_1003147002 155
191 3300005844 Ga0068862_100642660 Ga0068862_1006426601 155
192 3300005844 Ga0068862_100676855 Ga0068862_1006768551 155
193 3300005937 Ga0081455_10007513 Ga0081455_1000751310 155
194 3300005937 Ga0081455_10080276 Ga0081455_100802762 155
195 3300005983 Ga0081540_1002549 Ga0081540_100254911 155
196 3300005983 Ga0081540_1003522 Ga0081540_10035224 155
197 3300005983 Ga0081540_1009485 Ga0081540_10094852 155
198 3300005983 Ga0081540_1029221 Ga0081540_10292212 155
199 3300005983 Ga0081540_1034399 Ga0081540_10343992 155
200 3300005983 Ga0081540_1035227 Ga0081540_10352272 155
201 3300005983 Ga0081540_1037441 Ga0081540_10374413 155
202 3300005983 Ga0081540_1058840 Ga0081540_10588402 155
203 3300005983 Ga0081540_1065600 Ga0081540_10656002 155
204 3300005983 Ga0081540_1070927 Ga0081540_10709272 155
205 3300005985 Ga0081539_10002259 Ga0081539_1000225914 155
206 3300005985 Ga0081539_10040454 Ga0081539_100404542 155
207 3300006038 Ga0075365_10050170 Ga0075365_100501702 155
208 3300006038 Ga0075365_10063990 Ga0075365_100639903 155
209 3300006038 Ga0075365_10071281 Ga0075365_100712812 155
210 3300006038 Ga0075365_10148595 Ga0075365_101485952 155
211 3300006038 Ga0075365_10358692 Ga0075365_103586922 155
212 3300006038 Ga0075365_10362240 Ga0075365_103622401 155
213 3300006042 Ga0075368_10031546 Ga0075368_100315461 155
214 3300006042 Ga0075368_10148456 Ga0075368_101484562 155
215 3300006048 Ga0075363_100009597 Ga0075363_1000095972 155
216 3300006048 Ga0075363_100170012 Ga0075363_1001700122 155
217 3300006048 Ga0075363_100219133 Ga0075363_1002191333 155
218 3300006048 Ga0075363_100256158 Ga0075363_1002561581 155
219 3300006051 Ga0075364_10121037 Ga0075364_101210372 155
220 3300006051 Ga0075364_10205693 Ga0075364_102056932 155
221 3300006173 Ga0070716_100441956 Ga0070716_1004419561 155
222 3300006175 Ga0070712_100168632 Ga0070712_1001686322 155
223 3300006177 Ga0075362_10036045 Ga0075362_100360452 155
224 3300006178 Ga0075367_10003520 Ga0075367_100035201 155
225 3300006178 Ga0075367_10029963 Ga0075367_100299634 155
226 3300006178 Ga0075367_10130645 Ga0075367_101306452 155
227 3300006178 Ga0075367_10150157 Ga0075367_101501572 155
228 3300006178 Ga0075367_10541823 Ga0075367_105418231 155
229 3300006186 Ga0075369_10029004 Ga0075369_100290042 155
230 3300006186 Ga0075369_10150151 Ga0075369_101501512 155
231 3300006195 Ga0075366_10057761 Ga0075366_100577612 155
232 3300006195 Ga0075366_10155797 Ga0075366_101557971 155
233 3300006195 Ga0075366_10341244 Ga0075366_103412441 155
234 3300006237 Ga0097621_102263669 Ga0097621_1022636691 155
235 3300006353 Ga0075370_10018348 Ga0075370_100183482 155
236 3300006353 Ga0075370_10034805 Ga0075370_100348051 155
237 3300006353 Ga0075370_10052957 Ga0075370_100529572 155
238 3300006353 Ga0075370_10104761 Ga0075370_101047612 155
239 3300006358 Ga0068871_100012150 Ga0068871_1000121502 155
240 3300006358 Ga0068871_100457600 Ga0068871_1004576002 155
241 3300006358 Ga0068871_101477952 Ga0068871_1014779521 155
242 3300006844 Ga0075428_101350500 Ga0075428_1013505001 155
243 3300006844 Ga0075428_101397160 Ga0075428_1013971601 155
244 3300006846 Ga0075430_100300783 Ga0075430_1003007832 155
245 3300006847 Ga0075431_101010994 Ga0075431_1010109941 155
246 3300006852 Ga0075433_10826858 Ga0075433_108268581 155
247 3300006871 Ga0075434_100249710 Ga0075434_1002497102 155
248 3300006881 Ga0068865_100105024 Ga0068865_1001050242 155
249 3300006881 Ga0068865_100210589 Ga0068865_1002105892 155
250 3300006881 Ga0068865_100400911 Ga0068865_1004009112 155
251 3300006881 Ga0068865_100521519 Ga0068865_1005215191 155
252 3300006914 Ga0075436_101181741 Ga0075436_1011817411 155
253 3300006931 Ga0097620_100066005 Ga0097620_1000660053 155
254 3300006931 Ga0097620_100171999 Ga0097620_1001719992 155
255 3300006931 Ga0097620_100609529 Ga0097620_1006095292 155
256 3300007076 Ga0075435_100102763 Ga0075435_1001027632 155
257 3300007265 Ga0099794_10182284 Ga0099794_101822841 155
258 3300007788 Ga0099795_10030957 Ga0099795_100309572 155
259 3300009092 Ga0105250_10010709 Ga0105250_100107092 155
260 3300009093 Ga0105240_10289820 Ga0105240_102898202 155
261 3300009093 Ga0105240_10732734 Ga0105240_107327341 155
262 3300009094 Ga0111539_10632735 Ga0111539_106327352 155
263 3300009098 Ga0105245_10154221 Ga0105245_101542211 155
264 3300009098 Ga0105245_10660941 Ga0105245_106609411 155
265 3300009098 Ga0105245_11037840 Ga0105245_110378402 155
266 3300009098 Ga0105245_11737719 Ga0105245_117377191 155
267 3300009098 Ga0105245_11809873 Ga0105245_118098731 155
268 3300009101 Ga0105247_10056856 Ga0105247_100568562 155
269 3300009101 Ga0105247_10094995 Ga0105247_100949951 155
270 3300009101 Ga0105247_10218005 Ga0105247_102180052 155
271 3300009101 Ga0105247_10224527 Ga0105247_102245271 155
272 3300009147 Ga0114129_10340226 Ga0114129_103402262 155
273 3300009147 Ga0114129_10520407 Ga0114129_105204072 155
274 3300009148 Ga0105243_10191923 Ga0105243_101919231 155
275 3300009148 Ga0105243_10274048 Ga0105243_102740481 155
276 3300009148 Ga0105243_10500350 Ga0105243_105003502 155
277 3300009174 Ga0105241_10031978 Ga0105241_100319784 155
278 3300009174 Ga0105241_10583277 Ga0105241_105832772 155
279 3300009174 Ga0105241_10608832 Ga0105241_106088321 155
280 3300009176 Ga0105242_10820502 Ga0105242_108205022 155
281 3300009177 Ga0105248_10056455 Ga0105248_100564552 155
282 3300009177 Ga0105248_10284047 Ga0105248_102840472 155
283 3300009177 Ga0105248_10555013 Ga0105248_105550131 155
284 3300009177 Ga0105248_10989167 Ga0105248_109891672 155
285 3300009545 Ga0105237_10277008 Ga0105237_102770081 155
286 3300009545 Ga0105237_10321090 Ga0105237_103210902 155
287 3300009545 Ga0105237_10349091 Ga0105237_103490912 155
288 3300009545 Ga0105237_10388607 Ga0105237_103886072 155
289 3300009545 Ga0105237_11533107 Ga0105237_115331071 155
290 3300009551 Ga0105238_10056480 Ga0105238_100564803 155
291 3300009551 Ga0105238_10515559 Ga0105238_105155592 155
292 3300009551 Ga0105238_10910579 Ga0105238_109105791 155
293 3300009551 Ga0105238_11003259 Ga0105238_110032592 155
294 3300009553 Ga0105249_10235264 Ga0105249_102352642 155
295 3300009553 Ga0105249_11527778 Ga0105249_115277781 155
296 3300010375 Ga0105239_10110518 Ga0105239_101105182 155
297 3300010375 Ga0105239_10123043 Ga0105239_101230431 155
298 3300010375 Ga0105239_10273304 Ga0105239_102733042 155
299 3300010375 Ga0105239_10306637 Ga0105239_103066373 155
300 3300010375 Ga0105239_10605370 Ga0105239_106053702 155
301 3300010375 Ga0105239_10919938 Ga0105239_109199382 155
302 3300011119 Ga0105246_10050528 Ga0105246_100505284 155
303 3300011119 Ga0105246_10081082 Ga0105246_100810822 155
304 3300011119 Ga0105246_10231528 Ga0105246_102315282 155
305 3300011119 Ga0105246_10480243 Ga0105246_104802431 155
306 3300011119 Ga0105246_10512460 Ga0105246_105124602 155
307 3300011119 Ga0105246_10586606 Ga0105246_105866061 155
308 3300013102 Ga0157371_10757451 Ga0157371_107574511 155
309 3300013296 Ga0157374_10018731 Ga0157374_100187311 155
310 3300013296 Ga0157374_10051454 Ga0157374_100514543 155
311 3300013296 Ga0157374_10433261 Ga0157374_104332612 155
312 3300013297 Ga0157378_10266102 Ga0157378_102661022 155
313 3300013297 Ga0157378_10271398 Ga0157378_102713982 155
314 3300013297 Ga0157378_11112613 Ga0157378_111126131 155
315 3300013297 Ga0157378_11596446 Ga0157378_115964461 155
316 3300013306 Ga0163162_10117403 Ga0163162_101174032 155
317 3300013306 Ga0163162_10219593 Ga0163162_102195932 155
318 3300013306 Ga0163162_10322849 Ga0163162_103228492 155
319 3300013306 Ga0163162_10544588 Ga0163162_105445881 155
320 3300013307 Ga0157372_12243697 Ga0157372_122436971 155
321 3300013308 Ga0157375_10231676 Ga0157375_102316762 155
322 3300013308 Ga0157375_10472529 Ga0157375_104725292 155
323 3300013308 Ga0157375_10499816 Ga0157375_104998161 155
324 3300013308 Ga0157375_11103194 Ga0157375_111031942 155
325 3300013308 Ga0157375_11385422 Ga0157375_113854221 155
326 3300014325 Ga0163163_10382437 Ga0163163_103824372 155
327 3300014325 Ga0163163_10390701 Ga0163163_103907012 155
328 3300014325 Ga0163163_10412706 Ga0163163_104127062 155
329 3300014325 Ga0163163_10554950 Ga0163163_105549502 155
330 3300014325 Ga0163163_10786188 Ga0163163_107861881 155
331 3300014326 Ga0157380_10346838 Ga0157380_103468382 155
332 3300014326 Ga0157380_10535167 Ga0157380_105351671 155
333 3300014326 Ga0157380_10549582 Ga0157380_105495821 155
334 3300014326 Ga0157380_10648775 Ga0157380_106487752 155
335 3300014326 Ga0157380_11161973 Ga0157380_111619731 155
336 3300014745 Ga0157377_10067494 Ga0157377_100674942 155
337 3300014745 Ga0157377_10197473 Ga0157377_101974731 155
338 3300014745 Ga0157377_10368717 Ga0157377_103687171 155
339 3300014968 Ga0157379_10121241 Ga0157379_101212414 155
340 3300014968 Ga0157379_10183366 Ga0157379_101833661 155
341 3300014968 Ga0157379_10548665 Ga0157379_105486651 155
342 3300014968 Ga0157379_10869370 Ga0157379_108693701 155
343 3300014968 Ga0157379_11518385 Ga0157379_115183851 155
344 3300014969 Ga0157376_10209764 Ga0157376_102097642 155
345 3300014969 Ga0157376_10282923 Ga0157376_102829232 155
346 3300014969 Ga0157376_10531823 Ga0157376_105318232 155
347 3300014969 Ga0157376_11237757 Ga0157376_112377571 155
348 3300017792 Ga0163161_10171195 Ga0163161_101711951 155
349 3300025297 Ga0209758_1006620 Ga0209758_10066201 155
350 3300025297 Ga0209758_1023273 Ga0209758_10232731 155
351 3300025315 Ga0207697_10062544 Ga0207697_100625442 155
352 3300025711 Ga0207696_1058404 Ga0207696_10584042 155
353 3300025898 Ga0207692_10040762 Ga0207692_100407622 155
354 3300025899 Ga0207642_10093257 Ga0207642_100932572 155
355 3300025899 Ga0207642_10112362 Ga0207642_101123621 155
356 3300025899 Ga0207642_10162989 Ga0207642_101629892 155
357 3300025899 Ga0207642_10191577 Ga0207642_101915772 155
358 3300025899 Ga0207642_10457645 Ga0207642_104576451 155
359 3300025900 Ga0207710_10456559 Ga0207710_104565591 155
360 3300025901 Ga0207688_10053044 Ga0207688_100530442 155
361 3300025901 Ga0207688_10509250 Ga0207688_105092501 155
362 3300025903 Ga0207680_10065184 Ga0207680_100651843 155
363 3300025904 Ga0207647_10117577 Ga0207647_101175772 155
364 3300025907 Ga0207645_10050155 Ga0207645_100501552 155
365 3300025907 Ga0207645_10195363 Ga0207645_101953632 155
366 3300025908 Ga0207643_10093287 Ga0207643_100932872 155
367 3300025908 Ga0207643_10185199 Ga0207643_101851992 155
368 3300025908 Ga0207643_10591296 Ga0207643_105912961 155
369 3300025909 Ga0207705_10949218 Ga0207705_109492181 155
370 3300025911 Ga0207654_10043586 Ga0207654_100435862 155
371 3300025913 Ga0207695_10208430 Ga0207695_102084301 155
372 3300025914 Ga0207671_10183049 Ga0207671_101830491 155
373 3300025914 Ga0207671_10299962 Ga0207671_102999622 155
374 3300025914 Ga0207671_10393774 Ga0207671_103937742 155
375 3300025915 Ga0207693_10392760 Ga0207693_103927602 155
376 3300025916 Ga0207663_10029308 Ga0207663_100293082 155
377 3300025918 Ga0207662_10124258 Ga0207662_101242582 155
378 3300025919 Ga0207657_10243596 Ga0207657_102435961 155
379 3300025919 Ga0207657_10832443 Ga0207657_108324431 155
380 3300025920 Ga0207649_10091707 Ga0207649_100917072 155
381 3300025920 Ga0207649_10206911 Ga0207649_102069112 155
382 3300025920 Ga0207649_10279398 Ga0207649_102793981 155
383 3300025920 Ga0207649_10329072 Ga0207649_103290721 155
384 3300025921 Ga0207652_10044564 Ga0207652_100445643 155
385 3300025923 Ga0207681_10077879 Ga0207681_100778792 155
386 3300025923 Ga0207681_10123131 Ga0207681_101231312 155
387 3300025924 Ga0207694_10708790 Ga0207694_107087901 155
388 3300025924 Ga0207694_10867886 Ga0207694_108678861 155
389 3300025925 Ga0207650_10693470 Ga0207650_106934701 155
390 3300025926 Ga0207659_10148531 Ga0207659_101485312 155
391 3300025926 Ga0207659_11305647 Ga0207659_113056471 155
392 3300025927 Ga0207687_10112630 Ga0207687_101126302 155
393 3300025927 Ga0207687_10157950 Ga0207687_101579501 155
394 3300025927 Ga0207687_10551840 Ga0207687_105518401 155
395 3300025931 Ga0207644_10061288 Ga0207644_100612882 155
396 3300025931 Ga0207644_10373537 Ga0207644_103735372 155
397 3300025931 Ga0207644_10763078 Ga0207644_107630781 155
398 3300025932 Ga0207690_10070494 Ga0207690_100704943 155
399 3300025932 Ga0207690_10841313 Ga0207690_108413131 155
400 3300025933 Ga0207706_10169596 Ga0207706_101695962 155
401 3300025933 Ga0207706_10197484 Ga0207706_101974841 155
402 3300025933 Ga0207706_10326947 Ga0207706_103269471 155
403 3300025933 Ga0207706_10381971 Ga0207706_103819712 155
404 3300025933 Ga0207706_10997141 Ga0207706_109971411 155
405 3300025934 Ga0207686_10625219 Ga0207686_106252191 155
406 3300025935 Ga0207709_10010739 Ga0207709_100107391 155
407 3300025935 Ga0207709_10228373 Ga0207709_102283732 155
408 3300025935 Ga0207709_10436611 Ga0207709_104366111 155
409 3300025935 Ga0207709_11196915 Ga0207709_111969151 155
410 3300025936 Ga0207670_10433982 Ga0207670_104339822 155
411 3300025937 Ga0207669_10053603 Ga0207669_100536032 155
412 3300025937 Ga0207669_10558324 Ga0207669_105583242 155
413 3300025937 Ga0207669_10672711 Ga0207669_106727111 155
414 3300025938 Ga0207704_10094491 Ga0207704_100944912 155
415 3300025938 Ga0207704_10350533 Ga0207704_103505332 155
416 3300025938 Ga0207704_10566371 Ga0207704_105663711 155
417 3300025938 Ga0207704_10637672 Ga0207704_106376722 155
418 3300025939 Ga0207665_10104988 Ga0207665_101049882 155
419 3300025939 Ga0207665_10394179 Ga0207665_103941791 155
420 3300025940 Ga0207691_10208471 Ga0207691_102084712 155
421 3300025940 Ga0207691_10336219 Ga0207691_103362192 155
422 3300025940 Ga0207691_11075556 Ga0207691_110755561 155
423 3300025941 Ga0207711_10041759 Ga0207711_100417592 155
424 3300025941 Ga0207711_10216117 Ga0207711_102161172 155
425 3300025941 Ga0207711_10362056 Ga0207711_103620562 155
426 3300025941 Ga0207711_10629547 Ga0207711_106295472 155
427 3300025942 Ga0207689_10039433 Ga0207689_100394332 155
428 3300025942 Ga0207689_10067712 Ga0207689_100677122 155
429 3300025942 Ga0207689_10354933 Ga0207689_103549332 155
430 3300025942 Ga0207689_10553420 Ga0207689_105534202 155
431 3300025944 Ga0207661_10105656 Ga0207661_101056562 155
432 3300025945 Ga0207679_10062689 Ga0207679_100626892 155
433 3300025945 Ga0207679_10117734 Ga0207679_101177341 155
434 3300025945 Ga0207679_10265087 Ga0207679_102650872 155
435 3300025945 Ga0207679_10424614 Ga0207679_104246141 155
436 3300025945 Ga0207679_10512255 Ga0207679_105122552 155
437 3300025949 Ga0207667_10080731 Ga0207667_100807311 155
438 3300025949 Ga0207667_10209621 Ga0207667_102096212 155
439 3300025960 Ga0207651_11159151 Ga0207651_111591511 155
440 3300025961 Ga0207712_10036980 Ga0207712_100369802 155
441 3300025961 Ga0207712_10089813 Ga0207712_100898132 155
442 3300025972 Ga0207668_10019940 Ga0207668_100199402 155
443 3300025972 Ga0207668_10023124 Ga0207668_100231242 155
444 3300025972 Ga0207668_10065657 Ga0207668_100656573 155
445 3300025972 Ga0207668_10246095 Ga0207668_102460952 155
446 3300025972 Ga0207668_10253503 Ga0207668_102535032 155
447 3300025972 Ga0207668_10265918 Ga0207668_102659183 155
448 3300025972 Ga0207668_10700088 Ga0207668_107000881 155
449 3300025972 Ga0207668_10826863 Ga0207668_108268632 155
450 3300025972 Ga0207668_10828184 Ga0207668_108281842 155
451 3300025981 Ga0207640_10349913 Ga0207640_103499131 155
452 3300025986 Ga0207658_10095459 Ga0207658_100954591 155
453 3300025986 Ga0207658_10369273 Ga0207658_103692732 155
454 3300026023 Ga0207677_10020729 Ga0207677_100207292 155
455 3300026023 Ga0207677_10097727 Ga0207677_100977272 155
456 3300026023 Ga0207677_10250716 Ga0207677_102507162 155
457 3300026023 Ga0207677_10699397 Ga0207677_106993971 155
458 3300026035 Ga0207703_10114655 Ga0207703_101146553 155
459 3300026035 Ga0207703_10138276 Ga0207703_101382761 155
460 3300026035 Ga0207703_10219206 Ga0207703_102192061 155
461 3300026041 Ga0207639_10123795 Ga0207639_101237952 155
462 3300026041 Ga0207639_10226335 Ga0207639_102263352 155
463 3300026041 Ga0207639_10539757 Ga0207639_105397571 155
464 3300026041 Ga0207639_10970615 Ga0207639_109706151 155
465 3300026067 Ga0207678_10032526 Ga0207678_100325263 155
466 3300026067 Ga0207678_10043098 Ga0207678_100430984 155
467 3300026067 Ga0207678_10061848 Ga0207678_100618481 155
468 3300026067 Ga0207678_10271563 Ga0207678_102715632 155
469 3300026067 Ga0207678_10756362 Ga0207678_107563621 155
470 3300026075 Ga0207708_10077375 Ga0207708_100773752 155
471 3300026075 Ga0207708_10237664 Ga0207708_102376641 155
472 3300026075 Ga0207708_10423269 Ga0207708_104232692 155
473 3300026075 Ga0207708_10507752 Ga0207708_105077522 155
474 3300026075 Ga0207708_10675935 Ga0207708_106759352 155
475 3300026078 Ga0207702_10046401 Ga0207702_100464012 155
476 3300026078 Ga0207702_11619720 Ga0207702_116197201 155
477 3300026088 Ga0207641_10230182 Ga0207641_102301822 155
478 3300026088 Ga0207641_10233998 Ga0207641_102339982 155
479 3300026088 Ga0207641_10988089 Ga0207641_109880892 155
480 3300026089 Ga0207648_10056377 Ga0207648_100563771 155
481 3300026089 Ga0207648_10509395 Ga0207648_105093952 155
482 3300026095 Ga0207676_10040090 Ga0207676_100400902 155
483 3300026095 Ga0207676_10064028 Ga0207676_100640282 155
484 3300026095 Ga0207676_10508424 Ga0207676_105084242 155
485 3300026095 Ga0207676_11833737 Ga0207676_118337371 155
486 3300026116 Ga0207674_10529027 Ga0207674_105290271 155
487 3300026116 Ga0207674_11490176 Ga0207674_114901761 155
488 3300026118 Ga0207675_100028928 Ga0207675_1000289285 155
489 3300026118 Ga0207675_100063858 Ga0207675_1000638584 155
490 3300026118 Ga0207675_100504980 Ga0207675_1005049802 155
491 3300026118 Ga0207675_101547370 Ga0207675_1015473701 155
492 3300026121 Ga0207683_10027677 Ga0207683_100276775 155
493 3300026121 Ga0207683_10030892 Ga0207683_100308921 155
494 3300026121 Ga0207683_10117220 Ga0207683_101172202 155
495 3300026121 Ga0207683_10269089 Ga0207683_102690891 155
496 3300026121 Ga0207683_10500174 Ga0207683_105001741 155
497 3300026121 Ga0207683_10770452 Ga0207683_107704521 155
498 3300026142 Ga0207698_10137494 Ga0207698_101374941 155
499 3300026142 Ga0207698_11265862 Ga0207698_112658621 155
500 3300026142 Ga0207698_11279665 Ga0207698_112796651 155
501 3300026142 Ga0207698_12170278 Ga0207698_121702781 155
502 3300027671 Ga0209588_1000800 Ga0209588_10008002 155
503 3300027866 Ga0209813_10066460 Ga0209813_100664601 155
504 3300027907 Ga0207428_10402407 Ga0207428_104024071 155
505 3300028379 Ga0268266_10006104 Ga0268266_100061049 155
506 3300028379 Ga0268266_10099968 Ga0268266_100999682 155
507 3300028379 Ga0268266_10168235 Ga0268266_101682352 155
508 3300028379 Ga0268266_10928574 Ga0268266_109285741 155
509 3300028380 Ga0268265_10048108 Ga0268265_100481082 155
510 3300028380 Ga0268265_10093002 Ga0268265_100930022 155
511 3300028380 Ga0268265_10111628 Ga0268265_101116282 155
512 3300028380 Ga0268265_10141673 Ga0268265_101416732 155
513 3300028380 Ga0268265_10317726 Ga0268265_103177261 155
514 3300028380 Ga0268265_10478001 Ga0268265_104780012 155
515 3300028380 Ga0268265_10803871 Ga0268265_108038712 155
516 3300028381 Ga0268264_10066935 Ga0268264_100669354 155
517 3300028381 Ga0268264_10516701 Ga0268264_105167012 155
518 3300028381 Ga0268264_10565213 Ga0268264_105652132 155
519 3300028381 Ga0268264_10851582 Ga0268264_108515821 155
520 3300028786 Ga0307517_10001338 Ga0307517_100013387 155
521 3300028794 Ga0307515_10036525 Ga0307515_100365259 155
522 3300028794 Ga0307515_10448358 Ga0307515_104483581 155
523 3300030521 Ga0307511_10212060 Ga0307511_102120601 155
524 3300031456 Ga0307513_10340745 Ga0307513_103407452 155
525 3300031548 Ga0307408_100384323 Ga0307408_1003843231 155
526 3300031548 Ga0307408_100431421 Ga0307408_1004314211 155
527 3300031730 Ga0307516_10008231 Ga0307516_1000823110 155
528 3300031730 Ga0307516_10029188 Ga0307516_100291882 155
529 3300031730 Ga0307516_10287509 Ga0307516_102875092 155
530 3300031730 Ga0307516_10634793 Ga0307516_106347931 155
531 3300031901 Ga0307406_10044603 Ga0307406_100446034 155
532 3300031901 Ga0307406_10587394 Ga0307406_105873941 155
533 3300031901 Ga0307406_11072533 Ga0307406_110725332 155
534 3300031911 Ga0307412_10090963 Ga0307412_100909632 155
535 3300031911 Ga0307412_10645814 Ga0307412_106458142 155
536 3300031995 Ga0307409_100267377 Ga0307409_1002673771 155
537 3300032002 Ga0307416_100150540 Ga0307416_1001505402 155
538 3300032002 Ga0307416_100293588 Ga0307416_1002935881 155
539 3300032002 Ga0307416_100499659 Ga0307416_1004996592 155
540 3300032005 Ga0307411_10241558 Ga0307411_102415581 155
541 3300032005 Ga0307411_11488467 Ga0307411_114884671 155
542 3300032126 Ga0307415_100042079 Ga0307415_1000420792 155
543 3300032126 Ga0307415_100066547 Ga0307415_1000665472 155
544 3300032126 Ga0307415_100472074 Ga0307415_1004720742 155
545 3300032126 Ga0307415_101200304 Ga0307415_1012003041 155
546 3300033180 Ga0307510_10001271 Ga0307510_1000127123 155
547 3300033180 Ga0307510_10164389 Ga0307510_101643891 155
548 3300035113 Ga0373936_0040480 Ga0373936_0040480_1191_1664 155
549 3300035695 Ga0373927_0067522 Ga0373927_0067522_1174_1641 155
550 3300037068 Ga0373925_0383771 Ga0373925_0383771_513_980 155
551 3300041413 Ga0439465_0019851 Ga0439465_0019851_920_1387 155
552 3300041443 Ga0451789_0204474 Ga0451789_0204474_203_670 155
553 3300041453 Ga0451797_1323973 Ga0451797_1323973_31_498 155
554 3300041456 Ga0451795_0306874 Ga0451795_0306874_393_860 155
555 3300041458 Ga0451798_1097871 Ga0451798_1097871_29_496 155
556 3300041459 Ga0451800_1593314 Ga0451800_1593314_322_789 155
557 3300041460 Ga0451802_1059125 Ga0451802_1059125_179_646 155
558 3300041491 Ga0451833_0077301 Ga0451833_0077301_128_595 155
559 3300041496 Ga0451839_1189050 Ga0451839_1189050_46_513 155
560 3300041498 Ga0451841_0118866 Ga0451841_0118866_72_539 155
561 3300041503 Ga0451847_0131072 Ga0451847_0131072_68_535 155
562 3300041511 Ga0451855_0645708 Ga0451855_0645708_42_509 155
563 3300041512 Ga0451853_2093545 Ga0451853_2093545_22_489 155
564 3300041512 Ga0451853_3973549 Ga0451853_3973549_265_738 155
565 3300041997 Ga0439431_0096058 Ga0439431_0096058_195_662 155
566 3300042438 Ga0439459_0057244 Ga0439459_0057244_296_763 155
567 3300046455 Ga0495603_0012846 Ga0495603_0012846_1131_1598 155
568 3300046455 Ga0495603_0063011 Ga0495603_0063011_483_950 155
569 3300046457 Ga0495590_0122970 Ga0495590_0122970_258_725 155
570 3300046460 Ga0495638_0049454 Ga0495638_0049454_1187_1654 155
571 3300046460 Ga0495638_0056441 Ga0495638_0056441_524_991 155
572 3300046460 Ga0495638_0164633 Ga0495638_0164633_26_493 155
573 3300046460 Ga0495638_0337811 Ga0495638_0337811_10_477 155
574 3300046472 Ga0495580_0724786 Ga0495580_0724786_120_587 155
575 3300046474 Ga0495605_0112127 Ga0495605_0112127_78_545 155
576 3300046474 Ga0495605_0248588 Ga0495605_0248588_239_706 155
577 3300046475 Ga0495639_0196217 Ga0495639_0196217_506_973 155
578 3300046491 Ga0495584_0388112 Ga0495584_0388112_201_668 155
579 3300046492 Ga0495585_0025931 Ga0495585_0025931_1144_1611 155
580 3300046500 Ga0495596_0115283 Ga0495596_0115283_135_602 155
581 3300046501 Ga0495607_0224148 Ga0495607_0224148_192_659 155
582 3300046507 Ga0495606_0651257 Ga0495606_0651257_19_486 155
583 3300046513 Ga0495616_0102165 Ga0495616_0102165_804_1271 155
584 3300046515 Ga0495620_0067877 Ga0495620_0067877_450_917 155
585 3300046515 Ga0495620_0187352 Ga0495620_0187352_133_600 155
586 3300046518 Ga0495631_0153362 Ga0495631_0153362_244_711 155
587 3300046518 Ga0495631_0245149 Ga0495631_0245149_88_555 155
588 3300046519 Ga0495632_0069355 Ga0495632_0069355_967_1434 155
589 3300046522 Ga0495643_0294638 Ga0495643_0294638_127_594 155
590 3300046523 Ga0495644_0081779 Ga0495644_0081779_480_947 155
591 3300046523 Ga0495644_0087035 Ga0495644_0087035_156_623 155
592 3300046524 Ga0495648_0313929 Ga0495648_0313929_25_492 155
593 3300046525 Ga0495663_0133922 Ga0495663_0133922_270_737 155
594 3300046526 Ga0495666_0159917 Ga0495666_0159917_329_796 155
595 3300046528 Ga0495642_0334175 Ga0495642_0334175_78_545 155
596 3300046531 Ga0495665_0135927 Ga0495665_0135927_117_584 155
597 3300046537 Ga0495598_0017737 Ga0495598_0017737_144_611 155
598 3300046538 Ga0495609_0223398 Ga0495609_0223398_55_522 155
599 3300046539 Ga0495621_0021383 Ga0495621_0021383_422_889 155
600 3300046557 Ga0495622_0118482 Ga0495622_0118482_507_974 155
601 3300046557 Ga0495622_0323091 Ga0495622_0323091_84_551 155
602 3300046558 Ga0495633_0123773 Ga0495633_0123773_23_490 155
603 3300046615 Ga0495656_0030045 Ga0495656_0030045_1192_1659 155
604 3300046615 Ga0495656_0063752 Ga0495656_0063752_699_1166 155
605 3300046616 Ga0495668_0300981 Ga0495668_0300981_202_669 155
606 3300046648 Ga0495611_0058435 Ga0495611_0058435_1058_1525 155
607 3300046648 Ga0495611_0115176 Ga0495611_0115176_736_1203 155
608 3300046660 Ga0495625_0153785 Ga0495625_0153785_563_1030 155
609 3300046660 Ga0495625_0637374 Ga0495625_0637374_67_534 155
610 3300046663 Ga0495635_0795537 Ga0495635_0795537_41_508 155
611 3300046664 Ga0495659_0195683 Ga0495659_0195683_184_651 155
612 3300046665 Ga0495661_0096281 Ga0495661_0096281_253_720 155
613 3300046674 Ga0495588_0213977 Ga0495588_0213977_158_625 155
614 3300046681 Ga0495647_0478380 Ga0495647_0478380_52_519 155
615 3300046683 Ga0495658_0156962 Ga0495658_0156962_833_1300 155
616 3300046683 Ga0495658_0542700 Ga0495658_0542700_17_484 155
617 3300046684 Ga0495669_0020508 Ga0495669_0020508_611_1078 155
618 3300046684 Ga0495669_0131600 Ga0495669_0131600_425_892 155
619 3300046689 Ga0495613_0430161 Ga0495613_0430161_231_698 155
620 3300046691 Ga0495670_0305380 Ga0495670_0305380_44_511 155
621 3300046692 Ga0495671_0126575 Ga0495671_0126575_462_929 155
622 3300046794 Ga0495589_0072700 Ga0495589_0072700_944_1411 155
623 3300046794 Ga0495589_0086022 Ga0495589_0086022_229_696 155
624 3300046794 Ga0495589_0142507 Ga0495589_0142507_215_682 155
625 3300046810 Ga0495660_0384487 Ga0495660_0384487_97_564 155
626 3300047315 Ga0495581_0011636 Ga0495581_0011636_1996_2463 155
627 3300047315 Ga0495581_0127403 Ga0495581_0127403_124_591 155
628 3300047315 Ga0495581_0223174 Ga0495581_0223174_283_750 155
629 3300047315 Ga0495581_0318460 Ga0495581_0318460_350_817 155
630 3300047317 Ga0495604_0842035 Ga0495604_0842035_14_481 155
631 3300047318 Ga0495636_0049548 Ga0495636_0049548_1159_1626 155
632 3300047318 Ga0495636_0058864 Ga0495636_0058864_745_1212 155
633 3300047318 Ga0495636_0089460 Ga0495636_0089460_431_898 155
634 3300047318 Ga0495636_0224001 Ga0495636_0224001_245_712 155
635 3300047319 Ga0495674_0489472 Ga0495674_0489472_475_969 155
636 3300047320 Ga0495672_0013417 Ga0495672_0013417_3938_4405 155
637 3300047321 Ga0495676_0098498 Ga0495676_0098498_777_1244 155
638 3300047469 Ga0495673_0019319 Ga0495673_0019319_2720_3187 155
639 3300047469 Ga0495673_0221110 Ga0495673_0221110_143_610 155
640 3300047472 Ga0495686_0041319 Ga0495686_0041319_105_572 155
641 3300048091 Ga0495626_0231595 Ga0495626_0231595_109_576 155
642 3300048903 Ga0496100_0507350 Ga0496100_0507350_332_799 155
643 3300048903 Ga0496100_1376761 Ga0496100_1376761_24_491 155
644 3300048904 Ga0496101_0023371 Ga0496101_0023371_2262_2729 155
645 3300048904 Ga0496101_0239352 Ga0496101_0239352_61_528 155
646 3300048904 Ga0496101_0280213 Ga0496101_0280213_784_1251 155
647 3300048904 Ga0496101_0823504 Ga0496101_0823504_195_662 155
648 3300048905 Ga0496102_0017911 Ga0496102_0017911_4142_4609 155
649 3300048905 Ga0496102_0213461 Ga0496102_0213461_740_1207 155
650 3300048905 Ga0496102_0256941 Ga0496102_0256941_1052_1519 155
651 3300048905 Ga0496102_0265852 Ga0496102_0265852_782_1249 155
652 3300048905 Ga0496102_0415197 Ga0496102_0415197_277_744 155
653 3300048905 Ga0496102_0864138 Ga0496102_0864138_196_663 155
654 3300048906 Ga0496103_0071587 Ga0496103_0071587_1107_1574 155
655 3300048906 Ga0496103_0082938 Ga0496103_0082938_772_1239 155
656 3300048906 Ga0496103_0186298 Ga0496103_0186298_48_515 155
657 3300048907 Ga0496104_0411505 Ga0496104_0411505_524_991 155
658 3300048907 Ga0496104_0623369 Ga0496104_0623369_31_498 155
659 3300048907 Ga0496104_0900353 Ga0496104_0900353_191_658 155
660 3300048908 Ga0496105_0014175 Ga0496105_0014175_3964_4431 155
661 3300048908 Ga0496105_0412879 Ga0496105_0412879_76_543 155
662 3300048909 Ga0496106_0001014 Ga0496106_0001014_495_962 155
663 3300048909 Ga0496106_0030569 Ga0496106_0030569_1141_1608 155
664 3300048909 Ga0496106_0094937 Ga0496106_0094937_1720_2187 155
665 3300048909 Ga0496106_0213387 Ga0496106_0213387_155_622 155
666 3300048910 Ga0496107_0073340 Ga0496107_0073340_243_710 155
667 3300048910 Ga0496107_0129708 Ga0496107_0129708_436_903 155
668 3300048910 Ga0496107_0218747 Ga0496107_0218747_846_1313 155
669 3300048911 Ga0496108_0050866 Ga0496108_0050866_1542_2009 155
670 3300048911 Ga0496108_0071509 Ga0496108_0071509_1764_2231 155
671 3300048911 Ga0496108_0463217 Ga0496108_0463217_523_990 155
672 3300048912 Ga0496109_0186380 Ga0496109_0186380_1064_1531 155
673 3300048912 Ga0496109_0538515 Ga0496109_0538515_76_543 155
674 3300048913 Ga0496110_0142157 Ga0496110_0142157_418_885 155
675 3300048914 Ga0496111_0033983 Ga0496111_0033983_565_1032 155
676 3300048914 Ga0496111_0064866 Ga0496111_0064866_1434_1901 155
677 3300048915 Ga0496112_0277580 Ga0496112_0277580_867_1334 155
678 3300048915 Ga0496112_0448601 Ga0496112_0448601_508_975 155
679 3300048916 Ga0496113_0103626 Ga0496113_0103626_761_1228 155
680 3300048916 Ga0496113_0482690 Ga0496113_0482690_103_570 155
681 3300048917 Ga0496114_0008301 Ga0496114_0008301_6689_7156 155
682 3300048917 Ga0496114_0032009 Ga0496114_0032009_2261_2743 155
683 3300048917 Ga0496114_0035932 Ga0496114_0035932_1952_2419 155
684 3300048917 Ga0496114_0594040 Ga0496114_0594040_383_850 155
685 3300048917 Ga0496114_0604744 Ga0496114_0604744_86_553 155
686 3300048917 Ga0496114_0679275 Ga0496114_0679275_114_581 155
687 3300048917 Ga0496114_0928793 Ga0496114_0928793_261_728 155
688 3300048918 Ga0496115_0004376 Ga0496115_0004376_2089_2556 155
689 3300048918 Ga0496115_0230254 Ga0496115_0230254_733_1200 155
690 3300048918 Ga0496115_0286128 Ga0496115_0286128_228_695 155
691 3300048918 Ga0496115_0378341 Ga0496115_0378341_531_998 155
692 3300048918 Ga0496115_0501252 Ga0496115_0501252_247_726 155
693 3300048921 Ga0496118_0153486 Ga0496118_0153486_369_836 155
694 3300048922 Ga0496119_0124996 Ga0496119_0124996_660_1127 155
695 3300048924 Ga0496121_0175233 Ga0496121_0175233_210_677 155
696 3300048924 Ga0496121_0193014 Ga0496121_0193014_756_1223 155
697 3300048924 Ga0496121_0195571 Ga0496121_0195571_69_551 155
698 3300048924 Ga0496121_0296112 Ga0496121_0296112_534_1001 155
699 3300048924 Ga0496121_0722042 Ga0496121_0722042_56_523 155
700 3300048927 Ga0496124_0082915 Ga0496124_0082915_158_625 155
701 3300048927 Ga0496124_0168126 Ga0496124_0168126_954_1421 155
702 3300048927 Ga0496124_0445202 Ga0496124_0445202_232_699 155
703 3300048927 Ga0496124_0567626 Ga0496124_0567626_149_616 155
704 3300048928 Ga0496125_0090129 Ga0496125_0090129_894_1361 155
705 3300048928 Ga0496125_0242471 Ga0496125_0242471_161_628 155
706 3300048928 Ga0496125_0437223 Ga0496125_0437223_274_741 155
707 3300048929 Ga0496126_0002460 Ga0496126_0002460_16328_16795 155
708 3300048929 Ga0496126_0056061 Ga0496126_0056061_1207_1674 155
709 3300048929 Ga0496126_0103546 Ga0496126_0103546_299_766 155
710 3300048929 Ga0496126_0132946 Ga0496126_0132946_488_955 155
711 3300048929 Ga0496126_0135890 Ga0496126_0135890_1620_2102 155
712 3300048929 Ga0496126_0441969 Ga0496126_0441969_71_538 155
713 3300048929 Ga0496126_1125551 Ga0496126_1125551_39_506 155
714 3300049460 Ga0495682_0285903 Ga0495682_0285903_92_559 155
715 3300049575 Ga0501039_1090913 Ga0501039_1090913_106_573 155
716 3300050489 nmdc:mga03683_27750_c1 nmdc:mga03683_27750_c1_795_1262 155
717 3300050489 nmdc:mga03683_29035_c1 nmdc:mga03683_29035_c1_171_638 155
718 3300050490 nmdc:mga03n38_533221_c1 nmdc:mga03n38_533221_c1_25_492 155
719 3300050490 nmdc:mga03n38_84131_c1 nmdc:mga03n38_84131_c1_222_689 155
720 3300050490 nmdc:mga03n38_93190_c1 nmdc:mga03n38_93190_c1_769_1236 155
721 3300050490 nmdc:mga03n38_983_c1 nmdc:mga03n38_983_c1_3958_4425 155
722 3300050491 nmdc:mga00v17_141946_c1 nmdc:mga00v17_141946_c1_59_526 155
723 3300050491 nmdc:mga00v17_171470_c1 nmdc:mga00v17_171470_c1_342_809 155
724 3300050491 nmdc:mga00v17_195751_c1 nmdc:mga00v17_195751_c1_777_1244 155
725 3300050491 nmdc:mga00v17_38844_c1 nmdc:mga00v17_38844_c1_1423_1890 155
726 3300050491 nmdc:mga00v17_96637_c1 nmdc:mga00v17_96637_c1_777_1244 155
727 3300050492 nmdc:mga0yw44_18229_c1 nmdc:mga0yw44_18229_c1_48_515 155
728 3300050492 nmdc:mga0yw44_184596_c1 nmdc:mga0yw44_184596_c1_763_1230 155
729 3300050492 nmdc:mga0yw44_201729_c1 nmdc:mga0yw44_201729_c1_525_992 155
730 3300050492 nmdc:mga0yw44_218528_c1 nmdc:mga0yw44_218528_c1_287_754 155
731 3300050493 nmdc:mga0k408_31768_c1 nmdc:mga0k408_31768_c1_1973_2440 155
732 3300050493 nmdc:mga0k408_66541_c1 nmdc:mga0k408_66541_c1_1203_1670 155
733 3300050493 nmdc:mga0k408_857948_c1 nmdc:mga0k408_857948_c1_29_496 155
734 3300050494 nmdc:mga06z11_112434_c1 nmdc:mga06z11_112434_c1_474_941 155
735 3300050494 nmdc:mga06z11_37966_c1 nmdc:mga06z11_37966_c1_643_1110 155
736 3300050494 nmdc:mga06z11_80134_c1 nmdc:mga06z11_80134_c1_67_534 155
737 3300050495 nmdc:mga04h51_74902_c1 nmdc:mga04h51_74902_c1_134_601 155
738 3300050495 nmdc:mga04h51_85263_c1 nmdc:mga04h51_85263_c1_392_859 155
739 3300050496 nmdc:mga07m45_156015_c1 nmdc:mga07m45_156015_c1_371_838 155
740 3300050496 nmdc:mga07m45_76608_c1 nmdc:mga07m45_76608_c1_599_1066 155
741 3300050507 nmdc:mga05p37_624977_c1 nmdc:mga05p37_624977_c1_128_595 155
742 3300050511 nmdc:mga08y16_320063_c1 nmdc:mga08y16_320063_c1_886_1353 155
743 3300050512 nmdc:mga0n895_306810_c1 nmdc:mga0n895_306810_c1_1098_1565 155
744 3300050513 nmdc:mga0rr50_175827_c1 nmdc:mga0rr50_175827_c1_642_1109 155
745 3300050514 nmdc:mga08x19_703636_c1 nmdc:mga08x19_703636_c1_199_666 155
746 3300050515 nmdc:mga0a205_295163_c1 nmdc:mga0a205_295163_c1_774_1241 155
747 3300050515 nmdc:mga0a205_785997_c1 nmdc:mga0a205_785997_c1_114_581 155
748 3300050516 nmdc:mga0sz30_43832_c1 nmdc:mga0sz30_43832_c1_806_1273 155
749 3300053079 Ga0500610_0317223 Ga0500610_0317223_115_582 155
750 3300053083 Ga0495655_0042595 Ga0495655_0042595_664_1131 155
751 3300053086 Ga0500578_0195299 Ga0500578_0195299_382_849 155
752 3300053087 Ga0500643_042060 Ga0500643_042060_262_729 155
753 3300053087 Ga0500643_186881 Ga0500643_186881_17_484 155
754 3300053088 Ga0500644_0177051 Ga0500644_0177051_27_494 155
755 3300053090 Ga0500646_0162299 Ga0500646_0162299_228_695 155
756 3300053090 Ga0500646_0276771 Ga0500646_0276771_120_587 155
757 3300053092 Ga0500583_0168680 Ga0500583_0168680_206_673 155
758 3300053094 Ga0500566_0311815 Ga0500566_0311815_248_715 155
759 3300053096 Ga0500641_0001979 Ga0500641_0001979_1284_1751 155
760 3300053096 Ga0500641_0004753 Ga0500641_0004753_1321_1788 155
761 3300053096 Ga0500641_0048387 Ga0500641_0048387_1217_1684 155
762 3300053109 Ga0500569_077676 Ga0500569_077676_162_629 155
763 3300053116 Ga0500592_081340 Ga0500592_081340_16_483 155
764 3300053118 Ga0500594_0137620 Ga0500594_0137620_17_484 155
765 3300053119 Ga0500595_067699 Ga0500595_067699_535_1002 155
766 3300053126 Ga0500621_192249 Ga0500621_192249_18_485 155
767 3300053130 Ga0500642_0165832 Ga0500642_0165832_371_838 155
768 3300053130 Ga0500642_0177611 Ga0500642_0177611_10_477 155
769 3300053133 Ga0500655_019362 Ga0500655_019362_611_1078 155
770 3300053134 Ga0500658_0298125 Ga0500658_0298125_229_696 155
771 3300053137 Ga0500561_0221398 Ga0500561_0221398_10_477 155
772 3300053147 Ga0500589_027270 Ga0500589_027270_175_642 155
773 3300053147 Ga0500589_188955 Ga0500589_188955_309_776 155
774 3300053147 Ga0500589_193055 Ga0500589_193055_155_622 155
775 3300053148 Ga0500590_092717 Ga0500590_092717_45_512 155
776 3300053150 Ga0500603_190334 Ga0500603_190334_74_541 155
777 3300053151 Ga0500604_0029825 Ga0500604_0029825_967_1434 155
778 3300053156 Ga0500622_0285217 Ga0500622_0285217_40_507 155
779 3300053160 Ga0500633_0142958 Ga0500633_0142958_81_548 155
780 3300053161 Ga0500634_0056200 Ga0500634_0056200_1458_1925 155
781 3300053178 Ga0500637_0309310 Ga0500637_0309310_282_749 155
782 3300053727 Ga0500611_034917 Ga0500611_034917_232_699 155
783 3300053730 Ga0500645_147305 Ga0500645_147305_84_551 155
784 3300053731 Ga0500609_038710 Ga0500609_038710_20_487 155
785 3300003320 rootH2_10104916 rootH2_101049163 156
786 3300003322 rootL2_10144200 rootL2_101442002 156

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q1w-assembly1.cif.gz_B mutations outside the active site of hiv-1 protease alter enzyme structure and dynamic ensemble of the active site to confer drug resistance 0.327 28 57
3oy4-assembly1.cif.gz_B crystal structure of hiv-1 l76v protease in complex with the protease inhibitor darunavir. 0.3089 28 58
4q1x-assembly1.cif.gz_B mutations outside the active site of hiv-1 protease alter enzyme structure and dynamic ensemble of the active site to confer drug resistance 0.3082 28 58
4obg-assembly2.cif.gz_C crystal structure of nelfinavir-resistant, inactive hiv-1 protease (d30n/n88d) in complex with the p1-p6 substrate. 0.3035 28 58
3jvy-assembly1.cif.gz_B hiv-1 protease mutant g86a with darunavir 0.3033 28 58
ID Description Score Start End Superfamily
af_C6T8X9_163_323_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.3596 50 119 3.40.1280.10
af_F4J7U9_265_379_2.40.70.10 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.3406 12 45 2.40.70.10
1wec001 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.3119 31 56 2.40.70.10
af_A4I142_25_204_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.2751 57 144 3.40.1280.10
af_Q54DY1_210_295_3.30.2330.10 Alpha Beta;2-Layer Sandwich;arginine biosynthesis bifunctional protein fold;arginine biosynthesis bifunctional protein suprefamily 0.2358 64 144 3.30.2330.10
ID Description Score Start End GO Terms
AF-A0A4Q8R3J2-F1-model_v4 Uncharacterized protein 0.8926 15 146
AF-H0TJT8-F1-model_v4 Uncharacterized protein 0.8413 28 146
AF-A0A4Q8R3J2-F1-model_v4 Uncharacterized protein 0.8256 15 146
AF-Q13E45-F1-model_v4 Uncharacterized protein 0.8137 1 155
AF-Q13E45-F1-model_v4 Uncharacterized protein 0.8041 1 155

Feature Viewer

pLDDT pTM Quality
74.18 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map