F480786
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 786 | 345 | 772 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300025933|Ga0207706_10197484|Ga0207706_101974841 |
| Length | 184 |
| Sequence | MLRLKILASVVPLAVAALFARGEFLVGQRPCIEIAGRSVQIATLSWQAHRHVSFTSDPGRATVRVQISDSADAADFTVIDDVDTAESGACESNSPPALVAISGKPGEGDPVIYLTRDGPADYRIFVSSKSFSVRDAAALIVGARGQHHRVEAASLSILEHGLRANAFRVCREGKPASTFPGHAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 2 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 3 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 4 | 2791355199 | |||
| 5 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 6 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 7 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 8 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 9 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 10 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 92 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 93 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 186 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 187 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 188 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 191 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 192 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 197 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 198 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 199 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 200 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 201 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 204 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 212 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 213 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 214 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 215 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 216 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 217 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 218 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 219 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 275 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 276 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 277 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 278 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 279 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 280 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 283 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 284 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 285 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 286 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 287 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 288 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 289 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 290 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 291 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 292 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 293 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 294 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 297 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 298 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 299 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 300 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 301 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 302 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 303 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 304 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 311 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 312 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 314 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 315 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 316 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 317 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 318 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 319 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 320 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 321 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 322 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 323 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 324 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 325 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 326 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 327 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 328 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 329 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 330 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 331 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 332 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 333 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 334 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 335 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 336 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 337 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 338 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 339 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 340 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 341 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 342 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 343 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 344 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 345 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.34 |
| Metatranscriptomes | 0 |
| Isolates | 1.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.09 |
| Nodule | 1.27 |
| Rhizoplane | 7.51 |
| Rhizosphere | 73.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10104916 | 3300003320 | Bacteria | 2516 |
| 2 | rootL2_10144200 | 3300003322 | Bacteria | 1811 |
| 3 | JGI25404J52841_10021953 | 3300003659 | Bacteria | 1381 |
| 4 | Ga0070658_10495004 | 3300005327 | Bacteria | 1055 |
| 5 | Ga0070676_10155196 | 3300005328 | Bacteria | 1469 |
| 6 | Ga0070676_11003131 | 3300005328 | Bacteria | 627 |
| 7 | Ga0070683_100386523 | 3300005329 | Bacteria | 1334 |
| 8 | Ga0070690_100056075 | 3300005330 | Bacteria | 2525 |
| 9 | Ga0070690_100319261 | 3300005330 | Bacteria | 1119 |
| 10 | Ga0070690_100697566 | 3300005330 | Bacteria | 779 |
| 11 | Ga0070670_100101019 | 3300005331 | Bacteria | 2483 |
| 12 | Ga0068869_100050231 | 3300005334 | Bacteria | 3022 |
| 13 | Ga0068869_100058856 | 3300005334 | Bacteria | 2811 |
| 14 | Ga0070666_10093735 | 3300005335 | Bacteria | 2065 |
| 15 | Ga0070666_10267595 | 3300005335 | Bacteria | 1213 |
| 16 | Ga0070666_10913934 | 3300005335 | Bacteria | 649 |
| 17 | Ga0070680_101447424 | 3300005336 | Bacteria | 595 |
| 18 | Ga0070682_100162240 | 3300005337 | Bacteria | 1545 |
| 19 | Ga0068868_100052909 | 3300005338 | Bacteria | 3197 |
| 20 | Ga0068868_100260799 | 3300005338 | Bacteria | 1461 |
| 21 | Ga0068868_100341923 | 3300005338 | Bacteria | 1280 |
| 22 | Ga0068868_100483960 | 3300005338 | Bacteria | 1082 |
| 23 | Ga0068868_101067994 | 3300005338 | Bacteria | 741 |
| 24 | Ga0070660_100603394 | 3300005339 | Bacteria | 918 |
| 25 | Ga0070689_100417446 | 3300005340 | Bacteria | 1137 |
| 26 | Ga0070689_100870624 | 3300005340 | Bacteria | 796 |
| 27 | Ga0070687_100353829 | 3300005343 | Bacteria | 949 |
| 28 | Ga0070687_100579408 | 3300005343 | Bacteria | 768 |
| 29 | Ga0070661_100171457 | 3300005344 | Bacteria | 1648 |
| 30 | Ga0070661_100210671 | 3300005344 | Bacteria | 1487 |
| 31 | Ga0070661_100283003 | 3300005344 | Bacteria | 1287 |
| 32 | Ga0070661_100363693 | 3300005344 | Bacteria | 1137 |
| 33 | Ga0070661_100466839 | 3300005344 | Bacteria | 1006 |
| 34 | Ga0070668_100062410 | 3300005347 | Bacteria | 2887 |
| 35 | Ga0070668_100066909 | 3300005347 | Bacteria | 2789 |
| 36 | Ga0070668_100175674 | 3300005347 | Bacteria | 1746 |
| 37 | Ga0070668_100182406 | 3300005347 | Bacteria | 1715 |
| 38 | Ga0070668_100836420 | 3300005347 | Bacteria | 820 |
| 39 | Ga0070669_100252431 | 3300005353 | Bacteria | 1405 |
| 40 | Ga0070669_100277603 | 3300005353 | Bacteria | 1342 |
| 41 | Ga0070675_100395138 | 3300005354 | Bacteria | 1233 |
| 42 | Ga0070675_100595130 | 3300005354 | Bacteria | 1003 |
| 43 | Ga0070675_100634740 | 3300005354 | Bacteria | 970 |
| 44 | Ga0070675_101528615 | 3300005354 | Bacteria | 616 |
| 45 | Ga0070671_100115922 | 3300005355 | Bacteria | 2252 |
| 46 | Ga0070671_100534927 | 3300005355 | Bacteria | 1010 |
| 47 | Ga0070674_100167286 | 3300005356 | Bacteria | 1673 |
| 48 | Ga0070674_100316513 | 3300005356 | Bacteria | 1250 |
| 49 | Ga0070674_100446419 | 3300005356 | Bacteria | 1067 |
| 50 | Ga0070674_100723884 | 3300005356 | Bacteria | 853 |
| 51 | Ga0070673_100289473 | 3300005364 | Bacteria | 1439 |
| 52 | Ga0070673_100359545 | 3300005364 | Bacteria | 1294 |
| 53 | Ga0070659_100148359 | 3300005366 | Bacteria | 1912 |
| 54 | Ga0070659_100429066 | 3300005366 | Bacteria | 1119 |
| 55 | Ga0070659_101395384 | 3300005366 | Bacteria | 623 |
| 56 | Ga0070667_100060591 | 3300005367 | Bacteria | 3202 |
| 57 | Ga0070667_101251627 | 3300005367 | Bacteria | 695 |
| 58 | Ga0070667_101459083 | 3300005367 | Bacteria | 642 |
| 59 | Ga0070710_10086088 | 3300005437 | Bacteria | 1845 |
| 60 | Ga0070710_10662303 | 3300005437 | Bacteria | 733 |
| 61 | Ga0070701_10369462 | 3300005438 | Bacteria | 901 |
| 62 | Ga0070711_100023422 | 3300005439 | Bacteria | 4015 |
| 63 | Ga0070700_100149576 | 3300005441 | Bacteria | 1595 |
| 64 | Ga0070700_100150235 | 3300005441 | Bacteria | 1592 |
| 65 | Ga0070700_100552038 | 3300005441 | Bacteria | 895 |
| 66 | Ga0070663_100012307 | 3300005455 | Bacteria | 5407 |
| 67 | Ga0070663_100073868 | 3300005455 | Bacteria | 2488 |
| 68 | Ga0070663_100078350 | 3300005455 | Bacteria | 2422 |
| 69 | Ga0070663_100235132 | 3300005455 | Bacteria | 1444 |
| 70 | Ga0070678_100031128 | 3300005456 | Bacteria | 3676 |
| 71 | Ga0070678_100093597 | 3300005456 | Bacteria | 2311 |
| 72 | Ga0070678_100103337 | 3300005456 | Bacteria | 2213 |
| 73 | Ga0070678_101579375 | 3300005456 | Bacteria | 616 |
| 74 | Ga0070662_100222143 | 3300005457 | Bacteria | 1508 |
| 75 | Ga0070662_100390710 | 3300005457 | Bacteria | 1147 |
| 76 | Ga0070706_100316926 | 3300005467 | Bacteria | 1455 |
| 77 | Ga0070684_101944343 | 3300005535 | Bacteria | 555 |
| 78 | Ga0068853_100170181 | 3300005539 | Bacteria | 1971 |
| 79 | Ga0068853_100225066 | 3300005539 | Bacteria | 1714 |
| 80 | Ga0070672_100270710 | 3300005543 | Bacteria | 1434 |
| 81 | Ga0070672_100670420 | 3300005543 | Bacteria | 907 |
| 82 | Ga0070672_100827451 | 3300005543 | Bacteria | 815 |
| 83 | Ga0070686_100020047 | 3300005544 | Bacteria | 3953 |
| 84 | Ga0070695_100732684 | 3300005545 | Bacteria | 787 |
| 85 | Ga0070696_100058612 | 3300005546 | Bacteria | 2689 |
| 86 | Ga0070665_100004203 | 3300005548 | Bacteria | 15155 |
| 87 | Ga0070665_100009471 | 3300005548 | Bacteria | 9855 |
| 88 | Ga0070665_100077521 | 3300005548 | Bacteria | 3330 |
| 89 | Ga0070665_100112322 | 3300005548 | Bacteria | 2727 |
| 90 | Ga0070665_100124827 | 3300005548 | Bacteria | 2576 |
| 91 | Ga0070665_100151199 | 3300005548 | Bacteria | 2324 |
| 92 | Ga0070665_100184209 | 3300005548 | Bacteria | 2089 |
| 93 | Ga0070665_100227808 | 3300005548 | Bacteria | 1864 |
| 94 | Ga0070665_100305738 | 3300005548 | Bacteria | 1593 |
| 95 | Ga0070665_100577963 | 3300005548 | Bacteria | 1136 |
| 96 | Ga0070665_101698096 | 3300005548 | Bacteria | 639 |
| 97 | Ga0068855_100102902 | 3300005563 | Bacteria | 3287 |
| 98 | Ga0068855_100699865 | 3300005563 | Bacteria | 1084 |
| 99 | Ga0068855_101015023 | 3300005563 | Bacteria | 871 |
| 100 | Ga0070664_100057841 | 3300005564 | Bacteria | 3297 |
| 101 | Ga0070664_100819432 | 3300005564 | Bacteria | 871 |
| 102 | Ga0070664_100929488 | 3300005564 | Bacteria | 816 |
| 103 | Ga0070664_101620012 | 3300005564 | Bacteria | 613 |
| 104 | Ga0068857_100431555 | 3300005577 | Bacteria | 1230 |
| 105 | Ga0068856_100043240 | 3300005614 | Bacteria | 4433 |
| 106 | Ga0068856_100412336 | 3300005614 | Bacteria | 1371 |
| 107 | Ga0068856_100629511 | 3300005614 | Bacteria | 1093 |
| 108 | Ga0068856_101095015 | 3300005614 | Bacteria | 814 |
| 109 | Ga0068852_100189509 | 3300005616 | Bacteria | 1939 |
| 110 | Ga0068852_100278437 | 3300005616 | Bacteria | 1612 |
| 111 | Ga0068852_100906621 | 3300005616 | Bacteria | 899 |
| 112 | Ga0068852_101108698 | 3300005616 | Bacteria | 812 |
| 113 | Ga0068859_100066012 | 3300005617 | Bacteria | 3653 |
| 114 | Ga0068859_100172003 | 3300005617 | Bacteria | 2247 |
| 115 | Ga0068859_100609553 | 3300005617 | Bacteria | 1184 |
| 116 | Ga0068864_100028662 | 3300005618 | Bacteria | 4709 |
| 117 | Ga0068864_100059050 | 3300005618 | Bacteria | 3317 |
| 118 | Ga0068864_101977029 | 3300005618 | Bacteria | 589 |
| 119 | Ga0068866_10067059 | 3300005718 | Bacteria | 1883 |
| 120 | Ga0068866_10072159 | 3300005718 | Bacteria | 1828 |
| 121 | Ga0068866_10077238 | 3300005718 | Bacteria | 1778 |
| 122 | Ga0068866_10146133 | 3300005718 | Bacteria | 1363 |
| 123 | Ga0068861_100082824 | 3300005719 | Bacteria | 2515 |
| 124 | Ga0068861_100090685 | 3300005719 | Bacteria | 2412 |
| 125 | Ga0068861_100250660 | 3300005719 | Bacteria | 1510 |
| 126 | Ga0068861_100337141 | 3300005719 | Bacteria | 1318 |
| 127 | Ga0068861_100423535 | 3300005719 | Bacteria | 1187 |
| 128 | Ga0068851_10204645 | 3300005834 | Bacteria | 1103 |
| 129 | Ga0068851_10461885 | 3300005834 | Bacteria | 756 |
| 130 | Ga0068851_10848868 | 3300005834 | Bacteria | 570 |
| 131 | Ga0068870_10083541 | 3300005840 | Bacteria | 1770 |
| 132 | Ga0068870_10261051 | 3300005840 | Bacteria | 1078 |
| 133 | Ga0068870_10340807 | 3300005840 | Bacteria | 959 |
| 134 | Ga0068870_10735087 | 3300005840 | Bacteria | 684 |
| 135 | Ga0068863_100105012 | 3300005841 | Bacteria | 2687 |
| 136 | Ga0068863_100391160 | 3300005841 | Bacteria | 1359 |
| 137 | Ga0068863_100732803 | 3300005841 | Bacteria | 984 |
| 138 | Ga0068858_100049881 | 3300005842 | Bacteria | 3875 |
| 139 | Ga0068858_100192587 | 3300005842 | Bacteria | 1927 |
| 140 | Ga0068858_100201825 | 3300005842 | Bacteria | 1881 |
| 141 | Ga0068858_100581291 | 3300005842 | Bacteria | 1086 |
| 142 | Ga0068858_101319456 | 3300005842 | Unclassified | 710 |
| 143 | Ga0068860_100058803 | 3300005843 | Bacteria | 3655 |
| 144 | Ga0068860_100108629 | 3300005843 | Bacteria | 2651 |
| 145 | Ga0068860_100359890 | 3300005843 | Bacteria | 1433 |
| 146 | Ga0068860_100378241 | 3300005843 | Bacteria | 1397 |
| 147 | Ga0068862_100177803 | 3300005844 | Bacteria | 1908 |
| 148 | Ga0068862_100214213 | 3300005844 | Bacteria | 1741 |
| 149 | Ga0068862_100279144 | 3300005844 | Bacteria | 1530 |
| 150 | Ga0068862_100314700 | 3300005844 | Bacteria | 1443 |
| 151 | Ga0068862_100642660 | 3300005844 | Bacteria | 1023 |
| 152 | Ga0068862_100676855 | 3300005844 | Bacteria | 997 |
| 153 | Ga0081455_10007513 | 3300005937 | Bacteria | 11465 |
| 154 | Ga0081455_10080276 | 3300005937 | Bacteria | 2675 |
| 155 | Ga0081540_1002549 | 3300005983 | Bacteria | 14782 |
| 156 | Ga0081540_1003522 | 3300005983 | Bacteria | 12352 |
| 157 | Ga0081540_1009485 | 3300005983 | Bacteria | 6704 |
| 158 | Ga0081540_1029221 | 3300005983 | Bacteria | 3076 |
| 159 | Ga0081540_1034399 | 3300005983 | Bacteria | 2734 |
| 160 | Ga0081540_1035227 | 3300005983 | Bacteria | 2687 |
| 161 | Ga0081540_1037441 | 3300005983 | Bacteria | 2572 |
| 162 | Ga0081540_1058840 | 3300005983 | Bacteria | 1848 |
| 163 | Ga0081540_1065600 | 3300005983 | Bacteria | 1706 |
| 164 | Ga0081540_1070927 | 3300005983 | Bacteria | 1612 |
| 165 | Ga0081539_10002259 | 3300005985 | Bacteria | 28018 |
| 166 | Ga0081539_10040454 | 3300005985 | Bacteria | 2736 |
| 167 | Ga0075365_10050170 | 3300006038 | Bacteria | 2753 |
| 168 | Ga0075365_10063990 | 3300006038 | Bacteria | 2463 |
| 169 | Ga0075365_10071281 | 3300006038 | Bacteria | 2339 |
| 170 | Ga0075365_10148595 | 3300006038 | Bacteria | 1629 |
| 171 | Ga0075365_10358692 | 3300006038 | Bacteria | 1028 |
| 172 | Ga0075365_10362240 | 3300006038 | Bacteria | 1022 |
| 173 | Ga0075368_10031546 | 3300006042 | Bacteria | 2055 |
| 174 | Ga0075368_10148456 | 3300006042 | Bacteria | 979 |
| 175 | Ga0075363_100009597 | 3300006048 | Bacteria | 4555 |
| 176 | Ga0075363_100170012 | 3300006048 | Bacteria | 1237 |
| 177 | Ga0075363_100219133 | 3300006048 | Bacteria | 1090 |
| 178 | Ga0075363_100256158 | 3300006048 | Bacteria | 1008 |
| 179 | Ga0075364_10121037 | 3300006051 | Bacteria | 1752 |
| 180 | Ga0075364_10205693 | 3300006051 | Bacteria | 1335 |
| 181 | Ga0070716_100441956 | 3300006173 | Bacteria | 946 |
| 182 | Ga0070712_100168632 | 3300006175 | Bacteria | 1697 |
| 183 | Ga0075362_10036045 | 3300006177 | Bacteria | 2162 |
| 184 | Ga0075367_10003520 | 3300006178 | Bacteria | 7484 |
| 185 | Ga0075367_10029963 | 3300006178 | Bacteria | 3116 |
| 186 | Ga0075367_10130645 | 3300006178 | Bacteria | 1552 |
| 187 | Ga0075367_10150157 | 3300006178 | Bacteria | 1446 |
| 188 | Ga0075367_10541823 | 3300006178 | Bacteria | 739 |
| 189 | Ga0075369_10029004 | 3300006186 | Bacteria | 2322 |
| 190 | Ga0075369_10150151 | 3300006186 | Bacteria | 1065 |
| 191 | Ga0075366_10057761 | 3300006195 | Bacteria | 2305 |
| 192 | Ga0075366_10155797 | 3300006195 | Bacteria | 1383 |
| 193 | Ga0075366_10341244 | 3300006195 | Bacteria | 919 |
| 194 | Ga0097621_102263669 | 3300006237 | Bacteria | 520 |
| 195 | Ga0075370_10018348 | 3300006353 | Bacteria | 3797 |
| 196 | Ga0075370_10034805 | 3300006353 | Bacteria | 2824 |
| 197 | Ga0075370_10052957 | 3300006353 | Bacteria | 2303 |
| 198 | Ga0075370_10104761 | 3300006353 | Bacteria | 1639 |
| 199 | Ga0068871_100012150 | 3300006358 | Bacteria | 6338 |
| 200 | Ga0068871_100457600 | 3300006358 | Bacteria | 1145 |
| 201 | Ga0068871_101477952 | 3300006358 | Bacteria | 642 |
| 202 | Ga0075428_101350500 | 3300006844 | Bacteria | 749 |
| 203 | Ga0075428_101397160 | 3300006844 | Bacteria | 735 |
| 204 | Ga0075430_100300783 | 3300006846 | Bacteria | 1327 |
| 205 | Ga0075431_101010994 | 3300006847 | Bacteria | 798 |
| 206 | Ga0075433_10826858 | 3300006852 | Bacteria | 809 |
| 207 | Ga0075434_100249710 | 3300006871 | Bacteria | 1793 |
| 208 | Ga0068865_100105024 | 3300006881 | Bacteria | 2074 |
| 209 | Ga0068865_100210589 | 3300006881 | Bacteria | 1514 |
| 210 | Ga0068865_100400911 | 3300006881 | Bacteria | 1123 |
| 211 | Ga0068865_100513870 | 3300006881 | Bacteria | 1001 |
| 212 | Ga0068865_100521519 | 3300006881 | Bacteria | 994 |
| 213 | Ga0075436_101181741 | 3300006914 | Bacteria | 577 |
| 214 | Ga0097620_100066005 | 3300006931 | Bacteria | 3653 |
| 215 | Ga0097620_100171999 | 3300006931 | Bacteria | 2247 |
| 216 | Ga0097620_100609529 | 3300006931 | Bacteria | 1184 |
| 217 | Ga0075435_100102763 | 3300007076 | Bacteria | 2369 |
| 218 | Ga0099794_10182284 | 3300007265 | Bacteria | 1072 |
| 219 | Ga0099795_10030957 | 3300007788 | Bacteria | 1840 |
| 220 | Ga0105250_10010709 | 3300009092 | Bacteria | 3817 |
| 221 | Ga0105240_10232630 | 3300009093 | Bacteria | 2141 |
| 222 | Ga0105240_10289820 | 3300009093 | Bacteria | 1877 |
| 223 | Ga0105240_10732734 | 3300009093 | Bacteria | 1076 |
| 224 | Ga0111539_10632735 | 3300009094 | Bacteria | 1246 |
| 225 | Ga0111539_10687070 | 3300009094 | Bacteria | 1191 |
| 226 | Ga0105245_10154221 | 3300009098 | Bacteria | 2174 |
| 227 | Ga0105245_10660941 | 3300009098 | Bacteria | 1076 |
| 228 | Ga0105245_11037840 | 3300009098 | Bacteria | 865 |
| 229 | Ga0105245_11737719 | 3300009098 | Bacteria | 676 |
| 230 | Ga0105245_11809873 | 3300009098 | Bacteria | 663 |
| 231 | Ga0105247_10056856 | 3300009101 | Bacteria | 2417 |
| 232 | Ga0105247_10094995 | 3300009101 | Bacteria | 1898 |
| 233 | Ga0105247_10218005 | 3300009101 | Bacteria | 1290 |
| 234 | Ga0105247_10224527 | 3300009101 | Bacteria | 1273 |
| 235 | Ga0114129_10340226 | 3300009147 | Bacteria | 1990 |
| 236 | Ga0114129_10520407 | 3300009147 | Bacteria | 1551 |
| 237 | Ga0105243_10191923 | 3300009148 | Bacteria | 1785 |
| 238 | Ga0105243_10274048 | 3300009148 | Bacteria | 1516 |
| 239 | Ga0105243_10500350 | 3300009148 | Bacteria | 1151 |
| 240 | Ga0105241_10031978 | 3300009174 | Bacteria | 3941 |
| 241 | Ga0105241_10583277 | 3300009174 | Bacteria | 1008 |
| 242 | Ga0105241_10608832 | 3300009174 | Bacteria | 988 |
| 243 | Ga0105242_10820502 | 3300009176 | Bacteria | 922 |
| 244 | Ga0105248_10056455 | 3300009177 | Bacteria | 4405 |
| 245 | Ga0105248_10284047 | 3300009177 | Bacteria | 1863 |
| 246 | Ga0105248_10555013 | 3300009177 | Bacteria | 1296 |
| 247 | Ga0105248_10989167 | 3300009177 | Bacteria | 950 |
| 248 | Ga0105237_10277008 | 3300009545 | Bacteria | 1680 |
| 249 | Ga0105237_10321090 | 3300009545 | Bacteria | 1552 |
| 250 | Ga0105237_10349091 | 3300009545 | Bacteria | 1484 |
| 251 | Ga0105237_10388607 | 3300009545 | Bacteria | 1400 |
| 252 | Ga0105237_11533107 | 3300009545 | Bacteria | 673 |
| 253 | Ga0105238_10056480 | 3300009551 | Bacteria | 3938 |
| 254 | Ga0105238_10515559 | 3300009551 | Bacteria | 1198 |
| 255 | Ga0105238_10910579 | 3300009551 | Bacteria | 898 |
| 256 | Ga0105238_11003259 | 3300009551 | Bacteria | 856 |
| 257 | Ga0105249_10235264 | 3300009553 | Bacteria | 1808 |
| 258 | Ga0105249_11527778 | 3300009553 | Bacteria | 740 |
| 259 | Ga0105239_10110518 | 3300010375 | Bacteria | 3047 |
| 260 | Ga0105239_10123043 | 3300010375 | Bacteria | 2883 |
| 261 | Ga0105239_10273304 | 3300010375 | Bacteria | 1901 |
| 262 | Ga0105239_10306637 | 3300010375 | Bacteria | 1789 |
| 263 | Ga0105239_10605370 | 3300010375 | Bacteria | 1250 |
| 264 | Ga0105239_10919938 | 3300010375 | Bacteria | 1004 |
| 265 | Ga0105246_10050528 | 3300011119 | Bacteria | 2852 |
| 266 | Ga0105246_10081082 | 3300011119 | Bacteria | 2311 |
| 267 | Ga0105246_10231528 | 3300011119 | Bacteria | 1455 |
| 268 | Ga0105246_10480243 | 3300011119 | Bacteria | 1051 |
| 269 | Ga0105246_10512460 | 3300011119 | Bacteria | 1021 |
| 270 | Ga0105246_10586606 | 3300011119 | Bacteria | 961 |
| 271 | Ga0157371_10757451 | 3300013102 | Bacteria | 729 |
| 272 | Ga0157374_10018731 | 3300013296 | Bacteria | 6116 |
| 273 | Ga0157374_10051454 | 3300013296 | Bacteria | 3833 |
| 274 | Ga0157374_10433261 | 3300013296 | Bacteria | 1315 |
| 275 | Ga0157378_10266102 | 3300013297 | Bacteria | 1647 |
| 276 | Ga0157378_10271398 | 3300013297 | Bacteria | 1631 |
| 277 | Ga0157378_11112613 | 3300013297 | Bacteria | 827 |
| 278 | Ga0157378_11596446 | 3300013297 | Bacteria | 698 |
| 279 | Ga0163162_10117403 | 3300013306 | Bacteria | 2762 |
| 280 | Ga0163162_10219593 | 3300013306 | Bacteria | 2031 |
| 281 | Ga0163162_10322849 | 3300013306 | Bacteria | 1676 |
| 282 | Ga0163162_10544588 | 3300013306 | Bacteria | 1289 |
| 283 | Ga0157372_12243697 | 3300013307 | Bacteria | 627 |
| 284 | Ga0157372_12626389 | 3300013307 | Bacteria | 578 |
| 285 | Ga0157375_10231676 | 3300013308 | Bacteria | 2006 |
| 286 | Ga0157375_10472529 | 3300013308 | Bacteria | 1419 |
| 287 | Ga0157375_10499816 | 3300013308 | Bacteria | 1380 |
| 288 | Ga0157375_11103194 | 3300013308 | Bacteria | 929 |
| 289 | Ga0157375_11385422 | 3300013308 | Bacteria | 828 |
| 290 | Ga0163163_10382437 | 3300014325 | Bacteria | 1465 |
| 291 | Ga0163163_10390701 | 3300014325 | Bacteria | 1449 |
| 292 | Ga0163163_10412706 | 3300014325 | Bacteria | 1409 |
| 293 | Ga0163163_10554950 | 3300014325 | Bacteria | 1211 |
| 294 | Ga0163163_10786188 | 3300014325 | Bacteria | 1015 |
| 295 | Ga0163163_11229493 | 3300014325 | Bacteria | 812 |
| 296 | Ga0157380_10346838 | 3300014326 | Bacteria | 1387 |
| 297 | Ga0157380_10535167 | 3300014326 | Bacteria | 1146 |
| 298 | Ga0157380_10549582 | 3300014326 | Bacteria | 1132 |
| 299 | Ga0157380_10592666 | 3300014326 | Bacteria | 1095 |
| 300 | Ga0157380_10648775 | 3300014326 | Bacteria | 1052 |
| 301 | Ga0157380_11161973 | 3300014326 | Bacteria | 814 |
| 302 | Ga0157377_10067494 | 3300014745 | Bacteria | 2059 |
| 303 | Ga0157377_10197473 | 3300014745 | Bacteria | 1275 |
| 304 | Ga0157377_10368717 | 3300014745 | Bacteria | 969 |
| 305 | Ga0157379_10121241 | 3300014968 | Bacteria | 2352 |
| 306 | Ga0157379_10183366 | 3300014968 | Bacteria | 1891 |
| 307 | Ga0157379_10548665 | 3300014968 | Bacteria | 1075 |
| 308 | Ga0157379_10869370 | 3300014968 | Bacteria | 854 |
| 309 | Ga0157379_11518385 | 3300014968 | Bacteria | 652 |
| 310 | Ga0157379_11808138 | 3300014968 | Bacteria | 600 |
| 311 | Ga0157376_10209764 | 3300014969 | Bacteria | 1798 |
| 312 | Ga0157376_10282923 | 3300014969 | Bacteria | 1563 |
| 313 | Ga0157376_10531823 | 3300014969 | Bacteria | 1160 |
| 314 | Ga0157376_11237757 | 3300014969 | Bacteria | 775 |
| 315 | Ga0163161_10171195 | 3300017792 | Bacteria | 1661 |
| 316 | Ga0163161_10652617 | 3300017792 | Bacteria | 872 |
| 317 | Ga0209758_1006620 | 3300025297 | Bacteria | 8210 |
| 318 | Ga0209758_1023273 | 3300025297 | Bacteria | 2808 |
| 319 | Ga0207697_10062544 | 3300025315 | Bacteria | 1550 |
| 320 | Ga0207696_1058404 | 3300025711 | Bacteria | 1089 |
| 321 | Ga0207692_10040762 | 3300025898 | Bacteria | 2294 |
| 322 | Ga0207642_10093257 | 3300025899 | Bacteria | 1493 |
| 323 | Ga0207642_10112362 | 3300025899 | Bacteria | 1390 |
| 324 | Ga0207642_10162989 | 3300025899 | Bacteria | 1199 |
| 325 | Ga0207642_10191577 | 3300025899 | Bacteria | 1122 |
| 326 | Ga0207642_10457645 | 3300025899 | Bacteria | 774 |
| 327 | Ga0207710_10456559 | 3300025900 | Bacteria | 660 |
| 328 | Ga0207688_10053044 | 3300025901 | Bacteria | 2273 |
| 329 | Ga0207688_10509250 | 3300025901 | Bacteria | 754 |
| 330 | Ga0207680_10065184 | 3300025903 | Bacteria | 2235 |
| 331 | Ga0207680_10148456 | 3300025903 | Bacteria | 1561 |
| 332 | Ga0207647_10117577 | 3300025904 | Bacteria | 1569 |
| 333 | Ga0207645_10050155 | 3300025907 | Bacteria | 2665 |
| 334 | Ga0207645_10195363 | 3300025907 | Bacteria | 1330 |
| 335 | Ga0207643_10027031 | 3300025908 | Bacteria | 3180 |
| 336 | Ga0207643_10093287 | 3300025908 | Bacteria | 1757 |
| 337 | Ga0207643_10185199 | 3300025908 | Bacteria | 1262 |
| 338 | Ga0207643_10591296 | 3300025908 | Bacteria | 714 |
| 339 | Ga0207705_10949218 | 3300025909 | Bacteria | 665 |
| 340 | Ga0207654_10043586 | 3300025911 | Bacteria | 2544 |
| 341 | Ga0207695_10208430 | 3300025913 | Bacteria | 1866 |
| 342 | Ga0207671_10183049 | 3300025914 | Bacteria | 1631 |
| 343 | Ga0207671_10299962 | 3300025914 | Bacteria | 1269 |
| 344 | Ga0207671_10393774 | 3300025914 | Bacteria | 1101 |
| 345 | Ga0207693_10392760 | 3300025915 | Bacteria | 1085 |
| 346 | Ga0207663_10029308 | 3300025916 | Bacteria | 3231 |
| 347 | Ga0207662_10124258 | 3300025918 | Bacteria | 1621 |
| 348 | Ga0207657_10243596 | 3300025919 | Bacteria | 1435 |
| 349 | Ga0207657_10832443 | 3300025919 | Bacteria | 713 |
| 350 | Ga0207649_10091707 | 3300025920 | Bacteria | 1991 |
| 351 | Ga0207649_10206911 | 3300025920 | Bacteria | 1390 |
| 352 | Ga0207649_10279398 | 3300025920 | Bacteria | 1213 |
| 353 | Ga0207649_10329072 | 3300025920 | Bacteria | 1125 |
| 354 | Ga0207652_10044564 | 3300025921 | Bacteria | 3779 |
| 355 | Ga0207681_10077879 | 3300025923 | Bacteria | 2332 |
| 356 | Ga0207681_10123131 | 3300025923 | Bacteria | 1905 |
| 357 | Ga0207694_10708790 | 3300025924 | Bacteria | 849 |
| 358 | Ga0207694_10867886 | 3300025924 | Bacteria | 763 |
| 359 | Ga0207650_10693470 | 3300025925 | Bacteria | 860 |
| 360 | Ga0207659_10148531 | 3300025926 | Bacteria | 1828 |
| 361 | Ga0207659_11305647 | 3300025926 | Bacteria | 623 |
| 362 | Ga0207687_10112630 | 3300025927 | Bacteria | 2022 |
| 363 | Ga0207687_10157950 | 3300025927 | Bacteria | 1737 |
| 364 | Ga0207687_10551840 | 3300025927 | Bacteria | 967 |
| 365 | Ga0207644_10061288 | 3300025931 | Bacteria | 2724 |
| 366 | Ga0207644_10373537 | 3300025931 | Bacteria | 1162 |
| 367 | Ga0207644_10763078 | 3300025931 | Bacteria | 808 |
| 368 | Ga0207690_10070494 | 3300025932 | Bacteria | 2408 |
| 369 | Ga0207690_10841313 | 3300025932 | Bacteria | 759 |
| 370 | Ga0207706_10169596 | 3300025933 | Bacteria | 1918 |
| 371 | Ga0207706_10197484 | 3300025933 | Bacteria | 1764 |
| 372 | Ga0207706_10326947 | 3300025933 | Bacteria | 1334 |
| 373 | Ga0207706_10381971 | 3300025933 | Bacteria | 1222 |
| 374 | Ga0207706_10997141 | 3300025933 | Bacteria | 704 |
| 375 | Ga0207706_11016156 | 3300025933 | Bacteria | 696 |
| 376 | Ga0207686_10625219 | 3300025934 | Bacteria | 850 |
| 377 | Ga0207709_10010739 | 3300025935 | Bacteria | 5044 |
| 378 | Ga0207709_10228373 | 3300025935 | Bacteria | 1347 |
| 379 | Ga0207709_10436611 | 3300025935 | Bacteria | 1009 |
| 380 | Ga0207709_11196915 | 3300025935 | Bacteria | 626 |
| 381 | Ga0207670_10433982 | 3300025936 | Bacteria | 1056 |
| 382 | Ga0207669_10053603 | 3300025937 | Bacteria | 2431 |
| 383 | Ga0207669_10558324 | 3300025937 | Bacteria | 925 |
| 384 | Ga0207669_10672711 | 3300025937 | Bacteria | 848 |
| 385 | Ga0207704_10094491 | 3300025938 | Bacteria | 1974 |
| 386 | Ga0207704_10350533 | 3300025938 | Bacteria | 1149 |
| 387 | Ga0207704_10566371 | 3300025938 | Bacteria | 925 |
| 388 | Ga0207704_10637672 | 3300025938 | Bacteria | 876 |
| 389 | Ga0207665_10104988 | 3300025939 | Bacteria | 1978 |
| 390 | Ga0207665_10394179 | 3300025939 | Bacteria | 1053 |
| 391 | Ga0207691_10208471 | 3300025940 | Bacteria | 1699 |
| 392 | Ga0207691_10336219 | 3300025940 | Bacteria | 1293 |
| 393 | Ga0207691_11075556 | 3300025940 | Bacteria | 670 |
| 394 | Ga0207711_10041759 | 3300025941 | Bacteria | 3907 |
| 395 | Ga0207711_10216117 | 3300025941 | Bacteria | 1752 |
| 396 | Ga0207711_10362056 | 3300025941 | Bacteria | 1344 |
| 397 | Ga0207711_10629547 | 3300025941 | Bacteria | 1001 |
| 398 | Ga0207689_10039433 | 3300025942 | Bacteria | 3910 |
| 399 | Ga0207689_10067712 | 3300025942 | Bacteria | 2934 |
| 400 | Ga0207689_10354933 | 3300025942 | Bacteria | 1219 |
| 401 | Ga0207689_10553420 | 3300025942 | Bacteria | 966 |
| 402 | Ga0207661_10105656 | 3300025944 | Bacteria | 2373 |
| 403 | Ga0207679_10062689 | 3300025945 | Bacteria | 2772 |
| 404 | Ga0207679_10117734 | 3300025945 | Bacteria | 2109 |
| 405 | Ga0207679_10265087 | 3300025945 | Bacteria | 1467 |
| 406 | Ga0207679_10424614 | 3300025945 | Bacteria | 1174 |
| 407 | Ga0207679_10512255 | 3300025945 | Bacteria | 1072 |
| 408 | Ga0207667_10080731 | 3300025949 | Bacteria | 3369 |
| 409 | Ga0207667_10209621 | 3300025949 | Bacteria | 1997 |
| 410 | Ga0207651_10245093 | 3300025960 | Bacteria | 1463 |
| 411 | Ga0207651_11159151 | 3300025960 | Bacteria | 693 |
| 412 | Ga0207712_10036980 | 3300025961 | Bacteria | 3328 |
| 413 | Ga0207712_10089813 | 3300025961 | Bacteria | 2259 |
| 414 | Ga0207668_10019940 | 3300025972 | Bacteria | 4250 |
| 415 | Ga0207668_10023124 | 3300025972 | Bacteria | 3989 |
| 416 | Ga0207668_10065657 | 3300025972 | Bacteria | 2569 |
| 417 | Ga0207668_10246095 | 3300025972 | Bacteria | 1449 |
| 418 | Ga0207668_10253503 | 3300025972 | Bacteria | 1430 |
| 419 | Ga0207668_10265918 | 3300025972 | Bacteria | 1400 |
| 420 | Ga0207668_10386500 | 3300025972 | Bacteria | 1179 |
| 421 | Ga0207668_10700088 | 3300025972 | Bacteria | 890 |
| 422 | Ga0207668_10826863 | 3300025972 | Bacteria | 821 |
| 423 | Ga0207668_10828184 | 3300025972 | Bacteria | 820 |
| 424 | Ga0207640_10349913 | 3300025981 | Bacteria | 1187 |
| 425 | Ga0207658_10095459 | 3300025986 | Bacteria | 2317 |
| 426 | Ga0207658_10369273 | 3300025986 | Bacteria | 1254 |
| 427 | Ga0207677_10020729 | 3300026023 | Bacteria | 3998 |
| 428 | Ga0207677_10097727 | 3300026023 | Bacteria | 2152 |
| 429 | Ga0207677_10250716 | 3300026023 | Bacteria | 1437 |
| 430 | Ga0207677_10699397 | 3300026023 | Bacteria | 899 |
| 431 | Ga0207703_10114655 | 3300026035 | Bacteria | 2305 |
| 432 | Ga0207703_10138276 | 3300026035 | Bacteria | 2111 |
| 433 | Ga0207703_10219206 | 3300026035 | Bacteria | 1700 |
| 434 | Ga0207639_10123795 | 3300026041 | Bacteria | 2129 |
| 435 | Ga0207639_10226335 | 3300026041 | Bacteria | 1618 |
| 436 | Ga0207639_10539757 | 3300026041 | Bacteria | 1070 |
| 437 | Ga0207639_10970615 | 3300026041 | Bacteria | 795 |
| 438 | Ga0207678_10032526 | 3300026067 | Bacteria | 4545 |
| 439 | Ga0207678_10043098 | 3300026067 | Bacteria | 3906 |
| 440 | Ga0207678_10061848 | 3300026067 | Bacteria | 3220 |
| 441 | Ga0207678_10271563 | 3300026067 | Bacteria | 1454 |
| 442 | Ga0207678_10577766 | 3300026067 | Bacteria | 984 |
| 443 | Ga0207678_10756362 | 3300026067 | Bacteria | 857 |
| 444 | Ga0207708_10077375 | 3300026075 | Bacteria | 2553 |
| 445 | Ga0207708_10237664 | 3300026075 | Bacteria | 1464 |
| 446 | Ga0207708_10423269 | 3300026075 | Bacteria | 1104 |
| 447 | Ga0207708_10507752 | 3300026075 | Bacteria | 1011 |
| 448 | Ga0207708_10675935 | 3300026075 | Bacteria | 881 |
| 449 | Ga0207702_10046401 | 3300026078 | Bacteria | 3657 |
| 450 | Ga0207702_11619720 | 3300026078 | Bacteria | 641 |
| 451 | Ga0207641_10230182 | 3300026088 | Bacteria | 1722 |
| 452 | Ga0207641_10233998 | 3300026088 | Bacteria | 1709 |
| 453 | Ga0207641_10988089 | 3300026088 | Bacteria | 838 |
| 454 | Ga0207648_10056377 | 3300026089 | Bacteria | 3430 |
| 455 | Ga0207648_10277663 | 3300026089 | Bacteria | 1498 |
| 456 | Ga0207648_10509395 | 3300026089 | Bacteria | 1102 |
| 457 | Ga0207676_10040090 | 3300026095 | Bacteria | 3587 |
| 458 | Ga0207676_10064028 | 3300026095 | Bacteria | 2922 |
| 459 | Ga0207676_10508424 | 3300026095 | Bacteria | 1145 |
| 460 | Ga0207676_11833737 | 3300026095 | Bacteria | 605 |
| 461 | Ga0207674_10529027 | 3300026116 | Bacteria | 1139 |
| 462 | Ga0207674_11490176 | 3300026116 | Bacteria | 646 |
| 463 | Ga0207675_100028928 | 3300026118 | Bacteria | 5162 |
| 464 | Ga0207675_100063858 | 3300026118 | Bacteria | 3440 |
| 465 | Ga0207675_100195014 | 3300026118 | Bacteria | 1944 |
| 466 | Ga0207675_100504980 | 3300026118 | Bacteria | 1204 |
| 467 | Ga0207675_101547370 | 3300026118 | Bacteria | 684 |
| 468 | Ga0207683_10027677 | 3300026121 | Bacteria | 4898 |
| 469 | Ga0207683_10030892 | 3300026121 | Bacteria | 4645 |
| 470 | Ga0207683_10117220 | 3300026121 | Bacteria | 2388 |
| 471 | Ga0207683_10269089 | 3300026121 | Bacteria | 1556 |
| 472 | Ga0207683_10410557 | 3300026121 | Bacteria | 1246 |
| 473 | Ga0207683_10500174 | 3300026121 | Bacteria | 1123 |
| 474 | Ga0207683_10770452 | 3300026121 | Bacteria | 893 |
| 475 | Ga0207698_10137494 | 3300026142 | Bacteria | 2099 |
| 476 | Ga0207698_11265862 | 3300026142 | Bacteria | 752 |
| 477 | Ga0207698_11279665 | 3300026142 | Bacteria | 748 |
| 478 | Ga0207698_12170278 | 3300026142 | Bacteria | 568 |
| 479 | Ga0209588_1000800 | 3300027671 | Bacteria | 7985 |
| 480 | Ga0209813_10066460 | 3300027866 | Bacteria | 1163 |
| 481 | Ga0207428_10402407 | 3300027907 | Bacteria | 1002 |
| 482 | Ga0268266_10006104 | 3300028379 | Bacteria | 11096 |
| 483 | Ga0268266_10099968 | 3300028379 | Bacteria | 2554 |
| 484 | Ga0268266_10168235 | 3300028379 | Bacteria | 1988 |
| 485 | Ga0268266_10928574 | 3300028379 | Bacteria | 842 |
| 486 | Ga0268265_10048108 | 3300028380 | Bacteria | 3199 |
| 487 | Ga0268265_10093002 | 3300028380 | Bacteria | 2415 |
| 488 | Ga0268265_10111628 | 3300028380 | Bacteria | 2233 |
| 489 | Ga0268265_10141673 | 3300028380 | Bacteria | 2013 |
| 490 | Ga0268265_10317726 | 3300028380 | Bacteria | 1409 |
| 491 | Ga0268265_10478001 | 3300028380 | Bacteria | 1169 |
| 492 | Ga0268265_10803871 | 3300028380 | Bacteria | 917 |
| 493 | Ga0268264_10066935 | 3300028381 | Bacteria | 3031 |
| 494 | Ga0268264_10516701 | 3300028381 | Bacteria | 1167 |
| 495 | Ga0268264_10565213 | 3300028381 | Bacteria | 1117 |
| 496 | Ga0268264_10851582 | 3300028381 | Bacteria | 913 |
| 497 | Ga0307517_10001338 | 3300028786 | Bacteria | 41372 |
| 498 | Ga0307515_10036525 | 3300028794 | Bacteria | 7944 |
| 499 | Ga0307515_10448358 | 3300028794 | Bacteria | 906 |
| 500 | Ga0307511_10212060 | 3300030521 | Bacteria | 987 |
| 501 | Ga0307513_10340745 | 3300031456 | Bacteria | 1250 |
| 502 | Ga0307408_100384323 | 3300031548 | Bacteria | 1201 |
| 503 | Ga0307408_100431421 | 3300031548 | Bacteria | 1139 |
| 504 | Ga0307516_10008231 | 3300031730 | Bacteria | 11840 |
| 505 | Ga0307516_10029188 | 3300031730 | Bacteria | 5577 |
| 506 | Ga0307516_10287509 | 3300031730 | Bacteria | 1324 |
| 507 | Ga0307516_10634793 | 3300031730 | Bacteria | 723 |
| 508 | Ga0307413_10034084 | 3300031824 | Bacteria | 2906 |
| 509 | Ga0307413_11166642 | 3300031824 | Bacteria | 668 |
| 510 | Ga0307406_10044603 | 3300031901 | Bacteria | 2780 |
| 511 | Ga0307406_10587394 | 3300031901 | Bacteria | 917 |
| 512 | Ga0307406_11072533 | 3300031901 | Bacteria | 694 |
| 513 | Ga0307412_10090963 | 3300031911 | Bacteria | 2135 |
| 514 | Ga0307412_10141464 | 3300031911 | Bacteria | 1763 |
| 515 | Ga0307412_10645814 | 3300031911 | Bacteria | 902 |
| 516 | Ga0307409_100267377 | 3300031995 | Bacteria | 1573 |
| 517 | Ga0307416_100150540 | 3300032002 | Bacteria | 2133 |
| 518 | Ga0307416_100293588 | 3300032002 | Bacteria | 1611 |
| 519 | Ga0307416_100499659 | 3300032002 | Bacteria | 1280 |
| 520 | Ga0307411_10241558 | 3300032005 | Bacteria | 1414 |
| 521 | Ga0307411_11488467 | 3300032005 | Bacteria | 622 |
| 522 | Ga0307415_100042079 | 3300032126 | Bacteria | 3038 |
| 523 | Ga0307415_100066547 | 3300032126 | Bacteria | 2515 |
| 524 | Ga0307415_100472074 | 3300032126 | Bacteria | 1090 |
| 525 | Ga0307415_100832057 | 3300032126 | Bacteria | 845 |
| 526 | Ga0307415_101200304 | 3300032126 | Bacteria | 715 |
| 527 | Ga0307510_10001271 | 3300033180 | Bacteria | 27493 |
| 528 | Ga0307510_10164389 | 3300033180 | Bacteria | 1810 |
| 529 | Ga0373928_0120693 | 3300035084 | Bacteria | 702 |
| 530 | Ga0373936_0040480 | 3300035113 | Bacteria | 1867 |
| 531 | Ga0373927_0067522 | 3300035695 | Bacteria | 2314 |
| 532 | Ga0373925_0383771 | 3300037068 | Bacteria | 1144 |
| 533 | Ga0439465_0019851 | 3300041413 | Bacteria | 2102 |
| 534 | Ga0451789_0204474 | 3300041443 | Bacteria | 880 |
| 535 | Ga0451791_0697653 | 3300041451 | Bacteria | 875 |
| 536 | Ga0451797_1323973 | 3300041453 | Bacteria | 779 |
| 537 | Ga0451795_0306874 | 3300041456 | Bacteria | 958 |
| 538 | Ga0451798_1097871 | 3300041458 | Bacteria | 727 |
| 539 | Ga0451800_1593314 | 3300041459 | Bacteria | 900 |
| 540 | Ga0451802_1059125 | 3300041460 | Bacteria | 859 |
| 541 | Ga0451833_0077301 | 3300041491 | Bacteria | 829 |
| 542 | Ga0451839_1189050 | 3300041496 | Bacteria | 597 |
| 543 | Ga0451841_0118866 | 3300041498 | Bacteria | 618 |
| 544 | Ga0451847_0131072 | 3300041503 | Bacteria | 725 |
| 545 | Ga0451855_0645708 | 3300041511 | Bacteria | 555 |
| 546 | Ga0451853_2093545 | 3300041512 | Bacteria | 683 |
| 547 | Ga0451853_3973549 | 3300041512 | Bacteria | 1256 |
| 548 | Ga0439431_0096058 | 3300041997 | Bacteria | 811 |
| 549 | Ga0439459_0057244 | 3300042438 | Bacteria | 872 |
| 550 | Ga0495603_0012846 | 3300046455 | Bacteria | 5063 |
| 551 | Ga0495603_0063011 | 3300046455 | Bacteria | 2188 |
| 552 | Ga0495590_0122970 | 3300046457 | Bacteria | 930 |
| 553 | Ga0495638_0049454 | 3300046460 | Bacteria | 2628 |
| 554 | Ga0495638_0056441 | 3300046460 | Bacteria | 2437 |
| 555 | Ga0495638_0164633 | 3300046460 | Bacteria | 1277 |
| 556 | Ga0495638_0337811 | 3300046460 | Bacteria | 799 |
| 557 | Ga0495580_0724786 | 3300046472 | Bacteria | 649 |
| 558 | Ga0495605_0112127 | 3300046474 | Bacteria | 1243 |
| 559 | Ga0495605_0248588 | 3300046474 | Bacteria | 761 |
| 560 | Ga0495639_0196217 | 3300046475 | Bacteria | 987 |
| 561 | Ga0495584_0388112 | 3300046491 | Bacteria | 709 |
| 562 | Ga0495585_0025931 | 3300046492 | Bacteria | 3352 |
| 563 | Ga0495596_0115283 | 3300046500 | Bacteria | 1043 |
| 564 | Ga0495607_0224148 | 3300046501 | Bacteria | 918 |
| 565 | Ga0495606_0651257 | 3300046507 | Bacteria | 509 |
| 566 | Ga0495616_0102165 | 3300046513 | Bacteria | 1343 |
| 567 | Ga0495620_0067877 | 3300046515 | Bacteria | 1466 |
| 568 | Ga0495620_0187352 | 3300046515 | Bacteria | 799 |
| 569 | Ga0495631_0153362 | 3300046518 | Bacteria | 988 |
| 570 | Ga0495631_0245149 | 3300046518 | Bacteria | 764 |
| 571 | Ga0495632_0069355 | 3300046519 | Bacteria | 1697 |
| 572 | Ga0495643_0294638 | 3300046522 | Bacteria | 742 |
| 573 | Ga0495644_0081779 | 3300046523 | Bacteria | 1218 |
| 574 | Ga0495644_0087035 | 3300046523 | Bacteria | 1178 |
| 575 | Ga0495648_0313929 | 3300046524 | Bacteria | 729 |
| 576 | Ga0495663_0133922 | 3300046525 | Bacteria | 837 |
| 577 | Ga0495666_0159917 | 3300046526 | Bacteria | 1045 |
| 578 | Ga0495642_0334175 | 3300046528 | Bacteria | 665 |
| 579 | Ga0495665_0135927 | 3300046531 | Bacteria | 1286 |
| 580 | Ga0495598_0017737 | 3300046537 | Bacteria | 1839 |
| 581 | Ga0495609_0223398 | 3300046538 | Bacteria | 781 |
| 582 | Ga0495621_0021383 | 3300046539 | Bacteria | 2132 |
| 583 | Ga0495622_0118482 | 3300046557 | Bacteria | 1210 |
| 584 | Ga0495622_0323091 | 3300046557 | Bacteria | 670 |
| 585 | Ga0495633_0123773 | 3300046558 | Bacteria | 1197 |
| 586 | Ga0495656_0030045 | 3300046615 | Bacteria | 2193 |
| 587 | Ga0495656_0063752 | 3300046615 | Bacteria | 1616 |
| 588 | Ga0495668_0300981 | 3300046616 | Bacteria | 879 |
| 589 | Ga0495611_0058435 | 3300046648 | Bacteria | 1749 |
| 590 | Ga0495611_0115176 | 3300046648 | Bacteria | 1252 |
| 591 | Ga0495625_0153785 | 3300046660 | Bacteria | 1545 |
| 592 | Ga0495625_0637374 | 3300046660 | Bacteria | 636 |
| 593 | Ga0495635_0795537 | 3300046663 | Bacteria | 609 |
| 594 | Ga0495659_0195683 | 3300046664 | Bacteria | 827 |
| 595 | Ga0495661_0096281 | 3300046665 | Bacteria | 1674 |
| 596 | Ga0495588_0213977 | 3300046674 | Bacteria | 1017 |
| 597 | Ga0495647_0478380 | 3300046681 | Bacteria | 578 |
| 598 | Ga0495658_0156962 | 3300046683 | Bacteria | 1401 |
| 599 | Ga0495658_0542700 | 3300046683 | Bacteria | 744 |
| 600 | Ga0495669_0020508 | 3300046684 | Bacteria | 2862 |
| 601 | Ga0495669_0131600 | 3300046684 | Bacteria | 1177 |
| 602 | Ga0495613_0430161 | 3300046689 | Bacteria | 897 |
| 603 | Ga0495670_0305380 | 3300046691 | Bacteria | 853 |
| 604 | Ga0495671_0126575 | 3300046692 | Bacteria | 1246 |
| 605 | Ga0495589_0072700 | 3300046794 | Bacteria | 1679 |
| 606 | Ga0495589_0086022 | 3300046794 | Bacteria | 1527 |
| 607 | Ga0495589_0142507 | 3300046794 | Bacteria | 1147 |
| 608 | Ga0495660_0384487 | 3300046810 | Bacteria | 618 |
| 609 | Ga0495581_0011636 | 3300047315 | Bacteria | 5093 |
| 610 | Ga0495581_0127403 | 3300047315 | Bacteria | 1483 |
| 611 | Ga0495581_0223174 | 3300047315 | Bacteria | 1102 |
| 612 | Ga0495581_0318460 | 3300047315 | Bacteria | 909 |
| 613 | Ga0495581_0327529 | 3300047315 | Bacteria | 895 |
| 614 | Ga0495604_0842035 | 3300047317 | Bacteria | 576 |
| 615 | Ga0495636_0049548 | 3300047318 | Bacteria | 1756 |
| 616 | Ga0495636_0058864 | 3300047318 | Bacteria | 1621 |
| 617 | Ga0495636_0089460 | 3300047318 | Bacteria | 1335 |
| 618 | Ga0495636_0224001 | 3300047318 | Bacteria | 864 |
| 619 | Ga0495674_0489472 | 3300047319 | Bacteria | 985 |
| 620 | Ga0495672_0013417 | 3300047320 | Bacteria | 5654 |
| 621 | Ga0495676_0098498 | 3300047321 | Bacteria | 2169 |
| 622 | Ga0495680_0684864 | 3300047322 | Bacteria | 678 |
| 623 | Ga0495673_0019319 | 3300047469 | Bacteria | 3415 |
| 624 | Ga0495673_0221110 | 3300047469 | Bacteria | 701 |
| 625 | Ga0495686_0041319 | 3300047472 | Bacteria | 2937 |
| 626 | Ga0495626_0231595 | 3300048091 | Bacteria | 747 |
| 627 | Ga0496100_0507350 | 3300048903 | Bacteria | 930 |
| 628 | Ga0496100_1376761 | 3300048903 | Bacteria | 557 |
| 629 | Ga0496101_0023371 | 3300048904 | Bacteria | 4270 |
| 630 | Ga0496101_0239352 | 3300048904 | Bacteria | 1412 |
| 631 | Ga0496101_0280213 | 3300048904 | Bacteria | 1303 |
| 632 | Ga0496101_0823504 | 3300048904 | Bacteria | 732 |
| 633 | Ga0496102_0017911 | 3300048905 | Bacteria | 6213 |
| 634 | Ga0496102_0213461 | 3300048905 | Bacteria | 1819 |
| 635 | Ga0496102_0256941 | 3300048905 | Bacteria | 1647 |
| 636 | Ga0496102_0265852 | 3300048905 | Bacteria | 1617 |
| 637 | Ga0496102_0415197 | 3300048905 | Bacteria | 1264 |
| 638 | Ga0496102_0864138 | 3300048905 | Bacteria | 827 |
| 639 | Ga0496103_0071587 | 3300048906 | Bacteria | 2170 |
| 640 | Ga0496103_0082938 | 3300048906 | Bacteria | 2018 |
| 641 | Ga0496103_0186298 | 3300048906 | Bacteria | 1334 |
| 642 | Ga0496104_0411505 | 3300048907 | Bacteria | 1264 |
| 643 | Ga0496104_0623369 | 3300048907 | Bacteria | 988 |
| 644 | Ga0496104_0900353 | 3300048907 | Bacteria | 790 |
| 645 | Ga0496105_0014175 | 3300048908 | Bacteria | 6344 |
| 646 | Ga0496105_0412879 | 3300048908 | Bacteria | 1070 |
| 647 | Ga0496105_0615052 | 3300048908 | Bacteria | 842 |
| 648 | Ga0496106_0001014 | 3300048909 | Bacteria | 20581 |
| 649 | Ga0496106_0030569 | 3300048909 | Bacteria | 4014 |
| 650 | Ga0496106_0094937 | 3300048909 | Bacteria | 2306 |
| 651 | Ga0496106_0213387 | 3300048909 | Bacteria | 1538 |
| 652 | Ga0496107_0073340 | 3300048910 | Bacteria | 2489 |
| 653 | Ga0496107_0129708 | 3300048910 | Bacteria | 1861 |
| 654 | Ga0496107_0218747 | 3300048910 | Bacteria | 1417 |
| 655 | Ga0496108_0050866 | 3300048911 | Bacteria | 3470 |
| 656 | Ga0496108_0071509 | 3300048911 | Bacteria | 2927 |
| 657 | Ga0496108_0463217 | 3300048911 | Bacteria | 1107 |
| 658 | Ga0496109_0186380 | 3300048912 | Bacteria | 1949 |
| 659 | Ga0496109_0538515 | 3300048912 | Bacteria | 1102 |
| 660 | Ga0496110_0142157 | 3300048913 | Bacteria | 2169 |
| 661 | Ga0496111_0033983 | 3300048914 | Bacteria | 3639 |
| 662 | Ga0496111_0064866 | 3300048914 | Bacteria | 2650 |
| 663 | Ga0496112_0277580 | 3300048915 | Bacteria | 1623 |
| 664 | Ga0496112_0448601 | 3300048915 | Bacteria | 1228 |
| 665 | Ga0496113_0103626 | 3300048916 | Bacteria | 2207 |
| 666 | Ga0496113_0482690 | 3300048916 | Bacteria | 995 |
| 667 | Ga0496114_0008301 | 3300048917 | Bacteria | 8230 |
| 668 | Ga0496114_0032009 | 3300048917 | Bacteria | 4327 |
| 669 | Ga0496114_0035932 | 3300048917 | Bacteria | 4094 |
| 670 | Ga0496114_0594040 | 3300048917 | Bacteria | 976 |
| 671 | Ga0496114_0604744 | 3300048917 | Bacteria | 967 |
| 672 | Ga0496114_0679275 | 3300048917 | Bacteria | 904 |
| 673 | Ga0496114_0928793 | 3300048917 | Bacteria | 752 |
| 674 | Ga0496115_0004376 | 3300048918 | Bacteria | 10231 |
| 675 | Ga0496115_0230254 | 3300048918 | Bacteria | 1528 |
| 676 | Ga0496115_0286128 | 3300048918 | Bacteria | 1353 |
| 677 | Ga0496115_0378341 | 3300048918 | Bacteria | 1152 |
| 678 | Ga0496115_0501252 | 3300048918 | Bacteria | 976 |
| 679 | Ga0496118_0153486 | 3300048921 | Bacteria | 1437 |
| 680 | Ga0496119_0124996 | 3300048922 | Bacteria | 1408 |
| 681 | Ga0496121_0175233 | 3300048924 | Bacteria | 1553 |
| 682 | Ga0496121_0193014 | 3300048924 | Bacteria | 1458 |
| 683 | Ga0496121_0195571 | 3300048924 | Bacteria | 1446 |
| 684 | Ga0496121_0296112 | 3300048924 | Bacteria | 1100 |
| 685 | Ga0496121_0722042 | 3300048924 | Bacteria | 596 |
| 686 | Ga0496124_0082915 | 3300048927 | Bacteria | 2631 |
| 687 | Ga0496124_0168126 | 3300048927 | Bacteria | 1702 |
| 688 | Ga0496124_0445202 | 3300048927 | Bacteria | 885 |
| 689 | Ga0496124_0567626 | 3300048927 | Bacteria | 745 |
| 690 | Ga0496125_0090129 | 3300048928 | Bacteria | 2303 |
| 691 | Ga0496125_0242471 | 3300048928 | Bacteria | 1143 |
| 692 | Ga0496125_0437223 | 3300048928 | Bacteria | 753 |
| 693 | Ga0496126_0002460 | 3300048929 | Bacteria | 24974 |
| 694 | Ga0496126_0056061 | 3300048929 | Bacteria | 3563 |
| 695 | Ga0496126_0103546 | 3300048929 | Bacteria | 2487 |
| 696 | Ga0496126_0132946 | 3300048929 | Bacteria | 2148 |
| 697 | Ga0496126_0135890 | 3300048929 | Bacteria | 2121 |
| 698 | Ga0496126_0441969 | 3300048929 | Bacteria | 1048 |
| 699 | Ga0496126_1125551 | 3300048929 | Bacteria | 582 |
| 700 | Ga0495682_0285903 | 3300049460 | Bacteria | 582 |
| 701 | Ga0501039_1090913 | 3300049575 | Bacteria | 619 |
| 702 | nmdc:mga03683_27750_c1 | 3300050489 | Bacteria | 2245 |
| 703 | nmdc:mga03683_29035_c1 | 3300050489 | Bacteria | 2203 |
| 704 | nmdc:mga03n38_533221_c1 | 3300050490 | Bacteria | 662 |
| 705 | nmdc:mga03n38_84131_c1 | 3300050490 | Bacteria | 1501 |
| 706 | nmdc:mga03n38_93190_c1 | 3300050490 | Bacteria | 1438 |
| 707 | nmdc:mga03n38_983_c1 | 3300050490 | Bacteria | 7778 |
| 708 | nmdc:mga00v17_141946_c1 | 3300050491 | Bacteria | 1540 |
| 709 | nmdc:mga00v17_171470_c1 | 3300050491 | Bacteria | 1399 |
| 710 | nmdc:mga00v17_195751_c1 | 3300050491 | Bacteria | 1306 |
| 711 | nmdc:mga00v17_38844_c1 | 3300050491 | Bacteria | 2848 |
| 712 | nmdc:mga00v17_96637_c1 | 3300050491 | Bacteria | 1861 |
| 713 | nmdc:mga0yw44_18229_c1 | 3300050492 | Bacteria | 3839 |
| 714 | nmdc:mga0yw44_184596_c1 | 3300050492 | Bacteria | 1374 |
| 715 | nmdc:mga0yw44_201729_c1 | 3300050492 | Bacteria | 1314 |
| 716 | nmdc:mga0yw44_218528_c1 | 3300050492 | Bacteria | 1262 |
| 717 | nmdc:mga0k408_31768_c1 | 3300050493 | Bacteria | 3017 |
| 718 | nmdc:mga0k408_66541_c1 | 3300050493 | Bacteria | 2099 |
| 719 | nmdc:mga0k408_857948_c1 | 3300050493 | Bacteria | 528 |
| 720 | nmdc:mga06z11_112434_c1 | 3300050494 | Bacteria | 1510 |
| 721 | nmdc:mga06z11_37966_c1 | 3300050494 | Bacteria | 2389 |
| 722 | nmdc:mga06z11_80134_c1 | 3300050494 | Bacteria | 1750 |
| 723 | nmdc:mga04h51_74902_c1 | 3300050495 | Bacteria | 1190 |
| 724 | nmdc:mga04h51_85263_c1 | 3300050495 | Bacteria | 1128 |
| 725 | nmdc:mga07m45_156015_c1 | 3300050496 | Bacteria | 1324 |
| 726 | nmdc:mga07m45_76608_c1 | 3300050496 | Bacteria | 1907 |
| 727 | nmdc:mga05p37_624977_c1 | 3300050507 | Bacteria | 1211 |
| 728 | nmdc:mga08y16_320063_c1 | 3300050511 | Bacteria | 1597 |
| 729 | nmdc:mga0n895_306810_c1 | 3300050512 | Bacteria | 1609 |
| 730 | nmdc:mga0rr50_175827_c1 | 3300050513 | Bacteria | 1747 |
| 731 | nmdc:mga08x19_703636_c1 | 3300050514 | Bacteria | 717 |
| 732 | nmdc:mga0a205_295163_c1 | 3300050515 | Bacteria | 1494 |
| 733 | nmdc:mga0a205_785997_c1 | 3300050515 | Bacteria | 800 |
| 734 | nmdc:mga0sz30_43832_c1 | 3300050516 | Bacteria | 1884 |
| 735 | Ga0500610_0317223 | 3300053079 | Bacteria | 678 |
| 736 | Ga0495655_0042595 | 3300053083 | Bacteria | 1167 |
| 737 | Ga0500578_0195299 | 3300053086 | Bacteria | 1241 |
| 738 | Ga0500643_042060 | 3300053087 | Bacteria | 1339 |
| 739 | Ga0500643_186881 | 3300053087 | Bacteria | 556 |
| 740 | Ga0500644_0177051 | 3300053088 | Bacteria | 871 |
| 741 | Ga0500646_0162299 | 3300053090 | Bacteria | 747 |
| 742 | Ga0500646_0276771 | 3300053090 | Bacteria | 597 |
| 743 | Ga0500583_0168680 | 3300053092 | Bacteria | 1090 |
| 744 | Ga0500566_0311815 | 3300053094 | Bacteria | 736 |
| 745 | Ga0500641_0001979 | 3300053096 | Bacteria | 7275 |
| 746 | Ga0500641_0004753 | 3300053096 | Bacteria | 4806 |
| 747 | Ga0500641_0048387 | 3300053096 | Bacteria | 1741 |
| 748 | Ga0500569_077676 | 3300053109 | Bacteria | 1057 |
| 749 | Ga0500592_081340 | 3300053116 | Bacteria | 539 |
| 750 | Ga0500594_0137620 | 3300053118 | Bacteria | 777 |
| 751 | Ga0500595_067699 | 3300053119 | Bacteria | 1064 |
| 752 | Ga0500621_192249 | 3300053126 | Bacteria | 730 |
| 753 | Ga0500642_0165832 | 3300053130 | Bacteria | 1035 |
| 754 | Ga0500642_0177611 | 3300053130 | Bacteria | 996 |
| 755 | Ga0500655_019362 | 3300053133 | Bacteria | 1268 |
| 756 | Ga0500658_0298125 | 3300053134 | Bacteria | 741 |
| 757 | Ga0500561_0221398 | 3300053137 | Bacteria | 600 |
| 758 | Ga0500589_027270 | 3300053147 | Bacteria | 2650 |
| 759 | Ga0500589_188955 | 3300053147 | Bacteria | 802 |
| 760 | Ga0500589_193055 | 3300053147 | Bacteria | 789 |
| 761 | Ga0500590_092717 | 3300053148 | Bacteria | 1464 |
| 762 | Ga0500603_190334 | 3300053150 | Bacteria | 648 |
| 763 | Ga0500604_0029825 | 3300053151 | Bacteria | 1592 |
| 764 | Ga0500616_0000127 | 3300053153 | Bacteria | 134777 |
| 765 | Ga0500622_0285217 | 3300053156 | Bacteria | 710 |
| 766 | Ga0500633_0142958 | 3300053160 | Bacteria | 896 |
| 767 | Ga0500634_0056200 | 3300053161 | Bacteria | 2103 |
| 768 | Ga0500638_163195 | 3300053162 | Bacteria | 979 |
| 769 | Ga0500637_0309310 | 3300053178 | Bacteria | 858 |
| 770 | Ga0500611_034917 | 3300053727 | Bacteria | 1068 |
| 771 | Ga0500645_147305 | 3300053730 | Bacteria | 649 |
| 772 | Ga0500609_038710 | 3300053731 | Bacteria | 659 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031824 | Ga0307413_10034084 | Ga0307413_100340842 | 148 |
| 2 | iso_pu_bacteria | 2513237101 | 2513695083 | 151 |
| 3 | iso_pu_bacteria | 2721755755 | 2723841615 | 151 |
| 4 | iso_pu_bacteria | 2728368998 | 2728754962 | 151 |
| 5 | iso_pu_bacteria | 2791355199 | 2793081654 | 151 |
| 6 | iso_pu_bacteria | 2874604998 | 2874608091 | 151 |
| 7 | iso_pu_bacteria | 2876808645 | 2876810823 | 151 |
| 8 | iso_pu_bacteria | 2879110137 | 2879112142 | 151 |
| 9 | iso_pu_bacteria | 2889033259 | 2889035520 | 151 |
| 10 | iso_pu_bacteria | 2922361189 | 2922364029 | 151 |
| 11 | iso_pu_bacteria | 2922386360 | 2922392538 | 151 |
| 12 | iso_pu_bacteria | 8006964411 | 8006969332 | 151 |
| 13 | iso_pu_bacteria | 8006984368 | 8006990894 | 151 |
| 14 | iso_pu_bacteria | 8006994254 | 8006996538 | 151 |
| 15 | iso_pu_bacteria | 8056673599 | 8056675715 | 151 |
| 16 | 3300005842 | Ga0068858_101319456 | Ga0068858_1013194561 | 153 |
| 17 | 3300009093 | Ga0105240_10232630 | Ga0105240_102326302 | 153 |
| 18 | 3300014968 | Ga0157379_11808138 | Ga0157379_118081381 | 153 |
| 19 | 3300025903 | Ga0207680_10148456 | Ga0207680_101484562 | 153 |
| 20 | 3300026089 | Ga0207648_10277663 | Ga0207648_102776631 | 153 |
| 21 | 3300053153 | Ga0500616_0000127 | Ga0500616_0000127_53666_54130 | 153 |
| 22 | 3300005328 | Ga0070676_11003131 | Ga0070676_110031311 | 154 |
| 23 | 3300005347 | Ga0070668_100175674 | Ga0070668_1001756742 | 154 |
| 24 | 3300005353 | Ga0070669_100277603 | Ga0070669_1002776032 | 154 |
| 25 | 3300005354 | Ga0070675_100595130 | Ga0070675_1005951302 | 154 |
| 26 | 3300005356 | Ga0070674_100446419 | Ga0070674_1004464192 | 154 |
| 27 | 3300005364 | Ga0070673_100359545 | Ga0070673_1003595451 | 154 |
| 28 | 3300005456 | Ga0070678_100093597 | Ga0070678_1000935972 | 154 |
| 29 | 3300005457 | Ga0070662_100390710 | Ga0070662_1003907101 | 154 |
| 30 | 3300005564 | Ga0070664_100819432 | Ga0070664_1008194322 | 154 |
| 31 | 3300005719 | Ga0068861_100082824 | Ga0068861_1000828242 | 154 |
| 32 | 3300005840 | Ga0068870_10083541 | Ga0068870_100835412 | 154 |
| 33 | 3300005844 | Ga0068862_100279144 | Ga0068862_1002791441 | 154 |
| 34 | 3300006881 | Ga0068865_100513870 | Ga0068865_1005138701 | 154 |
| 35 | 3300009094 | Ga0111539_10687070 | Ga0111539_106870701 | 154 |
| 36 | 3300013307 | Ga0157372_12626389 | Ga0157372_126263891 | 154 |
| 37 | 3300014325 | Ga0163163_11229493 | Ga0163163_112294931 | 154 |
| 38 | 3300014326 | Ga0157380_10592666 | Ga0157380_105926661 | 154 |
| 39 | 3300017792 | Ga0163161_10652617 | Ga0163161_106526171 | 154 |
| 40 | 3300025908 | Ga0207643_10027031 | Ga0207643_100270312 | 154 |
| 41 | 3300025933 | Ga0207706_11016156 | Ga0207706_110161561 | 154 |
| 42 | 3300025960 | Ga0207651_10245093 | Ga0207651_102450932 | 154 |
| 43 | 3300025972 | Ga0207668_10386500 | Ga0207668_103865001 | 154 |
| 44 | 3300026067 | Ga0207678_10577766 | Ga0207678_105777662 | 154 |
| 45 | 3300026118 | Ga0207675_100195014 | Ga0207675_1001950142 | 154 |
| 46 | 3300026121 | Ga0207683_10410557 | Ga0207683_104105571 | 154 |
| 47 | 3300031824 | Ga0307413_11166642 | Ga0307413_111666421 | 154 |
| 48 | 3300031911 | Ga0307412_10141464 | Ga0307412_101414642 | 154 |
| 49 | 3300032126 | Ga0307415_100832057 | Ga0307415_1008320571 | 154 |
| 50 | 3300035084 | Ga0373928_0120693 | Ga0373928_0120693_55_519 | 154 |
| 51 | 3300041451 | Ga0451791_0697653 | Ga0451791_0697653_166_630 | 154 |
| 52 | 3300047315 | Ga0495581_0327529 | Ga0495581_0327529_365_832 | 154 |
| 53 | 3300047322 | Ga0495680_0684864 | Ga0495680_0684864_177_641 | 154 |
| 54 | 3300048908 | Ga0496105_0615052 | Ga0496105_0615052_101_565 | 154 |
| 55 | 3300053162 | Ga0500638_163195 | Ga0500638_163195_57_524 | 154 |
| 56 | 3300003659 | JGI25404J52841_10021953 | JGI25404J52841_100219532 | 155 |
| 57 | 3300005327 | Ga0070658_10495004 | Ga0070658_104950041 | 155 |
| 58 | 3300005328 | Ga0070676_10155196 | Ga0070676_101551961 | 155 |
| 59 | 3300005329 | Ga0070683_100386523 | Ga0070683_1003865231 | 155 |
| 60 | 3300005330 | Ga0070690_100056075 | Ga0070690_1000560753 | 155 |
| 61 | 3300005330 | Ga0070690_100319261 | Ga0070690_1003192612 | 155 |
| 62 | 3300005330 | Ga0070690_100697566 | Ga0070690_1006975661 | 155 |
| 63 | 3300005331 | Ga0070670_100101019 | Ga0070670_1001010192 | 155 |
| 64 | 3300005334 | Ga0068869_100050231 | Ga0068869_1000502312 | 155 |
| 65 | 3300005334 | Ga0068869_100058856 | Ga0068869_1000588562 | 155 |
| 66 | 3300005335 | Ga0070666_10093735 | Ga0070666_100937351 | 155 |
| 67 | 3300005335 | Ga0070666_10267595 | Ga0070666_102675951 | 155 |
| 68 | 3300005335 | Ga0070666_10913934 | Ga0070666_109139341 | 155 |
| 69 | 3300005336 | Ga0070680_101447424 | Ga0070680_1014474241 | 155 |
| 70 | 3300005337 | Ga0070682_100162240 | Ga0070682_1001622402 | 155 |
| 71 | 3300005338 | Ga0068868_100052909 | Ga0068868_1000529092 | 155 |
| 72 | 3300005338 | Ga0068868_100260799 | Ga0068868_1002607991 | 155 |
| 73 | 3300005338 | Ga0068868_100341923 | Ga0068868_1003419232 | 155 |
| 74 | 3300005338 | Ga0068868_100483960 | Ga0068868_1004839601 | 155 |
| 75 | 3300005338 | Ga0068868_101067994 | Ga0068868_1010679941 | 155 |
| 76 | 3300005339 | Ga0070660_100603394 | Ga0070660_1006033941 | 155 |
| 77 | 3300005340 | Ga0070689_100417446 | Ga0070689_1004174461 | 155 |
| 78 | 3300005340 | Ga0070689_100870624 | Ga0070689_1008706242 | 155 |
| 79 | 3300005343 | Ga0070687_100353829 | Ga0070687_1003538291 | 155 |
| 80 | 3300005343 | Ga0070687_100579408 | Ga0070687_1005794081 | 155 |
| 81 | 3300005344 | Ga0070661_100171457 | Ga0070661_1001714572 | 155 |
| 82 | 3300005344 | Ga0070661_100210671 | Ga0070661_1002106712 | 155 |
| 83 | 3300005344 | Ga0070661_100283003 | Ga0070661_1002830032 | 155 |
| 84 | 3300005344 | Ga0070661_100363693 | Ga0070661_1003636932 | 155 |
| 85 | 3300005344 | Ga0070661_100466839 | Ga0070661_1004668392 | 155 |
| 86 | 3300005347 | Ga0070668_100062410 | Ga0070668_1000624102 | 155 |
| 87 | 3300005347 | Ga0070668_100066909 | Ga0070668_1000669092 | 155 |
| 88 | 3300005347 | Ga0070668_100182406 | Ga0070668_1001824062 | 155 |
| 89 | 3300005347 | Ga0070668_100836420 | Ga0070668_1008364202 | 155 |
| 90 | 3300005353 | Ga0070669_100252431 | Ga0070669_1002524312 | 155 |
| 91 | 3300005354 | Ga0070675_100395138 | Ga0070675_1003951382 | 155 |
| 92 | 3300005354 | Ga0070675_100634740 | Ga0070675_1006347401 | 155 |
| 93 | 3300005354 | Ga0070675_101528615 | Ga0070675_1015286151 | 155 |
| 94 | 3300005355 | Ga0070671_100115922 | Ga0070671_1001159223 | 155 |
| 95 | 3300005355 | Ga0070671_100534927 | Ga0070671_1005349271 | 155 |
| 96 | 3300005356 | Ga0070674_100167286 | Ga0070674_1001672862 | 155 |
| 97 | 3300005356 | Ga0070674_100316513 | Ga0070674_1003165132 | 155 |
| 98 | 3300005356 | Ga0070674_100723884 | Ga0070674_1007238841 | 155 |
| 99 | 3300005364 | Ga0070673_100289473 | Ga0070673_1002894731 | 155 |
| 100 | 3300005366 | Ga0070659_100148359 | Ga0070659_1001483591 | 155 |
| 101 | 3300005366 | Ga0070659_100429066 | Ga0070659_1004290661 | 155 |
| 102 | 3300005366 | Ga0070659_101395384 | Ga0070659_1013953841 | 155 |
| 103 | 3300005367 | Ga0070667_100060591 | Ga0070667_1000605911 | 155 |
| 104 | 3300005367 | Ga0070667_101251627 | Ga0070667_1012516271 | 155 |
| 105 | 3300005367 | Ga0070667_101459083 | Ga0070667_1014590831 | 155 |
| 106 | 3300005437 | Ga0070710_10086088 | Ga0070710_100860882 | 155 |
| 107 | 3300005437 | Ga0070710_10662303 | Ga0070710_106623031 | 155 |
| 108 | 3300005438 | Ga0070701_10369462 | Ga0070701_103694622 | 155 |
| 109 | 3300005439 | Ga0070711_100023422 | Ga0070711_1000234223 | 155 |
| 110 | 3300005441 | Ga0070700_100149576 | Ga0070700_1001495762 | 155 |
| 111 | 3300005441 | Ga0070700_100150235 | Ga0070700_1001502352 | 155 |
| 112 | 3300005441 | Ga0070700_100552038 | Ga0070700_1005520381 | 155 |
| 113 | 3300005455 | Ga0070663_100012307 | Ga0070663_1000123073 | 155 |
| 114 | 3300005455 | Ga0070663_100073868 | Ga0070663_1000738682 | 155 |
| 115 | 3300005455 | Ga0070663_100078350 | Ga0070663_1000783502 | 155 |
| 116 | 3300005455 | Ga0070663_100235132 | Ga0070663_1002351322 | 155 |
| 117 | 3300005456 | Ga0070678_100031128 | Ga0070678_1000311281 | 155 |
| 118 | 3300005456 | Ga0070678_100103337 | Ga0070678_1001033372 | 155 |
| 119 | 3300005456 | Ga0070678_101579375 | Ga0070678_1015793751 | 155 |
| 120 | 3300005457 | Ga0070662_100222143 | Ga0070662_1002221431 | 155 |
| 121 | 3300005467 | Ga0070706_100316926 | Ga0070706_1003169262 | 155 |
| 122 | 3300005535 | Ga0070684_101944343 | Ga0070684_1019443431 | 155 |
| 123 | 3300005539 | Ga0068853_100170181 | Ga0068853_1001701812 | 155 |
| 124 | 3300005539 | Ga0068853_100225066 | Ga0068853_1002250663 | 155 |
| 125 | 3300005543 | Ga0070672_100270710 | Ga0070672_1002707102 | 155 |
| 126 | 3300005543 | Ga0070672_100670420 | Ga0070672_1006704202 | 155 |
| 127 | 3300005543 | Ga0070672_100827451 | Ga0070672_1008274511 | 155 |
| 128 | 3300005544 | Ga0070686_100020047 | Ga0070686_1000200472 | 155 |
| 129 | 3300005545 | Ga0070695_100732684 | Ga0070695_1007326841 | 155 |
| 130 | 3300005546 | Ga0070696_100058612 | Ga0070696_1000586122 | 155 |
| 131 | 3300005548 | Ga0070665_100004203 | Ga0070665_1000042032 | 155 |
| 132 | 3300005548 | Ga0070665_100009471 | Ga0070665_1000094716 | 155 |
| 133 | 3300005548 | Ga0070665_100077521 | Ga0070665_1000775212 | 155 |
| 134 | 3300005548 | Ga0070665_100112322 | Ga0070665_1001123223 | 155 |
| 135 | 3300005548 | Ga0070665_100124827 | Ga0070665_1001248272 | 155 |
| 136 | 3300005548 | Ga0070665_100151199 | Ga0070665_1001511992 | 155 |
| 137 | 3300005548 | Ga0070665_100184209 | Ga0070665_1001842091 | 155 |
| 138 | 3300005548 | Ga0070665_100227808 | Ga0070665_1002278082 | 155 |
| 139 | 3300005548 | Ga0070665_100305738 | Ga0070665_1003057382 | 155 |
| 140 | 3300005548 | Ga0070665_100577963 | Ga0070665_1005779632 | 155 |
| 141 | 3300005548 | Ga0070665_101698096 | Ga0070665_1016980961 | 155 |
| 142 | 3300005563 | Ga0068855_100102902 | Ga0068855_1001029022 | 155 |
| 143 | 3300005563 | Ga0068855_100699865 | Ga0068855_1006998651 | 155 |
| 144 | 3300005563 | Ga0068855_101015023 | Ga0068855_1010150231 | 155 |
| 145 | 3300005564 | Ga0070664_100057841 | Ga0070664_1000578413 | 155 |
| 146 | 3300005564 | Ga0070664_100929488 | Ga0070664_1009294882 | 155 |
| 147 | 3300005564 | Ga0070664_101620012 | Ga0070664_1016200121 | 155 |
| 148 | 3300005577 | Ga0068857_100431555 | Ga0068857_1004315552 | 155 |
| 149 | 3300005614 | Ga0068856_100043240 | Ga0068856_1000432402 | 155 |
| 150 | 3300005614 | Ga0068856_100412336 | Ga0068856_1004123362 | 155 |
| 151 | 3300005614 | Ga0068856_100629511 | Ga0068856_1006295112 | 155 |
| 152 | 3300005614 | Ga0068856_101095015 | Ga0068856_1010950151 | 155 |
| 153 | 3300005616 | Ga0068852_100189509 | Ga0068852_1001895092 | 155 |
| 154 | 3300005616 | Ga0068852_100278437 | Ga0068852_1002784371 | 155 |
| 155 | 3300005616 | Ga0068852_100906621 | Ga0068852_1009066212 | 155 |
| 156 | 3300005616 | Ga0068852_101108698 | Ga0068852_1011086981 | 155 |
| 157 | 3300005617 | Ga0068859_100066012 | Ga0068859_1000660123 | 155 |
| 158 | 3300005617 | Ga0068859_100172003 | Ga0068859_1001720032 | 155 |
| 159 | 3300005617 | Ga0068859_100609553 | Ga0068859_1006095532 | 155 |
| 160 | 3300005618 | Ga0068864_100028662 | Ga0068864_1000286624 | 155 |
| 161 | 3300005618 | Ga0068864_100059050 | Ga0068864_1000590502 | 155 |
| 162 | 3300005618 | Ga0068864_101977029 | Ga0068864_1019770291 | 155 |
| 163 | 3300005718 | Ga0068866_10067059 | Ga0068866_100670592 | 155 |
| 164 | 3300005718 | Ga0068866_10072159 | Ga0068866_100721593 | 155 |
| 165 | 3300005718 | Ga0068866_10077238 | Ga0068866_100772382 | 155 |
| 166 | 3300005718 | Ga0068866_10146133 | Ga0068866_101461332 | 155 |
| 167 | 3300005719 | Ga0068861_100090685 | Ga0068861_1000906852 | 155 |
| 168 | 3300005719 | Ga0068861_100250660 | Ga0068861_1002506602 | 155 |
| 169 | 3300005719 | Ga0068861_100337141 | Ga0068861_1003371411 | 155 |
| 170 | 3300005719 | Ga0068861_100423535 | Ga0068861_1004235352 | 155 |
| 171 | 3300005834 | Ga0068851_10204645 | Ga0068851_102046452 | 155 |
| 172 | 3300005834 | Ga0068851_10461885 | Ga0068851_104618851 | 155 |
| 173 | 3300005834 | Ga0068851_10848868 | Ga0068851_108488681 | 155 |
| 174 | 3300005840 | Ga0068870_10261051 | Ga0068870_102610512 | 155 |
| 175 | 3300005840 | Ga0068870_10340807 | Ga0068870_103408071 | 155 |
| 176 | 3300005840 | Ga0068870_10735087 | Ga0068870_107350871 | 155 |
| 177 | 3300005841 | Ga0068863_100105012 | Ga0068863_1001050122 | 155 |
| 178 | 3300005841 | Ga0068863_100391160 | Ga0068863_1003911601 | 155 |
| 179 | 3300005841 | Ga0068863_100732803 | Ga0068863_1007328031 | 155 |
| 180 | 3300005842 | Ga0068858_100049881 | Ga0068858_1000498812 | 155 |
| 181 | 3300005842 | Ga0068858_100192587 | Ga0068858_1001925872 | 155 |
| 182 | 3300005842 | Ga0068858_100201825 | Ga0068858_1002018252 | 155 |
| 183 | 3300005842 | Ga0068858_100581291 | Ga0068858_1005812911 | 155 |
| 184 | 3300005843 | Ga0068860_100058803 | Ga0068860_1000588034 | 155 |
| 185 | 3300005843 | Ga0068860_100108629 | Ga0068860_1001086291 | 155 |
| 186 | 3300005843 | Ga0068860_100359890 | Ga0068860_1003598902 | 155 |
| 187 | 3300005843 | Ga0068860_100378241 | Ga0068860_1003782412 | 155 |
| 188 | 3300005844 | Ga0068862_100177803 | Ga0068862_1001778032 | 155 |
| 189 | 3300005844 | Ga0068862_100214213 | Ga0068862_1002142132 | 155 |
| 190 | 3300005844 | Ga0068862_100314700 | Ga0068862_1003147002 | 155 |
| 191 | 3300005844 | Ga0068862_100642660 | Ga0068862_1006426601 | 155 |
| 192 | 3300005844 | Ga0068862_100676855 | Ga0068862_1006768551 | 155 |
| 193 | 3300005937 | Ga0081455_10007513 | Ga0081455_1000751310 | 155 |
| 194 | 3300005937 | Ga0081455_10080276 | Ga0081455_100802762 | 155 |
| 195 | 3300005983 | Ga0081540_1002549 | Ga0081540_100254911 | 155 |
| 196 | 3300005983 | Ga0081540_1003522 | Ga0081540_10035224 | 155 |
| 197 | 3300005983 | Ga0081540_1009485 | Ga0081540_10094852 | 155 |
| 198 | 3300005983 | Ga0081540_1029221 | Ga0081540_10292212 | 155 |
| 199 | 3300005983 | Ga0081540_1034399 | Ga0081540_10343992 | 155 |
| 200 | 3300005983 | Ga0081540_1035227 | Ga0081540_10352272 | 155 |
| 201 | 3300005983 | Ga0081540_1037441 | Ga0081540_10374413 | 155 |
| 202 | 3300005983 | Ga0081540_1058840 | Ga0081540_10588402 | 155 |
| 203 | 3300005983 | Ga0081540_1065600 | Ga0081540_10656002 | 155 |
| 204 | 3300005983 | Ga0081540_1070927 | Ga0081540_10709272 | 155 |
| 205 | 3300005985 | Ga0081539_10002259 | Ga0081539_1000225914 | 155 |
| 206 | 3300005985 | Ga0081539_10040454 | Ga0081539_100404542 | 155 |
| 207 | 3300006038 | Ga0075365_10050170 | Ga0075365_100501702 | 155 |
| 208 | 3300006038 | Ga0075365_10063990 | Ga0075365_100639903 | 155 |
| 209 | 3300006038 | Ga0075365_10071281 | Ga0075365_100712812 | 155 |
| 210 | 3300006038 | Ga0075365_10148595 | Ga0075365_101485952 | 155 |
| 211 | 3300006038 | Ga0075365_10358692 | Ga0075365_103586922 | 155 |
| 212 | 3300006038 | Ga0075365_10362240 | Ga0075365_103622401 | 155 |
| 213 | 3300006042 | Ga0075368_10031546 | Ga0075368_100315461 | 155 |
| 214 | 3300006042 | Ga0075368_10148456 | Ga0075368_101484562 | 155 |
| 215 | 3300006048 | Ga0075363_100009597 | Ga0075363_1000095972 | 155 |
| 216 | 3300006048 | Ga0075363_100170012 | Ga0075363_1001700122 | 155 |
| 217 | 3300006048 | Ga0075363_100219133 | Ga0075363_1002191333 | 155 |
| 218 | 3300006048 | Ga0075363_100256158 | Ga0075363_1002561581 | 155 |
| 219 | 3300006051 | Ga0075364_10121037 | Ga0075364_101210372 | 155 |
| 220 | 3300006051 | Ga0075364_10205693 | Ga0075364_102056932 | 155 |
| 221 | 3300006173 | Ga0070716_100441956 | Ga0070716_1004419561 | 155 |
| 222 | 3300006175 | Ga0070712_100168632 | Ga0070712_1001686322 | 155 |
| 223 | 3300006177 | Ga0075362_10036045 | Ga0075362_100360452 | 155 |
| 224 | 3300006178 | Ga0075367_10003520 | Ga0075367_100035201 | 155 |
| 225 | 3300006178 | Ga0075367_10029963 | Ga0075367_100299634 | 155 |
| 226 | 3300006178 | Ga0075367_10130645 | Ga0075367_101306452 | 155 |
| 227 | 3300006178 | Ga0075367_10150157 | Ga0075367_101501572 | 155 |
| 228 | 3300006178 | Ga0075367_10541823 | Ga0075367_105418231 | 155 |
| 229 | 3300006186 | Ga0075369_10029004 | Ga0075369_100290042 | 155 |
| 230 | 3300006186 | Ga0075369_10150151 | Ga0075369_101501512 | 155 |
| 231 | 3300006195 | Ga0075366_10057761 | Ga0075366_100577612 | 155 |
| 232 | 3300006195 | Ga0075366_10155797 | Ga0075366_101557971 | 155 |
| 233 | 3300006195 | Ga0075366_10341244 | Ga0075366_103412441 | 155 |
| 234 | 3300006237 | Ga0097621_102263669 | Ga0097621_1022636691 | 155 |
| 235 | 3300006353 | Ga0075370_10018348 | Ga0075370_100183482 | 155 |
| 236 | 3300006353 | Ga0075370_10034805 | Ga0075370_100348051 | 155 |
| 237 | 3300006353 | Ga0075370_10052957 | Ga0075370_100529572 | 155 |
| 238 | 3300006353 | Ga0075370_10104761 | Ga0075370_101047612 | 155 |
| 239 | 3300006358 | Ga0068871_100012150 | Ga0068871_1000121502 | 155 |
| 240 | 3300006358 | Ga0068871_100457600 | Ga0068871_1004576002 | 155 |
| 241 | 3300006358 | Ga0068871_101477952 | Ga0068871_1014779521 | 155 |
| 242 | 3300006844 | Ga0075428_101350500 | Ga0075428_1013505001 | 155 |
| 243 | 3300006844 | Ga0075428_101397160 | Ga0075428_1013971601 | 155 |
| 244 | 3300006846 | Ga0075430_100300783 | Ga0075430_1003007832 | 155 |
| 245 | 3300006847 | Ga0075431_101010994 | Ga0075431_1010109941 | 155 |
| 246 | 3300006852 | Ga0075433_10826858 | Ga0075433_108268581 | 155 |
| 247 | 3300006871 | Ga0075434_100249710 | Ga0075434_1002497102 | 155 |
| 248 | 3300006881 | Ga0068865_100105024 | Ga0068865_1001050242 | 155 |
| 249 | 3300006881 | Ga0068865_100210589 | Ga0068865_1002105892 | 155 |
| 250 | 3300006881 | Ga0068865_100400911 | Ga0068865_1004009112 | 155 |
| 251 | 3300006881 | Ga0068865_100521519 | Ga0068865_1005215191 | 155 |
| 252 | 3300006914 | Ga0075436_101181741 | Ga0075436_1011817411 | 155 |
| 253 | 3300006931 | Ga0097620_100066005 | Ga0097620_1000660053 | 155 |
| 254 | 3300006931 | Ga0097620_100171999 | Ga0097620_1001719992 | 155 |
| 255 | 3300006931 | Ga0097620_100609529 | Ga0097620_1006095292 | 155 |
| 256 | 3300007076 | Ga0075435_100102763 | Ga0075435_1001027632 | 155 |
| 257 | 3300007265 | Ga0099794_10182284 | Ga0099794_101822841 | 155 |
| 258 | 3300007788 | Ga0099795_10030957 | Ga0099795_100309572 | 155 |
| 259 | 3300009092 | Ga0105250_10010709 | Ga0105250_100107092 | 155 |
| 260 | 3300009093 | Ga0105240_10289820 | Ga0105240_102898202 | 155 |
| 261 | 3300009093 | Ga0105240_10732734 | Ga0105240_107327341 | 155 |
| 262 | 3300009094 | Ga0111539_10632735 | Ga0111539_106327352 | 155 |
| 263 | 3300009098 | Ga0105245_10154221 | Ga0105245_101542211 | 155 |
| 264 | 3300009098 | Ga0105245_10660941 | Ga0105245_106609411 | 155 |
| 265 | 3300009098 | Ga0105245_11037840 | Ga0105245_110378402 | 155 |
| 266 | 3300009098 | Ga0105245_11737719 | Ga0105245_117377191 | 155 |
| 267 | 3300009098 | Ga0105245_11809873 | Ga0105245_118098731 | 155 |
| 268 | 3300009101 | Ga0105247_10056856 | Ga0105247_100568562 | 155 |
| 269 | 3300009101 | Ga0105247_10094995 | Ga0105247_100949951 | 155 |
| 270 | 3300009101 | Ga0105247_10218005 | Ga0105247_102180052 | 155 |
| 271 | 3300009101 | Ga0105247_10224527 | Ga0105247_102245271 | 155 |
| 272 | 3300009147 | Ga0114129_10340226 | Ga0114129_103402262 | 155 |
| 273 | 3300009147 | Ga0114129_10520407 | Ga0114129_105204072 | 155 |
| 274 | 3300009148 | Ga0105243_10191923 | Ga0105243_101919231 | 155 |
| 275 | 3300009148 | Ga0105243_10274048 | Ga0105243_102740481 | 155 |
| 276 | 3300009148 | Ga0105243_10500350 | Ga0105243_105003502 | 155 |
| 277 | 3300009174 | Ga0105241_10031978 | Ga0105241_100319784 | 155 |
| 278 | 3300009174 | Ga0105241_10583277 | Ga0105241_105832772 | 155 |
| 279 | 3300009174 | Ga0105241_10608832 | Ga0105241_106088321 | 155 |
| 280 | 3300009176 | Ga0105242_10820502 | Ga0105242_108205022 | 155 |
| 281 | 3300009177 | Ga0105248_10056455 | Ga0105248_100564552 | 155 |
| 282 | 3300009177 | Ga0105248_10284047 | Ga0105248_102840472 | 155 |
| 283 | 3300009177 | Ga0105248_10555013 | Ga0105248_105550131 | 155 |
| 284 | 3300009177 | Ga0105248_10989167 | Ga0105248_109891672 | 155 |
| 285 | 3300009545 | Ga0105237_10277008 | Ga0105237_102770081 | 155 |
| 286 | 3300009545 | Ga0105237_10321090 | Ga0105237_103210902 | 155 |
| 287 | 3300009545 | Ga0105237_10349091 | Ga0105237_103490912 | 155 |
| 288 | 3300009545 | Ga0105237_10388607 | Ga0105237_103886072 | 155 |
| 289 | 3300009545 | Ga0105237_11533107 | Ga0105237_115331071 | 155 |
| 290 | 3300009551 | Ga0105238_10056480 | Ga0105238_100564803 | 155 |
| 291 | 3300009551 | Ga0105238_10515559 | Ga0105238_105155592 | 155 |
| 292 | 3300009551 | Ga0105238_10910579 | Ga0105238_109105791 | 155 |
| 293 | 3300009551 | Ga0105238_11003259 | Ga0105238_110032592 | 155 |
| 294 | 3300009553 | Ga0105249_10235264 | Ga0105249_102352642 | 155 |
| 295 | 3300009553 | Ga0105249_11527778 | Ga0105249_115277781 | 155 |
| 296 | 3300010375 | Ga0105239_10110518 | Ga0105239_101105182 | 155 |
| 297 | 3300010375 | Ga0105239_10123043 | Ga0105239_101230431 | 155 |
| 298 | 3300010375 | Ga0105239_10273304 | Ga0105239_102733042 | 155 |
| 299 | 3300010375 | Ga0105239_10306637 | Ga0105239_103066373 | 155 |
| 300 | 3300010375 | Ga0105239_10605370 | Ga0105239_106053702 | 155 |
| 301 | 3300010375 | Ga0105239_10919938 | Ga0105239_109199382 | 155 |
| 302 | 3300011119 | Ga0105246_10050528 | Ga0105246_100505284 | 155 |
| 303 | 3300011119 | Ga0105246_10081082 | Ga0105246_100810822 | 155 |
| 304 | 3300011119 | Ga0105246_10231528 | Ga0105246_102315282 | 155 |
| 305 | 3300011119 | Ga0105246_10480243 | Ga0105246_104802431 | 155 |
| 306 | 3300011119 | Ga0105246_10512460 | Ga0105246_105124602 | 155 |
| 307 | 3300011119 | Ga0105246_10586606 | Ga0105246_105866061 | 155 |
| 308 | 3300013102 | Ga0157371_10757451 | Ga0157371_107574511 | 155 |
| 309 | 3300013296 | Ga0157374_10018731 | Ga0157374_100187311 | 155 |
| 310 | 3300013296 | Ga0157374_10051454 | Ga0157374_100514543 | 155 |
| 311 | 3300013296 | Ga0157374_10433261 | Ga0157374_104332612 | 155 |
| 312 | 3300013297 | Ga0157378_10266102 | Ga0157378_102661022 | 155 |
| 313 | 3300013297 | Ga0157378_10271398 | Ga0157378_102713982 | 155 |
| 314 | 3300013297 | Ga0157378_11112613 | Ga0157378_111126131 | 155 |
| 315 | 3300013297 | Ga0157378_11596446 | Ga0157378_115964461 | 155 |
| 316 | 3300013306 | Ga0163162_10117403 | Ga0163162_101174032 | 155 |
| 317 | 3300013306 | Ga0163162_10219593 | Ga0163162_102195932 | 155 |
| 318 | 3300013306 | Ga0163162_10322849 | Ga0163162_103228492 | 155 |
| 319 | 3300013306 | Ga0163162_10544588 | Ga0163162_105445881 | 155 |
| 320 | 3300013307 | Ga0157372_12243697 | Ga0157372_122436971 | 155 |
| 321 | 3300013308 | Ga0157375_10231676 | Ga0157375_102316762 | 155 |
| 322 | 3300013308 | Ga0157375_10472529 | Ga0157375_104725292 | 155 |
| 323 | 3300013308 | Ga0157375_10499816 | Ga0157375_104998161 | 155 |
| 324 | 3300013308 | Ga0157375_11103194 | Ga0157375_111031942 | 155 |
| 325 | 3300013308 | Ga0157375_11385422 | Ga0157375_113854221 | 155 |
| 326 | 3300014325 | Ga0163163_10382437 | Ga0163163_103824372 | 155 |
| 327 | 3300014325 | Ga0163163_10390701 | Ga0163163_103907012 | 155 |
| 328 | 3300014325 | Ga0163163_10412706 | Ga0163163_104127062 | 155 |
| 329 | 3300014325 | Ga0163163_10554950 | Ga0163163_105549502 | 155 |
| 330 | 3300014325 | Ga0163163_10786188 | Ga0163163_107861881 | 155 |
| 331 | 3300014326 | Ga0157380_10346838 | Ga0157380_103468382 | 155 |
| 332 | 3300014326 | Ga0157380_10535167 | Ga0157380_105351671 | 155 |
| 333 | 3300014326 | Ga0157380_10549582 | Ga0157380_105495821 | 155 |
| 334 | 3300014326 | Ga0157380_10648775 | Ga0157380_106487752 | 155 |
| 335 | 3300014326 | Ga0157380_11161973 | Ga0157380_111619731 | 155 |
| 336 | 3300014745 | Ga0157377_10067494 | Ga0157377_100674942 | 155 |
| 337 | 3300014745 | Ga0157377_10197473 | Ga0157377_101974731 | 155 |
| 338 | 3300014745 | Ga0157377_10368717 | Ga0157377_103687171 | 155 |
| 339 | 3300014968 | Ga0157379_10121241 | Ga0157379_101212414 | 155 |
| 340 | 3300014968 | Ga0157379_10183366 | Ga0157379_101833661 | 155 |
| 341 | 3300014968 | Ga0157379_10548665 | Ga0157379_105486651 | 155 |
| 342 | 3300014968 | Ga0157379_10869370 | Ga0157379_108693701 | 155 |
| 343 | 3300014968 | Ga0157379_11518385 | Ga0157379_115183851 | 155 |
| 344 | 3300014969 | Ga0157376_10209764 | Ga0157376_102097642 | 155 |
| 345 | 3300014969 | Ga0157376_10282923 | Ga0157376_102829232 | 155 |
| 346 | 3300014969 | Ga0157376_10531823 | Ga0157376_105318232 | 155 |
| 347 | 3300014969 | Ga0157376_11237757 | Ga0157376_112377571 | 155 |
| 348 | 3300017792 | Ga0163161_10171195 | Ga0163161_101711951 | 155 |
| 349 | 3300025297 | Ga0209758_1006620 | Ga0209758_10066201 | 155 |
| 350 | 3300025297 | Ga0209758_1023273 | Ga0209758_10232731 | 155 |
| 351 | 3300025315 | Ga0207697_10062544 | Ga0207697_100625442 | 155 |
| 352 | 3300025711 | Ga0207696_1058404 | Ga0207696_10584042 | 155 |
| 353 | 3300025898 | Ga0207692_10040762 | Ga0207692_100407622 | 155 |
| 354 | 3300025899 | Ga0207642_10093257 | Ga0207642_100932572 | 155 |
| 355 | 3300025899 | Ga0207642_10112362 | Ga0207642_101123621 | 155 |
| 356 | 3300025899 | Ga0207642_10162989 | Ga0207642_101629892 | 155 |
| 357 | 3300025899 | Ga0207642_10191577 | Ga0207642_101915772 | 155 |
| 358 | 3300025899 | Ga0207642_10457645 | Ga0207642_104576451 | 155 |
| 359 | 3300025900 | Ga0207710_10456559 | Ga0207710_104565591 | 155 |
| 360 | 3300025901 | Ga0207688_10053044 | Ga0207688_100530442 | 155 |
| 361 | 3300025901 | Ga0207688_10509250 | Ga0207688_105092501 | 155 |
| 362 | 3300025903 | Ga0207680_10065184 | Ga0207680_100651843 | 155 |
| 363 | 3300025904 | Ga0207647_10117577 | Ga0207647_101175772 | 155 |
| 364 | 3300025907 | Ga0207645_10050155 | Ga0207645_100501552 | 155 |
| 365 | 3300025907 | Ga0207645_10195363 | Ga0207645_101953632 | 155 |
| 366 | 3300025908 | Ga0207643_10093287 | Ga0207643_100932872 | 155 |
| 367 | 3300025908 | Ga0207643_10185199 | Ga0207643_101851992 | 155 |
| 368 | 3300025908 | Ga0207643_10591296 | Ga0207643_105912961 | 155 |
| 369 | 3300025909 | Ga0207705_10949218 | Ga0207705_109492181 | 155 |
| 370 | 3300025911 | Ga0207654_10043586 | Ga0207654_100435862 | 155 |
| 371 | 3300025913 | Ga0207695_10208430 | Ga0207695_102084301 | 155 |
| 372 | 3300025914 | Ga0207671_10183049 | Ga0207671_101830491 | 155 |
| 373 | 3300025914 | Ga0207671_10299962 | Ga0207671_102999622 | 155 |
| 374 | 3300025914 | Ga0207671_10393774 | Ga0207671_103937742 | 155 |
| 375 | 3300025915 | Ga0207693_10392760 | Ga0207693_103927602 | 155 |
| 376 | 3300025916 | Ga0207663_10029308 | Ga0207663_100293082 | 155 |
| 377 | 3300025918 | Ga0207662_10124258 | Ga0207662_101242582 | 155 |
| 378 | 3300025919 | Ga0207657_10243596 | Ga0207657_102435961 | 155 |
| 379 | 3300025919 | Ga0207657_10832443 | Ga0207657_108324431 | 155 |
| 380 | 3300025920 | Ga0207649_10091707 | Ga0207649_100917072 | 155 |
| 381 | 3300025920 | Ga0207649_10206911 | Ga0207649_102069112 | 155 |
| 382 | 3300025920 | Ga0207649_10279398 | Ga0207649_102793981 | 155 |
| 383 | 3300025920 | Ga0207649_10329072 | Ga0207649_103290721 | 155 |
| 384 | 3300025921 | Ga0207652_10044564 | Ga0207652_100445643 | 155 |
| 385 | 3300025923 | Ga0207681_10077879 | Ga0207681_100778792 | 155 |
| 386 | 3300025923 | Ga0207681_10123131 | Ga0207681_101231312 | 155 |
| 387 | 3300025924 | Ga0207694_10708790 | Ga0207694_107087901 | 155 |
| 388 | 3300025924 | Ga0207694_10867886 | Ga0207694_108678861 | 155 |
| 389 | 3300025925 | Ga0207650_10693470 | Ga0207650_106934701 | 155 |
| 390 | 3300025926 | Ga0207659_10148531 | Ga0207659_101485312 | 155 |
| 391 | 3300025926 | Ga0207659_11305647 | Ga0207659_113056471 | 155 |
| 392 | 3300025927 | Ga0207687_10112630 | Ga0207687_101126302 | 155 |
| 393 | 3300025927 | Ga0207687_10157950 | Ga0207687_101579501 | 155 |
| 394 | 3300025927 | Ga0207687_10551840 | Ga0207687_105518401 | 155 |
| 395 | 3300025931 | Ga0207644_10061288 | Ga0207644_100612882 | 155 |
| 396 | 3300025931 | Ga0207644_10373537 | Ga0207644_103735372 | 155 |
| 397 | 3300025931 | Ga0207644_10763078 | Ga0207644_107630781 | 155 |
| 398 | 3300025932 | Ga0207690_10070494 | Ga0207690_100704943 | 155 |
| 399 | 3300025932 | Ga0207690_10841313 | Ga0207690_108413131 | 155 |
| 400 | 3300025933 | Ga0207706_10169596 | Ga0207706_101695962 | 155 |
| 401 | 3300025933 | Ga0207706_10197484 | Ga0207706_101974841 | 155 |
| 402 | 3300025933 | Ga0207706_10326947 | Ga0207706_103269471 | 155 |
| 403 | 3300025933 | Ga0207706_10381971 | Ga0207706_103819712 | 155 |
| 404 | 3300025933 | Ga0207706_10997141 | Ga0207706_109971411 | 155 |
| 405 | 3300025934 | Ga0207686_10625219 | Ga0207686_106252191 | 155 |
| 406 | 3300025935 | Ga0207709_10010739 | Ga0207709_100107391 | 155 |
| 407 | 3300025935 | Ga0207709_10228373 | Ga0207709_102283732 | 155 |
| 408 | 3300025935 | Ga0207709_10436611 | Ga0207709_104366111 | 155 |
| 409 | 3300025935 | Ga0207709_11196915 | Ga0207709_111969151 | 155 |
| 410 | 3300025936 | Ga0207670_10433982 | Ga0207670_104339822 | 155 |
| 411 | 3300025937 | Ga0207669_10053603 | Ga0207669_100536032 | 155 |
| 412 | 3300025937 | Ga0207669_10558324 | Ga0207669_105583242 | 155 |
| 413 | 3300025937 | Ga0207669_10672711 | Ga0207669_106727111 | 155 |
| 414 | 3300025938 | Ga0207704_10094491 | Ga0207704_100944912 | 155 |
| 415 | 3300025938 | Ga0207704_10350533 | Ga0207704_103505332 | 155 |
| 416 | 3300025938 | Ga0207704_10566371 | Ga0207704_105663711 | 155 |
| 417 | 3300025938 | Ga0207704_10637672 | Ga0207704_106376722 | 155 |
| 418 | 3300025939 | Ga0207665_10104988 | Ga0207665_101049882 | 155 |
| 419 | 3300025939 | Ga0207665_10394179 | Ga0207665_103941791 | 155 |
| 420 | 3300025940 | Ga0207691_10208471 | Ga0207691_102084712 | 155 |
| 421 | 3300025940 | Ga0207691_10336219 | Ga0207691_103362192 | 155 |
| 422 | 3300025940 | Ga0207691_11075556 | Ga0207691_110755561 | 155 |
| 423 | 3300025941 | Ga0207711_10041759 | Ga0207711_100417592 | 155 |
| 424 | 3300025941 | Ga0207711_10216117 | Ga0207711_102161172 | 155 |
| 425 | 3300025941 | Ga0207711_10362056 | Ga0207711_103620562 | 155 |
| 426 | 3300025941 | Ga0207711_10629547 | Ga0207711_106295472 | 155 |
| 427 | 3300025942 | Ga0207689_10039433 | Ga0207689_100394332 | 155 |
| 428 | 3300025942 | Ga0207689_10067712 | Ga0207689_100677122 | 155 |
| 429 | 3300025942 | Ga0207689_10354933 | Ga0207689_103549332 | 155 |
| 430 | 3300025942 | Ga0207689_10553420 | Ga0207689_105534202 | 155 |
| 431 | 3300025944 | Ga0207661_10105656 | Ga0207661_101056562 | 155 |
| 432 | 3300025945 | Ga0207679_10062689 | Ga0207679_100626892 | 155 |
| 433 | 3300025945 | Ga0207679_10117734 | Ga0207679_101177341 | 155 |
| 434 | 3300025945 | Ga0207679_10265087 | Ga0207679_102650872 | 155 |
| 435 | 3300025945 | Ga0207679_10424614 | Ga0207679_104246141 | 155 |
| 436 | 3300025945 | Ga0207679_10512255 | Ga0207679_105122552 | 155 |
| 437 | 3300025949 | Ga0207667_10080731 | Ga0207667_100807311 | 155 |
| 438 | 3300025949 | Ga0207667_10209621 | Ga0207667_102096212 | 155 |
| 439 | 3300025960 | Ga0207651_11159151 | Ga0207651_111591511 | 155 |
| 440 | 3300025961 | Ga0207712_10036980 | Ga0207712_100369802 | 155 |
| 441 | 3300025961 | Ga0207712_10089813 | Ga0207712_100898132 | 155 |
| 442 | 3300025972 | Ga0207668_10019940 | Ga0207668_100199402 | 155 |
| 443 | 3300025972 | Ga0207668_10023124 | Ga0207668_100231242 | 155 |
| 444 | 3300025972 | Ga0207668_10065657 | Ga0207668_100656573 | 155 |
| 445 | 3300025972 | Ga0207668_10246095 | Ga0207668_102460952 | 155 |
| 446 | 3300025972 | Ga0207668_10253503 | Ga0207668_102535032 | 155 |
| 447 | 3300025972 | Ga0207668_10265918 | Ga0207668_102659183 | 155 |
| 448 | 3300025972 | Ga0207668_10700088 | Ga0207668_107000881 | 155 |
| 449 | 3300025972 | Ga0207668_10826863 | Ga0207668_108268632 | 155 |
| 450 | 3300025972 | Ga0207668_10828184 | Ga0207668_108281842 | 155 |
| 451 | 3300025981 | Ga0207640_10349913 | Ga0207640_103499131 | 155 |
| 452 | 3300025986 | Ga0207658_10095459 | Ga0207658_100954591 | 155 |
| 453 | 3300025986 | Ga0207658_10369273 | Ga0207658_103692732 | 155 |
| 454 | 3300026023 | Ga0207677_10020729 | Ga0207677_100207292 | 155 |
| 455 | 3300026023 | Ga0207677_10097727 | Ga0207677_100977272 | 155 |
| 456 | 3300026023 | Ga0207677_10250716 | Ga0207677_102507162 | 155 |
| 457 | 3300026023 | Ga0207677_10699397 | Ga0207677_106993971 | 155 |
| 458 | 3300026035 | Ga0207703_10114655 | Ga0207703_101146553 | 155 |
| 459 | 3300026035 | Ga0207703_10138276 | Ga0207703_101382761 | 155 |
| 460 | 3300026035 | Ga0207703_10219206 | Ga0207703_102192061 | 155 |
| 461 | 3300026041 | Ga0207639_10123795 | Ga0207639_101237952 | 155 |
| 462 | 3300026041 | Ga0207639_10226335 | Ga0207639_102263352 | 155 |
| 463 | 3300026041 | Ga0207639_10539757 | Ga0207639_105397571 | 155 |
| 464 | 3300026041 | Ga0207639_10970615 | Ga0207639_109706151 | 155 |
| 465 | 3300026067 | Ga0207678_10032526 | Ga0207678_100325263 | 155 |
| 466 | 3300026067 | Ga0207678_10043098 | Ga0207678_100430984 | 155 |
| 467 | 3300026067 | Ga0207678_10061848 | Ga0207678_100618481 | 155 |
| 468 | 3300026067 | Ga0207678_10271563 | Ga0207678_102715632 | 155 |
| 469 | 3300026067 | Ga0207678_10756362 | Ga0207678_107563621 | 155 |
| 470 | 3300026075 | Ga0207708_10077375 | Ga0207708_100773752 | 155 |
| 471 | 3300026075 | Ga0207708_10237664 | Ga0207708_102376641 | 155 |
| 472 | 3300026075 | Ga0207708_10423269 | Ga0207708_104232692 | 155 |
| 473 | 3300026075 | Ga0207708_10507752 | Ga0207708_105077522 | 155 |
| 474 | 3300026075 | Ga0207708_10675935 | Ga0207708_106759352 | 155 |
| 475 | 3300026078 | Ga0207702_10046401 | Ga0207702_100464012 | 155 |
| 476 | 3300026078 | Ga0207702_11619720 | Ga0207702_116197201 | 155 |
| 477 | 3300026088 | Ga0207641_10230182 | Ga0207641_102301822 | 155 |
| 478 | 3300026088 | Ga0207641_10233998 | Ga0207641_102339982 | 155 |
| 479 | 3300026088 | Ga0207641_10988089 | Ga0207641_109880892 | 155 |
| 480 | 3300026089 | Ga0207648_10056377 | Ga0207648_100563771 | 155 |
| 481 | 3300026089 | Ga0207648_10509395 | Ga0207648_105093952 | 155 |
| 482 | 3300026095 | Ga0207676_10040090 | Ga0207676_100400902 | 155 |
| 483 | 3300026095 | Ga0207676_10064028 | Ga0207676_100640282 | 155 |
| 484 | 3300026095 | Ga0207676_10508424 | Ga0207676_105084242 | 155 |
| 485 | 3300026095 | Ga0207676_11833737 | Ga0207676_118337371 | 155 |
| 486 | 3300026116 | Ga0207674_10529027 | Ga0207674_105290271 | 155 |
| 487 | 3300026116 | Ga0207674_11490176 | Ga0207674_114901761 | 155 |
| 488 | 3300026118 | Ga0207675_100028928 | Ga0207675_1000289285 | 155 |
| 489 | 3300026118 | Ga0207675_100063858 | Ga0207675_1000638584 | 155 |
| 490 | 3300026118 | Ga0207675_100504980 | Ga0207675_1005049802 | 155 |
| 491 | 3300026118 | Ga0207675_101547370 | Ga0207675_1015473701 | 155 |
| 492 | 3300026121 | Ga0207683_10027677 | Ga0207683_100276775 | 155 |
| 493 | 3300026121 | Ga0207683_10030892 | Ga0207683_100308921 | 155 |
| 494 | 3300026121 | Ga0207683_10117220 | Ga0207683_101172202 | 155 |
| 495 | 3300026121 | Ga0207683_10269089 | Ga0207683_102690891 | 155 |
| 496 | 3300026121 | Ga0207683_10500174 | Ga0207683_105001741 | 155 |
| 497 | 3300026121 | Ga0207683_10770452 | Ga0207683_107704521 | 155 |
| 498 | 3300026142 | Ga0207698_10137494 | Ga0207698_101374941 | 155 |
| 499 | 3300026142 | Ga0207698_11265862 | Ga0207698_112658621 | 155 |
| 500 | 3300026142 | Ga0207698_11279665 | Ga0207698_112796651 | 155 |
| 501 | 3300026142 | Ga0207698_12170278 | Ga0207698_121702781 | 155 |
| 502 | 3300027671 | Ga0209588_1000800 | Ga0209588_10008002 | 155 |
| 503 | 3300027866 | Ga0209813_10066460 | Ga0209813_100664601 | 155 |
| 504 | 3300027907 | Ga0207428_10402407 | Ga0207428_104024071 | 155 |
| 505 | 3300028379 | Ga0268266_10006104 | Ga0268266_100061049 | 155 |
| 506 | 3300028379 | Ga0268266_10099968 | Ga0268266_100999682 | 155 |
| 507 | 3300028379 | Ga0268266_10168235 | Ga0268266_101682352 | 155 |
| 508 | 3300028379 | Ga0268266_10928574 | Ga0268266_109285741 | 155 |
| 509 | 3300028380 | Ga0268265_10048108 | Ga0268265_100481082 | 155 |
| 510 | 3300028380 | Ga0268265_10093002 | Ga0268265_100930022 | 155 |
| 511 | 3300028380 | Ga0268265_10111628 | Ga0268265_101116282 | 155 |
| 512 | 3300028380 | Ga0268265_10141673 | Ga0268265_101416732 | 155 |
| 513 | 3300028380 | Ga0268265_10317726 | Ga0268265_103177261 | 155 |
| 514 | 3300028380 | Ga0268265_10478001 | Ga0268265_104780012 | 155 |
| 515 | 3300028380 | Ga0268265_10803871 | Ga0268265_108038712 | 155 |
| 516 | 3300028381 | Ga0268264_10066935 | Ga0268264_100669354 | 155 |
| 517 | 3300028381 | Ga0268264_10516701 | Ga0268264_105167012 | 155 |
| 518 | 3300028381 | Ga0268264_10565213 | Ga0268264_105652132 | 155 |
| 519 | 3300028381 | Ga0268264_10851582 | Ga0268264_108515821 | 155 |
| 520 | 3300028786 | Ga0307517_10001338 | Ga0307517_100013387 | 155 |
| 521 | 3300028794 | Ga0307515_10036525 | Ga0307515_100365259 | 155 |
| 522 | 3300028794 | Ga0307515_10448358 | Ga0307515_104483581 | 155 |
| 523 | 3300030521 | Ga0307511_10212060 | Ga0307511_102120601 | 155 |
| 524 | 3300031456 | Ga0307513_10340745 | Ga0307513_103407452 | 155 |
| 525 | 3300031548 | Ga0307408_100384323 | Ga0307408_1003843231 | 155 |
| 526 | 3300031548 | Ga0307408_100431421 | Ga0307408_1004314211 | 155 |
| 527 | 3300031730 | Ga0307516_10008231 | Ga0307516_1000823110 | 155 |
| 528 | 3300031730 | Ga0307516_10029188 | Ga0307516_100291882 | 155 |
| 529 | 3300031730 | Ga0307516_10287509 | Ga0307516_102875092 | 155 |
| 530 | 3300031730 | Ga0307516_10634793 | Ga0307516_106347931 | 155 |
| 531 | 3300031901 | Ga0307406_10044603 | Ga0307406_100446034 | 155 |
| 532 | 3300031901 | Ga0307406_10587394 | Ga0307406_105873941 | 155 |
| 533 | 3300031901 | Ga0307406_11072533 | Ga0307406_110725332 | 155 |
| 534 | 3300031911 | Ga0307412_10090963 | Ga0307412_100909632 | 155 |
| 535 | 3300031911 | Ga0307412_10645814 | Ga0307412_106458142 | 155 |
| 536 | 3300031995 | Ga0307409_100267377 | Ga0307409_1002673771 | 155 |
| 537 | 3300032002 | Ga0307416_100150540 | Ga0307416_1001505402 | 155 |
| 538 | 3300032002 | Ga0307416_100293588 | Ga0307416_1002935881 | 155 |
| 539 | 3300032002 | Ga0307416_100499659 | Ga0307416_1004996592 | 155 |
| 540 | 3300032005 | Ga0307411_10241558 | Ga0307411_102415581 | 155 |
| 541 | 3300032005 | Ga0307411_11488467 | Ga0307411_114884671 | 155 |
| 542 | 3300032126 | Ga0307415_100042079 | Ga0307415_1000420792 | 155 |
| 543 | 3300032126 | Ga0307415_100066547 | Ga0307415_1000665472 | 155 |
| 544 | 3300032126 | Ga0307415_100472074 | Ga0307415_1004720742 | 155 |
| 545 | 3300032126 | Ga0307415_101200304 | Ga0307415_1012003041 | 155 |
| 546 | 3300033180 | Ga0307510_10001271 | Ga0307510_1000127123 | 155 |
| 547 | 3300033180 | Ga0307510_10164389 | Ga0307510_101643891 | 155 |
| 548 | 3300035113 | Ga0373936_0040480 | Ga0373936_0040480_1191_1664 | 155 |
| 549 | 3300035695 | Ga0373927_0067522 | Ga0373927_0067522_1174_1641 | 155 |
| 550 | 3300037068 | Ga0373925_0383771 | Ga0373925_0383771_513_980 | 155 |
| 551 | 3300041413 | Ga0439465_0019851 | Ga0439465_0019851_920_1387 | 155 |
| 552 | 3300041443 | Ga0451789_0204474 | Ga0451789_0204474_203_670 | 155 |
| 553 | 3300041453 | Ga0451797_1323973 | Ga0451797_1323973_31_498 | 155 |
| 554 | 3300041456 | Ga0451795_0306874 | Ga0451795_0306874_393_860 | 155 |
| 555 | 3300041458 | Ga0451798_1097871 | Ga0451798_1097871_29_496 | 155 |
| 556 | 3300041459 | Ga0451800_1593314 | Ga0451800_1593314_322_789 | 155 |
| 557 | 3300041460 | Ga0451802_1059125 | Ga0451802_1059125_179_646 | 155 |
| 558 | 3300041491 | Ga0451833_0077301 | Ga0451833_0077301_128_595 | 155 |
| 559 | 3300041496 | Ga0451839_1189050 | Ga0451839_1189050_46_513 | 155 |
| 560 | 3300041498 | Ga0451841_0118866 | Ga0451841_0118866_72_539 | 155 |
| 561 | 3300041503 | Ga0451847_0131072 | Ga0451847_0131072_68_535 | 155 |
| 562 | 3300041511 | Ga0451855_0645708 | Ga0451855_0645708_42_509 | 155 |
| 563 | 3300041512 | Ga0451853_2093545 | Ga0451853_2093545_22_489 | 155 |
| 564 | 3300041512 | Ga0451853_3973549 | Ga0451853_3973549_265_738 | 155 |
| 565 | 3300041997 | Ga0439431_0096058 | Ga0439431_0096058_195_662 | 155 |
| 566 | 3300042438 | Ga0439459_0057244 | Ga0439459_0057244_296_763 | 155 |
| 567 | 3300046455 | Ga0495603_0012846 | Ga0495603_0012846_1131_1598 | 155 |
| 568 | 3300046455 | Ga0495603_0063011 | Ga0495603_0063011_483_950 | 155 |
| 569 | 3300046457 | Ga0495590_0122970 | Ga0495590_0122970_258_725 | 155 |
| 570 | 3300046460 | Ga0495638_0049454 | Ga0495638_0049454_1187_1654 | 155 |
| 571 | 3300046460 | Ga0495638_0056441 | Ga0495638_0056441_524_991 | 155 |
| 572 | 3300046460 | Ga0495638_0164633 | Ga0495638_0164633_26_493 | 155 |
| 573 | 3300046460 | Ga0495638_0337811 | Ga0495638_0337811_10_477 | 155 |
| 574 | 3300046472 | Ga0495580_0724786 | Ga0495580_0724786_120_587 | 155 |
| 575 | 3300046474 | Ga0495605_0112127 | Ga0495605_0112127_78_545 | 155 |
| 576 | 3300046474 | Ga0495605_0248588 | Ga0495605_0248588_239_706 | 155 |
| 577 | 3300046475 | Ga0495639_0196217 | Ga0495639_0196217_506_973 | 155 |
| 578 | 3300046491 | Ga0495584_0388112 | Ga0495584_0388112_201_668 | 155 |
| 579 | 3300046492 | Ga0495585_0025931 | Ga0495585_0025931_1144_1611 | 155 |
| 580 | 3300046500 | Ga0495596_0115283 | Ga0495596_0115283_135_602 | 155 |
| 581 | 3300046501 | Ga0495607_0224148 | Ga0495607_0224148_192_659 | 155 |
| 582 | 3300046507 | Ga0495606_0651257 | Ga0495606_0651257_19_486 | 155 |
| 583 | 3300046513 | Ga0495616_0102165 | Ga0495616_0102165_804_1271 | 155 |
| 584 | 3300046515 | Ga0495620_0067877 | Ga0495620_0067877_450_917 | 155 |
| 585 | 3300046515 | Ga0495620_0187352 | Ga0495620_0187352_133_600 | 155 |
| 586 | 3300046518 | Ga0495631_0153362 | Ga0495631_0153362_244_711 | 155 |
| 587 | 3300046518 | Ga0495631_0245149 | Ga0495631_0245149_88_555 | 155 |
| 588 | 3300046519 | Ga0495632_0069355 | Ga0495632_0069355_967_1434 | 155 |
| 589 | 3300046522 | Ga0495643_0294638 | Ga0495643_0294638_127_594 | 155 |
| 590 | 3300046523 | Ga0495644_0081779 | Ga0495644_0081779_480_947 | 155 |
| 591 | 3300046523 | Ga0495644_0087035 | Ga0495644_0087035_156_623 | 155 |
| 592 | 3300046524 | Ga0495648_0313929 | Ga0495648_0313929_25_492 | 155 |
| 593 | 3300046525 | Ga0495663_0133922 | Ga0495663_0133922_270_737 | 155 |
| 594 | 3300046526 | Ga0495666_0159917 | Ga0495666_0159917_329_796 | 155 |
| 595 | 3300046528 | Ga0495642_0334175 | Ga0495642_0334175_78_545 | 155 |
| 596 | 3300046531 | Ga0495665_0135927 | Ga0495665_0135927_117_584 | 155 |
| 597 | 3300046537 | Ga0495598_0017737 | Ga0495598_0017737_144_611 | 155 |
| 598 | 3300046538 | Ga0495609_0223398 | Ga0495609_0223398_55_522 | 155 |
| 599 | 3300046539 | Ga0495621_0021383 | Ga0495621_0021383_422_889 | 155 |
| 600 | 3300046557 | Ga0495622_0118482 | Ga0495622_0118482_507_974 | 155 |
| 601 | 3300046557 | Ga0495622_0323091 | Ga0495622_0323091_84_551 | 155 |
| 602 | 3300046558 | Ga0495633_0123773 | Ga0495633_0123773_23_490 | 155 |
| 603 | 3300046615 | Ga0495656_0030045 | Ga0495656_0030045_1192_1659 | 155 |
| 604 | 3300046615 | Ga0495656_0063752 | Ga0495656_0063752_699_1166 | 155 |
| 605 | 3300046616 | Ga0495668_0300981 | Ga0495668_0300981_202_669 | 155 |
| 606 | 3300046648 | Ga0495611_0058435 | Ga0495611_0058435_1058_1525 | 155 |
| 607 | 3300046648 | Ga0495611_0115176 | Ga0495611_0115176_736_1203 | 155 |
| 608 | 3300046660 | Ga0495625_0153785 | Ga0495625_0153785_563_1030 | 155 |
| 609 | 3300046660 | Ga0495625_0637374 | Ga0495625_0637374_67_534 | 155 |
| 610 | 3300046663 | Ga0495635_0795537 | Ga0495635_0795537_41_508 | 155 |
| 611 | 3300046664 | Ga0495659_0195683 | Ga0495659_0195683_184_651 | 155 |
| 612 | 3300046665 | Ga0495661_0096281 | Ga0495661_0096281_253_720 | 155 |
| 613 | 3300046674 | Ga0495588_0213977 | Ga0495588_0213977_158_625 | 155 |
| 614 | 3300046681 | Ga0495647_0478380 | Ga0495647_0478380_52_519 | 155 |
| 615 | 3300046683 | Ga0495658_0156962 | Ga0495658_0156962_833_1300 | 155 |
| 616 | 3300046683 | Ga0495658_0542700 | Ga0495658_0542700_17_484 | 155 |
| 617 | 3300046684 | Ga0495669_0020508 | Ga0495669_0020508_611_1078 | 155 |
| 618 | 3300046684 | Ga0495669_0131600 | Ga0495669_0131600_425_892 | 155 |
| 619 | 3300046689 | Ga0495613_0430161 | Ga0495613_0430161_231_698 | 155 |
| 620 | 3300046691 | Ga0495670_0305380 | Ga0495670_0305380_44_511 | 155 |
| 621 | 3300046692 | Ga0495671_0126575 | Ga0495671_0126575_462_929 | 155 |
| 622 | 3300046794 | Ga0495589_0072700 | Ga0495589_0072700_944_1411 | 155 |
| 623 | 3300046794 | Ga0495589_0086022 | Ga0495589_0086022_229_696 | 155 |
| 624 | 3300046794 | Ga0495589_0142507 | Ga0495589_0142507_215_682 | 155 |
| 625 | 3300046810 | Ga0495660_0384487 | Ga0495660_0384487_97_564 | 155 |
| 626 | 3300047315 | Ga0495581_0011636 | Ga0495581_0011636_1996_2463 | 155 |
| 627 | 3300047315 | Ga0495581_0127403 | Ga0495581_0127403_124_591 | 155 |
| 628 | 3300047315 | Ga0495581_0223174 | Ga0495581_0223174_283_750 | 155 |
| 629 | 3300047315 | Ga0495581_0318460 | Ga0495581_0318460_350_817 | 155 |
| 630 | 3300047317 | Ga0495604_0842035 | Ga0495604_0842035_14_481 | 155 |
| 631 | 3300047318 | Ga0495636_0049548 | Ga0495636_0049548_1159_1626 | 155 |
| 632 | 3300047318 | Ga0495636_0058864 | Ga0495636_0058864_745_1212 | 155 |
| 633 | 3300047318 | Ga0495636_0089460 | Ga0495636_0089460_431_898 | 155 |
| 634 | 3300047318 | Ga0495636_0224001 | Ga0495636_0224001_245_712 | 155 |
| 635 | 3300047319 | Ga0495674_0489472 | Ga0495674_0489472_475_969 | 155 |
| 636 | 3300047320 | Ga0495672_0013417 | Ga0495672_0013417_3938_4405 | 155 |
| 637 | 3300047321 | Ga0495676_0098498 | Ga0495676_0098498_777_1244 | 155 |
| 638 | 3300047469 | Ga0495673_0019319 | Ga0495673_0019319_2720_3187 | 155 |
| 639 | 3300047469 | Ga0495673_0221110 | Ga0495673_0221110_143_610 | 155 |
| 640 | 3300047472 | Ga0495686_0041319 | Ga0495686_0041319_105_572 | 155 |
| 641 | 3300048091 | Ga0495626_0231595 | Ga0495626_0231595_109_576 | 155 |
| 642 | 3300048903 | Ga0496100_0507350 | Ga0496100_0507350_332_799 | 155 |
| 643 | 3300048903 | Ga0496100_1376761 | Ga0496100_1376761_24_491 | 155 |
| 644 | 3300048904 | Ga0496101_0023371 | Ga0496101_0023371_2262_2729 | 155 |
| 645 | 3300048904 | Ga0496101_0239352 | Ga0496101_0239352_61_528 | 155 |
| 646 | 3300048904 | Ga0496101_0280213 | Ga0496101_0280213_784_1251 | 155 |
| 647 | 3300048904 | Ga0496101_0823504 | Ga0496101_0823504_195_662 | 155 |
| 648 | 3300048905 | Ga0496102_0017911 | Ga0496102_0017911_4142_4609 | 155 |
| 649 | 3300048905 | Ga0496102_0213461 | Ga0496102_0213461_740_1207 | 155 |
| 650 | 3300048905 | Ga0496102_0256941 | Ga0496102_0256941_1052_1519 | 155 |
| 651 | 3300048905 | Ga0496102_0265852 | Ga0496102_0265852_782_1249 | 155 |
| 652 | 3300048905 | Ga0496102_0415197 | Ga0496102_0415197_277_744 | 155 |
| 653 | 3300048905 | Ga0496102_0864138 | Ga0496102_0864138_196_663 | 155 |
| 654 | 3300048906 | Ga0496103_0071587 | Ga0496103_0071587_1107_1574 | 155 |
| 655 | 3300048906 | Ga0496103_0082938 | Ga0496103_0082938_772_1239 | 155 |
| 656 | 3300048906 | Ga0496103_0186298 | Ga0496103_0186298_48_515 | 155 |
| 657 | 3300048907 | Ga0496104_0411505 | Ga0496104_0411505_524_991 | 155 |
| 658 | 3300048907 | Ga0496104_0623369 | Ga0496104_0623369_31_498 | 155 |
| 659 | 3300048907 | Ga0496104_0900353 | Ga0496104_0900353_191_658 | 155 |
| 660 | 3300048908 | Ga0496105_0014175 | Ga0496105_0014175_3964_4431 | 155 |
| 661 | 3300048908 | Ga0496105_0412879 | Ga0496105_0412879_76_543 | 155 |
| 662 | 3300048909 | Ga0496106_0001014 | Ga0496106_0001014_495_962 | 155 |
| 663 | 3300048909 | Ga0496106_0030569 | Ga0496106_0030569_1141_1608 | 155 |
| 664 | 3300048909 | Ga0496106_0094937 | Ga0496106_0094937_1720_2187 | 155 |
| 665 | 3300048909 | Ga0496106_0213387 | Ga0496106_0213387_155_622 | 155 |
| 666 | 3300048910 | Ga0496107_0073340 | Ga0496107_0073340_243_710 | 155 |
| 667 | 3300048910 | Ga0496107_0129708 | Ga0496107_0129708_436_903 | 155 |
| 668 | 3300048910 | Ga0496107_0218747 | Ga0496107_0218747_846_1313 | 155 |
| 669 | 3300048911 | Ga0496108_0050866 | Ga0496108_0050866_1542_2009 | 155 |
| 670 | 3300048911 | Ga0496108_0071509 | Ga0496108_0071509_1764_2231 | 155 |
| 671 | 3300048911 | Ga0496108_0463217 | Ga0496108_0463217_523_990 | 155 |
| 672 | 3300048912 | Ga0496109_0186380 | Ga0496109_0186380_1064_1531 | 155 |
| 673 | 3300048912 | Ga0496109_0538515 | Ga0496109_0538515_76_543 | 155 |
| 674 | 3300048913 | Ga0496110_0142157 | Ga0496110_0142157_418_885 | 155 |
| 675 | 3300048914 | Ga0496111_0033983 | Ga0496111_0033983_565_1032 | 155 |
| 676 | 3300048914 | Ga0496111_0064866 | Ga0496111_0064866_1434_1901 | 155 |
| 677 | 3300048915 | Ga0496112_0277580 | Ga0496112_0277580_867_1334 | 155 |
| 678 | 3300048915 | Ga0496112_0448601 | Ga0496112_0448601_508_975 | 155 |
| 679 | 3300048916 | Ga0496113_0103626 | Ga0496113_0103626_761_1228 | 155 |
| 680 | 3300048916 | Ga0496113_0482690 | Ga0496113_0482690_103_570 | 155 |
| 681 | 3300048917 | Ga0496114_0008301 | Ga0496114_0008301_6689_7156 | 155 |
| 682 | 3300048917 | Ga0496114_0032009 | Ga0496114_0032009_2261_2743 | 155 |
| 683 | 3300048917 | Ga0496114_0035932 | Ga0496114_0035932_1952_2419 | 155 |
| 684 | 3300048917 | Ga0496114_0594040 | Ga0496114_0594040_383_850 | 155 |
| 685 | 3300048917 | Ga0496114_0604744 | Ga0496114_0604744_86_553 | 155 |
| 686 | 3300048917 | Ga0496114_0679275 | Ga0496114_0679275_114_581 | 155 |
| 687 | 3300048917 | Ga0496114_0928793 | Ga0496114_0928793_261_728 | 155 |
| 688 | 3300048918 | Ga0496115_0004376 | Ga0496115_0004376_2089_2556 | 155 |
| 689 | 3300048918 | Ga0496115_0230254 | Ga0496115_0230254_733_1200 | 155 |
| 690 | 3300048918 | Ga0496115_0286128 | Ga0496115_0286128_228_695 | 155 |
| 691 | 3300048918 | Ga0496115_0378341 | Ga0496115_0378341_531_998 | 155 |
| 692 | 3300048918 | Ga0496115_0501252 | Ga0496115_0501252_247_726 | 155 |
| 693 | 3300048921 | Ga0496118_0153486 | Ga0496118_0153486_369_836 | 155 |
| 694 | 3300048922 | Ga0496119_0124996 | Ga0496119_0124996_660_1127 | 155 |
| 695 | 3300048924 | Ga0496121_0175233 | Ga0496121_0175233_210_677 | 155 |
| 696 | 3300048924 | Ga0496121_0193014 | Ga0496121_0193014_756_1223 | 155 |
| 697 | 3300048924 | Ga0496121_0195571 | Ga0496121_0195571_69_551 | 155 |
| 698 | 3300048924 | Ga0496121_0296112 | Ga0496121_0296112_534_1001 | 155 |
| 699 | 3300048924 | Ga0496121_0722042 | Ga0496121_0722042_56_523 | 155 |
| 700 | 3300048927 | Ga0496124_0082915 | Ga0496124_0082915_158_625 | 155 |
| 701 | 3300048927 | Ga0496124_0168126 | Ga0496124_0168126_954_1421 | 155 |
| 702 | 3300048927 | Ga0496124_0445202 | Ga0496124_0445202_232_699 | 155 |
| 703 | 3300048927 | Ga0496124_0567626 | Ga0496124_0567626_149_616 | 155 |
| 704 | 3300048928 | Ga0496125_0090129 | Ga0496125_0090129_894_1361 | 155 |
| 705 | 3300048928 | Ga0496125_0242471 | Ga0496125_0242471_161_628 | 155 |
| 706 | 3300048928 | Ga0496125_0437223 | Ga0496125_0437223_274_741 | 155 |
| 707 | 3300048929 | Ga0496126_0002460 | Ga0496126_0002460_16328_16795 | 155 |
| 708 | 3300048929 | Ga0496126_0056061 | Ga0496126_0056061_1207_1674 | 155 |
| 709 | 3300048929 | Ga0496126_0103546 | Ga0496126_0103546_299_766 | 155 |
| 710 | 3300048929 | Ga0496126_0132946 | Ga0496126_0132946_488_955 | 155 |
| 711 | 3300048929 | Ga0496126_0135890 | Ga0496126_0135890_1620_2102 | 155 |
| 712 | 3300048929 | Ga0496126_0441969 | Ga0496126_0441969_71_538 | 155 |
| 713 | 3300048929 | Ga0496126_1125551 | Ga0496126_1125551_39_506 | 155 |
| 714 | 3300049460 | Ga0495682_0285903 | Ga0495682_0285903_92_559 | 155 |
| 715 | 3300049575 | Ga0501039_1090913 | Ga0501039_1090913_106_573 | 155 |
| 716 | 3300050489 | nmdc:mga03683_27750_c1 | nmdc:mga03683_27750_c1_795_1262 | 155 |
| 717 | 3300050489 | nmdc:mga03683_29035_c1 | nmdc:mga03683_29035_c1_171_638 | 155 |
| 718 | 3300050490 | nmdc:mga03n38_533221_c1 | nmdc:mga03n38_533221_c1_25_492 | 155 |
| 719 | 3300050490 | nmdc:mga03n38_84131_c1 | nmdc:mga03n38_84131_c1_222_689 | 155 |
| 720 | 3300050490 | nmdc:mga03n38_93190_c1 | nmdc:mga03n38_93190_c1_769_1236 | 155 |
| 721 | 3300050490 | nmdc:mga03n38_983_c1 | nmdc:mga03n38_983_c1_3958_4425 | 155 |
| 722 | 3300050491 | nmdc:mga00v17_141946_c1 | nmdc:mga00v17_141946_c1_59_526 | 155 |
| 723 | 3300050491 | nmdc:mga00v17_171470_c1 | nmdc:mga00v17_171470_c1_342_809 | 155 |
| 724 | 3300050491 | nmdc:mga00v17_195751_c1 | nmdc:mga00v17_195751_c1_777_1244 | 155 |
| 725 | 3300050491 | nmdc:mga00v17_38844_c1 | nmdc:mga00v17_38844_c1_1423_1890 | 155 |
| 726 | 3300050491 | nmdc:mga00v17_96637_c1 | nmdc:mga00v17_96637_c1_777_1244 | 155 |
| 727 | 3300050492 | nmdc:mga0yw44_18229_c1 | nmdc:mga0yw44_18229_c1_48_515 | 155 |
| 728 | 3300050492 | nmdc:mga0yw44_184596_c1 | nmdc:mga0yw44_184596_c1_763_1230 | 155 |
| 729 | 3300050492 | nmdc:mga0yw44_201729_c1 | nmdc:mga0yw44_201729_c1_525_992 | 155 |
| 730 | 3300050492 | nmdc:mga0yw44_218528_c1 | nmdc:mga0yw44_218528_c1_287_754 | 155 |
| 731 | 3300050493 | nmdc:mga0k408_31768_c1 | nmdc:mga0k408_31768_c1_1973_2440 | 155 |
| 732 | 3300050493 | nmdc:mga0k408_66541_c1 | nmdc:mga0k408_66541_c1_1203_1670 | 155 |
| 733 | 3300050493 | nmdc:mga0k408_857948_c1 | nmdc:mga0k408_857948_c1_29_496 | 155 |
| 734 | 3300050494 | nmdc:mga06z11_112434_c1 | nmdc:mga06z11_112434_c1_474_941 | 155 |
| 735 | 3300050494 | nmdc:mga06z11_37966_c1 | nmdc:mga06z11_37966_c1_643_1110 | 155 |
| 736 | 3300050494 | nmdc:mga06z11_80134_c1 | nmdc:mga06z11_80134_c1_67_534 | 155 |
| 737 | 3300050495 | nmdc:mga04h51_74902_c1 | nmdc:mga04h51_74902_c1_134_601 | 155 |
| 738 | 3300050495 | nmdc:mga04h51_85263_c1 | nmdc:mga04h51_85263_c1_392_859 | 155 |
| 739 | 3300050496 | nmdc:mga07m45_156015_c1 | nmdc:mga07m45_156015_c1_371_838 | 155 |
| 740 | 3300050496 | nmdc:mga07m45_76608_c1 | nmdc:mga07m45_76608_c1_599_1066 | 155 |
| 741 | 3300050507 | nmdc:mga05p37_624977_c1 | nmdc:mga05p37_624977_c1_128_595 | 155 |
| 742 | 3300050511 | nmdc:mga08y16_320063_c1 | nmdc:mga08y16_320063_c1_886_1353 | 155 |
| 743 | 3300050512 | nmdc:mga0n895_306810_c1 | nmdc:mga0n895_306810_c1_1098_1565 | 155 |
| 744 | 3300050513 | nmdc:mga0rr50_175827_c1 | nmdc:mga0rr50_175827_c1_642_1109 | 155 |
| 745 | 3300050514 | nmdc:mga08x19_703636_c1 | nmdc:mga08x19_703636_c1_199_666 | 155 |
| 746 | 3300050515 | nmdc:mga0a205_295163_c1 | nmdc:mga0a205_295163_c1_774_1241 | 155 |
| 747 | 3300050515 | nmdc:mga0a205_785997_c1 | nmdc:mga0a205_785997_c1_114_581 | 155 |
| 748 | 3300050516 | nmdc:mga0sz30_43832_c1 | nmdc:mga0sz30_43832_c1_806_1273 | 155 |
| 749 | 3300053079 | Ga0500610_0317223 | Ga0500610_0317223_115_582 | 155 |
| 750 | 3300053083 | Ga0495655_0042595 | Ga0495655_0042595_664_1131 | 155 |
| 751 | 3300053086 | Ga0500578_0195299 | Ga0500578_0195299_382_849 | 155 |
| 752 | 3300053087 | Ga0500643_042060 | Ga0500643_042060_262_729 | 155 |
| 753 | 3300053087 | Ga0500643_186881 | Ga0500643_186881_17_484 | 155 |
| 754 | 3300053088 | Ga0500644_0177051 | Ga0500644_0177051_27_494 | 155 |
| 755 | 3300053090 | Ga0500646_0162299 | Ga0500646_0162299_228_695 | 155 |
| 756 | 3300053090 | Ga0500646_0276771 | Ga0500646_0276771_120_587 | 155 |
| 757 | 3300053092 | Ga0500583_0168680 | Ga0500583_0168680_206_673 | 155 |
| 758 | 3300053094 | Ga0500566_0311815 | Ga0500566_0311815_248_715 | 155 |
| 759 | 3300053096 | Ga0500641_0001979 | Ga0500641_0001979_1284_1751 | 155 |
| 760 | 3300053096 | Ga0500641_0004753 | Ga0500641_0004753_1321_1788 | 155 |
| 761 | 3300053096 | Ga0500641_0048387 | Ga0500641_0048387_1217_1684 | 155 |
| 762 | 3300053109 | Ga0500569_077676 | Ga0500569_077676_162_629 | 155 |
| 763 | 3300053116 | Ga0500592_081340 | Ga0500592_081340_16_483 | 155 |
| 764 | 3300053118 | Ga0500594_0137620 | Ga0500594_0137620_17_484 | 155 |
| 765 | 3300053119 | Ga0500595_067699 | Ga0500595_067699_535_1002 | 155 |
| 766 | 3300053126 | Ga0500621_192249 | Ga0500621_192249_18_485 | 155 |
| 767 | 3300053130 | Ga0500642_0165832 | Ga0500642_0165832_371_838 | 155 |
| 768 | 3300053130 | Ga0500642_0177611 | Ga0500642_0177611_10_477 | 155 |
| 769 | 3300053133 | Ga0500655_019362 | Ga0500655_019362_611_1078 | 155 |
| 770 | 3300053134 | Ga0500658_0298125 | Ga0500658_0298125_229_696 | 155 |
| 771 | 3300053137 | Ga0500561_0221398 | Ga0500561_0221398_10_477 | 155 |
| 772 | 3300053147 | Ga0500589_027270 | Ga0500589_027270_175_642 | 155 |
| 773 | 3300053147 | Ga0500589_188955 | Ga0500589_188955_309_776 | 155 |
| 774 | 3300053147 | Ga0500589_193055 | Ga0500589_193055_155_622 | 155 |
| 775 | 3300053148 | Ga0500590_092717 | Ga0500590_092717_45_512 | 155 |
| 776 | 3300053150 | Ga0500603_190334 | Ga0500603_190334_74_541 | 155 |
| 777 | 3300053151 | Ga0500604_0029825 | Ga0500604_0029825_967_1434 | 155 |
| 778 | 3300053156 | Ga0500622_0285217 | Ga0500622_0285217_40_507 | 155 |
| 779 | 3300053160 | Ga0500633_0142958 | Ga0500633_0142958_81_548 | 155 |
| 780 | 3300053161 | Ga0500634_0056200 | Ga0500634_0056200_1458_1925 | 155 |
| 781 | 3300053178 | Ga0500637_0309310 | Ga0500637_0309310_282_749 | 155 |
| 782 | 3300053727 | Ga0500611_034917 | Ga0500611_034917_232_699 | 155 |
| 783 | 3300053730 | Ga0500645_147305 | Ga0500645_147305_84_551 | 155 |
| 784 | 3300053731 | Ga0500609_038710 | Ga0500609_038710_20_487 | 155 |
| 785 | 3300003320 | rootH2_10104916 | rootH2_101049163 | 156 |
| 786 | 3300003322 | rootL2_10144200 | rootL2_101442002 | 156 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4q1w-assembly1.cif.gz_B | mutations outside the active site of hiv-1 protease alter enzyme structure and dynamic ensemble of the active site to confer drug resistance | 0.327 | 28 | 57 |
| 3oy4-assembly1.cif.gz_B | crystal structure of hiv-1 l76v protease in complex with the protease inhibitor darunavir. | 0.3089 | 28 | 58 |
| 4q1x-assembly1.cif.gz_B | mutations outside the active site of hiv-1 protease alter enzyme structure and dynamic ensemble of the active site to confer drug resistance | 0.3082 | 28 | 58 |
| 4obg-assembly2.cif.gz_C | crystal structure of nelfinavir-resistant, inactive hiv-1 protease (d30n/n88d) in complex with the p1-p6 substrate. | 0.3035 | 28 | 58 |
| 3jvy-assembly1.cif.gz_B | hiv-1 protease mutant g86a with darunavir | 0.3033 | 28 | 58 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6T8X9_163_323_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.3596 | 50 | 119 | 3.40.1280.10 |
| af_F4J7U9_265_379_2.40.70.10 | Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases | 0.3406 | 12 | 45 | 2.40.70.10 |
| 1wec001 | Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases | 0.3119 | 31 | 56 | 2.40.70.10 |
| af_A4I142_25_204_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.2751 | 57 | 144 | 3.40.1280.10 |
| af_Q54DY1_210_295_3.30.2330.10 | Alpha Beta;2-Layer Sandwich;arginine biosynthesis bifunctional protein fold;arginine biosynthesis bifunctional protein suprefamily | 0.2358 | 64 | 144 | 3.30.2330.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q8R3J2-F1-model_v4 | Uncharacterized protein | 0.8926 | 15 | 146 |
|
| AF-H0TJT8-F1-model_v4 | Uncharacterized protein | 0.8413 | 28 | 146 |
|
| AF-A0A4Q8R3J2-F1-model_v4 | Uncharacterized protein | 0.8256 | 15 | 146 |
|
| AF-Q13E45-F1-model_v4 | Uncharacterized protein | 0.8137 | 1 | 155 |
|
| AF-Q13E45-F1-model_v4 | Uncharacterized protein | 0.8041 | 1 | 155 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar