F480823
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 787 | 266 | 787 | 224 |
Family's Representative Sequence
| Representative Sequence | 3300005614|Ga0068856_100011053|Ga0068856_1000110535 |
| Length | 261 |
| Sequence | LVLCALIENYETQIPNESIKAQRTKHKEQSSSVNMTHVTTFSRYDQKLEFILRSAAQIFADKSYHSTSMRDIARATNVSLAGLYHYCKSKEELLFLIQDNCFGRVLERLEERLRDVRDPIEKLRIFIENHLSFFAANMAEMKVLSHESQSLQGDLRQHVSGKKDKYTKLATRILREVDDGSGVNLTVATYALFGMMNWIYNWYDPKGRLKVHDLAQNLTQLFLEGFAPGSSFEVSDKFPRQLPENLSVWRGASRQQEKPIR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 89 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 179 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 181 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 182 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 183 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 184 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 186 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 187 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 188 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 189 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 190 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 192 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 193 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 194 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 195 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 196 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 197 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 198 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 199 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 200 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 201 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 202 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 203 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 204 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 214 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 215 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 216 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 217 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 220 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 221 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 222 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 223 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 224 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 225 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 226 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 227 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 228 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 230 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 231 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 232 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 233 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 234 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 235 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 236 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 237 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 238 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 239 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 240 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 241 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 242 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 243 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 244 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 245 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 246 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 247 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 248 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 249 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 250 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 251 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 252 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 253 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 254 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 255 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 256 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 257 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 258 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.65 |
| Rhizosphere | 97.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_699995 | 2162886007 | Bacteria | 3256 |
| 2 | CNAas_1000021 | 3300000532 | Bacteria | 9956 |
| 3 | LJNas_1009394 | 3300000546 | Unclassified | 1046 |
| 4 | JGI24748J21848_1000035 | 3300002074 | Bacteria | 73922 |
| 5 | JGI24034J26672_10000039 | 3300002239 | Bacteria | 73907 |
| 6 | JGI24742J22300_10012050 | 3300002244 | Unclassified | 1438 |
| 7 | JGI24751J29686_10000098 | 3300002459 | Bacteria | 48084 |
| 8 | JGI25406J46586_10075459 | 3300003203 | Unclassified | 1046 |
| 9 | Ga0065714_10064594 | 3300005288 | Bacteria | 30899 |
| 10 | Ga0065704_10075225 | 3300005289 | Bacteria | 5721 |
| 11 | Ga0065704_10094010 | 3300005289 | Bacteria | 2566 |
| 12 | Ga0065704_10150367 | 3300005289 | Bacteria | 1434 |
| 13 | Ga0065712_10000121 | 3300005290 | Bacteria | 103063 |
| 14 | Ga0065712_10002144 | 3300005290 | Bacteria | 6237 |
| 15 | Ga0065712_10320374 | 3300005290 | Bacteria | 829 |
| 16 | Ga0065715_10056236 | 3300005293 | Bacteria | 1064 |
| 17 | Ga0065715_10098674 | 3300005293 | Bacteria | 3507 |
| 18 | Ga0065715_10214433 | 3300005293 | Unclassified | 1299 |
| 19 | Ga0065707_10003206 | 3300005295 | Bacteria | 6416 |
| 20 | Ga0065707_10007244 | 3300005295 | Bacteria | 5581 |
| 21 | Ga0065707_10242325 | 3300005295 | Unclassified | 1151 |
| 22 | Ga0065707_10260663 | 3300005295 | Unclassified | 1098 |
| 23 | Ga0065707_10310452 | 3300005295 | Bacteria | 986 |
| 24 | Ga0070676_10284671 | 3300005328 | Unclassified | 1115 |
| 25 | Ga0070690_100000567 | 3300005330 | Bacteria | 18596 |
| 26 | Ga0070690_100037832 | 3300005330 | Unclassified | 3042 |
| 27 | Ga0070690_100177763 | 3300005330 | Bacteria | 1469 |
| 28 | Ga0070670_100002046 | 3300005331 | Bacteria | 16506 |
| 29 | Ga0070670_100005519 | 3300005331 | Bacteria | 10673 |
| 30 | Ga0070670_100122872 | 3300005331 | Bacteria | 2240 |
| 31 | Ga0070670_100188623 | 3300005331 | Bacteria | 1791 |
| 32 | Ga0070670_100301303 | 3300005331 | Bacteria | 1402 |
| 33 | Ga0070670_100604196 | 3300005331 | Unclassified | 982 |
| 34 | Ga0068869_100010916 | 3300005334 | Bacteria | 5944 |
| 35 | Ga0068869_100013833 | 3300005334 | Bacteria | 5378 |
| 36 | Ga0068869_100047108 | 3300005334 | Bacteria | 3112 |
| 37 | Ga0068869_100047112 | 3300005334 | Bacteria | 3112 |
| 38 | Ga0068869_100105449 | 3300005334 | Bacteria | 2138 |
| 39 | Ga0068869_100240009 | 3300005334 | Unclassified | 1444 |
| 40 | Ga0068869_100917290 | 3300005334 | Unclassified | 759 |
| 41 | Ga0070666_10604571 | 3300005335 | Bacteria | 800 |
| 42 | Ga0070680_100030063 | 3300005336 | Bacteria | 4363 |
| 43 | Ga0070680_100199240 | 3300005336 | Bacteria | 1688 |
| 44 | Ga0070682_100000058 | 3300005337 | Bacteria | 108660 |
| 45 | Ga0070682_100035308 | 3300005337 | Bacteria | 3052 |
| 46 | Ga0070682_100071595 | 3300005337 | Unclassified | 2220 |
| 47 | Ga0068868_100022725 | 3300005338 | Bacteria | 4738 |
| 48 | Ga0068868_100036004 | 3300005338 | Unclassified | 3828 |
| 49 | Ga0068868_100158815 | 3300005338 | Bacteria | 1866 |
| 50 | Ga0070660_100055252 | 3300005339 | Bacteria | 3068 |
| 51 | Ga0070689_100005379 | 3300005340 | Bacteria | 8731 |
| 52 | Ga0070689_100030638 | 3300005340 | Bacteria | 4084 |
| 53 | Ga0070689_100070955 | 3300005340 | Bacteria | 2720 |
| 54 | Ga0070689_100088331 | 3300005340 | Bacteria | 2439 |
| 55 | Ga0070691_10112000 | 3300005341 | Unclassified | 1366 |
| 56 | Ga0070687_100029472 | 3300005343 | Unclassified | 2673 |
| 57 | Ga0070687_100085051 | 3300005343 | Bacteria | 1735 |
| 58 | Ga0070687_100131479 | 3300005343 | Bacteria | 1445 |
| 59 | Ga0070687_100134904 | 3300005343 | Unclassified | 1430 |
| 60 | Ga0070661_100013512 | 3300005344 | Bacteria | 5732 |
| 61 | Ga0070692_10096350 | 3300005345 | Bacteria | 1616 |
| 62 | Ga0070692_10148110 | 3300005345 | Bacteria | 1334 |
| 63 | Ga0070668_100586531 | 3300005347 | Bacteria | 974 |
| 64 | Ga0070669_100008727 | 3300005353 | Bacteria | 7231 |
| 65 | Ga0070669_100053620 | 3300005353 | Bacteria | 2952 |
| 66 | Ga0070669_100096862 | 3300005353 | Bacteria | 2220 |
| 67 | Ga0070669_100155261 | 3300005353 | Bacteria | 1774 |
| 68 | Ga0070669_100180086 | 3300005353 | Bacteria | 1653 |
| 69 | Ga0070669_100244719 | 3300005353 | Bacteria | 1426 |
| 70 | Ga0070669_100394975 | 3300005353 | Bacteria | 1130 |
| 71 | Ga0070675_100447190 | 3300005354 | Unclassified | 1159 |
| 72 | Ga0070671_100003674 | 3300005355 | Bacteria | 12027 |
| 73 | Ga0070671_100010870 | 3300005355 | Bacteria | 7306 |
| 74 | Ga0070671_100022824 | 3300005355 | Bacteria | 5112 |
| 75 | Ga0070671_100086061 | 3300005355 | Bacteria | 2630 |
| 76 | Ga0070674_100559405 | 3300005356 | Bacteria | 961 |
| 77 | Ga0070673_100074245 | 3300005364 | Bacteria | 2740 |
| 78 | Ga0070673_100132885 | 3300005364 | Bacteria | 2091 |
| 79 | Ga0070673_100295693 | 3300005364 | Bacteria | 1424 |
| 80 | Ga0070673_100401037 | 3300005364 | Bacteria | 1226 |
| 81 | Ga0070673_100428643 | 3300005364 | Bacteria | 1187 |
| 82 | Ga0070659_100009251 | 3300005366 | Bacteria | 7232 |
| 83 | Ga0070667_100065960 | 3300005367 | Bacteria | 3075 |
| 84 | Ga0070703_10002571 | 3300005406 | Bacteria | 5230 |
| 85 | Ga0070701_10037732 | 3300005438 | Bacteria | 2441 |
| 86 | Ga0070701_10123090 | 3300005438 | Unclassified | 1464 |
| 87 | Ga0070701_10145139 | 3300005438 | Bacteria | 1361 |
| 88 | Ga0070701_10199736 | 3300005438 | Bacteria | 1181 |
| 89 | Ga0070701_10394783 | 3300005438 | Unclassified | 875 |
| 90 | Ga0070700_100000157 | 3300005441 | Bacteria | 39668 |
| 91 | Ga0070700_100037529 | 3300005441 | Bacteria | 2947 |
| 92 | Ga0070700_100109848 | 3300005441 | Bacteria | 1831 |
| 93 | Ga0070700_100207097 | 3300005441 | Bacteria | 1381 |
| 94 | Ga0070700_100273428 | 3300005441 | Bacteria | 1222 |
| 95 | Ga0070700_100397835 | 3300005441 | Bacteria | 1035 |
| 96 | Ga0070694_100014780 | 3300005444 | Bacteria | 4891 |
| 97 | Ga0070694_100041531 | 3300005444 | Bacteria | 3069 |
| 98 | Ga0070694_100075001 | 3300005444 | Bacteria | 2339 |
| 99 | Ga0070694_100079171 | 3300005444 | Bacteria | 2281 |
| 100 | Ga0070694_100295507 | 3300005444 | Unclassified | 1240 |
| 101 | Ga0070694_100309790 | 3300005444 | Bacteria | 1212 |
| 102 | Ga0070694_100337418 | 3300005444 | Unclassified | 1164 |
| 103 | Ga0070708_100008524 | 3300005445 | Bacteria | 8236 |
| 104 | Ga0070708_100020885 | 3300005445 | Bacteria | 5528 |
| 105 | Ga0070708_100211799 | 3300005445 | Bacteria | 1816 |
| 106 | Ga0070708_100446331 | 3300005445 | Bacteria | 1220 |
| 107 | Ga0070708_100971501 | 3300005445 | Bacteria | 797 |
| 108 | Ga0070662_100016062 | 3300005457 | Bacteria | 5022 |
| 109 | Ga0070662_100052204 | 3300005457 | Bacteria | 2955 |
| 110 | Ga0070662_100087889 | 3300005457 | Bacteria | 2328 |
| 111 | Ga0070662_100847908 | 3300005457 | Bacteria | 778 |
| 112 | Ga0070681_10000065 | 3300005458 | Bacteria | 76633 |
| 113 | Ga0070681_10002833 | 3300005458 | Bacteria | 16027 |
| 114 | Ga0070681_10037839 | 3300005458 | Bacteria | 4839 |
| 115 | Ga0068867_100007155 | 3300005459 | Bacteria | 7886 |
| 116 | Ga0068867_100021246 | 3300005459 | Bacteria | 4631 |
| 117 | Ga0068867_100098739 | 3300005459 | Bacteria | 2227 |
| 118 | Ga0068867_100159470 | 3300005459 | Bacteria | 1778 |
| 119 | Ga0068867_100161279 | 3300005459 | Bacteria | 1768 |
| 120 | Ga0070706_100000431 | 3300005467 | Bacteria | 50311 |
| 121 | Ga0070706_100015492 | 3300005467 | Bacteria | 7041 |
| 122 | Ga0070706_100028799 | 3300005467 | Bacteria | 5115 |
| 123 | Ga0070706_100057839 | 3300005467 | Bacteria | 3578 |
| 124 | Ga0070706_100092982 | 3300005467 | Bacteria | 2798 |
| 125 | Ga0070706_100154266 | 3300005467 | Bacteria | 2144 |
| 126 | Ga0070706_100280197 | 3300005467 | Bacteria | 1556 |
| 127 | Ga0070707_100001118 | 3300005468 | Bacteria | 26489 |
| 128 | Ga0070707_100023273 | 3300005468 | Bacteria | 5861 |
| 129 | Ga0070707_100064574 | 3300005468 | Bacteria | 3515 |
| 130 | Ga0070707_100079132 | 3300005468 | Bacteria | 3172 |
| 131 | Ga0070707_100115491 | 3300005468 | Bacteria | 2605 |
| 132 | Ga0070707_100461013 | 3300005468 | Bacteria | 1232 |
| 133 | Ga0070698_100000008 | 3300005471 | Bacteria | 119408 |
| 134 | Ga0070698_100009412 | 3300005471 | Bacteria | 10471 |
| 135 | Ga0070698_100033195 | 3300005471 | Bacteria | 5345 |
| 136 | Ga0070698_100080843 | 3300005471 | Bacteria | 3244 |
| 137 | Ga0070698_100183585 | 3300005471 | Bacteria | 2030 |
| 138 | Ga0070698_100261221 | 3300005471 | Bacteria | 1664 |
| 139 | Ga0070698_100503842 | 3300005471 | Unclassified | 1149 |
| 140 | Ga0070699_100016622 | 3300005518 | Bacteria | 6315 |
| 141 | Ga0070699_100125797 | 3300005518 | Bacteria | 2257 |
| 142 | Ga0070699_100180025 | 3300005518 | Unclassified | 1876 |
| 143 | Ga0070699_100239133 | 3300005518 | Unclassified | 1620 |
| 144 | Ga0070699_100327234 | 3300005518 | Bacteria | 1378 |
| 145 | Ga0070679_100000013 | 3300005530 | Bacteria | 151602 |
| 146 | Ga0070679_100040983 | 3300005530 | Bacteria | 4609 |
| 147 | Ga0070697_100000014 | 3300005536 | Bacteria | 144589 |
| 148 | Ga0070697_100000343 | 3300005536 | Bacteria | 36583 |
| 149 | Ga0070697_100101613 | 3300005536 | Bacteria | 2389 |
| 150 | Ga0070697_100180771 | 3300005536 | Bacteria | 1788 |
| 151 | Ga0070697_100313858 | 3300005536 | Bacteria | 1349 |
| 152 | Ga0070697_100499816 | 3300005536 | Bacteria | 1063 |
| 153 | Ga0070697_100632833 | 3300005536 | Bacteria | 941 |
| 154 | Ga0068853_100017537 | 3300005539 | Bacteria | 5909 |
| 155 | Ga0068853_100528466 | 3300005539 | Unclassified | 1116 |
| 156 | Ga0070686_100005948 | 3300005544 | Bacteria | 6763 |
| 157 | Ga0070686_100012198 | 3300005544 | Bacteria | 4888 |
| 158 | Ga0070686_100119473 | 3300005544 | Bacteria | 1808 |
| 159 | Ga0070686_100168331 | 3300005544 | Bacteria | 1548 |
| 160 | Ga0070695_100032167 | 3300005545 | Bacteria | 3279 |
| 161 | Ga0070695_100052270 | 3300005545 | Bacteria | 2625 |
| 162 | Ga0070695_100060072 | 3300005545 | Bacteria | 2463 |
| 163 | Ga0070695_100090421 | 3300005545 | Bacteria | 2043 |
| 164 | Ga0070695_100165974 | 3300005545 | Bacteria | 1554 |
| 165 | Ga0070695_100175146 | 3300005545 | Bacteria | 1516 |
| 166 | Ga0070695_100196446 | 3300005545 | Bacteria | 1439 |
| 167 | Ga0070695_100348500 | 3300005545 | Bacteria | 1109 |
| 168 | Ga0070695_100354895 | 3300005545 | Bacteria | 1099 |
| 169 | Ga0070695_100404577 | 3300005545 | Unclassified | 1036 |
| 170 | Ga0070696_100016199 | 3300005546 | Bacteria | 5015 |
| 171 | Ga0070696_100098187 | 3300005546 | Bacteria | 2095 |
| 172 | Ga0070696_100120059 | 3300005546 | Unclassified | 1902 |
| 173 | Ga0070696_100154084 | 3300005546 | Bacteria | 1689 |
| 174 | Ga0070696_100301934 | 3300005546 | Bacteria | 1226 |
| 175 | Ga0070696_100359715 | 3300005546 | Bacteria | 1129 |
| 176 | Ga0070696_100518192 | 3300005546 | Bacteria | 951 |
| 177 | Ga0070693_100325774 | 3300005547 | Unclassified | 1044 |
| 178 | Ga0070693_100504441 | 3300005547 | Unclassified | 859 |
| 179 | Ga0070665_100105216 | 3300005548 | Bacteria | 2824 |
| 180 | Ga0070704_100066968 | 3300005549 | Bacteria | 2592 |
| 181 | Ga0070704_100211362 | 3300005549 | Bacteria | 1572 |
| 182 | Ga0070704_100265848 | 3300005549 | Unclassified | 1415 |
| 183 | Ga0070704_100422223 | 3300005549 | Bacteria | 1142 |
| 184 | Ga0070704_100462978 | 3300005549 | Bacteria | 1094 |
| 185 | Ga0070704_100521119 | 3300005549 | Bacteria | 1035 |
| 186 | Ga0068855_100168180 | 3300005563 | Unclassified | 2484 |
| 187 | Ga0070664_100001208 | 3300005564 | Bacteria | 20575 |
| 188 | Ga0070664_100094606 | 3300005564 | Bacteria | 2591 |
| 189 | Ga0070664_101297331 | 3300005564 | Bacteria | 687 |
| 190 | Ga0068857_100001249 | 3300005577 | Bacteria | 19891 |
| 191 | Ga0068857_100049265 | 3300005577 | Bacteria | 3737 |
| 192 | Ga0068857_100058962 | 3300005577 | Bacteria | 3409 |
| 193 | Ga0068857_100231978 | 3300005577 | Bacteria | 1688 |
| 194 | Ga0068857_100279441 | 3300005577 | Bacteria | 1535 |
| 195 | Ga0068854_100076078 | 3300005578 | Bacteria | 2466 |
| 196 | Ga0068854_100263338 | 3300005578 | Bacteria | 1381 |
| 197 | Ga0068854_100558470 | 3300005578 | Bacteria | 972 |
| 198 | Ga0068856_100011053 | 3300005614 | Bacteria | 8768 |
| 199 | Ga0070702_100003806 | 3300005615 | Bacteria | 6819 |
| 200 | Ga0070702_100031429 | 3300005615 | Bacteria | 2905 |
| 201 | Ga0070702_100092716 | 3300005615 | Bacteria | 1835 |
| 202 | Ga0070702_100883287 | 3300005615 | Bacteria | 698 |
| 203 | Ga0068852_100337509 | 3300005616 | Bacteria | 1468 |
| 204 | Ga0068852_100742341 | 3300005616 | Bacteria | 993 |
| 205 | Ga0068859_100008702 | 3300005617 | Bacteria | 10262 |
| 206 | Ga0068859_100012277 | 3300005617 | Bacteria | 8616 |
| 207 | Ga0068859_100017817 | 3300005617 | Bacteria | 7139 |
| 208 | Ga0068859_100058943 | 3300005617 | Bacteria | 3868 |
| 209 | Ga0068859_100067796 | 3300005617 | Bacteria | 3603 |
| 210 | Ga0068859_100120850 | 3300005617 | Bacteria | 2686 |
| 211 | Ga0068859_100310636 | 3300005617 | Bacteria | 1670 |
| 212 | Ga0068859_100526428 | 3300005617 | Bacteria | 1277 |
| 213 | Ga0068859_100628183 | 3300005617 | Bacteria | 1166 |
| 214 | Ga0068864_100009780 | 3300005618 | Bacteria | 7906 |
| 215 | Ga0068864_100057920 | 3300005618 | Bacteria | 3347 |
| 216 | Ga0068864_100182502 | 3300005618 | Bacteria | 1919 |
| 217 | Ga0068864_100224605 | 3300005618 | Bacteria | 1734 |
| 218 | Ga0068866_10010008 | 3300005718 | Bacteria | 4050 |
| 219 | Ga0068866_10118306 | 3300005718 | Bacteria | 1489 |
| 220 | Ga0068861_100005742 | 3300005719 | Bacteria | 8414 |
| 221 | Ga0068861_100011809 | 3300005719 | Bacteria | 6078 |
| 222 | Ga0068861_100027856 | 3300005719 | Bacteria | 4120 |
| 223 | Ga0068861_100189915 | 3300005719 | Bacteria | 1716 |
| 224 | Ga0068861_100207828 | 3300005719 | Unclassified | 1647 |
| 225 | Ga0068861_100285173 | 3300005719 | Bacteria | 1424 |
| 226 | Ga0068861_100408152 | 3300005719 | Bacteria | 1207 |
| 227 | Ga0068861_100643142 | 3300005719 | Bacteria | 979 |
| 228 | Ga0068851_10007449 | 3300005834 | Bacteria | 5026 |
| 229 | Ga0068870_10014072 | 3300005840 | Bacteria | 3773 |
| 230 | Ga0068870_10137315 | 3300005840 | Bacteria | 1427 |
| 231 | Ga0068870_10460825 | 3300005840 | Unclassified | 840 |
| 232 | Ga0068863_100036585 | 3300005841 | Bacteria | 4676 |
| 233 | Ga0068863_100062950 | 3300005841 | Bacteria | 3508 |
| 234 | Ga0068863_100072842 | 3300005841 | Bacteria | 3250 |
| 235 | Ga0068863_100114635 | 3300005841 | Bacteria | 2567 |
| 236 | Ga0068863_100130469 | 3300005841 | Bacteria | 2399 |
| 237 | Ga0068863_100287103 | 3300005841 | Bacteria | 1595 |
| 238 | Ga0068863_100773637 | 3300005841 | Bacteria | 957 |
| 239 | Ga0068863_100896827 | 3300005841 | Unclassified | 887 |
| 240 | Ga0068858_100000053 | 3300005842 | Bacteria | 119869 |
| 241 | Ga0068858_100044544 | 3300005842 | Bacteria | 4112 |
| 242 | Ga0068858_100154917 | 3300005842 | Bacteria | 2155 |
| 243 | Ga0068858_100210917 | 3300005842 | Bacteria | 1838 |
| 244 | Ga0068858_100349319 | 3300005842 | Bacteria | 1417 |
| 245 | Ga0068858_100820826 | 3300005842 | Bacteria | 907 |
| 246 | Ga0068860_100004968 | 3300005843 | Bacteria | 13554 |
| 247 | Ga0068860_100025602 | 3300005843 | Bacteria | 5691 |
| 248 | Ga0068860_100129750 | 3300005843 | Bacteria | 2418 |
| 249 | Ga0068860_100160847 | 3300005843 | Bacteria | 2165 |
| 250 | Ga0068860_100253686 | 3300005843 | Bacteria | 1713 |
| 251 | Ga0068860_100335605 | 3300005843 | Bacteria | 1485 |
| 252 | Ga0068862_100011968 | 3300005844 | Bacteria | 7166 |
| 253 | Ga0068862_100087027 | 3300005844 | Bacteria | 2717 |
| 254 | Ga0068862_100178538 | 3300005844 | Bacteria | 1904 |
| 255 | Ga0068862_100730526 | 3300005844 | Unclassified | 962 |
| 256 | Ga0068862_100738739 | 3300005844 | Bacteria | 956 |
| 257 | Ga0081540_1028728 | 3300005983 | Bacteria | 3115 |
| 258 | Ga0081539_10000998 | 3300005985 | Bacteria | 52505 |
| 259 | Ga0081539_10002508 | 3300005985 | Bacteria | 25695 |
| 260 | Ga0081539_10057930 | 3300005985 | Bacteria | 2140 |
| 261 | Ga0070716_100068529 | 3300006173 | Unclassified | 2076 |
| 262 | Ga0070716_100083496 | 3300006173 | Bacteria | 1913 |
| 263 | Ga0070716_100461628 | 3300006173 | Bacteria | 928 |
| 264 | Ga0097621_100013953 | 3300006237 | Bacteria | 6001 |
| 265 | Ga0097621_100032515 | 3300006237 | Bacteria | 4148 |
| 266 | Ga0068871_100008976 | 3300006358 | Bacteria | 7216 |
| 267 | Ga0068871_100031887 | 3300006358 | Bacteria | 4158 |
| 268 | Ga0068871_100278527 | 3300006358 | Bacteria | 1463 |
| 269 | Ga0075428_100349297 | 3300006844 | Unclassified | 1587 |
| 270 | Ga0075428_100458836 | 3300006844 | Bacteria | 1364 |
| 271 | Ga0075428_100499377 | 3300006844 | Bacteria | 1302 |
| 272 | Ga0075431_100053880 | 3300006847 | Bacteria | 4147 |
| 273 | Ga0075433_10092654 | 3300006852 | Bacteria | 2673 |
| 274 | Ga0075433_10108274 | 3300006852 | Bacteria | 2465 |
| 275 | Ga0075433_10135748 | 3300006852 | Unclassified | 2187 |
| 276 | Ga0075433_10148887 | 3300006852 | Bacteria | 2082 |
| 277 | Ga0075433_10174455 | 3300006852 | Bacteria | 1913 |
| 278 | Ga0075433_10179311 | 3300006852 | Bacteria | 1885 |
| 279 | Ga0075433_10724345 | 3300006852 | Unclassified | 871 |
| 280 | Ga0075433_10875503 | 3300006852 | Bacteria | 784 |
| 281 | Ga0075434_100039378 | 3300006871 | Bacteria | 4683 |
| 282 | Ga0075434_100124658 | 3300006871 | Bacteria | 2593 |
| 283 | Ga0075434_100148611 | 3300006871 | Bacteria | 2363 |
| 284 | Ga0075434_100168493 | 3300006871 | Bacteria | 2210 |
| 285 | Ga0075434_100309585 | 3300006871 | Bacteria | 1600 |
| 286 | Ga0075434_100903844 | 3300006871 | Bacteria | 898 |
| 287 | Ga0075429_100349441 | 3300006880 | Bacteria | 1294 |
| 288 | Ga0068865_100145726 | 3300006881 | Bacteria | 1791 |
| 289 | Ga0075436_100000002 | 3300006914 | Bacteria | 475522 |
| 290 | Ga0075436_100166625 | 3300006914 | Bacteria | 1555 |
| 291 | Ga0097620_100008702 | 3300006931 | Bacteria | 10262 |
| 292 | Ga0097620_100012277 | 3300006931 | Bacteria | 8616 |
| 293 | Ga0097620_100017817 | 3300006931 | Bacteria | 7139 |
| 294 | Ga0097620_100058944 | 3300006931 | Bacteria | 3868 |
| 295 | Ga0097620_100067795 | 3300006931 | Bacteria | 3603 |
| 296 | Ga0097620_100120849 | 3300006931 | Bacteria | 2686 |
| 297 | Ga0097620_100310619 | 3300006931 | Bacteria | 1670 |
| 298 | Ga0097620_100526424 | 3300006931 | Bacteria | 1277 |
| 299 | Ga0097620_100628182 | 3300006931 | Bacteria | 1166 |
| 300 | Ga0075435_100000198 | 3300007076 | Bacteria | 36326 |
| 301 | Ga0075435_100024836 | 3300007076 | Bacteria | 4657 |
| 302 | Ga0099794_10001385 | 3300007265 | Bacteria | 8449 |
| 303 | Ga0105251_10065511 | 3300009011 | Bacteria | 1700 |
| 304 | Ga0105244_10357370 | 3300009036 | Bacteria | 673 |
| 305 | Ga0105240_10181726 | 3300009093 | Bacteria | 2481 |
| 306 | Ga0105240_10241664 | 3300009093 | Bacteria | 2093 |
| 307 | Ga0111539_10007031 | 3300009094 | Bacteria | 14443 |
| 308 | Ga0111539_10114236 | 3300009094 | Bacteria | 3167 |
| 309 | Ga0111539_10124845 | 3300009094 | Bacteria | 3016 |
| 310 | Ga0111539_10212839 | 3300009094 | Bacteria | 2252 |
| 311 | Ga0111539_11180524 | 3300009094 | Bacteria | 889 |
| 312 | Ga0105245_10297429 | 3300009098 | Bacteria | 1583 |
| 313 | Ga0105245_10498687 | 3300009098 | Bacteria | 1233 |
| 314 | Ga0105247_10000052 | 3300009101 | Bacteria | 141465 |
| 315 | Ga0105247_10019475 | 3300009101 | Bacteria | 4074 |
| 316 | Ga0105247_10040702 | 3300009101 | Bacteria | 2842 |
| 317 | Ga0114129_10015480 | 3300009147 | Bacteria | 10848 |
| 318 | Ga0114129_10022866 | 3300009147 | Bacteria | 8865 |
| 319 | Ga0114129_10085855 | 3300009147 | Bacteria | 4366 |
| 320 | Ga0114129_10093871 | 3300009147 | Bacteria | 4155 |
| 321 | Ga0114129_10099787 | 3300009147 | Bacteria | 4018 |
| 322 | Ga0114129_10478683 | 3300009147 | Bacteria | 1629 |
| 323 | Ga0114129_10576322 | 3300009147 | Bacteria | 1461 |
| 324 | Ga0114129_10827978 | 3300009147 | Bacteria | 1178 |
| 325 | Ga0114129_10925110 | 3300009147 | Bacteria | 1103 |
| 326 | Ga0114129_10943793 | 3300009147 | Bacteria | 1090 |
| 327 | Ga0114129_11491569 | 3300009147 | Bacteria | 831 |
| 328 | Ga0114129_11633033 | 3300009147 | Unclassified | 788 |
| 329 | Ga0105243_10001504 | 3300009148 | Bacteria | 20405 |
| 330 | Ga0105243_10003856 | 3300009148 | Bacteria | 11977 |
| 331 | Ga0105243_10009519 | 3300009148 | Bacteria | 7396 |
| 332 | Ga0105243_10024493 | 3300009148 | Bacteria | 4603 |
| 333 | Ga0105243_10115489 | 3300009148 | Bacteria | 2254 |
| 334 | Ga0105243_10176025 | 3300009148 | Unclassified | 1857 |
| 335 | Ga0105243_10180898 | 3300009148 | Bacteria | 1833 |
| 336 | Ga0105243_10196398 | 3300009148 | Bacteria | 1766 |
| 337 | Ga0105243_10208720 | 3300009148 | Unclassified | 1718 |
| 338 | Ga0105243_10307311 | 3300009148 | Unclassified | 1439 |
| 339 | Ga0105241_10111849 | 3300009174 | Bacteria | 2187 |
| 340 | Ga0105241_10126184 | 3300009174 | Bacteria | 2067 |
| 341 | Ga0105241_10145910 | 3300009174 | Unclassified | 1931 |
| 342 | Ga0105241_10178785 | 3300009174 | Bacteria | 1758 |
| 343 | Ga0105241_10279943 | 3300009174 | Bacteria | 1424 |
| 344 | Ga0105241_10373356 | 3300009174 | Bacteria | 1244 |
| 345 | Ga0105241_10641128 | 3300009174 | Bacteria | 964 |
| 346 | Ga0105241_10856254 | 3300009174 | Bacteria | 841 |
| 347 | Ga0105242_10003404 | 3300009176 | Bacteria | 12370 |
| 348 | Ga0105242_10029809 | 3300009176 | Bacteria | 4354 |
| 349 | Ga0105242_10070549 | 3300009176 | Bacteria | 2897 |
| 350 | Ga0105242_10101463 | 3300009176 | Bacteria | 2439 |
| 351 | Ga0105242_10109794 | 3300009176 | Bacteria | 2349 |
| 352 | Ga0105242_10320475 | 3300009176 | Bacteria | 1421 |
| 353 | Ga0105242_10453231 | 3300009176 | Bacteria | 1210 |
| 354 | Ga0105242_10517077 | 3300009176 | Bacteria | 1138 |
| 355 | Ga0105242_10983912 | 3300009176 | Unclassified | 850 |
| 356 | Ga0105242_11085999 | 3300009176 | Unclassified | 813 |
| 357 | Ga0105242_11307976 | 3300009176 | Bacteria | 749 |
| 358 | Ga0105248_10014780 | 3300009177 | Bacteria | 8596 |
| 359 | Ga0105248_10014842 | 3300009177 | Bacteria | 8580 |
| 360 | Ga0105248_10021365 | 3300009177 | Bacteria | 7171 |
| 361 | Ga0105248_10030337 | 3300009177 | Bacteria | 6037 |
| 362 | Ga0105248_10033630 | 3300009177 | Bacteria | 5728 |
| 363 | Ga0105248_10048643 | 3300009177 | Bacteria | 4757 |
| 364 | Ga0105248_10251027 | 3300009177 | Bacteria | 1991 |
| 365 | Ga0105248_10278088 | 3300009177 | Bacteria | 1884 |
| 366 | Ga0105248_10292434 | 3300009177 | Bacteria | 1834 |
| 367 | Ga0105248_10559895 | 3300009177 | Bacteria | 1290 |
| 368 | Ga0105248_10702106 | 3300009177 | Bacteria | 1141 |
| 369 | Ga0105237_10000468 | 3300009545 | Bacteria | 57134 |
| 370 | Ga0105237_10279707 | 3300009545 | Bacteria | 1671 |
| 371 | Ga0105238_10002654 | 3300009551 | Bacteria | 17795 |
| 372 | Ga0105238_10413537 | 3300009551 | Bacteria | 1343 |
| 373 | Ga0105249_10000003 | 3300009553 | Bacteria | 370855 |
| 374 | Ga0105249_10010278 | 3300009553 | Bacteria | 8221 |
| 375 | Ga0105249_10038874 | 3300009553 | Bacteria | 4319 |
| 376 | Ga0105249_10043318 | 3300009553 | Bacteria | 4094 |
| 377 | Ga0105249_10140190 | 3300009553 | Bacteria | 2318 |
| 378 | Ga0105249_10553056 | 3300009553 | Bacteria | 1202 |
| 379 | Ga0105239_10009646 | 3300010375 | Bacteria | 10857 |
| 380 | Ga0105239_10049188 | 3300010375 | Bacteria | 4623 |
| 381 | Ga0105239_10450098 | 3300010375 | Bacteria | 1461 |
| 382 | Ga0105239_10457824 | 3300010375 | Bacteria | 1448 |
| 383 | Ga0105239_10661803 | 3300010375 | Bacteria | 1193 |
| 384 | Ga0105246_10022556 | 3300011119 | Bacteria | 4062 |
| 385 | Ga0105246_10112062 | 3300011119 | Unclassified | 2006 |
| 386 | Ga0105246_10226107 | 3300011119 | Bacteria | 1470 |
| 387 | Ga0105246_10395351 | 3300011119 | Unclassified | 1146 |
| 388 | Ga0157373_10023272 | 3300013100 | Bacteria | 4492 |
| 389 | Ga0157373_10052311 | 3300013100 | Bacteria | 2906 |
| 390 | Ga0157373_10153543 | 3300013100 | Bacteria | 1620 |
| 391 | Ga0157371_10332497 | 3300013102 | Bacteria | 1104 |
| 392 | Ga0157374_10930778 | 3300013296 | Bacteria | 887 |
| 393 | Ga0157378_10000090 | 3300013297 | Bacteria | 86085 |
| 394 | Ga0157378_10007028 | 3300013297 | Bacteria | 9823 |
| 395 | Ga0157378_10008063 | 3300013297 | Bacteria | 9194 |
| 396 | Ga0157378_10025360 | 3300013297 | Bacteria | 5222 |
| 397 | Ga0157378_10062821 | 3300013297 | Bacteria | 3317 |
| 398 | Ga0157378_10205599 | 3300013297 | Bacteria | 1864 |
| 399 | Ga0157378_10220455 | 3300013297 | Bacteria | 1803 |
| 400 | Ga0157378_10339260 | 3300013297 | Unclassified | 1465 |
| 401 | Ga0157378_10424945 | 3300013297 | Bacteria | 1314 |
| 402 | Ga0157378_10631851 | 3300013297 | Bacteria | 1085 |
| 403 | Ga0157378_10637211 | 3300013297 | Bacteria | 1080 |
| 404 | Ga0157378_10880946 | 3300013297 | Unclassified | 925 |
| 405 | Ga0157378_10952927 | 3300013297 | Bacteria | 891 |
| 406 | Ga0163162_10000033 | 3300013306 | Bacteria | 150185 |
| 407 | Ga0163162_10011591 | 3300013306 | Bacteria | 8598 |
| 408 | Ga0163162_10078154 | 3300013306 | Bacteria | 3374 |
| 409 | Ga0163162_10125072 | 3300013306 | Unclassified | 2677 |
| 410 | Ga0163162_10338188 | 3300013306 | Unclassified | 1638 |
| 411 | Ga0163162_10629769 | 3300013306 | Bacteria | 1197 |
| 412 | Ga0163162_10787373 | 3300013306 | Bacteria | 1069 |
| 413 | Ga0163162_11402584 | 3300013306 | Bacteria | 795 |
| 414 | Ga0157372_10010507 | 3300013307 | Bacteria | 9855 |
| 415 | Ga0157372_10238872 | 3300013307 | Bacteria | 2108 |
| 416 | Ga0157372_11388662 | 3300013307 | Bacteria | 810 |
| 417 | Ga0157375_10005668 | 3300013308 | Bacteria | 10866 |
| 418 | Ga0157375_10364735 | 3300013308 | Unclassified | 1611 |
| 419 | Ga0157375_10429129 | 3300013308 | Bacteria | 1488 |
| 420 | Ga0157375_10710596 | 3300013308 | Unclassified | 1158 |
| 421 | Ga0163163_10003484 | 3300014325 | Bacteria | 13363 |
| 422 | Ga0163163_10011368 | 3300014325 | Bacteria | 8070 |
| 423 | Ga0163163_10049931 | 3300014325 | Bacteria | 4119 |
| 424 | Ga0163163_10103299 | 3300014325 | Bacteria | 2875 |
| 425 | Ga0163163_10104071 | 3300014325 | Bacteria | 2863 |
| 426 | Ga0163163_10186477 | 3300014325 | Bacteria | 2122 |
| 427 | Ga0163163_10226996 | 3300014325 | Bacteria | 1916 |
| 428 | Ga0163163_10257173 | 3300014325 | Bacteria | 1797 |
| 429 | Ga0163163_10595755 | 3300014325 | Bacteria | 1168 |
| 430 | Ga0157380_10001117 | 3300014326 | Bacteria | 17322 |
| 431 | Ga0157380_10008445 | 3300014326 | Bacteria | 7354 |
| 432 | Ga0157380_10072483 | 3300014326 | Bacteria | 2790 |
| 433 | Ga0157380_10088678 | 3300014326 | Bacteria | 2546 |
| 434 | Ga0157380_10097785 | 3300014326 | Bacteria | 2437 |
| 435 | Ga0157380_10442213 | 3300014326 | Bacteria | 1246 |
| 436 | Ga0157380_10527591 | 3300014326 | Unclassified | 1153 |
| 437 | Ga0157380_10684711 | 3300014326 | Bacteria | 1028 |
| 438 | Ga0157380_11048510 | 3300014326 | Bacteria | 852 |
| 439 | Ga0157377_10023493 | 3300014745 | Bacteria | 3268 |
| 440 | Ga0157377_10050448 | 3300014745 | Bacteria | 2343 |
| 441 | Ga0157377_10266921 | 3300014745 | Unclassified | 1116 |
| 442 | Ga0157379_10088304 | 3300014968 | Bacteria | 2780 |
| 443 | Ga0157379_10116747 | 3300014968 | Bacteria | 2400 |
| 444 | Ga0157379_10123026 | 3300014968 | Bacteria | 2335 |
| 445 | Ga0157379_10405133 | 3300014968 | Bacteria | 1254 |
| 446 | Ga0157379_10449990 | 3300014968 | Bacteria | 1189 |
| 447 | Ga0157379_10573942 | 3300014968 | Bacteria | 1051 |
| 448 | Ga0157376_10378801 | 3300014969 | Bacteria | 1362 |
| 449 | Ga0157376_10419179 | 3300014969 | Bacteria | 1299 |
| 450 | Ga0182007_10062075 | 3300015262 | Bacteria | 1225 |
| 451 | Ga0182007_10117888 | 3300015262 | Unclassified | 887 |
| 452 | Ga0182005_1068097 | 3300015265 | Bacteria | 976 |
| 453 | Ga0163161_10074696 | 3300017792 | Bacteria | 2486 |
| 454 | Ga0163161_10242148 | 3300017792 | Bacteria | 1403 |
| 455 | Ga0163161_10335628 | 3300017792 | Bacteria | 1198 |
| 456 | Ga0163161_10500896 | 3300017792 | Bacteria | 989 |
| 457 | Ga0213876_10015546 | 3300021384 | Bacteria | 4027 |
| 458 | Ga0207672_1000693 | 3300025223 | Bacteria | 3873 |
| 459 | Ga0207656_10000731 | 3300025321 | Bacteria | 10747 |
| 460 | Ga0207653_10003230 | 3300025885 | Bacteria | 5150 |
| 461 | Ga0207642_10149375 | 3300025899 | Unclassified | 1242 |
| 462 | Ga0207710_10000004 | 3300025900 | Bacteria | 846540 |
| 463 | Ga0207710_10030646 | 3300025900 | Bacteria | 2348 |
| 464 | Ga0207688_10130743 | 3300025901 | Bacteria | 1471 |
| 465 | Ga0207680_10065045 | 3300025903 | Bacteria | 2238 |
| 466 | Ga0207647_10028782 | 3300025904 | Bacteria | 3605 |
| 467 | Ga0207647_10060937 | 3300025904 | Unclassified | 2305 |
| 468 | Ga0207645_10086715 | 3300025907 | Bacteria | 2011 |
| 469 | Ga0207643_10031116 | 3300025908 | Bacteria | 2973 |
| 470 | Ga0207684_10000316 | 3300025910 | Bacteria | 68606 |
| 471 | Ga0207684_10007906 | 3300025910 | Bacteria | 9508 |
| 472 | Ga0207684_10073429 | 3300025910 | Bacteria | 2905 |
| 473 | Ga0207684_10163094 | 3300025910 | Bacteria | 1920 |
| 474 | Ga0207684_10303875 | 3300025910 | Bacteria | 1375 |
| 475 | Ga0207684_10341189 | 3300025910 | Bacteria | 1290 |
| 476 | Ga0207654_10030797 | 3300025911 | Bacteria | 2949 |
| 477 | Ga0207654_10182102 | 3300025911 | Bacteria | 1371 |
| 478 | Ga0207654_10371236 | 3300025911 | Unclassified | 989 |
| 479 | Ga0207707_10000004 | 3300025912 | Bacteria | 391281 |
| 480 | Ga0207707_10041799 | 3300025912 | Bacteria | 4003 |
| 481 | Ga0207695_10114042 | 3300025913 | Bacteria | 2678 |
| 482 | Ga0207671_10001108 | 3300025914 | Bacteria | 32488 |
| 483 | Ga0207660_10016005 | 3300025917 | Bacteria | 4958 |
| 484 | Ga0207660_10374362 | 3300025917 | Unclassified | 1144 |
| 485 | Ga0207662_10012804 | 3300025918 | Bacteria | 4679 |
| 486 | Ga0207662_10087850 | 3300025918 | Bacteria | 1908 |
| 487 | Ga0207662_10518494 | 3300025918 | Bacteria | 822 |
| 488 | Ga0207657_10138729 | 3300025919 | Bacteria | 1988 |
| 489 | Ga0207657_10341907 | 3300025919 | Bacteria | 1181 |
| 490 | Ga0207649_10037995 | 3300025920 | Bacteria | 2912 |
| 491 | Ga0207652_10000122 | 3300025921 | Bacteria | 85075 |
| 492 | Ga0207652_10035361 | 3300025921 | Bacteria | 4216 |
| 493 | Ga0207646_10000576 | 3300025922 | Bacteria | 48114 |
| 494 | Ga0207646_10005566 | 3300025922 | Bacteria | 13225 |
| 495 | Ga0207646_10024120 | 3300025922 | Bacteria | 5576 |
| 496 | Ga0207646_10051924 | 3300025922 | Bacteria | 3668 |
| 497 | Ga0207646_10252253 | 3300025922 | Bacteria | 1594 |
| 498 | Ga0207646_10355145 | 3300025922 | Bacteria | 1324 |
| 499 | Ga0207681_10006395 | 3300025923 | Bacteria | 7233 |
| 500 | Ga0207681_10066022 | 3300025923 | Bacteria | 2503 |
| 501 | Ga0207681_10086629 | 3300025923 | Bacteria | 2226 |
| 502 | Ga0207681_10224768 | 3300025923 | Bacteria | 1454 |
| 503 | Ga0207694_10026090 | 3300025924 | Bacteria | 4443 |
| 504 | Ga0207694_10034546 | 3300025924 | Bacteria | 3877 |
| 505 | Ga0207650_10000001 | 3300025925 | Bacteria | 1545726 |
| 506 | Ga0207650_10000555 | 3300025925 | Bacteria | 30291 |
| 507 | Ga0207650_10041897 | 3300025925 | Bacteria | 3357 |
| 508 | Ga0207650_10089544 | 3300025925 | Bacteria | 2349 |
| 509 | Ga0207650_10099499 | 3300025925 | Bacteria | 2236 |
| 510 | Ga0207650_10109313 | 3300025925 | Bacteria | 2138 |
| 511 | Ga0207650_10284223 | 3300025925 | Bacteria | 1348 |
| 512 | Ga0207659_10487395 | 3300025926 | Bacteria | 1042 |
| 513 | Ga0207687_10054774 | 3300025927 | Bacteria | 2792 |
| 514 | Ga0207687_10218709 | 3300025927 | Bacteria | 1498 |
| 515 | Ga0207687_10779214 | 3300025927 | Unclassified | 815 |
| 516 | Ga0207644_10000206 | 3300025931 | Bacteria | 41161 |
| 517 | Ga0207644_10019624 | 3300025931 | Bacteria | 4589 |
| 518 | Ga0207644_10053796 | 3300025931 | Bacteria | 2898 |
| 519 | Ga0207644_10226816 | 3300025931 | Bacteria | 1483 |
| 520 | Ga0207690_10041616 | 3300025932 | Bacteria | 3012 |
| 521 | Ga0207690_10217625 | 3300025932 | Bacteria | 1460 |
| 522 | Ga0207690_10287949 | 3300025932 | Bacteria | 1281 |
| 523 | Ga0207706_10060196 | 3300025933 | Bacteria | 3344 |
| 524 | Ga0207706_10113310 | 3300025933 | Bacteria | 2386 |
| 525 | Ga0207686_10000740 | 3300025934 | Bacteria | 20214 |
| 526 | Ga0207686_10002448 | 3300025934 | Bacteria | 10083 |
| 527 | Ga0207686_10127984 | 3300025934 | Unclassified | 1738 |
| 528 | Ga0207686_10841938 | 3300025934 | Unclassified | 737 |
| 529 | Ga0207709_10000754 | 3300025935 | Bacteria | 25567 |
| 530 | Ga0207709_10018169 | 3300025935 | Bacteria | 3933 |
| 531 | Ga0207709_10051797 | 3300025935 | Bacteria | 2517 |
| 532 | Ga0207709_10204051 | 3300025935 | Bacteria | 1414 |
| 533 | Ga0207709_10204726 | 3300025935 | Bacteria | 1412 |
| 534 | Ga0207709_10218273 | 3300025935 | Bacteria | 1373 |
| 535 | Ga0207709_10765350 | 3300025935 | Unclassified | 777 |
| 536 | Ga0207670_10004999 | 3300025936 | Bacteria | 7225 |
| 537 | Ga0207670_10025119 | 3300025936 | Bacteria | 3735 |
| 538 | Ga0207669_10419135 | 3300025937 | Bacteria | 1053 |
| 539 | Ga0207704_10045559 | 3300025938 | Unclassified | 2606 |
| 540 | Ga0207665_10311296 | 3300025939 | Unclassified | 1180 |
| 541 | Ga0207665_10331144 | 3300025939 | Bacteria | 1145 |
| 542 | Ga0207691_10170346 | 3300025940 | Bacteria | 1907 |
| 543 | Ga0207691_10264749 | 3300025940 | Unclassified | 1481 |
| 544 | Ga0207711_10014225 | 3300025941 | Bacteria | 6609 |
| 545 | Ga0207711_10031649 | 3300025941 | Bacteria | 4467 |
| 546 | Ga0207711_10077256 | 3300025941 | Bacteria | 2902 |
| 547 | Ga0207711_10154903 | 3300025941 | Unclassified | 2070 |
| 548 | Ga0207711_10183591 | 3300025941 | Bacteria | 1903 |
| 549 | Ga0207711_10191113 | 3300025941 | Unclassified | 1866 |
| 550 | Ga0207711_10212680 | 3300025941 | Bacteria | 1766 |
| 551 | Ga0207689_10001985 | 3300025942 | Bacteria | 19327 |
| 552 | Ga0207689_10016832 | 3300025942 | Bacteria | 6188 |
| 553 | Ga0207689_10018626 | 3300025942 | Bacteria | 5857 |
| 554 | Ga0207689_10030576 | 3300025942 | Bacteria | 4488 |
| 555 | Ga0207689_10055831 | 3300025942 | Bacteria | 3249 |
| 556 | Ga0207689_10075394 | 3300025942 | Bacteria | 2772 |
| 557 | Ga0207689_10347858 | 3300025942 | Bacteria | 1232 |
| 558 | Ga0207689_10395458 | 3300025942 | Unclassified | 1152 |
| 559 | Ga0207679_10060003 | 3300025945 | Unclassified | 2824 |
| 560 | Ga0207679_10709858 | 3300025945 | Bacteria | 913 |
| 561 | Ga0207651_10023987 | 3300025960 | Bacteria | 3764 |
| 562 | Ga0207651_10110530 | 3300025960 | Bacteria | 2062 |
| 563 | Ga0207651_10229299 | 3300025960 | Bacteria | 1507 |
| 564 | Ga0207651_10339171 | 3300025960 | Bacteria | 1262 |
| 565 | Ga0207651_10828142 | 3300025960 | Unclassified | 821 |
| 566 | Ga0207712_10000060 | 3300025961 | Bacteria | 136248 |
| 567 | Ga0207712_10002854 | 3300025961 | Bacteria | 11068 |
| 568 | Ga0207712_10175755 | 3300025961 | Unclassified | 1678 |
| 569 | Ga0207712_10332787 | 3300025961 | Bacteria | 1257 |
| 570 | Ga0207712_10342703 | 3300025961 | Bacteria | 1240 |
| 571 | Ga0207668_10072733 | 3300025972 | Unclassified | 2461 |
| 572 | Ga0207640_10050988 | 3300025981 | Unclassified | 2688 |
| 573 | Ga0207640_10185052 | 3300025981 | Bacteria | 1565 |
| 574 | Ga0207640_10329284 | 3300025981 | Bacteria | 1219 |
| 575 | Ga0207640_10348673 | 3300025981 | Unclassified | 1189 |
| 576 | Ga0207677_10089882 | 3300026023 | Bacteria | 2230 |
| 577 | Ga0207677_10180364 | 3300026023 | Bacteria | 1660 |
| 578 | Ga0207703_10000093 | 3300026035 | Bacteria | 104313 |
| 579 | Ga0207703_10149736 | 3300026035 | Bacteria | 2033 |
| 580 | Ga0207703_10177078 | 3300026035 | Bacteria | 1880 |
| 581 | Ga0207703_10295746 | 3300026035 | Unclassified | 1475 |
| 582 | Ga0207703_10298791 | 3300026035 | Bacteria | 1468 |
| 583 | Ga0207703_10479728 | 3300026035 | Bacteria | 1165 |
| 584 | Ga0207703_10834258 | 3300026035 | Unclassified | 881 |
| 585 | Ga0207639_10160976 | 3300026041 | Unclassified | 1891 |
| 586 | Ga0207639_10237452 | 3300026041 | Bacteria | 1583 |
| 587 | Ga0207639_10381728 | 3300026041 | Bacteria | 1265 |
| 588 | Ga0207708_10000331 | 3300026075 | Bacteria | 37200 |
| 589 | Ga0207708_10006300 | 3300026075 | Bacteria | 8797 |
| 590 | Ga0207708_10006438 | 3300026075 | Bacteria | 8702 |
| 591 | Ga0207708_10105023 | 3300026075 | Bacteria | 2189 |
| 592 | Ga0207708_10114058 | 3300026075 | Bacteria | 2100 |
| 593 | Ga0207708_10185306 | 3300026075 | Bacteria | 1654 |
| 594 | Ga0207708_10241248 | 3300026075 | Bacteria | 1454 |
| 595 | Ga0207641_10089775 | 3300026088 | Bacteria | 2686 |
| 596 | Ga0207641_10097529 | 3300026088 | Bacteria | 2584 |
| 597 | Ga0207641_10159449 | 3300026088 | Bacteria | 2050 |
| 598 | Ga0207641_10273772 | 3300026088 | Bacteria | 1585 |
| 599 | Ga0207641_10819768 | 3300026088 | Bacteria | 921 |
| 600 | Ga0207648_10006728 | 3300026089 | Bacteria | 11403 |
| 601 | Ga0207648_10015111 | 3300026089 | Bacteria | 7106 |
| 602 | Ga0207648_10205229 | 3300026089 | Unclassified | 1749 |
| 603 | Ga0207648_10257454 | 3300026089 | Bacteria | 1557 |
| 604 | Ga0207648_10399232 | 3300026089 | Bacteria | 1246 |
| 605 | Ga0207648_10741829 | 3300026089 | Bacteria | 912 |
| 606 | Ga0207676_10028127 | 3300026095 | Bacteria | 4196 |
| 607 | Ga0207676_10158639 | 3300026095 | Bacteria | 1957 |
| 608 | Ga0207676_10343720 | 3300026095 | Bacteria | 1378 |
| 609 | Ga0207676_10378296 | 3300026095 | Bacteria | 1317 |
| 610 | Ga0207674_10000023 | 3300026116 | Bacteria | 157752 |
| 611 | Ga0207674_10023018 | 3300026116 | Bacteria | 6681 |
| 612 | Ga0207674_10282694 | 3300026116 | Bacteria | 1607 |
| 613 | Ga0207674_10446102 | 3300026116 | Bacteria | 1251 |
| 614 | Ga0207674_10636113 | 3300026116 | Bacteria | 1030 |
| 615 | Ga0207674_10669806 | 3300026116 | Bacteria | 1002 |
| 616 | Ga0207674_10886500 | 3300026116 | Unclassified | 860 |
| 617 | Ga0207675_100004103 | 3300026118 | Bacteria | 14102 |
| 618 | Ga0207675_100006780 | 3300026118 | Bacteria | 10834 |
| 619 | Ga0207675_100009590 | 3300026118 | Bacteria | 9056 |
| 620 | Ga0207675_100045073 | 3300026118 | Bacteria | 4120 |
| 621 | Ga0207675_100064591 | 3300026118 | Bacteria | 3421 |
| 622 | Ga0207675_100134976 | 3300026118 | Bacteria | 2341 |
| 623 | Ga0207675_100221658 | 3300026118 | Unclassified | 1822 |
| 624 | Ga0207675_100222082 | 3300026118 | Bacteria | 1821 |
| 625 | Ga0207675_100368885 | 3300026118 | Bacteria | 1410 |
| 626 | Ga0207675_100502737 | 3300026118 | Bacteria | 1207 |
| 627 | Ga0207675_100770966 | 3300026118 | Bacteria | 974 |
| 628 | Ga0207698_10588605 | 3300026142 | Bacteria | 1095 |
| 629 | Ga0209588_1029981 | 3300027671 | Bacteria | 1737 |
| 630 | Ga0207428_10022748 | 3300027907 | Bacteria | 5285 |
| 631 | Ga0207428_10050348 | 3300027907 | Bacteria | 3333 |
| 632 | Ga0268265_10027886 | 3300028380 | Bacteria | 4037 |
| 633 | Ga0268265_10047558 | 3300028380 | Bacteria | 3215 |
| 634 | Ga0268265_11295255 | 3300028380 | Unclassified | 729 |
| 635 | Ga0268264_10023780 | 3300028381 | Bacteria | 4998 |
| 636 | Ga0268264_10074852 | 3300028381 | Bacteria | 2877 |
| 637 | Ga0268264_10087510 | 3300028381 | Bacteria | 2679 |
| 638 | Ga0268264_10224383 | 3300028381 | Bacteria | 1731 |
| 639 | Ga0268264_10250750 | 3300028381 | Bacteria | 1644 |
| 640 | Ga0268264_11249839 | 3300028381 | Unclassified | 752 |
| 641 | Ga0307408_100119624 | 3300031548 | Bacteria | 2038 |
| 642 | Ga0307405_10042653 | 3300031731 | Bacteria | 2763 |
| 643 | Ga0307413_10345659 | 3300031824 | Bacteria | 1146 |
| 644 | Ga0307410_10139968 | 3300031852 | Bacteria | 1789 |
| 645 | Ga0307406_10005171 | 3300031901 | Bacteria | 7122 |
| 646 | Ga0307407_10008746 | 3300031903 | Bacteria | 4669 |
| 647 | Ga0307412_10065249 | 3300031911 | Bacteria | 2463 |
| 648 | Ga0307409_100081370 | 3300031995 | Bacteria | 2618 |
| 649 | Ga0307416_100089823 | 3300032002 | Bacteria | 2632 |
| 650 | Ga0307416_100529145 | 3300032002 | Bacteria | 1248 |
| 651 | Ga0307416_100924860 | 3300032002 | Bacteria | 973 |
| 652 | Ga0307411_10102439 | 3300032005 | Unclassified | 2029 |
| 653 | Ga0307411_10260298 | 3300032005 | Bacteria | 1369 |
| 654 | Ga0307411_10767878 | 3300032005 | Bacteria | 846 |
| 655 | Ga0307415_100189036 | 3300032126 | Bacteria | 1623 |
| 656 | Ga0307415_100442320 | 3300032126 | Bacteria | 1121 |
| 657 | Ga0373940_0053688 | 3300035088 | Unclassified | 1138 |
| 658 | Ga0373931_0414081 | 3300035691 | Bacteria | 856 |
| 659 | Ga0395899_0095073 | 3300037312 | Bacteria | 2156 |
| 660 | Ga0395900_0052049 | 3300037418 | Bacteria | 4216 |
| 661 | Ga0395900_0057058 | 3300037418 | Bacteria | 4020 |
| 662 | Ga0395900_0289882 | 3300037418 | Unclassified | 1626 |
| 663 | Ga0395900_0743959 | 3300037418 | Unclassified | 911 |
| 664 | Ga0395898_0182257 | 3300037466 | Bacteria | 2007 |
| 665 | Ga0395898_0205933 | 3300037466 | Unclassified | 1877 |
| 666 | Ga0395898_0283673 | 3300037466 | Bacteria | 1580 |
| 667 | Ga0436364_1457132 | 3300037853 | Unclassified | 1759 |
| 668 | Ga0395901_0016085 | 3300038443 | Bacteria | 7622 |
| 669 | Ga0395901_0232876 | 3300038443 | Bacteria | 1923 |
| 670 | Ga0395901_0312254 | 3300038443 | Bacteria | 1628 |
| 671 | Ga0242420_007642 | 3300038996 | Bacteria | 1739 |
| 672 | Ga0436365_0101175 | 3300039437 | Bacteria | 11647 |
| 673 | Ga0439462_0087909 | 3300042015 | Unclassified | 851 |
| 674 | Ga0439446_0104204 | 3300042156 | Unclassified | 900 |
| 675 | Ga0439458_0009559 | 3300042157 | Bacteria | 2160 |
| 676 | Ga0451577_0726754 | 3300042876 | Bacteria | 899 |
| 677 | Ga0453683_0012971 | 3300044673 | Bacteria | 5449 |
| 678 | Ga0451576_0051461 | 3300045051 | Bacteria | 4318 |
| 679 | Ga0451576_0753635 | 3300045051 | Unclassified | 1023 |
| 680 | Ga0451576_0928086 | 3300045051 | Unclassified | 913 |
| 681 | Ga0451576_1145670 | 3300045051 | Unclassified | 813 |
| 682 | Ga0451576_1238793 | 3300045051 | Unclassified | 779 |
| 683 | Ga0495582_0123882 | 3300046473 | Bacteria | 1458 |
| 684 | Ga0495662_0080421 | 3300046476 | Bacteria | 1585 |
| 685 | Ga0495632_0043222 | 3300046519 | Bacteria | 2253 |
| 686 | Ga0495663_0000063 | 3300046525 | Bacteria | 49946 |
| 687 | Ga0495598_0000170 | 3300046537 | Bacteria | 11194 |
| 688 | Ga0495621_0000230 | 3300046539 | Bacteria | 13105 |
| 689 | Ga0495621_0031183 | 3300046539 | Bacteria | 1827 |
| 690 | Ga0495656_0314033 | 3300046615 | Bacteria | 806 |
| 691 | Ga0495636_0042316 | 3300047318 | Bacteria | 1892 |
| 692 | Ga0495672_0005738 | 3300047320 | Bacteria | 9777 |
| 693 | Ga0496102_0366383 | 3300048905 | Bacteria | 1356 |
| 694 | Ga0496103_0071631 | 3300048906 | Bacteria | 2170 |
| 695 | Ga0496106_0003034 | 3300048909 | Bacteria | 12505 |
| 696 | Ga0496106_0025482 | 3300048909 | Bacteria | 4402 |
| 697 | Ga0496107_0256600 | 3300048910 | Bacteria | 1301 |
| 698 | Ga0496108_0096509 | 3300048911 | Bacteria | 2518 |
| 699 | Ga0496108_0109097 | 3300048911 | Bacteria | 2365 |
| 700 | Ga0496109_0506260 | 3300048912 | Bacteria | 1140 |
| 701 | Ga0496110_0335318 | 3300048913 | Bacteria | 1378 |
| 702 | Ga0496112_0318140 | 3300048915 | Bacteria | 1501 |
| 703 | Ga0496112_0371611 | 3300048915 | Bacteria | 1371 |
| 704 | Ga0496112_0468658 | 3300048915 | Bacteria | 1197 |
| 705 | Ga0496112_0530182 | 3300048915 | Bacteria | 1112 |
| 706 | Ga0501291_001644 | 3300049514 | Bacteria | 2607 |
| 707 | Ga0501292_018769 | 3300049515 | Bacteria | 1103 |
| 708 | Ga0501296_001023 | 3300049519 | Bacteria | 2793 |
| 709 | Ga0501297_017061 | 3300049520 | Bacteria | 882 |
| 710 | Ga0501298_000778 | 3300049521 | Bacteria | 4481 |
| 711 | Ga0501298_018480 | 3300049521 | Bacteria | 1282 |
| 712 | Ga0501299_000882 | 3300049522 | Bacteria | 3691 |
| 713 | Ga0501300_011593 | 3300049523 | Bacteria | 1283 |
| 714 | Ga0501300_021451 | 3300049523 | Bacteria | 943 |
| 715 | Ga0501038_0014457 | 3300049574 | Bacteria | 7193 |
| 716 | Ga0501198_011262 | 3300049649 | Bacteria | 1332 |
| 717 | Ga0501198_037087 | 3300049649 | Bacteria | 833 |
| 718 | Ga0501201_004910 | 3300049651 | Unclassified | 1245 |
| 719 | Ga0501207_017838 | 3300049654 | Unclassified | 1111 |
| 720 | Ga0501209_118319 | 3300049656 | Unclassified | 785 |
| 721 | Ga0501214_000501 | 3300049659 | Bacteria | 2634 |
| 722 | Ga0501217_005298 | 3300049661 | Bacteria | 2690 |
| 723 | Ga0501217_035143 | 3300049661 | Bacteria | 1252 |
| 724 | Ga0501224_009323 | 3300049664 | Unclassified | 1436 |
| 725 | Ga0501224_021996 | 3300049664 | Bacteria | 951 |
| 726 | Ga0501227_050582 | 3300049665 | Bacteria | 1048 |
| 727 | Ga0501230_013474 | 3300049667 | Bacteria | 1327 |
| 728 | Ga0501233_001585 | 3300049668 | Bacteria | 3913 |
| 729 | Ga0501233_003689 | 3300049668 | Bacteria | 2765 |
| 730 | Ga0501235_010826 | 3300049669 | Bacteria | 1995 |
| 731 | Ga0501235_014538 | 3300049669 | Bacteria | 1734 |
| 732 | Ga0501240_018042 | 3300049673 | Bacteria | 1034 |
| 733 | Ga0501253_016574 | 3300049683 | Bacteria | 1229 |
| 734 | Ga0501256_004780 | 3300049685 | Unclassified | 1173 |
| 735 | Ga0501256_006381 | 3300049685 | Bacteria | 1062 |
| 736 | Ga0501257_066075 | 3300049686 | Bacteria | 919 |
| 737 | Ga0501259_020974 | 3300049688 | Unclassified | 1163 |
| 738 | Ga0501260_000313 | 3300049689 | Bacteria | 3816 |
| 739 | Ga0501221_027512 | 3300049704 | Bacteria | 1163 |
| 740 | Ga0501225_0003104 | 3300049705 | Bacteria | 5078 |
| 741 | Ga0501225_0028764 | 3300049705 | Unclassified | 1527 |
| 742 | Ga0501229_009424 | 3300049706 | Bacteria | 1226 |
| 743 | Ga0501234_002650 | 3300049707 | Bacteria | 2819 |
| 744 | Ga0501268_028705 | 3300049765 | Bacteria | 996 |
| 745 | Ga0501268_041983 | 3300049765 | Bacteria | 863 |
| 746 | Ga0501272_017523 | 3300049769 | Bacteria | 844 |
| 747 | Ga0501273_010615 | 3300049770 | Unclassified | 1135 |
| 748 | Ga0501278_008763 | 3300049774 | Unclassified | 785 |
| 749 | Ga0501279_005537 | 3300049775 | Bacteria | 1660 |
| 750 | Ga0501283_001160 | 3300049779 | Bacteria | 3468 |
| 751 | Ga0501212_012601 | 3300049851 | Bacteria | 1232 |
| 752 | Ga0501226_013431 | 3300049853 | Bacteria | 904 |
| 753 | nmdc:mga05p37_145614_c1 | 3300050507 | Bacteria | 2901 |
| 754 | nmdc:mga05p37_28431_c1 | 3300050507 | Bacteria | 6817 |
| 755 | nmdc:mga05p37_321050_c1 | 3300050507 | Bacteria | 1833 |
| 756 | nmdc:mga05p37_432003_c1 | 3300050507 | Bacteria | 1530 |
| 757 | nmdc:mga05p37_46576_c1 | 3300050507 | Bacteria | 5331 |
| 758 | nmdc:mga09592_128212_c1 | 3300050508 | Bacteria | 2182 |
| 759 | nmdc:mga09592_22546_c1 | 3300050508 | Bacteria | 5198 |
| 760 | nmdc:mga0qj67_27290_c1 | 3300050509 | Bacteria | 4424 |
| 761 | nmdc:mga0qj67_568364_c1 | 3300050509 | Bacteria | 909 |
| 762 | nmdc:mga06r32_1006934_c1 | 3300050510 | Bacteria | 786 |
| 763 | nmdc:mga06r32_571931_c1 | 3300050510 | Unclassified | 1103 |
| 764 | nmdc:mga06r32_760890_c1 | 3300050510 | Bacteria | 931 |
| 765 | nmdc:mga06r32_782745_c1 | 3300050510 | Unclassified | 915 |
| 766 | nmdc:mga08y16_142706_c1 | 3300050511 | Bacteria | 2490 |
| 767 | nmdc:mga08y16_32049_c1 | 3300050511 | Bacteria | 5527 |
| 768 | nmdc:mga08y16_46098_c1 | 3300050511 | Bacteria | 4565 |
| 769 | nmdc:mga08y16_528898_c1 | 3300050511 | Bacteria | 1195 |
| 770 | nmdc:mga0n895_124542_c1 | 3300050512 | Bacteria | 2600 |
| 771 | nmdc:mga0n895_154635_c1 | 3300050512 | Bacteria | 2324 |
| 772 | nmdc:mga0n895_245626_c1 | 3300050512 | Bacteria | 1816 |
| 773 | nmdc:mga0n895_310769_c1 | 3300050512 | Bacteria | 1597 |
| 774 | nmdc:mga0n895_349359_c1 | 3300050512 | Bacteria | 1498 |
| 775 | nmdc:mga0n895_365691_c1 | 3300050512 | Bacteria | 1460 |
| 776 | nmdc:mga0n895_451780_c1 | 3300050512 | Bacteria | 1297 |
| 777 | nmdc:mga0n895_938006_c1 | 3300050512 | Unclassified | 849 |
| 778 | nmdc:mga0rr50_11606_c1 | 3300050513 | Bacteria | 5651 |
| 779 | nmdc:mga0rr50_697008_c1 | 3300050513 | Bacteria | 867 |
| 780 | nmdc:mga0rr50_959_c1 | 3300050513 | Bacteria | 15638 |
| 781 | nmdc:mga08x19_53_c1 | 3300050514 | Bacteria | 123767 |
| 782 | nmdc:mga0a205_159048_c1 | 3300050515 | Bacteria | 2157 |
| 783 | nmdc:mga0a205_300298_c1 | 3300050515 | Bacteria | 1479 |
| 784 | nmdc:mga0a205_35711_c1 | 3300050515 | Bacteria | 4773 |
| 785 | nmdc:mga0a205_471182_c1 | 3300050515 | Unclassified | 1115 |
| 786 | nmdc:mga0a205_55034_c1 | 3300050515 | Bacteria | 3842 |
| 787 | nmdc:mga0a205_695023_c1 | 3300050515 | Bacteria | 867 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005340 | Ga0070689_100088331 | Ga0070689_1000883311 | 199 |
| 2 | 3300009147 | Ga0114129_10099787 | Ga0114129_100997872 | 204 |
| 3 | 3300009174 | Ga0105241_10178785 | Ga0105241_101787852 | 204 |
| 4 | 3300005842 | Ga0068858_100820826 | Ga0068858_1008208262 | 205 |
| 5 | 3300009036 | Ga0105244_10357370 | Ga0105244_103573701 | 205 |
| 6 | 3300009177 | Ga0105248_10559895 | Ga0105248_105598952 | 205 |
| 7 | 3300013308 | Ga0157375_10429129 | Ga0157375_104291292 | 205 |
| 8 | 3300014745 | Ga0157377_10266921 | Ga0157377_102669212 | 205 |
| 9 | 3300025932 | Ga0207690_10217625 | Ga0207690_102176252 | 205 |
| 10 | 3300025942 | Ga0207689_10347858 | Ga0207689_103478582 | 205 |
| 11 | 3300048912 | Ga0496109_0506260 | Ga0496109_0506260_377_1018 | 205 |
| 12 | 3300035088 | Ga0373940_0053688 | Ga0373940_0053688_219_857 | 206 |
| 13 | 3300005518 | Ga0070699_100125797 | Ga0070699_1001257972 | 207 |
| 14 | 3300005290 | Ga0065712_10002144 | Ga0065712_100021443 | 210 |
| 15 | 3300005330 | Ga0070690_100037832 | Ga0070690_1000378322 | 210 |
| 16 | 3300005539 | Ga0068853_100528466 | Ga0068853_1005284662 | 210 |
| 17 | 3300005545 | Ga0070695_100090421 | Ga0070695_1000904212 | 210 |
| 18 | 3300009101 | Ga0105247_10040702 | Ga0105247_100407023 | 210 |
| 19 | 3300009174 | Ga0105241_10279943 | Ga0105241_102799432 | 210 |
| 20 | 3300025900 | Ga0207710_10030646 | Ga0207710_100306462 | 210 |
| 21 | 3300025911 | Ga0207654_10182102 | Ga0207654_101821022 | 210 |
| 22 | 3300026041 | Ga0207639_10237452 | Ga0207639_102374522 | 210 |
| 23 | 3300048915 | Ga0496112_0468658 | Ga0496112_0468658_518_1156 | 210 |
| 24 | 3300009147 | Ga0114129_10022866 | Ga0114129_100228665 | 211 |
| 25 | 3300050507 | nmdc:mga05p37_46576_c1 | nmdc:mga05p37_46576_c1_2605_3381 | 211 |
| 26 | 3300050513 | nmdc:mga0rr50_697008_c1 | nmdc:mga0rr50_697008_c1_75_812 | 211 |
| 27 | 3300002459 | JGI24751J29686_10000098 | JGI24751J29686_1000009823 | 212 |
| 28 | 3300005288 | Ga0065714_10064594 | Ga0065714_100645947 | 212 |
| 29 | 3300005290 | Ga0065712_10000121 | Ga0065712_100001218 | 212 |
| 30 | 3300005293 | Ga0065715_10214433 | Ga0065715_102144332 | 212 |
| 31 | 3300005295 | Ga0065707_10310452 | Ga0065707_103104522 | 212 |
| 32 | 3300005331 | Ga0070670_100002046 | Ga0070670_1000020464 | 212 |
| 33 | 3300005343 | Ga0070687_100134904 | Ga0070687_1001349042 | 212 |
| 34 | 3300005354 | Ga0070675_100447190 | Ga0070675_1004471902 | 212 |
| 35 | 3300005441 | Ga0070700_100000157 | Ga0070700_10000015717 | 212 |
| 36 | 3300005444 | Ga0070694_100014780 | Ga0070694_1000147802 | 212 |
| 37 | 3300005444 | Ga0070694_100079171 | Ga0070694_1000791712 | 212 |
| 38 | 3300005458 | Ga0070681_10002833 | Ga0070681_100028333 | 212 |
| 39 | 3300005518 | Ga0070699_100327234 | Ga0070699_1003272342 | 212 |
| 40 | 3300005547 | Ga0070693_100504441 | Ga0070693_1005044411 | 212 |
| 41 | 3300005549 | Ga0070704_100211362 | Ga0070704_1002113622 | 212 |
| 42 | 3300005564 | Ga0070664_101297331 | Ga0070664_1012973311 | 212 |
| 43 | 3300005617 | Ga0068859_100008702 | Ga0068859_10000870210 | 212 |
| 44 | 3300005617 | Ga0068859_100012277 | Ga0068859_1000122772 | 212 |
| 45 | 3300005617 | Ga0068859_100017817 | Ga0068859_1000178172 | 212 |
| 46 | 3300005617 | Ga0068859_100628183 | Ga0068859_1006281832 | 212 |
| 47 | 3300005840 | Ga0068870_10137315 | Ga0068870_101373152 | 212 |
| 48 | 3300005840 | Ga0068870_10460825 | Ga0068870_104608252 | 212 |
| 49 | 3300005841 | Ga0068863_100114635 | Ga0068863_1001146352 | 212 |
| 50 | 3300005841 | Ga0068863_100773637 | Ga0068863_1007736372 | 212 |
| 51 | 3300005841 | Ga0068863_100896827 | Ga0068863_1008968272 | 212 |
| 52 | 3300005842 | Ga0068858_100349319 | Ga0068858_1003493192 | 212 |
| 53 | 3300005985 | Ga0081539_10000998 | Ga0081539_1000099825 | 212 |
| 54 | 3300005985 | Ga0081539_10057930 | Ga0081539_100579303 | 212 |
| 55 | 3300006871 | Ga0075434_100168493 | Ga0075434_1001684932 | 212 |
| 56 | 3300006931 | Ga0097620_100008702 | Ga0097620_10000870210 | 212 |
| 57 | 3300006931 | Ga0097620_100012277 | Ga0097620_10001227712 | 212 |
| 58 | 3300006931 | Ga0097620_100017817 | Ga0097620_1000178172 | 212 |
| 59 | 3300006931 | Ga0097620_100628182 | Ga0097620_1006281822 | 212 |
| 60 | 3300009093 | Ga0105240_10181726 | Ga0105240_101817263 | 212 |
| 61 | 3300009101 | Ga0105247_10019475 | Ga0105247_100194754 | 212 |
| 62 | 3300009147 | Ga0114129_10943793 | Ga0114129_109437932 | 212 |
| 63 | 3300009148 | Ga0105243_10009519 | Ga0105243_1000951910 | 212 |
| 64 | 3300009148 | Ga0105243_10196398 | Ga0105243_101963982 | 212 |
| 65 | 3300009174 | Ga0105241_10641128 | Ga0105241_106411282 | 212 |
| 66 | 3300009174 | Ga0105241_10856254 | Ga0105241_108562542 | 212 |
| 67 | 3300009176 | Ga0105242_10101463 | Ga0105242_101014633 | 212 |
| 68 | 3300009176 | Ga0105242_10983912 | Ga0105242_109839121 | 212 |
| 69 | 3300009176 | Ga0105242_11085999 | Ga0105242_110859992 | 212 |
| 70 | 3300009176 | Ga0105242_11307976 | Ga0105242_113079761 | 212 |
| 71 | 3300009177 | Ga0105248_10014780 | Ga0105248_100147802 | 212 |
| 72 | 3300009177 | Ga0105248_10014842 | Ga0105248_100148427 | 212 |
| 73 | 3300009177 | Ga0105248_10251027 | Ga0105248_102510272 | 212 |
| 74 | 3300009545 | Ga0105237_10279707 | Ga0105237_102797072 | 212 |
| 75 | 3300009551 | Ga0105238_10413537 | Ga0105238_104135372 | 212 |
| 76 | 3300009553 | Ga0105249_10140190 | Ga0105249_101401903 | 212 |
| 77 | 3300010375 | Ga0105239_10457824 | Ga0105239_104578242 | 212 |
| 78 | 3300013100 | Ga0157373_10153543 | Ga0157373_101535433 | 212 |
| 79 | 3300013297 | Ga0157378_10952927 | Ga0157378_109529271 | 212 |
| 80 | 3300013308 | Ga0157375_10364735 | Ga0157375_103647352 | 212 |
| 81 | 3300014325 | Ga0163163_10003484 | Ga0163163_100034844 | 212 |
| 82 | 3300014968 | Ga0157379_10116747 | Ga0157379_101167472 | 212 |
| 83 | 3300015262 | Ga0182007_10117888 | Ga0182007_101178881 | 212 |
| 84 | 3300015265 | Ga0182005_1068097 | Ga0182005_10680972 | 212 |
| 85 | 3300017792 | Ga0163161_10242148 | Ga0163161_102421481 | 212 |
| 86 | 3300025901 | Ga0207688_10130743 | Ga0207688_101307432 | 212 |
| 87 | 3300025919 | Ga0207657_10341907 | Ga0207657_103419072 | 212 |
| 88 | 3300025924 | Ga0207694_10026090 | Ga0207694_100260904 | 212 |
| 89 | 3300025925 | Ga0207650_10000001 | Ga0207650_100000011087 | 212 |
| 90 | 3300025925 | Ga0207650_10041897 | Ga0207650_100418972 | 212 |
| 91 | 3300025934 | Ga0207686_10127984 | Ga0207686_101279842 | 212 |
| 92 | 3300025934 | Ga0207686_10841938 | Ga0207686_108419381 | 212 |
| 93 | 3300025935 | Ga0207709_10018169 | Ga0207709_100181692 | 212 |
| 94 | 3300025935 | Ga0207709_10218273 | Ga0207709_102182732 | 212 |
| 95 | 3300025939 | Ga0207665_10311296 | Ga0207665_103112962 | 212 |
| 96 | 3300025941 | Ga0207711_10014225 | Ga0207711_100142255 | 212 |
| 97 | 3300025941 | Ga0207711_10191113 | Ga0207711_101911132 | 212 |
| 98 | 3300025942 | Ga0207689_10395458 | Ga0207689_103954581 | 212 |
| 99 | 3300025945 | Ga0207679_10709858 | Ga0207679_107098582 | 212 |
| 100 | 3300025960 | Ga0207651_10339171 | Ga0207651_103391712 | 212 |
| 101 | 3300025961 | Ga0207712_10002854 | Ga0207712_100028549 | 212 |
| 102 | 3300025981 | Ga0207640_10348673 | Ga0207640_103486732 | 212 |
| 103 | 3300026035 | Ga0207703_10149736 | Ga0207703_101497362 | 212 |
| 104 | 3300026035 | Ga0207703_10177078 | Ga0207703_101770782 | 212 |
| 105 | 3300026035 | Ga0207703_10295746 | Ga0207703_102957462 | 212 |
| 106 | 3300026075 | Ga0207708_10000331 | Ga0207708_1000033115 | 212 |
| 107 | 3300026088 | Ga0207641_10159449 | Ga0207641_101594492 | 212 |
| 108 | 3300026089 | Ga0207648_10205229 | Ga0207648_102052293 | 212 |
| 109 | 3300026118 | Ga0207675_100770966 | Ga0207675_1007709662 | 212 |
| 110 | 3300028381 | Ga0268264_10250750 | Ga0268264_102507502 | 212 |
| 111 | 3300031548 | Ga0307408_100119624 | Ga0307408_1001196242 | 212 |
| 112 | 3300031824 | Ga0307413_10345659 | Ga0307413_103456592 | 212 |
| 113 | 3300031852 | Ga0307410_10139968 | Ga0307410_101399682 | 212 |
| 114 | 3300031901 | Ga0307406_10005171 | Ga0307406_100051712 | 212 |
| 115 | 3300031903 | Ga0307407_10008746 | Ga0307407_100087463 | 212 |
| 116 | 3300031911 | Ga0307412_10065249 | Ga0307412_100652492 | 212 |
| 117 | 3300031995 | Ga0307409_100081370 | Ga0307409_1000813702 | 212 |
| 118 | 3300032002 | Ga0307416_100089823 | Ga0307416_1000898232 | 212 |
| 119 | 3300032005 | Ga0307411_10260298 | Ga0307411_102602981 | 212 |
| 120 | 3300032126 | Ga0307415_100189036 | Ga0307415_1001890362 | 212 |
| 121 | 3300035691 | Ga0373931_0414081 | Ga0373931_0414081_19_657 | 212 |
| 122 | 3300037312 | Ga0395899_0095073 | Ga0395899_0095073_1156_1794 | 212 |
| 123 | 3300037418 | Ga0395900_0052049 | Ga0395900_0052049_2812_3450 | 212 |
| 124 | 3300037466 | Ga0395898_0283673 | Ga0395898_0283673_800_1438 | 212 |
| 125 | 3300038443 | Ga0395901_0016085 | Ga0395901_0016085_1813_2451 | 212 |
| 126 | 3300042157 | Ga0439458_0009559 | Ga0439458_0009559_347_985 | 212 |
| 127 | 3300045051 | Ga0451576_1238793 | Ga0451576_1238793_80_727 | 212 |
| 128 | 3300046476 | Ga0495662_0080421 | Ga0495662_0080421_367_1020 | 212 |
| 129 | 3300048909 | Ga0496106_0025482 | Ga0496106_0025482_1306_1947 | 212 |
| 130 | 3300048911 | Ga0496108_0109097 | Ga0496108_0109097_58_699 | 212 |
| 131 | 3300048915 | Ga0496112_0318140 | Ga0496112_0318140_62_703 | 212 |
| 132 | 3300048915 | Ga0496112_0371611 | Ga0496112_0371611_650_1288 | 212 |
| 133 | 3300048915 | Ga0496112_0530182 | Ga0496112_0530182_19_657 | 212 |
| 134 | 3300049520 | Ga0501297_017061 | Ga0501297_017061_231_869 | 212 |
| 135 | 3300049521 | Ga0501298_018480 | Ga0501298_018480_533_1171 | 212 |
| 136 | 3300049659 | Ga0501214_000501 | Ga0501214_000501_262_900 | 212 |
| 137 | 3300049661 | Ga0501217_005298 | Ga0501217_005298_456_1094 | 212 |
| 138 | 3300049664 | Ga0501224_021996 | Ga0501224_021996_296_934 | 212 |
| 139 | 3300049665 | Ga0501227_050582 | Ga0501227_050582_181_819 | 212 |
| 140 | 3300049667 | Ga0501230_013474 | Ga0501230_013474_448_1086 | 212 |
| 141 | 3300049668 | Ga0501233_001585 | Ga0501233_001585_538_1176 | 212 |
| 142 | 3300049669 | Ga0501235_010826 | Ga0501235_010826_1018_1656 | 212 |
| 143 | 3300049685 | Ga0501256_006381 | Ga0501256_006381_111_749 | 212 |
| 144 | 3300049686 | Ga0501257_066075 | Ga0501257_066075_202_840 | 212 |
| 145 | 3300049704 | Ga0501221_027512 | Ga0501221_027512_246_884 | 212 |
| 146 | 3300049705 | Ga0501225_0003104 | Ga0501225_0003104_855_1493 | 212 |
| 147 | 3300049706 | Ga0501229_009424 | Ga0501229_009424_326_964 | 212 |
| 148 | 3300049707 | Ga0501234_002650 | Ga0501234_002650_1948_2586 | 212 |
| 149 | 3300049769 | Ga0501272_017523 | Ga0501272_017523_22_660 | 212 |
| 150 | 3300049851 | Ga0501212_012601 | Ga0501212_012601_465_1103 | 212 |
| 151 | 3300049853 | Ga0501226_013431 | Ga0501226_013431_24_662 | 212 |
| 152 | 3300005343 | Ga0070687_100131479 | Ga0070687_1001314792 | 213 |
| 153 | 3300005445 | Ga0070708_100446331 | Ga0070708_1004463311 | 213 |
| 154 | 3300005459 | Ga0068867_100098739 | Ga0068867_1000987392 | 213 |
| 155 | 3300005468 | Ga0070707_100023273 | Ga0070707_1000232731 | 213 |
| 156 | 3300005471 | Ga0070698_100183585 | Ga0070698_1001835852 | 213 |
| 157 | 3300005471 | Ga0070698_100503842 | Ga0070698_1005038422 | 213 |
| 158 | 3300005518 | Ga0070699_100239133 | Ga0070699_1002391332 | 213 |
| 159 | 3300005544 | Ga0070686_100119473 | Ga0070686_1001194732 | 213 |
| 160 | 3300005549 | Ga0070704_100422223 | Ga0070704_1004222232 | 213 |
| 161 | 3300005578 | Ga0068854_100558470 | Ga0068854_1005584701 | 213 |
| 162 | 3300005615 | Ga0070702_100883287 | Ga0070702_1008832871 | 213 |
| 163 | 3300005617 | Ga0068859_100067796 | Ga0068859_1000677964 | 213 |
| 164 | 3300005618 | Ga0068864_100224605 | Ga0068864_1002246052 | 213 |
| 165 | 3300005719 | Ga0068861_100643142 | Ga0068861_1006431422 | 213 |
| 166 | 3300006914 | Ga0075436_100000002 | Ga0075436_100000002371 | 213 |
| 167 | 3300006931 | Ga0097620_100067795 | Ga0097620_1000677954 | 213 |
| 168 | 3300007076 | Ga0075435_100000198 | Ga0075435_1000001984 | 213 |
| 169 | 3300009148 | Ga0105243_10115489 | Ga0105243_101154892 | 213 |
| 170 | 3300009176 | Ga0105242_10029809 | Ga0105242_100298092 | 213 |
| 171 | 3300013297 | Ga0157378_10025360 | Ga0157378_100253602 | 213 |
| 172 | 3300013297 | Ga0157378_10631851 | Ga0157378_106318511 | 213 |
| 173 | 3300013306 | Ga0163162_10125072 | Ga0163162_101250722 | 213 |
| 174 | 3300013306 | Ga0163162_10629769 | Ga0163162_106297692 | 213 |
| 175 | 3300014326 | Ga0157380_11048510 | Ga0157380_110485102 | 213 |
| 176 | 3300017792 | Ga0163161_10500896 | Ga0163161_105008961 | 213 |
| 177 | 3300025918 | Ga0207662_10087850 | Ga0207662_100878502 | 213 |
| 178 | 3300025922 | Ga0207646_10005566 | Ga0207646_100055669 | 213 |
| 179 | 3300025922 | Ga0207646_10024120 | Ga0207646_100241206 | 213 |
| 180 | 3300025922 | Ga0207646_10051924 | Ga0207646_100519242 | 213 |
| 181 | 3300025934 | Ga0207686_10000740 | Ga0207686_1000074011 | 213 |
| 182 | 3300026118 | Ga0207675_100222082 | Ga0207675_1002220822 | 213 |
| 183 | 3300032005 | Ga0307411_10767878 | Ga0307411_107678782 | 213 |
| 184 | 3300050510 | nmdc:mga06r32_760890_c1 | nmdc:mga06r32_760890_c1_27_686 | 213 |
| 185 | 3300050512 | nmdc:mga0n895_451780_c1 | nmdc:mga0n895_451780_c1_358_1017 | 213 |
| 186 | 3300050513 | nmdc:mga0rr50_959_c1 | nmdc:mga0rr50_959_c1_10896_11552 | 213 |
| 187 | 3300050514 | nmdc:mga08x19_53_c1 | nmdc:mga08x19_53_c1_106989_107645 | 213 |
| 188 | 3300005289 | Ga0065704_10150367 | Ga0065704_101503672 | 214 |
| 189 | 3300005293 | Ga0065715_10056236 | Ga0065715_100562361 | 214 |
| 190 | 3300005295 | Ga0065707_10242325 | Ga0065707_102423252 | 214 |
| 191 | 3300005334 | Ga0068869_100010916 | Ga0068869_1000109164 | 214 |
| 192 | 3300005336 | Ga0070680_100030063 | Ga0070680_1000300632 | 214 |
| 193 | 3300005353 | Ga0070669_100096862 | Ga0070669_1000968622 | 214 |
| 194 | 3300005445 | Ga0070708_100020885 | Ga0070708_1000208853 | 214 |
| 195 | 3300005458 | Ga0070681_10000065 | Ga0070681_1000006532 | 214 |
| 196 | 3300005468 | Ga0070707_100001118 | Ga0070707_10000111816 | 214 |
| 197 | 3300005468 | Ga0070707_100115491 | Ga0070707_1001154912 | 214 |
| 198 | 3300005471 | Ga0070698_100000008 | Ga0070698_10000000886 | 214 |
| 199 | 3300005530 | Ga0070679_100000013 | Ga0070679_100000013105 | 214 |
| 200 | 3300005536 | Ga0070697_100632833 | Ga0070697_1006328331 | 214 |
| 201 | 3300005545 | Ga0070695_100032167 | Ga0070695_1000321673 | 214 |
| 202 | 3300005545 | Ga0070695_100354895 | Ga0070695_1003548951 | 214 |
| 203 | 3300005546 | Ga0070696_100098187 | Ga0070696_1000981873 | 214 |
| 204 | 3300005546 | Ga0070696_100301934 | Ga0070696_1003019342 | 214 |
| 205 | 3300005614 | Ga0068856_100011053 | Ga0068856_1000110535 | 214 |
| 206 | 3300005617 | Ga0068859_100058943 | Ga0068859_1000589432 | 214 |
| 207 | 3300005719 | Ga0068861_100005742 | Ga0068861_1000057424 | 214 |
| 208 | 3300005719 | Ga0068861_100207828 | Ga0068861_1002078281 | 214 |
| 209 | 3300005843 | Ga0068860_100004968 | Ga0068860_1000049687 | 214 |
| 210 | 3300006173 | Ga0070716_100083496 | Ga0070716_1000834962 | 214 |
| 211 | 3300006852 | Ga0075433_10092654 | Ga0075433_100926542 | 214 |
| 212 | 3300006852 | Ga0075433_10135748 | Ga0075433_101357483 | 214 |
| 213 | 3300006871 | Ga0075434_100903844 | Ga0075434_1009038441 | 214 |
| 214 | 3300006931 | Ga0097620_100058944 | Ga0097620_1000589442 | 214 |
| 215 | 3300007265 | Ga0099794_10001385 | Ga0099794_100013857 | 214 |
| 216 | 3300009147 | Ga0114129_10576322 | Ga0114129_105763222 | 214 |
| 217 | 3300009148 | Ga0105243_10307311 | Ga0105243_103073111 | 214 |
| 218 | 3300009177 | Ga0105248_10021365 | Ga0105248_100213653 | 214 |
| 219 | 3300009553 | Ga0105249_10038874 | Ga0105249_100388742 | 214 |
| 220 | 3300009553 | Ga0105249_10043318 | Ga0105249_100433182 | 214 |
| 221 | 3300010375 | Ga0105239_10009646 | Ga0105239_100096469 | 214 |
| 222 | 3300013297 | Ga0157378_10637211 | Ga0157378_106372111 | 214 |
| 223 | 3300013297 | Ga0157378_10880946 | Ga0157378_108809462 | 214 |
| 224 | 3300013306 | Ga0163162_10011591 | Ga0163162_100115913 | 214 |
| 225 | 3300013306 | Ga0163162_10338188 | Ga0163162_103381882 | 214 |
| 226 | 3300013307 | Ga0157372_10010507 | Ga0157372_100105076 | 214 |
| 227 | 3300014326 | Ga0157380_10001117 | Ga0157380_100011173 | 214 |
| 228 | 3300025912 | Ga0207707_10000004 | Ga0207707_10000004221 | 214 |
| 229 | 3300025917 | Ga0207660_10016005 | Ga0207660_100160052 | 214 |
| 230 | 3300025921 | Ga0207652_10000122 | Ga0207652_1000012249 | 214 |
| 231 | 3300025922 | Ga0207646_10000576 | Ga0207646_1000057616 | 214 |
| 232 | 3300025923 | Ga0207681_10086629 | Ga0207681_100866292 | 214 |
| 233 | 3300025927 | Ga0207687_10779214 | Ga0207687_107792141 | 214 |
| 234 | 3300025940 | Ga0207691_10264749 | Ga0207691_102647492 | 214 |
| 235 | 3300025941 | Ga0207711_10031649 | Ga0207711_100316495 | 214 |
| 236 | 3300025942 | Ga0207689_10016832 | Ga0207689_100168323 | 214 |
| 237 | 3300025961 | Ga0207712_10175755 | Ga0207712_101757552 | 214 |
| 238 | 3300025961 | Ga0207712_10332787 | Ga0207712_103327872 | 214 |
| 239 | 3300026118 | Ga0207675_100009590 | Ga0207675_1000095905 | 214 |
| 240 | 3300026118 | Ga0207675_100221658 | Ga0207675_1002216583 | 214 |
| 241 | 3300027671 | Ga0209588_1029981 | Ga0209588_10299812 | 214 |
| 242 | 3300028381 | Ga0268264_10023780 | Ga0268264_100237802 | 214 |
| 243 | 3300038996 | Ga0242420_007642 | Ga0242420_007642_317_982 | 214 |
| 244 | 3300042876 | Ga0451577_0726754 | Ga0451577_0726754_28_690 | 214 |
| 245 | 3300044673 | Ga0453683_0012971 | Ga0453683_0012971_341_1006 | 214 |
| 246 | 3300045051 | Ga0451576_0051461 | Ga0451576_0051461_998_1663 | 214 |
| 247 | 3300045051 | Ga0451576_0928086 | Ga0451576_0928086_15_680 | 214 |
| 248 | 3300048905 | Ga0496102_0366383 | Ga0496102_0366383_82_768 | 214 |
| 249 | 3300048906 | Ga0496103_0071631 | Ga0496103_0071631_77_760 | 214 |
| 250 | 3300050512 | nmdc:mga0n895_124542_c1 | nmdc:mga0n895_124542_c1_432_1109 | 214 |
| 251 | 3300050512 | nmdc:mga0n895_310769_c1 | nmdc:mga0n895_310769_c1_741_1409 | 214 |
| 252 | 3300050512 | nmdc:mga0n895_938006_c1 | nmdc:mga0n895_938006_c1_25_711 | 214 |
| 253 | 3300050515 | nmdc:mga0a205_471182_c1 | nmdc:mga0a205_471182_c1_418_1083 | 214 |
| 254 | 3300005295 | Ga0065707_10260663 | Ga0065707_102606632 | 215 |
| 255 | 3300005353 | Ga0070669_100155261 | Ga0070669_1001552612 | 215 |
| 256 | 3300005445 | Ga0070708_100211799 | Ga0070708_1002117992 | 215 |
| 257 | 3300005459 | Ga0068867_100161279 | Ga0068867_1001612791 | 215 |
| 258 | 3300005467 | Ga0070706_100028799 | Ga0070706_1000287992 | 215 |
| 259 | 3300005468 | Ga0070707_100064574 | Ga0070707_1000645742 | 215 |
| 260 | 3300005536 | Ga0070697_100180771 | Ga0070697_1001807712 | 215 |
| 261 | 3300005545 | Ga0070695_100404577 | Ga0070695_1004045772 | 215 |
| 262 | 3300005547 | Ga0070693_100325774 | Ga0070693_1003257742 | 215 |
| 263 | 3300005617 | Ga0068859_100526428 | Ga0068859_1005264282 | 215 |
| 264 | 3300005842 | Ga0068858_100044544 | Ga0068858_1000445442 | 215 |
| 265 | 3300006173 | Ga0070716_100068529 | Ga0070716_1000685292 | 215 |
| 266 | 3300006173 | Ga0070716_100461628 | Ga0070716_1004616282 | 215 |
| 267 | 3300006852 | Ga0075433_10148887 | Ga0075433_101488872 | 215 |
| 268 | 3300006871 | Ga0075434_100039378 | Ga0075434_1000393782 | 215 |
| 269 | 3300006931 | Ga0097620_100526424 | Ga0097620_1005264242 | 215 |
| 270 | 3300009147 | Ga0114129_10085855 | Ga0114129_100858552 | 215 |
| 271 | 3300009147 | Ga0114129_11633033 | Ga0114129_116330332 | 215 |
| 272 | 3300009148 | Ga0105243_10001504 | Ga0105243_100015043 | 215 |
| 273 | 3300009148 | Ga0105243_10208720 | Ga0105243_102087202 | 215 |
| 274 | 3300009174 | Ga0105241_10373356 | Ga0105241_103733562 | 215 |
| 275 | 3300009176 | Ga0105242_10003404 | Ga0105242_100034046 | 215 |
| 276 | 3300009176 | Ga0105242_10109794 | Ga0105242_101097942 | 215 |
| 277 | 3300009553 | Ga0105249_10000003 | Ga0105249_1000000352 | 215 |
| 278 | 3300013297 | Ga0157378_10000090 | Ga0157378_1000009026 | 215 |
| 279 | 3300013306 | Ga0163162_10000033 | Ga0163162_1000003372 | 215 |
| 280 | 3300013308 | Ga0157375_10005668 | Ga0157375_1000566810 | 215 |
| 281 | 3300014326 | Ga0157380_10097785 | Ga0157380_100977852 | 215 |
| 282 | 3300025907 | Ga0207645_10086715 | Ga0207645_100867153 | 215 |
| 283 | 3300025911 | Ga0207654_10030797 | Ga0207654_100307973 | 215 |
| 284 | 3300025918 | Ga0207662_10518494 | Ga0207662_105184941 | 215 |
| 285 | 3300025934 | Ga0207686_10002448 | Ga0207686_100024485 | 215 |
| 286 | 3300025935 | Ga0207709_10000754 | Ga0207709_1000075416 | 215 |
| 287 | 3300025939 | Ga0207665_10331144 | Ga0207665_103311441 | 215 |
| 288 | 3300025961 | Ga0207712_10000060 | Ga0207712_1000006046 | 215 |
| 289 | 3300025972 | Ga0207668_10072733 | Ga0207668_100727331 | 215 |
| 290 | 3300026089 | Ga0207648_10399232 | Ga0207648_103992322 | 215 |
| 291 | 3300045051 | Ga0451576_1145670 | Ga0451576_1145670_25_681 | 215 |
| 292 | 3300048909 | Ga0496106_0003034 | Ga0496106_0003034_1484_2152 | 215 |
| 293 | 3300048910 | Ga0496107_0256600 | Ga0496107_0256600_54_722 | 215 |
| 294 | 3300050507 | nmdc:mga05p37_145614_c1 | nmdc:mga05p37_145614_c1_2056_2736 | 215 |
| 295 | 3300050512 | nmdc:mga0n895_349359_c1 | nmdc:mga0n895_349359_c1_620_1288 | 215 |
| 296 | 3300050515 | nmdc:mga0a205_300298_c1 | nmdc:mga0a205_300298_c1_530_1210 | 215 |
| 297 | 3300002074 | JGI24748J21848_1000035 | JGI24748J21848_100003572 | 216 |
| 298 | 3300002239 | JGI24034J26672_10000039 | JGI24034J26672_1000003972 | 216 |
| 299 | 3300002244 | JGI24742J22300_10012050 | JGI24742J22300_100120501 | 216 |
| 300 | 3300005334 | Ga0068869_100047112 | Ga0068869_1000471122 | 216 |
| 301 | 3300005337 | Ga0070682_100000058 | Ga0070682_10000005841 | 216 |
| 302 | 3300005355 | Ga0070671_100022824 | Ga0070671_1000228245 | 216 |
| 303 | 3300005364 | Ga0070673_100074245 | Ga0070673_1000742452 | 216 |
| 304 | 3300005364 | Ga0070673_100428643 | Ga0070673_1004286432 | 216 |
| 305 | 3300005459 | Ga0068867_100007155 | Ga0068867_1000071557 | 216 |
| 306 | 3300005545 | Ga0070695_100165974 | Ga0070695_1001659742 | 216 |
| 307 | 3300005577 | Ga0068857_100049265 | Ga0068857_1000492654 | 216 |
| 308 | 3300005841 | Ga0068863_100130469 | Ga0068863_1001304692 | 216 |
| 309 | 3300005841 | Ga0068863_100287103 | Ga0068863_1002871032 | 216 |
| 310 | 3300005842 | Ga0068858_100000053 | Ga0068858_10000005351 | 216 |
| 311 | 3300005843 | Ga0068860_100025602 | Ga0068860_1000256021 | 216 |
| 312 | 3300006358 | Ga0068871_100278527 | Ga0068871_1002785272 | 216 |
| 313 | 3300006847 | Ga0075431_100053880 | Ga0075431_1000538803 | 216 |
| 314 | 3300006852 | Ga0075433_10724345 | Ga0075433_107243451 | 216 |
| 315 | 3300006871 | Ga0075434_100148611 | Ga0075434_1001486113 | 216 |
| 316 | 3300006880 | Ga0075429_100349441 | Ga0075429_1003494412 | 216 |
| 317 | 3300009011 | Ga0105251_10065511 | Ga0105251_100655111 | 216 |
| 318 | 3300009101 | Ga0105247_10000052 | Ga0105247_1000005267 | 216 |
| 319 | 3300009148 | Ga0105243_10003856 | Ga0105243_100038566 | 216 |
| 320 | 3300009174 | Ga0105241_10111849 | Ga0105241_101118492 | 216 |
| 321 | 3300009176 | Ga0105242_10453231 | Ga0105242_104532312 | 216 |
| 322 | 3300009177 | Ga0105248_10292434 | Ga0105248_102924342 | 216 |
| 323 | 3300010375 | Ga0105239_10661803 | Ga0105239_106618032 | 216 |
| 324 | 3300011119 | Ga0105246_10022556 | Ga0105246_100225565 | 216 |
| 325 | 3300013297 | Ga0157378_10339260 | Ga0157378_103392602 | 216 |
| 326 | 3300014325 | Ga0163163_10257173 | Ga0163163_102571733 | 216 |
| 327 | 3300014968 | Ga0157379_10088304 | Ga0157379_100883042 | 216 |
| 328 | 3300017792 | Ga0163161_10074696 | Ga0163161_100746962 | 216 |
| 329 | 3300025223 | Ga0207672_1000693 | Ga0207672_10006932 | 216 |
| 330 | 3300025900 | Ga0207710_10000004 | Ga0207710_10000004440 | 216 |
| 331 | 3300025925 | Ga0207650_10099499 | Ga0207650_100994992 | 216 |
| 332 | 3300025931 | Ga0207644_10000206 | Ga0207644_1000020634 | 216 |
| 333 | 3300025935 | Ga0207709_10051797 | Ga0207709_100517972 | 216 |
| 334 | 3300025942 | Ga0207689_10055831 | Ga0207689_100558312 | 216 |
| 335 | 3300025960 | Ga0207651_10023987 | Ga0207651_100239873 | 216 |
| 336 | 3300025960 | Ga0207651_10229299 | Ga0207651_102292992 | 216 |
| 337 | 3300026035 | Ga0207703_10000093 | Ga0207703_1000009351 | 216 |
| 338 | 3300026035 | Ga0207703_10834258 | Ga0207703_108342582 | 216 |
| 339 | 3300026088 | Ga0207641_10097529 | Ga0207641_100975292 | 216 |
| 340 | 3300026088 | Ga0207641_10819768 | Ga0207641_108197682 | 216 |
| 341 | 3300026089 | Ga0207648_10015111 | Ga0207648_100151113 | 216 |
| 342 | 3300026095 | Ga0207676_10378296 | Ga0207676_103782962 | 216 |
| 343 | 3300026116 | Ga0207674_10669806 | Ga0207674_106698062 | 216 |
| 344 | 3300028381 | Ga0268264_10224383 | Ga0268264_102243832 | 216 |
| 345 | 3300028381 | Ga0268264_11249839 | Ga0268264_112498391 | 216 |
| 346 | 3300037418 | Ga0395900_0057058 | Ga0395900_0057058_2436_3119 | 216 |
| 347 | 3300038443 | Ga0395901_0312254 | Ga0395901_0312254_703_1386 | 216 |
| 348 | 3300046525 | Ga0495663_0000063 | Ga0495663_0000063_31018_31677 | 216 |
| 349 | 3300046537 | Ga0495598_0000170 | Ga0495598_0000170_3929_4585 | 216 |
| 350 | 3300046539 | Ga0495621_0000230 | Ga0495621_0000230_4526_5182 | 216 |
| 351 | 3300048911 | Ga0496108_0096509 | Ga0496108_0096509_1216_1875 | 216 |
| 352 | 3300050508 | nmdc:mga09592_128212_c1 | nmdc:mga09592_128212_c1_957_1607 | 216 |
| 353 | 3300050509 | nmdc:mga0qj67_27290_c1 | nmdc:mga0qj67_27290_c1_921_1571 | 216 |
| 354 | 3300050509 | nmdc:mga0qj67_568364_c1 | nmdc:mga0qj67_568364_c1_186_836 | 216 |
| 355 | 3300050510 | nmdc:mga06r32_1006934_c1 | nmdc:mga06r32_1006934_c1_52_702 | 216 |
| 356 | 3300050510 | nmdc:mga06r32_571931_c1 | nmdc:mga06r32_571931_c1_191_850 | 216 |
| 357 | 3300050515 | nmdc:mga0a205_159048_c1 | nmdc:mga0a205_159048_c1_854_1510 | 216 |
| 358 | 3300000532 | CNAas_1000021 | CNAas_10000216 | 217 |
| 359 | 3300005290 | Ga0065712_10320374 | Ga0065712_103203741 | 217 |
| 360 | 3300005293 | Ga0065715_10098674 | Ga0065715_100986743 | 217 |
| 361 | 3300005331 | Ga0070670_100005519 | Ga0070670_10000551910 | 217 |
| 362 | 3300005334 | Ga0068869_100013833 | Ga0068869_1000138333 | 217 |
| 363 | 3300005337 | Ga0070682_100035308 | Ga0070682_1000353082 | 217 |
| 364 | 3300005338 | Ga0068868_100158815 | Ga0068868_1001588152 | 217 |
| 365 | 3300005340 | Ga0070689_100070955 | Ga0070689_1000709553 | 217 |
| 366 | 3300005345 | Ga0070692_10148110 | Ga0070692_101481102 | 217 |
| 367 | 3300005353 | Ga0070669_100008727 | Ga0070669_1000087275 | 217 |
| 368 | 3300005355 | Ga0070671_100003674 | Ga0070671_1000036743 | 217 |
| 369 | 3300005406 | Ga0070703_10002571 | Ga0070703_100025712 | 217 |
| 370 | 3300005438 | Ga0070701_10394783 | Ga0070701_103947831 | 217 |
| 371 | 3300005441 | Ga0070700_100207097 | Ga0070700_1002070972 | 217 |
| 372 | 3300005441 | Ga0070700_100397835 | Ga0070700_1003978351 | 217 |
| 373 | 3300005444 | Ga0070694_100041531 | Ga0070694_1000415314 | 217 |
| 374 | 3300005444 | Ga0070694_100075001 | Ga0070694_1000750012 | 217 |
| 375 | 3300005444 | Ga0070694_100295507 | Ga0070694_1002955072 | 217 |
| 376 | 3300005444 | Ga0070694_100337418 | Ga0070694_1003374182 | 217 |
| 377 | 3300005445 | Ga0070708_100971501 | Ga0070708_1009715011 | 217 |
| 378 | 3300005467 | Ga0070706_100000431 | Ga0070706_10000043135 | 217 |
| 379 | 3300005467 | Ga0070706_100057839 | Ga0070706_1000578393 | 217 |
| 380 | 3300005467 | Ga0070706_100092982 | Ga0070706_1000929823 | 217 |
| 381 | 3300005467 | Ga0070706_100280197 | Ga0070706_1002801972 | 217 |
| 382 | 3300005468 | Ga0070707_100461013 | Ga0070707_1004610132 | 217 |
| 383 | 3300005471 | Ga0070698_100080843 | Ga0070698_1000808432 | 217 |
| 384 | 3300005471 | Ga0070698_100261221 | Ga0070698_1002612211 | 217 |
| 385 | 3300005518 | Ga0070699_100180025 | Ga0070699_1001800252 | 217 |
| 386 | 3300005536 | Ga0070697_100000014 | Ga0070697_10000001455 | 217 |
| 387 | 3300005536 | Ga0070697_100000343 | Ga0070697_10000034314 | 217 |
| 388 | 3300005536 | Ga0070697_100101613 | Ga0070697_1001016132 | 217 |
| 389 | 3300005536 | Ga0070697_100499816 | Ga0070697_1004998161 | 217 |
| 390 | 3300005544 | Ga0070686_100005948 | Ga0070686_1000059482 | 217 |
| 391 | 3300005545 | Ga0070695_100052270 | Ga0070695_1000522702 | 217 |
| 392 | 3300005545 | Ga0070695_100175146 | Ga0070695_1001751462 | 217 |
| 393 | 3300005546 | Ga0070696_100016199 | Ga0070696_1000161992 | 217 |
| 394 | 3300005546 | Ga0070696_100120059 | Ga0070696_1001200591 | 217 |
| 395 | 3300005546 | Ga0070696_100359715 | Ga0070696_1003597152 | 217 |
| 396 | 3300005549 | Ga0070704_100066968 | Ga0070704_1000669683 | 217 |
| 397 | 3300005549 | Ga0070704_100265848 | Ga0070704_1002658482 | 217 |
| 398 | 3300005549 | Ga0070704_100521119 | Ga0070704_1005211191 | 217 |
| 399 | 3300005577 | Ga0068857_100058962 | Ga0068857_1000589622 | 217 |
| 400 | 3300005615 | Ga0070702_100092716 | Ga0070702_1000927162 | 217 |
| 401 | 3300005616 | Ga0068852_100337509 | Ga0068852_1003375092 | 217 |
| 402 | 3300005718 | Ga0068866_10010008 | Ga0068866_100100083 | 217 |
| 403 | 3300005719 | Ga0068861_100408152 | Ga0068861_1004081522 | 217 |
| 404 | 3300005834 | Ga0068851_10007449 | Ga0068851_100074492 | 217 |
| 405 | 3300005841 | Ga0068863_100072842 | Ga0068863_1000728423 | 217 |
| 406 | 3300005842 | Ga0068858_100154917 | Ga0068858_1001549172 | 217 |
| 407 | 3300005983 | Ga0081540_1028728 | Ga0081540_10287282 | 217 |
| 408 | 3300006844 | Ga0075428_100458836 | Ga0075428_1004588362 | 217 |
| 409 | 3300006914 | Ga0075436_100166625 | Ga0075436_1001666252 | 217 |
| 410 | 3300009093 | Ga0105240_10241664 | Ga0105240_102416642 | 217 |
| 411 | 3300009094 | Ga0111539_10124845 | Ga0111539_101248453 | 217 |
| 412 | 3300009094 | Ga0111539_10212839 | Ga0111539_102128391 | 217 |
| 413 | 3300009147 | Ga0114129_10093871 | Ga0114129_100938713 | 217 |
| 414 | 3300009147 | Ga0114129_10925110 | Ga0114129_109251101 | 217 |
| 415 | 3300009148 | Ga0105243_10024493 | Ga0105243_100244932 | 217 |
| 416 | 3300009176 | Ga0105242_10517077 | Ga0105242_105170772 | 217 |
| 417 | 3300009177 | Ga0105248_10702106 | Ga0105248_107021062 | 217 |
| 418 | 3300009545 | Ga0105237_10000468 | Ga0105237_1000046832 | 217 |
| 419 | 3300011119 | Ga0105246_10112062 | Ga0105246_101120622 | 217 |
| 420 | 3300011119 | Ga0105246_10226107 | Ga0105246_102261072 | 217 |
| 421 | 3300013297 | Ga0157378_10220455 | Ga0157378_102204551 | 217 |
| 422 | 3300013297 | Ga0157378_10424945 | Ga0157378_104249452 | 217 |
| 423 | 3300014325 | Ga0163163_10104071 | Ga0163163_101040712 | 217 |
| 424 | 3300014326 | Ga0157380_10442213 | Ga0157380_104422132 | 217 |
| 425 | 3300014326 | Ga0157380_10527591 | Ga0157380_105275911 | 217 |
| 426 | 3300014968 | Ga0157379_10405133 | Ga0157379_104051331 | 217 |
| 427 | 3300021384 | Ga0213876_10015546 | Ga0213876_100155464 | 217 |
| 428 | 3300025321 | Ga0207656_10000731 | Ga0207656_100007316 | 217 |
| 429 | 3300025885 | Ga0207653_10003230 | Ga0207653_100032307 | 217 |
| 430 | 3300025910 | Ga0207684_10000316 | Ga0207684_1000031625 | 217 |
| 431 | 3300025910 | Ga0207684_10007906 | Ga0207684_100079063 | 217 |
| 432 | 3300025910 | Ga0207684_10073429 | Ga0207684_100734293 | 217 |
| 433 | 3300025910 | Ga0207684_10341189 | Ga0207684_103411892 | 217 |
| 434 | 3300025913 | Ga0207695_10114042 | Ga0207695_101140422 | 217 |
| 435 | 3300025914 | Ga0207671_10001108 | Ga0207671_1000110813 | 217 |
| 436 | 3300025922 | Ga0207646_10252253 | Ga0207646_102522532 | 217 |
| 437 | 3300025923 | Ga0207681_10006395 | Ga0207681_100063953 | 217 |
| 438 | 3300025925 | Ga0207650_10000555 | Ga0207650_100005559 | 217 |
| 439 | 3300025931 | Ga0207644_10019624 | Ga0207644_100196243 | 217 |
| 440 | 3300025936 | Ga0207670_10025119 | Ga0207670_100251193 | 217 |
| 441 | 3300025942 | Ga0207689_10001985 | Ga0207689_100019854 | 217 |
| 442 | 3300025942 | Ga0207689_10018626 | Ga0207689_100186263 | 217 |
| 443 | 3300026023 | Ga0207677_10180364 | Ga0207677_101803642 | 217 |
| 444 | 3300026041 | Ga0207639_10381728 | Ga0207639_103817282 | 217 |
| 445 | 3300026075 | Ga0207708_10105023 | Ga0207708_101050232 | 217 |
| 446 | 3300026075 | Ga0207708_10241248 | Ga0207708_102412481 | 217 |
| 447 | 3300026088 | Ga0207641_10089775 | Ga0207641_100897751 | 217 |
| 448 | 3300026089 | Ga0207648_10741829 | Ga0207648_107418292 | 217 |
| 449 | 3300026116 | Ga0207674_10023018 | Ga0207674_100230184 | 217 |
| 450 | 3300026118 | Ga0207675_100502737 | Ga0207675_1005027372 | 217 |
| 451 | 3300026142 | Ga0207698_10588605 | Ga0207698_105886051 | 217 |
| 452 | 3300028380 | Ga0268265_11295255 | Ga0268265_112952551 | 217 |
| 453 | 3300032002 | Ga0307416_100529145 | Ga0307416_1005291452 | 217 |
| 454 | 3300032126 | Ga0307415_100442320 | Ga0307415_1004423202 | 217 |
| 455 | 3300037418 | Ga0395900_0289882 | Ga0395900_0289882_303_977 | 217 |
| 456 | 3300037466 | Ga0395898_0182257 | Ga0395898_0182257_132_785 | 217 |
| 457 | 3300037466 | Ga0395898_0205933 | Ga0395898_0205933_855_1517 | 217 |
| 458 | 3300038443 | Ga0395901_0232876 | Ga0395901_0232876_433_1095 | 217 |
| 459 | 3300039437 | Ga0436365_0101175 | Ga0436365_0101175_10309_10986 | 217 |
| 460 | 3300042156 | Ga0439446_0104204 | Ga0439446_0104204_41_745 | 217 |
| 461 | 3300046519 | Ga0495632_0043222 | Ga0495632_0043222_1328_2005 | 217 |
| 462 | 3300046539 | Ga0495621_0031183 | Ga0495621_0031183_103_795 | 217 |
| 463 | 3300046615 | Ga0495656_0314033 | Ga0495656_0314033_56_721 | 217 |
| 464 | 3300047318 | Ga0495636_0042316 | Ga0495636_0042316_486_1172 | 217 |
| 465 | 3300047320 | Ga0495672_0005738 | Ga0495672_0005738_6235_6897 | 217 |
| 466 | 3300048913 | Ga0496110_0335318 | Ga0496110_0335318_106_759 | 217 |
| 467 | 3300049515 | Ga0501292_018769 | Ga0501292_018769_202_864 | 217 |
| 468 | 3300049523 | Ga0501300_021451 | Ga0501300_021451_24_683 | 217 |
| 469 | 3300049649 | Ga0501198_037087 | Ga0501198_037087_105_764 | 217 |
| 470 | 3300049656 | Ga0501209_118319 | Ga0501209_118319_95_757 | 217 |
| 471 | 3300049661 | Ga0501217_035143 | Ga0501217_035143_169_831 | 217 |
| 472 | 3300049673 | Ga0501240_018042 | Ga0501240_018042_251_913 | 217 |
| 473 | 3300049765 | Ga0501268_028705 | Ga0501268_028705_305_964 | 217 |
| 474 | 3300049765 | Ga0501268_041983 | Ga0501268_041983_137_799 | 217 |
| 475 | 3300050507 | nmdc:mga05p37_432003_c1 | nmdc:mga05p37_432003_c1_511_1173 | 217 |
| 476 | 3300050511 | nmdc:mga08y16_46098_c1 | nmdc:mga08y16_46098_c1_3427_4089 | 217 |
| 477 | 3300050511 | nmdc:mga08y16_528898_c1 | nmdc:mga08y16_528898_c1_484_1155 | 217 |
| 478 | 3300000546 | LJNas_1009394 | LJNas_10093941 | 218 |
| 479 | 3300005289 | Ga0065704_10094010 | Ga0065704_100940103 | 218 |
| 480 | 3300005295 | Ga0065707_10003206 | Ga0065707_100032068 | 218 |
| 481 | 3300005328 | Ga0070676_10284671 | Ga0070676_102846712 | 218 |
| 482 | 3300005330 | Ga0070690_100000567 | Ga0070690_1000005678 | 218 |
| 483 | 3300005330 | Ga0070690_100177763 | Ga0070690_1001777632 | 218 |
| 484 | 3300005331 | Ga0070670_100122872 | Ga0070670_1001228722 | 218 |
| 485 | 3300005334 | Ga0068869_100105449 | Ga0068869_1001054491 | 218 |
| 486 | 3300005335 | Ga0070666_10604571 | Ga0070666_106045711 | 218 |
| 487 | 3300005338 | Ga0068868_100022725 | Ga0068868_1000227252 | 218 |
| 488 | 3300005343 | Ga0070687_100029472 | Ga0070687_1000294722 | 218 |
| 489 | 3300005343 | Ga0070687_100085051 | Ga0070687_1000850511 | 218 |
| 490 | 3300005353 | Ga0070669_100180086 | Ga0070669_1001800861 | 218 |
| 491 | 3300005353 | Ga0070669_100394975 | Ga0070669_1003949751 | 218 |
| 492 | 3300005355 | Ga0070671_100086061 | Ga0070671_1000860613 | 218 |
| 493 | 3300005356 | Ga0070674_100559405 | Ga0070674_1005594051 | 218 |
| 494 | 3300005364 | Ga0070673_100132885 | Ga0070673_1001328852 | 218 |
| 495 | 3300005364 | Ga0070673_100295693 | Ga0070673_1002956932 | 218 |
| 496 | 3300005367 | Ga0070667_100065960 | Ga0070667_1000659602 | 218 |
| 497 | 3300005438 | Ga0070701_10037732 | Ga0070701_100377322 | 218 |
| 498 | 3300005438 | Ga0070701_10145139 | Ga0070701_101451392 | 218 |
| 499 | 3300005438 | Ga0070701_10199736 | Ga0070701_101997362 | 218 |
| 500 | 3300005441 | Ga0070700_100109848 | Ga0070700_1001098482 | 218 |
| 501 | 3300005441 | Ga0070700_100273428 | Ga0070700_1002734281 | 218 |
| 502 | 3300005444 | Ga0070694_100309790 | Ga0070694_1003097902 | 218 |
| 503 | 3300005457 | Ga0070662_100016062 | Ga0070662_1000160625 | 218 |
| 504 | 3300005457 | Ga0070662_100052204 | Ga0070662_1000522042 | 218 |
| 505 | 3300005459 | Ga0068867_100159470 | Ga0068867_1001594702 | 218 |
| 506 | 3300005471 | Ga0070698_100009412 | Ga0070698_1000094129 | 218 |
| 507 | 3300005544 | Ga0070686_100012198 | Ga0070686_1000121983 | 218 |
| 508 | 3300005544 | Ga0070686_100168331 | Ga0070686_1001683312 | 218 |
| 509 | 3300005545 | Ga0070695_100060072 | Ga0070695_1000600722 | 218 |
| 510 | 3300005545 | Ga0070695_100196446 | Ga0070695_1001964462 | 218 |
| 511 | 3300005546 | Ga0070696_100154084 | Ga0070696_1001540842 | 218 |
| 512 | 3300005548 | Ga0070665_100105216 | Ga0070665_1001052162 | 218 |
| 513 | 3300005549 | Ga0070704_100462978 | Ga0070704_1004629781 | 218 |
| 514 | 3300005564 | Ga0070664_100094606 | Ga0070664_1000946063 | 218 |
| 515 | 3300005577 | Ga0068857_100231978 | Ga0068857_1002319782 | 218 |
| 516 | 3300005578 | Ga0068854_100076078 | Ga0068854_1000760782 | 218 |
| 517 | 3300005578 | Ga0068854_100263338 | Ga0068854_1002633382 | 218 |
| 518 | 3300005617 | Ga0068859_100120850 | Ga0068859_1001208502 | 218 |
| 519 | 3300005617 | Ga0068859_100310636 | Ga0068859_1003106362 | 218 |
| 520 | 3300005618 | Ga0068864_100009780 | Ga0068864_10000978010 | 218 |
| 521 | 3300005719 | Ga0068861_100011809 | Ga0068861_1000118095 | 218 |
| 522 | 3300005719 | Ga0068861_100027856 | Ga0068861_1000278563 | 218 |
| 523 | 3300005719 | Ga0068861_100285173 | Ga0068861_1002851732 | 218 |
| 524 | 3300005843 | Ga0068860_100160847 | Ga0068860_1001608472 | 218 |
| 525 | 3300005844 | Ga0068862_100011968 | Ga0068862_1000119686 | 218 |
| 526 | 3300005844 | Ga0068862_100738739 | Ga0068862_1007387391 | 218 |
| 527 | 3300006237 | Ga0097621_100013953 | Ga0097621_1000139533 | 218 |
| 528 | 3300006358 | Ga0068871_100031887 | Ga0068871_1000318874 | 218 |
| 529 | 3300006844 | Ga0075428_100349297 | Ga0075428_1003492972 | 218 |
| 530 | 3300006881 | Ga0068865_100145726 | Ga0068865_1001457262 | 218 |
| 531 | 3300006931 | Ga0097620_100120849 | Ga0097620_1001208492 | 218 |
| 532 | 3300006931 | Ga0097620_100310619 | Ga0097620_1003106192 | 218 |
| 533 | 3300009094 | Ga0111539_10114236 | Ga0111539_101142362 | 218 |
| 534 | 3300009098 | Ga0105245_10297429 | Ga0105245_102974292 | 218 |
| 535 | 3300009148 | Ga0105243_10180898 | Ga0105243_101808981 | 218 |
| 536 | 3300009176 | Ga0105242_10320475 | Ga0105242_103204752 | 218 |
| 537 | 3300009177 | Ga0105248_10033630 | Ga0105248_100336303 | 218 |
| 538 | 3300009177 | Ga0105248_10048643 | Ga0105248_100486432 | 218 |
| 539 | 3300009553 | Ga0105249_10010278 | Ga0105249_100102787 | 218 |
| 540 | 3300010375 | Ga0105239_10450098 | Ga0105239_104500981 | 218 |
| 541 | 3300013297 | Ga0157378_10007028 | Ga0157378_100070286 | 218 |
| 542 | 3300013297 | Ga0157378_10062821 | Ga0157378_100628214 | 218 |
| 543 | 3300013297 | Ga0157378_10205599 | Ga0157378_102055992 | 218 |
| 544 | 3300013306 | Ga0163162_11402584 | Ga0163162_114025841 | 218 |
| 545 | 3300013308 | Ga0157375_10710596 | Ga0157375_107105961 | 218 |
| 546 | 3300014325 | Ga0163163_10011368 | Ga0163163_100113686 | 218 |
| 547 | 3300014325 | Ga0163163_10049931 | Ga0163163_100499313 | 218 |
| 548 | 3300014326 | Ga0157380_10008445 | Ga0157380_100084454 | 218 |
| 549 | 3300014326 | Ga0157380_10072483 | Ga0157380_100724833 | 218 |
| 550 | 3300014326 | Ga0157380_10088678 | Ga0157380_100886781 | 218 |
| 551 | 3300014745 | Ga0157377_10023493 | Ga0157377_100234933 | 218 |
| 552 | 3300014968 | Ga0157379_10123026 | Ga0157379_101230262 | 218 |
| 553 | 3300014969 | Ga0157376_10378801 | Ga0157376_103788012 | 218 |
| 554 | 3300014969 | Ga0157376_10419179 | Ga0157376_104191792 | 218 |
| 555 | 3300025910 | Ga0207684_10163094 | Ga0207684_101630942 | 218 |
| 556 | 3300025918 | Ga0207662_10012804 | Ga0207662_100128042 | 218 |
| 557 | 3300025923 | Ga0207681_10066022 | Ga0207681_100660222 | 218 |
| 558 | 3300025925 | Ga0207650_10109313 | Ga0207650_101093132 | 218 |
| 559 | 3300025925 | Ga0207650_10284223 | Ga0207650_102842231 | 218 |
| 560 | 3300025927 | Ga0207687_10218709 | Ga0207687_102187092 | 218 |
| 561 | 3300025931 | Ga0207644_10226816 | Ga0207644_102268162 | 218 |
| 562 | 3300025932 | Ga0207690_10287949 | Ga0207690_102879491 | 218 |
| 563 | 3300025933 | Ga0207706_10060196 | Ga0207706_100601963 | 218 |
| 564 | 3300025935 | Ga0207709_10765350 | Ga0207709_107653501 | 218 |
| 565 | 3300025937 | Ga0207669_10419135 | Ga0207669_104191352 | 218 |
| 566 | 3300025940 | Ga0207691_10170346 | Ga0207691_101703463 | 218 |
| 567 | 3300025941 | Ga0207711_10154903 | Ga0207711_101549032 | 218 |
| 568 | 3300025941 | Ga0207711_10212680 | Ga0207711_102126802 | 218 |
| 569 | 3300025942 | Ga0207689_10075394 | Ga0207689_100753942 | 218 |
| 570 | 3300025960 | Ga0207651_10110530 | Ga0207651_101105302 | 218 |
| 571 | 3300025960 | Ga0207651_10828142 | Ga0207651_108281421 | 218 |
| 572 | 3300025961 | Ga0207712_10342703 | Ga0207712_103427032 | 218 |
| 573 | 3300025981 | Ga0207640_10185052 | Ga0207640_101850522 | 218 |
| 574 | 3300025981 | Ga0207640_10329284 | Ga0207640_103292842 | 218 |
| 575 | 3300026023 | Ga0207677_10089882 | Ga0207677_100898822 | 218 |
| 576 | 3300026075 | Ga0207708_10006300 | Ga0207708_100063006 | 218 |
| 577 | 3300026075 | Ga0207708_10185306 | Ga0207708_101853062 | 218 |
| 578 | 3300026089 | Ga0207648_10257454 | Ga0207648_102574542 | 218 |
| 579 | 3300026116 | Ga0207674_10446102 | Ga0207674_104461022 | 218 |
| 580 | 3300026118 | Ga0207675_100006780 | Ga0207675_1000067804 | 218 |
| 581 | 3300026118 | Ga0207675_100064591 | Ga0207675_1000645913 | 218 |
| 582 | 3300026118 | Ga0207675_100368885 | Ga0207675_1003688852 | 218 |
| 583 | 3300027907 | Ga0207428_10050348 | Ga0207428_100503482 | 218 |
| 584 | 3300028380 | Ga0268265_10047558 | Ga0268265_100475583 | 218 |
| 585 | 3300028381 | Ga0268264_10087510 | Ga0268264_100875102 | 218 |
| 586 | 3300031731 | Ga0307405_10042653 | Ga0307405_100426532 | 218 |
| 587 | 3300032002 | Ga0307416_100924860 | Ga0307416_1009248602 | 218 |
| 588 | 3300037853 | Ga0436364_1457132 | Ga0436364_1457132_885_1592 | 218 |
| 589 | 3300042015 | Ga0439462_0087909 | Ga0439462_0087909_141_809 | 218 |
| 590 | 3300046473 | Ga0495582_0123882 | Ga0495582_0123882_676_1446 | 218 |
| 591 | 3300050510 | nmdc:mga06r32_782745_c1 | nmdc:mga06r32_782745_c1_11_727 | 218 |
| 592 | 3300050511 | nmdc:mga08y16_142706_c1 | nmdc:mga08y16_142706_c1_970_1665 | 218 |
| 593 | 2162886007 | SwRhRL2b_contig_699995 | SwRhRL2b_0499.00007300 | 219 |
| 594 | 3300003203 | JGI25406J46586_10075459 | JGI25406J46586_100754592 | 219 |
| 595 | 3300005289 | Ga0065704_10075225 | Ga0065704_100752258 | 219 |
| 596 | 3300005295 | Ga0065707_10007244 | Ga0065707_100072447 | 219 |
| 597 | 3300005331 | Ga0070670_100188623 | Ga0070670_1001886232 | 219 |
| 598 | 3300005331 | Ga0070670_100301303 | Ga0070670_1003013032 | 219 |
| 599 | 3300005331 | Ga0070670_100604196 | Ga0070670_1006041961 | 219 |
| 600 | 3300005334 | Ga0068869_100047108 | Ga0068869_1000471083 | 219 |
| 601 | 3300005334 | Ga0068869_100240009 | Ga0068869_1002400091 | 219 |
| 602 | 3300005334 | Ga0068869_100917290 | Ga0068869_1009172901 | 219 |
| 603 | 3300005336 | Ga0070680_100199240 | Ga0070680_1001992402 | 219 |
| 604 | 3300005337 | Ga0070682_100071595 | Ga0070682_1000715953 | 219 |
| 605 | 3300005338 | Ga0068868_100036004 | Ga0068868_1000360041 | 219 |
| 606 | 3300005339 | Ga0070660_100055252 | Ga0070660_1000552522 | 219 |
| 607 | 3300005340 | Ga0070689_100005379 | Ga0070689_1000053798 | 219 |
| 608 | 3300005340 | Ga0070689_100030638 | Ga0070689_1000306383 | 219 |
| 609 | 3300005341 | Ga0070691_10112000 | Ga0070691_101120001 | 219 |
| 610 | 3300005344 | Ga0070661_100013512 | Ga0070661_1000135123 | 219 |
| 611 | 3300005345 | Ga0070692_10096350 | Ga0070692_100963502 | 219 |
| 612 | 3300005347 | Ga0070668_100586531 | Ga0070668_1005865311 | 219 |
| 613 | 3300005353 | Ga0070669_100053620 | Ga0070669_1000536202 | 219 |
| 614 | 3300005353 | Ga0070669_100244719 | Ga0070669_1002447192 | 219 |
| 615 | 3300005355 | Ga0070671_100010870 | Ga0070671_1000108704 | 219 |
| 616 | 3300005364 | Ga0070673_100401037 | Ga0070673_1004010372 | 219 |
| 617 | 3300005366 | Ga0070659_100009251 | Ga0070659_1000092514 | 219 |
| 618 | 3300005438 | Ga0070701_10123090 | Ga0070701_101230902 | 219 |
| 619 | 3300005441 | Ga0070700_100037529 | Ga0070700_1000375293 | 219 |
| 620 | 3300005445 | Ga0070708_100008524 | Ga0070708_1000085244 | 219 |
| 621 | 3300005457 | Ga0070662_100087889 | Ga0070662_1000878892 | 219 |
| 622 | 3300005457 | Ga0070662_100847908 | Ga0070662_1008479081 | 219 |
| 623 | 3300005458 | Ga0070681_10037839 | Ga0070681_100378392 | 219 |
| 624 | 3300005459 | Ga0068867_100021246 | Ga0068867_1000212462 | 219 |
| 625 | 3300005467 | Ga0070706_100015492 | Ga0070706_1000154924 | 219 |
| 626 | 3300005467 | Ga0070706_100154266 | Ga0070706_1001542662 | 219 |
| 627 | 3300005468 | Ga0070707_100079132 | Ga0070707_1000791323 | 219 |
| 628 | 3300005471 | Ga0070698_100033195 | Ga0070698_1000331954 | 219 |
| 629 | 3300005518 | Ga0070699_100016622 | Ga0070699_1000166224 | 219 |
| 630 | 3300005530 | Ga0070679_100040983 | Ga0070679_1000409832 | 219 |
| 631 | 3300005536 | Ga0070697_100313858 | Ga0070697_1003138581 | 219 |
| 632 | 3300005539 | Ga0068853_100017537 | Ga0068853_1000175372 | 219 |
| 633 | 3300005545 | Ga0070695_100348500 | Ga0070695_1003485002 | 219 |
| 634 | 3300005546 | Ga0070696_100518192 | Ga0070696_1005181921 | 219 |
| 635 | 3300005563 | Ga0068855_100168180 | Ga0068855_1001681803 | 219 |
| 636 | 3300005564 | Ga0070664_100001208 | Ga0070664_10000120815 | 219 |
| 637 | 3300005577 | Ga0068857_100001249 | Ga0068857_1000012492 | 219 |
| 638 | 3300005577 | Ga0068857_100279441 | Ga0068857_1002794413 | 219 |
| 639 | 3300005615 | Ga0070702_100003806 | Ga0070702_1000038065 | 219 |
| 640 | 3300005615 | Ga0070702_100031429 | Ga0070702_1000314292 | 219 |
| 641 | 3300005616 | Ga0068852_100742341 | Ga0068852_1007423411 | 219 |
| 642 | 3300005618 | Ga0068864_100057920 | Ga0068864_1000579202 | 219 |
| 643 | 3300005618 | Ga0068864_100182502 | Ga0068864_1001825022 | 219 |
| 644 | 3300005718 | Ga0068866_10118306 | Ga0068866_101183062 | 219 |
| 645 | 3300005719 | Ga0068861_100189915 | Ga0068861_1001899152 | 219 |
| 646 | 3300005840 | Ga0068870_10014072 | Ga0068870_100140723 | 219 |
| 647 | 3300005841 | Ga0068863_100036585 | Ga0068863_1000365855 | 219 |
| 648 | 3300005841 | Ga0068863_100062950 | Ga0068863_1000629503 | 219 |
| 649 | 3300005842 | Ga0068858_100210917 | Ga0068858_1002109171 | 219 |
| 650 | 3300005843 | Ga0068860_100129750 | Ga0068860_1001297502 | 219 |
| 651 | 3300005843 | Ga0068860_100253686 | Ga0068860_1002536862 | 219 |
| 652 | 3300005843 | Ga0068860_100335605 | Ga0068860_1003356052 | 219 |
| 653 | 3300005844 | Ga0068862_100087027 | Ga0068862_1000870273 | 219 |
| 654 | 3300005844 | Ga0068862_100178538 | Ga0068862_1001785382 | 219 |
| 655 | 3300005844 | Ga0068862_100730526 | Ga0068862_1007305262 | 219 |
| 656 | 3300005985 | Ga0081539_10002508 | Ga0081539_1000250810 | 219 |
| 657 | 3300006237 | Ga0097621_100032515 | Ga0097621_1000325154 | 219 |
| 658 | 3300006358 | Ga0068871_100008976 | Ga0068871_1000089765 | 219 |
| 659 | 3300006844 | Ga0075428_100499377 | Ga0075428_1004993772 | 219 |
| 660 | 3300006852 | Ga0075433_10108274 | Ga0075433_101082743 | 219 |
| 661 | 3300006852 | Ga0075433_10174455 | Ga0075433_101744552 | 219 |
| 662 | 3300006852 | Ga0075433_10179311 | Ga0075433_101793112 | 219 |
| 663 | 3300006852 | Ga0075433_10875503 | Ga0075433_108755031 | 219 |
| 664 | 3300006871 | Ga0075434_100124658 | Ga0075434_1001246582 | 219 |
| 665 | 3300006871 | Ga0075434_100309585 | Ga0075434_1003095852 | 219 |
| 666 | 3300007076 | Ga0075435_100024836 | Ga0075435_1000248364 | 219 |
| 667 | 3300009094 | Ga0111539_10007031 | Ga0111539_100070312 | 219 |
| 668 | 3300009094 | Ga0111539_11180524 | Ga0111539_111805241 | 219 |
| 669 | 3300009098 | Ga0105245_10498687 | Ga0105245_104986872 | 219 |
| 670 | 3300009147 | Ga0114129_10015480 | Ga0114129_100154806 | 219 |
| 671 | 3300009147 | Ga0114129_10478683 | Ga0114129_104786832 | 219 |
| 672 | 3300009147 | Ga0114129_10827978 | Ga0114129_108279782 | 219 |
| 673 | 3300009147 | Ga0114129_11491569 | Ga0114129_114915691 | 219 |
| 674 | 3300009148 | Ga0105243_10176025 | Ga0105243_101760253 | 219 |
| 675 | 3300009174 | Ga0105241_10126184 | Ga0105241_101261842 | 219 |
| 676 | 3300009174 | Ga0105241_10145910 | Ga0105241_101459102 | 219 |
| 677 | 3300009176 | Ga0105242_10070549 | Ga0105242_100705493 | 219 |
| 678 | 3300009177 | Ga0105248_10030337 | Ga0105248_100303372 | 219 |
| 679 | 3300009177 | Ga0105248_10278088 | Ga0105248_102780882 | 219 |
| 680 | 3300009551 | Ga0105238_10002654 | Ga0105238_1000265413 | 219 |
| 681 | 3300009553 | Ga0105249_10553056 | Ga0105249_105530561 | 219 |
| 682 | 3300010375 | Ga0105239_10049188 | Ga0105239_100491881 | 219 |
| 683 | 3300011119 | Ga0105246_10395351 | Ga0105246_103953512 | 219 |
| 684 | 3300013100 | Ga0157373_10023272 | Ga0157373_100232724 | 219 |
| 685 | 3300013100 | Ga0157373_10052311 | Ga0157373_100523112 | 219 |
| 686 | 3300013102 | Ga0157371_10332497 | Ga0157371_103324972 | 219 |
| 687 | 3300013296 | Ga0157374_10930778 | Ga0157374_109307782 | 219 |
| 688 | 3300013297 | Ga0157378_10008063 | Ga0157378_100080635 | 219 |
| 689 | 3300013306 | Ga0163162_10078154 | Ga0163162_100781542 | 219 |
| 690 | 3300013306 | Ga0163162_10787373 | Ga0163162_107873731 | 219 |
| 691 | 3300013307 | Ga0157372_10238872 | Ga0157372_102388722 | 219 |
| 692 | 3300013307 | Ga0157372_11388662 | Ga0157372_113886621 | 219 |
| 693 | 3300014325 | Ga0163163_10103299 | Ga0163163_101032993 | 219 |
| 694 | 3300014325 | Ga0163163_10186477 | Ga0163163_101864772 | 219 |
| 695 | 3300014325 | Ga0163163_10226996 | Ga0163163_102269963 | 219 |
| 696 | 3300014325 | Ga0163163_10595755 | Ga0163163_105957552 | 219 |
| 697 | 3300014326 | Ga0157380_10684711 | Ga0157380_106847112 | 219 |
| 698 | 3300014745 | Ga0157377_10050448 | Ga0157377_100504482 | 219 |
| 699 | 3300014968 | Ga0157379_10449990 | Ga0157379_104499902 | 219 |
| 700 | 3300014968 | Ga0157379_10573942 | Ga0157379_105739422 | 219 |
| 701 | 3300015262 | Ga0182007_10062075 | Ga0182007_100620752 | 219 |
| 702 | 3300017792 | Ga0163161_10335628 | Ga0163161_103356282 | 219 |
| 703 | 3300025899 | Ga0207642_10149375 | Ga0207642_101493751 | 219 |
| 704 | 3300025903 | Ga0207680_10065045 | Ga0207680_100650452 | 219 |
| 705 | 3300025904 | Ga0207647_10028782 | Ga0207647_100287822 | 219 |
| 706 | 3300025904 | Ga0207647_10060937 | Ga0207647_100609373 | 219 |
| 707 | 3300025908 | Ga0207643_10031116 | Ga0207643_100311163 | 219 |
| 708 | 3300025910 | Ga0207684_10303875 | Ga0207684_103038752 | 219 |
| 709 | 3300025911 | Ga0207654_10371236 | Ga0207654_103712362 | 219 |
| 710 | 3300025912 | Ga0207707_10041799 | Ga0207707_100417992 | 219 |
| 711 | 3300025917 | Ga0207660_10374362 | Ga0207660_103743622 | 219 |
| 712 | 3300025919 | Ga0207657_10138729 | Ga0207657_101387292 | 219 |
| 713 | 3300025920 | Ga0207649_10037995 | Ga0207649_100379952 | 219 |
| 714 | 3300025921 | Ga0207652_10035361 | Ga0207652_100353612 | 219 |
| 715 | 3300025922 | Ga0207646_10355145 | Ga0207646_103551451 | 219 |
| 716 | 3300025923 | Ga0207681_10224768 | Ga0207681_102247682 | 219 |
| 717 | 3300025924 | Ga0207694_10034546 | Ga0207694_100345464 | 219 |
| 718 | 3300025925 | Ga0207650_10089544 | Ga0207650_100895443 | 219 |
| 719 | 3300025926 | Ga0207659_10487395 | Ga0207659_104873951 | 219 |
| 720 | 3300025927 | Ga0207687_10054774 | Ga0207687_100547743 | 219 |
| 721 | 3300025931 | Ga0207644_10053796 | Ga0207644_100537962 | 219 |
| 722 | 3300025932 | Ga0207690_10041616 | Ga0207690_100416162 | 219 |
| 723 | 3300025933 | Ga0207706_10113310 | Ga0207706_101133102 | 219 |
| 724 | 3300025935 | Ga0207709_10204051 | Ga0207709_102040512 | 219 |
| 725 | 3300025935 | Ga0207709_10204726 | Ga0207709_102047262 | 219 |
| 726 | 3300025936 | Ga0207670_10004999 | Ga0207670_100049998 | 219 |
| 727 | 3300025938 | Ga0207704_10045559 | Ga0207704_100455591 | 219 |
| 728 | 3300025941 | Ga0207711_10077256 | Ga0207711_100772562 | 219 |
| 729 | 3300025941 | Ga0207711_10183591 | Ga0207711_101835912 | 219 |
| 730 | 3300025942 | Ga0207689_10030576 | Ga0207689_100305762 | 219 |
| 731 | 3300025945 | Ga0207679_10060003 | Ga0207679_100600033 | 219 |
| 732 | 3300025981 | Ga0207640_10050988 | Ga0207640_100509883 | 219 |
| 733 | 3300026035 | Ga0207703_10298791 | Ga0207703_102987912 | 219 |
| 734 | 3300026035 | Ga0207703_10479728 | Ga0207703_104797282 | 219 |
| 735 | 3300026041 | Ga0207639_10160976 | Ga0207639_101609762 | 219 |
| 736 | 3300026075 | Ga0207708_10006438 | Ga0207708_1000643810 | 219 |
| 737 | 3300026075 | Ga0207708_10114058 | Ga0207708_101140581 | 219 |
| 738 | 3300026088 | Ga0207641_10273772 | Ga0207641_102737722 | 219 |
| 739 | 3300026089 | Ga0207648_10006728 | Ga0207648_100067285 | 219 |
| 740 | 3300026095 | Ga0207676_10028127 | Ga0207676_100281273 | 219 |
| 741 | 3300026095 | Ga0207676_10158639 | Ga0207676_101586392 | 219 |
| 742 | 3300026095 | Ga0207676_10343720 | Ga0207676_103437202 | 219 |
| 743 | 3300026116 | Ga0207674_10000023 | Ga0207674_10000023108 | 219 |
| 744 | 3300026116 | Ga0207674_10282694 | Ga0207674_102826942 | 219 |
| 745 | 3300026116 | Ga0207674_10636113 | Ga0207674_106361132 | 219 |
| 746 | 3300026116 | Ga0207674_10886500 | Ga0207674_108865001 | 219 |
| 747 | 3300026118 | Ga0207675_100004103 | Ga0207675_1000041033 | 219 |
| 748 | 3300026118 | Ga0207675_100045073 | Ga0207675_1000450735 | 219 |
| 749 | 3300026118 | Ga0207675_100134976 | Ga0207675_1001349762 | 219 |
| 750 | 3300027907 | Ga0207428_10022748 | Ga0207428_100227482 | 219 |
| 751 | 3300028380 | Ga0268265_10027886 | Ga0268265_100278863 | 219 |
| 752 | 3300028381 | Ga0268264_10074852 | Ga0268264_100748522 | 219 |
| 753 | 3300032005 | Ga0307411_10102439 | Ga0307411_101024392 | 219 |
| 754 | 3300037418 | Ga0395900_0743959 | Ga0395900_0743959_21_704 | 219 |
| 755 | 3300045051 | Ga0451576_0753635 | Ga0451576_0753635_49_717 | 219 |
| 756 | 3300049514 | Ga0501291_001644 | Ga0501291_001644_1283_1948 | 219 |
| 757 | 3300049519 | Ga0501296_001023 | Ga0501296_001023_578_1243 | 219 |
| 758 | 3300049521 | Ga0501298_000778 | Ga0501298_000778_2145_2810 | 219 |
| 759 | 3300049522 | Ga0501299_000882 | Ga0501299_000882_1786_2451 | 219 |
| 760 | 3300049523 | Ga0501300_011593 | Ga0501300_011593_360_1025 | 219 |
| 761 | 3300049574 | Ga0501038_0014457 | Ga0501038_0014457_3387_4052 | 219 |
| 762 | 3300049649 | Ga0501198_011262 | Ga0501198_011262_531_1202 | 219 |
| 763 | 3300049651 | Ga0501201_004910 | Ga0501201_004910_408_1073 | 219 |
| 764 | 3300049654 | Ga0501207_017838 | Ga0501207_017838_192_863 | 219 |
| 765 | 3300049664 | Ga0501224_009323 | Ga0501224_009323_513_1178 | 219 |
| 766 | 3300049668 | Ga0501233_003689 | Ga0501233_003689_576_1241 | 219 |
| 767 | 3300049669 | Ga0501235_014538 | Ga0501235_014538_1029_1694 | 219 |
| 768 | 3300049683 | Ga0501253_016574 | Ga0501253_016574_137_808 | 219 |
| 769 | 3300049685 | Ga0501256_004780 | Ga0501256_004780_320_985 | 219 |
| 770 | 3300049688 | Ga0501259_020974 | Ga0501259_020974_97_762 | 219 |
| 771 | 3300049689 | Ga0501260_000313 | Ga0501260_000313_1112_1777 | 219 |
| 772 | 3300049705 | Ga0501225_0028764 | Ga0501225_0028764_534_1199 | 219 |
| 773 | 3300049770 | Ga0501273_010615 | Ga0501273_010615_179_850 | 219 |
| 774 | 3300049774 | Ga0501278_008763 | Ga0501278_008763_28_699 | 219 |
| 775 | 3300049775 | Ga0501279_005537 | Ga0501279_005537_218_883 | 219 |
| 776 | 3300049779 | Ga0501283_001160 | Ga0501283_001160_1585_2250 | 219 |
| 777 | 3300050507 | nmdc:mga05p37_28431_c1 | nmdc:mga05p37_28431_c1_1115_1834 | 219 |
| 778 | 3300050507 | nmdc:mga05p37_321050_c1 | nmdc:mga05p37_321050_c1_73_732 | 219 |
| 779 | 3300050508 | nmdc:mga09592_22546_c1 | nmdc:mga09592_22546_c1_4235_4954 | 219 |
| 780 | 3300050511 | nmdc:mga08y16_32049_c1 | nmdc:mga08y16_32049_c1_79_738 | 219 |
| 781 | 3300050512 | nmdc:mga0n895_154635_c1 | nmdc:mga0n895_154635_c1_1541_2209 | 219 |
| 782 | 3300050512 | nmdc:mga0n895_245626_c1 | nmdc:mga0n895_245626_c1_816_1475 | 219 |
| 783 | 3300050512 | nmdc:mga0n895_365691_c1 | nmdc:mga0n895_365691_c1_81_749 | 219 |
| 784 | 3300050513 | nmdc:mga0rr50_11606_c1 | nmdc:mga0rr50_11606_c1_2178_2846 | 219 |
| 785 | 3300050515 | nmdc:mga0a205_35711_c1 | nmdc:mga0a205_35711_c1_3254_3913 | 219 |
| 786 | 3300050515 | nmdc:mga0a205_55034_c1 | nmdc:mga0a205_55034_c1_1346_2014 | 219 |
| 787 | 3300050515 | nmdc:mga0a205_695023_c1 | nmdc:mga0a205_695023_c1_163_831 | 219 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ccy-assembly1.cif.gz_A-2 | crystal structure of a tetr-family transcriptional regulator from bordetella parapertussis 12822 | 0.9164 | 4 | 187 |
| 4w97-assembly1.cif.gz_A | structure of ketosteroid transcriptional regulator kstr2 of mycobacterium tuberculosis | 0.9013 | 5 | 189 |
| 3vpr-assembly2.cif.gz_C | crystal structure of a tetr family transcriptional regulator pfmr from thermus thermophilus hb8 | 0.8817 | 11 | 186 |
| 3him-assembly1.cif.gz_A | the crystal structure of a bacterial regulatory protein in the tetr family from rhodococcus rha1 to 2.2a | 0.8796 | 5 | 187 |
| 5k7z-assembly2.cif.gz_C | crystal structure of aibr in complex with isovaleryl coenzyme a and operator dna | 0.8768 | 6 | 185 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2eh3A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9769 | 7 | 53 | 1.10.10.60 |
| 1jtyA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9618 | 6 | 53 | 1.10.10.60 |
| 3btlA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9587 | 6 | 53 | 1.10.10.60 |
| 3btjA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9586 | 6 | 53 | 1.10.10.60 |
| 1qvuA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9585 | 6 | 53 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E7Y6E4-F1-model_v4 | HTH tetR-type domain-containing protein | 0.9686 | 7 | 192 |
GO:0000976
GO:0003700 |
| AF-A0A838RV32-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.9569 | 2 | 181 |
GO:0000976
GO:0003700 |
| AF-A0A1F2UTL5-F1-model_v4 | HTH tetR-type domain-containing protein | 0.9546 | 4 | 190 |
GO:0000976
GO:0003700 |
| AF-A0A0S8H224-F1-model_v4 | HTH tetR-type domain-containing protein | 0.9531 | 6 | 196 |
GO:0000976
GO:0003700 |
| AF-Q565X7-F1-model_v4 | TetR-family transcriptional regulator | 0.9524 | 4 | 196 |
GO:0000976
GO:0003700 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar