F480823

General Info

Members Datasets Scaffolds Average Seq Length
787 266 787 224

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100011053|Ga0068856_1000110535
Length 261
Sequence LVLCALIENYETQIPNESIKAQRTKHKEQSSSVNMTHVTTFSRYDQKLEFILRSAAQIFADKSYHSTSMRDIARATNVSLAGLYHYCKSKEELLFLIQDNCFGRVLERLEERLRDVRDPIEKLRIFIENHLSFFAANMAEMKVLSHESQSLQGDLRQHVSGKKDKYTKLATRILREVDDGSGVNLTVATYALFGMMNWIYNWYDPKGRLKVHDLAQNLTQLFLEGFAPGSSFEVSDKFPRQLPENLSVWRGASRQQEKPIR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
199 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
200 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
201 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
202 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
206 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
207 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
208 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
209 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
210 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
211 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
212 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
222 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
223 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
224 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
225 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
226 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
227 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
230 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
231 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
232 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
233 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
234 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
235 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
236 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
237 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
238 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
239 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
240 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
241 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
242 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
243 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
244 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
245 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
246 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
247 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
248 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
249 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
250 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
251 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
252 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
253 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
254 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
255 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
256 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
257 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.65
Rhizosphere 97.97
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_699995 2162886007 Bacteria 3256
2 CNAas_1000021 3300000532 Bacteria 9956
3 LJNas_1009394 3300000546 Unclassified 1046
4 JGI24748J21848_1000035 3300002074 Bacteria 73922
5 JGI24034J26672_10000039 3300002239 Bacteria 73907
6 JGI24742J22300_10012050 3300002244 Unclassified 1438
7 JGI24751J29686_10000098 3300002459 Bacteria 48084
8 JGI25406J46586_10075459 3300003203 Unclassified 1046
9 Ga0065714_10064594 3300005288 Bacteria 30899
10 Ga0065704_10075225 3300005289 Bacteria 5721
11 Ga0065704_10094010 3300005289 Bacteria 2566
12 Ga0065704_10150367 3300005289 Bacteria 1434
13 Ga0065712_10000121 3300005290 Bacteria 103063
14 Ga0065712_10002144 3300005290 Bacteria 6237
15 Ga0065712_10320374 3300005290 Bacteria 829
16 Ga0065715_10056236 3300005293 Bacteria 1064
17 Ga0065715_10098674 3300005293 Bacteria 3507
18 Ga0065715_10214433 3300005293 Unclassified 1299
19 Ga0065707_10003206 3300005295 Bacteria 6416
20 Ga0065707_10007244 3300005295 Bacteria 5581
21 Ga0065707_10242325 3300005295 Unclassified 1151
22 Ga0065707_10260663 3300005295 Unclassified 1098
23 Ga0065707_10310452 3300005295 Bacteria 986
24 Ga0070676_10284671 3300005328 Unclassified 1115
25 Ga0070690_100000567 3300005330 Bacteria 18596
26 Ga0070690_100037832 3300005330 Unclassified 3042
27 Ga0070690_100177763 3300005330 Bacteria 1469
28 Ga0070670_100002046 3300005331 Bacteria 16506
29 Ga0070670_100005519 3300005331 Bacteria 10673
30 Ga0070670_100122872 3300005331 Bacteria 2240
31 Ga0070670_100188623 3300005331 Bacteria 1791
32 Ga0070670_100301303 3300005331 Bacteria 1402
33 Ga0070670_100604196 3300005331 Unclassified 982
34 Ga0068869_100010916 3300005334 Bacteria 5944
35 Ga0068869_100013833 3300005334 Bacteria 5378
36 Ga0068869_100047108 3300005334 Bacteria 3112
37 Ga0068869_100047112 3300005334 Bacteria 3112
38 Ga0068869_100105449 3300005334 Bacteria 2138
39 Ga0068869_100240009 3300005334 Unclassified 1444
40 Ga0068869_100917290 3300005334 Unclassified 759
41 Ga0070666_10604571 3300005335 Bacteria 800
42 Ga0070680_100030063 3300005336 Bacteria 4363
43 Ga0070680_100199240 3300005336 Bacteria 1688
44 Ga0070682_100000058 3300005337 Bacteria 108660
45 Ga0070682_100035308 3300005337 Bacteria 3052
46 Ga0070682_100071595 3300005337 Unclassified 2220
47 Ga0068868_100022725 3300005338 Bacteria 4738
48 Ga0068868_100036004 3300005338 Unclassified 3828
49 Ga0068868_100158815 3300005338 Bacteria 1866
50 Ga0070660_100055252 3300005339 Bacteria 3068
51 Ga0070689_100005379 3300005340 Bacteria 8731
52 Ga0070689_100030638 3300005340 Bacteria 4084
53 Ga0070689_100070955 3300005340 Bacteria 2720
54 Ga0070689_100088331 3300005340 Bacteria 2439
55 Ga0070691_10112000 3300005341 Unclassified 1366
56 Ga0070687_100029472 3300005343 Unclassified 2673
57 Ga0070687_100085051 3300005343 Bacteria 1735
58 Ga0070687_100131479 3300005343 Bacteria 1445
59 Ga0070687_100134904 3300005343 Unclassified 1430
60 Ga0070661_100013512 3300005344 Bacteria 5732
61 Ga0070692_10096350 3300005345 Bacteria 1616
62 Ga0070692_10148110 3300005345 Bacteria 1334
63 Ga0070668_100586531 3300005347 Bacteria 974
64 Ga0070669_100008727 3300005353 Bacteria 7231
65 Ga0070669_100053620 3300005353 Bacteria 2952
66 Ga0070669_100096862 3300005353 Bacteria 2220
67 Ga0070669_100155261 3300005353 Bacteria 1774
68 Ga0070669_100180086 3300005353 Bacteria 1653
69 Ga0070669_100244719 3300005353 Bacteria 1426
70 Ga0070669_100394975 3300005353 Bacteria 1130
71 Ga0070675_100447190 3300005354 Unclassified 1159
72 Ga0070671_100003674 3300005355 Bacteria 12027
73 Ga0070671_100010870 3300005355 Bacteria 7306
74 Ga0070671_100022824 3300005355 Bacteria 5112
75 Ga0070671_100086061 3300005355 Bacteria 2630
76 Ga0070674_100559405 3300005356 Bacteria 961
77 Ga0070673_100074245 3300005364 Bacteria 2740
78 Ga0070673_100132885 3300005364 Bacteria 2091
79 Ga0070673_100295693 3300005364 Bacteria 1424
80 Ga0070673_100401037 3300005364 Bacteria 1226
81 Ga0070673_100428643 3300005364 Bacteria 1187
82 Ga0070659_100009251 3300005366 Bacteria 7232
83 Ga0070667_100065960 3300005367 Bacteria 3075
84 Ga0070703_10002571 3300005406 Bacteria 5230
85 Ga0070701_10037732 3300005438 Bacteria 2441
86 Ga0070701_10123090 3300005438 Unclassified 1464
87 Ga0070701_10145139 3300005438 Bacteria 1361
88 Ga0070701_10199736 3300005438 Bacteria 1181
89 Ga0070701_10394783 3300005438 Unclassified 875
90 Ga0070700_100000157 3300005441 Bacteria 39668
91 Ga0070700_100037529 3300005441 Bacteria 2947
92 Ga0070700_100109848 3300005441 Bacteria 1831
93 Ga0070700_100207097 3300005441 Bacteria 1381
94 Ga0070700_100273428 3300005441 Bacteria 1222
95 Ga0070700_100397835 3300005441 Bacteria 1035
96 Ga0070694_100014780 3300005444 Bacteria 4891
97 Ga0070694_100041531 3300005444 Bacteria 3069
98 Ga0070694_100075001 3300005444 Bacteria 2339
99 Ga0070694_100079171 3300005444 Bacteria 2281
100 Ga0070694_100295507 3300005444 Unclassified 1240
101 Ga0070694_100309790 3300005444 Bacteria 1212
102 Ga0070694_100337418 3300005444 Unclassified 1164
103 Ga0070708_100008524 3300005445 Bacteria 8236
104 Ga0070708_100020885 3300005445 Bacteria 5528
105 Ga0070708_100211799 3300005445 Bacteria 1816
106 Ga0070708_100446331 3300005445 Bacteria 1220
107 Ga0070708_100971501 3300005445 Bacteria 797
108 Ga0070662_100016062 3300005457 Bacteria 5022
109 Ga0070662_100052204 3300005457 Bacteria 2955
110 Ga0070662_100087889 3300005457 Bacteria 2328
111 Ga0070662_100847908 3300005457 Bacteria 778
112 Ga0070681_10000065 3300005458 Bacteria 76633
113 Ga0070681_10002833 3300005458 Bacteria 16027
114 Ga0070681_10037839 3300005458 Bacteria 4839
115 Ga0068867_100007155 3300005459 Bacteria 7886
116 Ga0068867_100021246 3300005459 Bacteria 4631
117 Ga0068867_100098739 3300005459 Bacteria 2227
118 Ga0068867_100159470 3300005459 Bacteria 1778
119 Ga0068867_100161279 3300005459 Bacteria 1768
120 Ga0070706_100000431 3300005467 Bacteria 50311
121 Ga0070706_100015492 3300005467 Bacteria 7041
122 Ga0070706_100028799 3300005467 Bacteria 5115
123 Ga0070706_100057839 3300005467 Bacteria 3578
124 Ga0070706_100092982 3300005467 Bacteria 2798
125 Ga0070706_100154266 3300005467 Bacteria 2144
126 Ga0070706_100280197 3300005467 Bacteria 1556
127 Ga0070707_100001118 3300005468 Bacteria 26489
128 Ga0070707_100023273 3300005468 Bacteria 5861
129 Ga0070707_100064574 3300005468 Bacteria 3515
130 Ga0070707_100079132 3300005468 Bacteria 3172
131 Ga0070707_100115491 3300005468 Bacteria 2605
132 Ga0070707_100461013 3300005468 Bacteria 1232
133 Ga0070698_100000008 3300005471 Bacteria 119408
134 Ga0070698_100009412 3300005471 Bacteria 10471
135 Ga0070698_100033195 3300005471 Bacteria 5345
136 Ga0070698_100080843 3300005471 Bacteria 3244
137 Ga0070698_100183585 3300005471 Bacteria 2030
138 Ga0070698_100261221 3300005471 Bacteria 1664
139 Ga0070698_100503842 3300005471 Unclassified 1149
140 Ga0070699_100016622 3300005518 Bacteria 6315
141 Ga0070699_100125797 3300005518 Bacteria 2257
142 Ga0070699_100180025 3300005518 Unclassified 1876
143 Ga0070699_100239133 3300005518 Unclassified 1620
144 Ga0070699_100327234 3300005518 Bacteria 1378
145 Ga0070679_100000013 3300005530 Bacteria 151602
146 Ga0070679_100040983 3300005530 Bacteria 4609
147 Ga0070697_100000014 3300005536 Bacteria 144589
148 Ga0070697_100000343 3300005536 Bacteria 36583
149 Ga0070697_100101613 3300005536 Bacteria 2389
150 Ga0070697_100180771 3300005536 Bacteria 1788
151 Ga0070697_100313858 3300005536 Bacteria 1349
152 Ga0070697_100499816 3300005536 Bacteria 1063
153 Ga0070697_100632833 3300005536 Bacteria 941
154 Ga0068853_100017537 3300005539 Bacteria 5909
155 Ga0068853_100528466 3300005539 Unclassified 1116
156 Ga0070686_100005948 3300005544 Bacteria 6763
157 Ga0070686_100012198 3300005544 Bacteria 4888
158 Ga0070686_100119473 3300005544 Bacteria 1808
159 Ga0070686_100168331 3300005544 Bacteria 1548
160 Ga0070695_100032167 3300005545 Bacteria 3279
161 Ga0070695_100052270 3300005545 Bacteria 2625
162 Ga0070695_100060072 3300005545 Bacteria 2463
163 Ga0070695_100090421 3300005545 Bacteria 2043
164 Ga0070695_100165974 3300005545 Bacteria 1554
165 Ga0070695_100175146 3300005545 Bacteria 1516
166 Ga0070695_100196446 3300005545 Bacteria 1439
167 Ga0070695_100348500 3300005545 Bacteria 1109
168 Ga0070695_100354895 3300005545 Bacteria 1099
169 Ga0070695_100404577 3300005545 Unclassified 1036
170 Ga0070696_100016199 3300005546 Bacteria 5015
171 Ga0070696_100098187 3300005546 Bacteria 2095
172 Ga0070696_100120059 3300005546 Unclassified 1902
173 Ga0070696_100154084 3300005546 Bacteria 1689
174 Ga0070696_100301934 3300005546 Bacteria 1226
175 Ga0070696_100359715 3300005546 Bacteria 1129
176 Ga0070696_100518192 3300005546 Bacteria 951
177 Ga0070693_100325774 3300005547 Unclassified 1044
178 Ga0070693_100504441 3300005547 Unclassified 859
179 Ga0070665_100105216 3300005548 Bacteria 2824
180 Ga0070704_100066968 3300005549 Bacteria 2592
181 Ga0070704_100211362 3300005549 Bacteria 1572
182 Ga0070704_100265848 3300005549 Unclassified 1415
183 Ga0070704_100422223 3300005549 Bacteria 1142
184 Ga0070704_100462978 3300005549 Bacteria 1094
185 Ga0070704_100521119 3300005549 Bacteria 1035
186 Ga0068855_100168180 3300005563 Unclassified 2484
187 Ga0070664_100001208 3300005564 Bacteria 20575
188 Ga0070664_100094606 3300005564 Bacteria 2591
189 Ga0070664_101297331 3300005564 Bacteria 687
190 Ga0068857_100001249 3300005577 Bacteria 19891
191 Ga0068857_100049265 3300005577 Bacteria 3737
192 Ga0068857_100058962 3300005577 Bacteria 3409
193 Ga0068857_100231978 3300005577 Bacteria 1688
194 Ga0068857_100279441 3300005577 Bacteria 1535
195 Ga0068854_100076078 3300005578 Bacteria 2466
196 Ga0068854_100263338 3300005578 Bacteria 1381
197 Ga0068854_100558470 3300005578 Bacteria 972
198 Ga0068856_100011053 3300005614 Bacteria 8768
199 Ga0070702_100003806 3300005615 Bacteria 6819
200 Ga0070702_100031429 3300005615 Bacteria 2905
201 Ga0070702_100092716 3300005615 Bacteria 1835
202 Ga0070702_100883287 3300005615 Bacteria 698
203 Ga0068852_100337509 3300005616 Bacteria 1468
204 Ga0068852_100742341 3300005616 Bacteria 993
205 Ga0068859_100008702 3300005617 Bacteria 10262
206 Ga0068859_100012277 3300005617 Bacteria 8616
207 Ga0068859_100017817 3300005617 Bacteria 7139
208 Ga0068859_100058943 3300005617 Bacteria 3868
209 Ga0068859_100067796 3300005617 Bacteria 3603
210 Ga0068859_100120850 3300005617 Bacteria 2686
211 Ga0068859_100310636 3300005617 Bacteria 1670
212 Ga0068859_100526428 3300005617 Bacteria 1277
213 Ga0068859_100628183 3300005617 Bacteria 1166
214 Ga0068864_100009780 3300005618 Bacteria 7906
215 Ga0068864_100057920 3300005618 Bacteria 3347
216 Ga0068864_100182502 3300005618 Bacteria 1919
217 Ga0068864_100224605 3300005618 Bacteria 1734
218 Ga0068866_10010008 3300005718 Bacteria 4050
219 Ga0068866_10118306 3300005718 Bacteria 1489
220 Ga0068861_100005742 3300005719 Bacteria 8414
221 Ga0068861_100011809 3300005719 Bacteria 6078
222 Ga0068861_100027856 3300005719 Bacteria 4120
223 Ga0068861_100189915 3300005719 Bacteria 1716
224 Ga0068861_100207828 3300005719 Unclassified 1647
225 Ga0068861_100285173 3300005719 Bacteria 1424
226 Ga0068861_100408152 3300005719 Bacteria 1207
227 Ga0068861_100643142 3300005719 Bacteria 979
228 Ga0068851_10007449 3300005834 Bacteria 5026
229 Ga0068870_10014072 3300005840 Bacteria 3773
230 Ga0068870_10137315 3300005840 Bacteria 1427
231 Ga0068870_10460825 3300005840 Unclassified 840
232 Ga0068863_100036585 3300005841 Bacteria 4676
233 Ga0068863_100062950 3300005841 Bacteria 3508
234 Ga0068863_100072842 3300005841 Bacteria 3250
235 Ga0068863_100114635 3300005841 Bacteria 2567
236 Ga0068863_100130469 3300005841 Bacteria 2399
237 Ga0068863_100287103 3300005841 Bacteria 1595
238 Ga0068863_100773637 3300005841 Bacteria 957
239 Ga0068863_100896827 3300005841 Unclassified 887
240 Ga0068858_100000053 3300005842 Bacteria 119869
241 Ga0068858_100044544 3300005842 Bacteria 4112
242 Ga0068858_100154917 3300005842 Bacteria 2155
243 Ga0068858_100210917 3300005842 Bacteria 1838
244 Ga0068858_100349319 3300005842 Bacteria 1417
245 Ga0068858_100820826 3300005842 Bacteria 907
246 Ga0068860_100004968 3300005843 Bacteria 13554
247 Ga0068860_100025602 3300005843 Bacteria 5691
248 Ga0068860_100129750 3300005843 Bacteria 2418
249 Ga0068860_100160847 3300005843 Bacteria 2165
250 Ga0068860_100253686 3300005843 Bacteria 1713
251 Ga0068860_100335605 3300005843 Bacteria 1485
252 Ga0068862_100011968 3300005844 Bacteria 7166
253 Ga0068862_100087027 3300005844 Bacteria 2717
254 Ga0068862_100178538 3300005844 Bacteria 1904
255 Ga0068862_100730526 3300005844 Unclassified 962
256 Ga0068862_100738739 3300005844 Bacteria 956
257 Ga0081540_1028728 3300005983 Bacteria 3115
258 Ga0081539_10000998 3300005985 Bacteria 52505
259 Ga0081539_10002508 3300005985 Bacteria 25695
260 Ga0081539_10057930 3300005985 Bacteria 2140
261 Ga0070716_100068529 3300006173 Unclassified 2076
262 Ga0070716_100083496 3300006173 Bacteria 1913
263 Ga0070716_100461628 3300006173 Bacteria 928
264 Ga0097621_100013953 3300006237 Bacteria 6001
265 Ga0097621_100032515 3300006237 Bacteria 4148
266 Ga0068871_100008976 3300006358 Bacteria 7216
267 Ga0068871_100031887 3300006358 Bacteria 4158
268 Ga0068871_100278527 3300006358 Bacteria 1463
269 Ga0075428_100349297 3300006844 Unclassified 1587
270 Ga0075428_100458836 3300006844 Bacteria 1364
271 Ga0075428_100499377 3300006844 Bacteria 1302
272 Ga0075431_100053880 3300006847 Bacteria 4147
273 Ga0075433_10092654 3300006852 Bacteria 2673
274 Ga0075433_10108274 3300006852 Bacteria 2465
275 Ga0075433_10135748 3300006852 Unclassified 2187
276 Ga0075433_10148887 3300006852 Bacteria 2082
277 Ga0075433_10174455 3300006852 Bacteria 1913
278 Ga0075433_10179311 3300006852 Bacteria 1885
279 Ga0075433_10724345 3300006852 Unclassified 871
280 Ga0075433_10875503 3300006852 Bacteria 784
281 Ga0075434_100039378 3300006871 Bacteria 4683
282 Ga0075434_100124658 3300006871 Bacteria 2593
283 Ga0075434_100148611 3300006871 Bacteria 2363
284 Ga0075434_100168493 3300006871 Bacteria 2210
285 Ga0075434_100309585 3300006871 Bacteria 1600
286 Ga0075434_100903844 3300006871 Bacteria 898
287 Ga0075429_100349441 3300006880 Bacteria 1294
288 Ga0068865_100145726 3300006881 Bacteria 1791
289 Ga0075436_100000002 3300006914 Bacteria 475522
290 Ga0075436_100166625 3300006914 Bacteria 1555
291 Ga0097620_100008702 3300006931 Bacteria 10262
292 Ga0097620_100012277 3300006931 Bacteria 8616
293 Ga0097620_100017817 3300006931 Bacteria 7139
294 Ga0097620_100058944 3300006931 Bacteria 3868
295 Ga0097620_100067795 3300006931 Bacteria 3603
296 Ga0097620_100120849 3300006931 Bacteria 2686
297 Ga0097620_100310619 3300006931 Bacteria 1670
298 Ga0097620_100526424 3300006931 Bacteria 1277
299 Ga0097620_100628182 3300006931 Bacteria 1166
300 Ga0075435_100000198 3300007076 Bacteria 36326
301 Ga0075435_100024836 3300007076 Bacteria 4657
302 Ga0099794_10001385 3300007265 Bacteria 8449
303 Ga0105251_10065511 3300009011 Bacteria 1700
304 Ga0105244_10357370 3300009036 Bacteria 673
305 Ga0105240_10181726 3300009093 Bacteria 2481
306 Ga0105240_10241664 3300009093 Bacteria 2093
307 Ga0111539_10007031 3300009094 Bacteria 14443
308 Ga0111539_10114236 3300009094 Bacteria 3167
309 Ga0111539_10124845 3300009094 Bacteria 3016
310 Ga0111539_10212839 3300009094 Bacteria 2252
311 Ga0111539_11180524 3300009094 Bacteria 889
312 Ga0105245_10297429 3300009098 Bacteria 1583
313 Ga0105245_10498687 3300009098 Bacteria 1233
314 Ga0105247_10000052 3300009101 Bacteria 141465
315 Ga0105247_10019475 3300009101 Bacteria 4074
316 Ga0105247_10040702 3300009101 Bacteria 2842
317 Ga0114129_10015480 3300009147 Bacteria 10848
318 Ga0114129_10022866 3300009147 Bacteria 8865
319 Ga0114129_10085855 3300009147 Bacteria 4366
320 Ga0114129_10093871 3300009147 Bacteria 4155
321 Ga0114129_10099787 3300009147 Bacteria 4018
322 Ga0114129_10478683 3300009147 Bacteria 1629
323 Ga0114129_10576322 3300009147 Bacteria 1461
324 Ga0114129_10827978 3300009147 Bacteria 1178
325 Ga0114129_10925110 3300009147 Bacteria 1103
326 Ga0114129_10943793 3300009147 Bacteria 1090
327 Ga0114129_11491569 3300009147 Bacteria 831
328 Ga0114129_11633033 3300009147 Unclassified 788
329 Ga0105243_10001504 3300009148 Bacteria 20405
330 Ga0105243_10003856 3300009148 Bacteria 11977
331 Ga0105243_10009519 3300009148 Bacteria 7396
332 Ga0105243_10024493 3300009148 Bacteria 4603
333 Ga0105243_10115489 3300009148 Bacteria 2254
334 Ga0105243_10176025 3300009148 Unclassified 1857
335 Ga0105243_10180898 3300009148 Bacteria 1833
336 Ga0105243_10196398 3300009148 Bacteria 1766
337 Ga0105243_10208720 3300009148 Unclassified 1718
338 Ga0105243_10307311 3300009148 Unclassified 1439
339 Ga0105241_10111849 3300009174 Bacteria 2187
340 Ga0105241_10126184 3300009174 Bacteria 2067
341 Ga0105241_10145910 3300009174 Unclassified 1931
342 Ga0105241_10178785 3300009174 Bacteria 1758
343 Ga0105241_10279943 3300009174 Bacteria 1424
344 Ga0105241_10373356 3300009174 Bacteria 1244
345 Ga0105241_10641128 3300009174 Bacteria 964
346 Ga0105241_10856254 3300009174 Bacteria 841
347 Ga0105242_10003404 3300009176 Bacteria 12370
348 Ga0105242_10029809 3300009176 Bacteria 4354
349 Ga0105242_10070549 3300009176 Bacteria 2897
350 Ga0105242_10101463 3300009176 Bacteria 2439
351 Ga0105242_10109794 3300009176 Bacteria 2349
352 Ga0105242_10320475 3300009176 Bacteria 1421
353 Ga0105242_10453231 3300009176 Bacteria 1210
354 Ga0105242_10517077 3300009176 Bacteria 1138
355 Ga0105242_10983912 3300009176 Unclassified 850
356 Ga0105242_11085999 3300009176 Unclassified 813
357 Ga0105242_11307976 3300009176 Bacteria 749
358 Ga0105248_10014780 3300009177 Bacteria 8596
359 Ga0105248_10014842 3300009177 Bacteria 8580
360 Ga0105248_10021365 3300009177 Bacteria 7171
361 Ga0105248_10030337 3300009177 Bacteria 6037
362 Ga0105248_10033630 3300009177 Bacteria 5728
363 Ga0105248_10048643 3300009177 Bacteria 4757
364 Ga0105248_10251027 3300009177 Bacteria 1991
365 Ga0105248_10278088 3300009177 Bacteria 1884
366 Ga0105248_10292434 3300009177 Bacteria 1834
367 Ga0105248_10559895 3300009177 Bacteria 1290
368 Ga0105248_10702106 3300009177 Bacteria 1141
369 Ga0105237_10000468 3300009545 Bacteria 57134
370 Ga0105237_10279707 3300009545 Bacteria 1671
371 Ga0105238_10002654 3300009551 Bacteria 17795
372 Ga0105238_10413537 3300009551 Bacteria 1343
373 Ga0105249_10000003 3300009553 Bacteria 370855
374 Ga0105249_10010278 3300009553 Bacteria 8221
375 Ga0105249_10038874 3300009553 Bacteria 4319
376 Ga0105249_10043318 3300009553 Bacteria 4094
377 Ga0105249_10140190 3300009553 Bacteria 2318
378 Ga0105249_10553056 3300009553 Bacteria 1202
379 Ga0105239_10009646 3300010375 Bacteria 10857
380 Ga0105239_10049188 3300010375 Bacteria 4623
381 Ga0105239_10450098 3300010375 Bacteria 1461
382 Ga0105239_10457824 3300010375 Bacteria 1448
383 Ga0105239_10661803 3300010375 Bacteria 1193
384 Ga0105246_10022556 3300011119 Bacteria 4062
385 Ga0105246_10112062 3300011119 Unclassified 2006
386 Ga0105246_10226107 3300011119 Bacteria 1470
387 Ga0105246_10395351 3300011119 Unclassified 1146
388 Ga0157373_10023272 3300013100 Bacteria 4492
389 Ga0157373_10052311 3300013100 Bacteria 2906
390 Ga0157373_10153543 3300013100 Bacteria 1620
391 Ga0157371_10332497 3300013102 Bacteria 1104
392 Ga0157374_10930778 3300013296 Bacteria 887
393 Ga0157378_10000090 3300013297 Bacteria 86085
394 Ga0157378_10007028 3300013297 Bacteria 9823
395 Ga0157378_10008063 3300013297 Bacteria 9194
396 Ga0157378_10025360 3300013297 Bacteria 5222
397 Ga0157378_10062821 3300013297 Bacteria 3317
398 Ga0157378_10205599 3300013297 Bacteria 1864
399 Ga0157378_10220455 3300013297 Bacteria 1803
400 Ga0157378_10339260 3300013297 Unclassified 1465
401 Ga0157378_10424945 3300013297 Bacteria 1314
402 Ga0157378_10631851 3300013297 Bacteria 1085
403 Ga0157378_10637211 3300013297 Bacteria 1080
404 Ga0157378_10880946 3300013297 Unclassified 925
405 Ga0157378_10952927 3300013297 Bacteria 891
406 Ga0163162_10000033 3300013306 Bacteria 150185
407 Ga0163162_10011591 3300013306 Bacteria 8598
408 Ga0163162_10078154 3300013306 Bacteria 3374
409 Ga0163162_10125072 3300013306 Unclassified 2677
410 Ga0163162_10338188 3300013306 Unclassified 1638
411 Ga0163162_10629769 3300013306 Bacteria 1197
412 Ga0163162_10787373 3300013306 Bacteria 1069
413 Ga0163162_11402584 3300013306 Bacteria 795
414 Ga0157372_10010507 3300013307 Bacteria 9855
415 Ga0157372_10238872 3300013307 Bacteria 2108
416 Ga0157372_11388662 3300013307 Bacteria 810
417 Ga0157375_10005668 3300013308 Bacteria 10866
418 Ga0157375_10364735 3300013308 Unclassified 1611
419 Ga0157375_10429129 3300013308 Bacteria 1488
420 Ga0157375_10710596 3300013308 Unclassified 1158
421 Ga0163163_10003484 3300014325 Bacteria 13363
422 Ga0163163_10011368 3300014325 Bacteria 8070
423 Ga0163163_10049931 3300014325 Bacteria 4119
424 Ga0163163_10103299 3300014325 Bacteria 2875
425 Ga0163163_10104071 3300014325 Bacteria 2863
426 Ga0163163_10186477 3300014325 Bacteria 2122
427 Ga0163163_10226996 3300014325 Bacteria 1916
428 Ga0163163_10257173 3300014325 Bacteria 1797
429 Ga0163163_10595755 3300014325 Bacteria 1168
430 Ga0157380_10001117 3300014326 Bacteria 17322
431 Ga0157380_10008445 3300014326 Bacteria 7354
432 Ga0157380_10072483 3300014326 Bacteria 2790
433 Ga0157380_10088678 3300014326 Bacteria 2546
434 Ga0157380_10097785 3300014326 Bacteria 2437
435 Ga0157380_10442213 3300014326 Bacteria 1246
436 Ga0157380_10527591 3300014326 Unclassified 1153
437 Ga0157380_10684711 3300014326 Bacteria 1028
438 Ga0157380_11048510 3300014326 Bacteria 852
439 Ga0157377_10023493 3300014745 Bacteria 3268
440 Ga0157377_10050448 3300014745 Bacteria 2343
441 Ga0157377_10266921 3300014745 Unclassified 1116
442 Ga0157379_10088304 3300014968 Bacteria 2780
443 Ga0157379_10116747 3300014968 Bacteria 2400
444 Ga0157379_10123026 3300014968 Bacteria 2335
445 Ga0157379_10405133 3300014968 Bacteria 1254
446 Ga0157379_10449990 3300014968 Bacteria 1189
447 Ga0157379_10573942 3300014968 Bacteria 1051
448 Ga0157376_10378801 3300014969 Bacteria 1362
449 Ga0157376_10419179 3300014969 Bacteria 1299
450 Ga0182007_10062075 3300015262 Bacteria 1225
451 Ga0182007_10117888 3300015262 Unclassified 887
452 Ga0182005_1068097 3300015265 Bacteria 976
453 Ga0163161_10074696 3300017792 Bacteria 2486
454 Ga0163161_10242148 3300017792 Bacteria 1403
455 Ga0163161_10335628 3300017792 Bacteria 1198
456 Ga0163161_10500896 3300017792 Bacteria 989
457 Ga0213876_10015546 3300021384 Bacteria 4027
458 Ga0207672_1000693 3300025223 Bacteria 3873
459 Ga0207656_10000731 3300025321 Bacteria 10747
460 Ga0207653_10003230 3300025885 Bacteria 5150
461 Ga0207642_10149375 3300025899 Unclassified 1242
462 Ga0207710_10000004 3300025900 Bacteria 846540
463 Ga0207710_10030646 3300025900 Bacteria 2348
464 Ga0207688_10130743 3300025901 Bacteria 1471
465 Ga0207680_10065045 3300025903 Bacteria 2238
466 Ga0207647_10028782 3300025904 Bacteria 3605
467 Ga0207647_10060937 3300025904 Unclassified 2305
468 Ga0207645_10086715 3300025907 Bacteria 2011
469 Ga0207643_10031116 3300025908 Bacteria 2973
470 Ga0207684_10000316 3300025910 Bacteria 68606
471 Ga0207684_10007906 3300025910 Bacteria 9508
472 Ga0207684_10073429 3300025910 Bacteria 2905
473 Ga0207684_10163094 3300025910 Bacteria 1920
474 Ga0207684_10303875 3300025910 Bacteria 1375
475 Ga0207684_10341189 3300025910 Bacteria 1290
476 Ga0207654_10030797 3300025911 Bacteria 2949
477 Ga0207654_10182102 3300025911 Bacteria 1371
478 Ga0207654_10371236 3300025911 Unclassified 989
479 Ga0207707_10000004 3300025912 Bacteria 391281
480 Ga0207707_10041799 3300025912 Bacteria 4003
481 Ga0207695_10114042 3300025913 Bacteria 2678
482 Ga0207671_10001108 3300025914 Bacteria 32488
483 Ga0207660_10016005 3300025917 Bacteria 4958
484 Ga0207660_10374362 3300025917 Unclassified 1144
485 Ga0207662_10012804 3300025918 Bacteria 4679
486 Ga0207662_10087850 3300025918 Bacteria 1908
487 Ga0207662_10518494 3300025918 Bacteria 822
488 Ga0207657_10138729 3300025919 Bacteria 1988
489 Ga0207657_10341907 3300025919 Bacteria 1181
490 Ga0207649_10037995 3300025920 Bacteria 2912
491 Ga0207652_10000122 3300025921 Bacteria 85075
492 Ga0207652_10035361 3300025921 Bacteria 4216
493 Ga0207646_10000576 3300025922 Bacteria 48114
494 Ga0207646_10005566 3300025922 Bacteria 13225
495 Ga0207646_10024120 3300025922 Bacteria 5576
496 Ga0207646_10051924 3300025922 Bacteria 3668
497 Ga0207646_10252253 3300025922 Bacteria 1594
498 Ga0207646_10355145 3300025922 Bacteria 1324
499 Ga0207681_10006395 3300025923 Bacteria 7233
500 Ga0207681_10066022 3300025923 Bacteria 2503
501 Ga0207681_10086629 3300025923 Bacteria 2226
502 Ga0207681_10224768 3300025923 Bacteria 1454
503 Ga0207694_10026090 3300025924 Bacteria 4443
504 Ga0207694_10034546 3300025924 Bacteria 3877
505 Ga0207650_10000001 3300025925 Bacteria 1545726
506 Ga0207650_10000555 3300025925 Bacteria 30291
507 Ga0207650_10041897 3300025925 Bacteria 3357
508 Ga0207650_10089544 3300025925 Bacteria 2349
509 Ga0207650_10099499 3300025925 Bacteria 2236
510 Ga0207650_10109313 3300025925 Bacteria 2138
511 Ga0207650_10284223 3300025925 Bacteria 1348
512 Ga0207659_10487395 3300025926 Bacteria 1042
513 Ga0207687_10054774 3300025927 Bacteria 2792
514 Ga0207687_10218709 3300025927 Bacteria 1498
515 Ga0207687_10779214 3300025927 Unclassified 815
516 Ga0207644_10000206 3300025931 Bacteria 41161
517 Ga0207644_10019624 3300025931 Bacteria 4589
518 Ga0207644_10053796 3300025931 Bacteria 2898
519 Ga0207644_10226816 3300025931 Bacteria 1483
520 Ga0207690_10041616 3300025932 Bacteria 3012
521 Ga0207690_10217625 3300025932 Bacteria 1460
522 Ga0207690_10287949 3300025932 Bacteria 1281
523 Ga0207706_10060196 3300025933 Bacteria 3344
524 Ga0207706_10113310 3300025933 Bacteria 2386
525 Ga0207686_10000740 3300025934 Bacteria 20214
526 Ga0207686_10002448 3300025934 Bacteria 10083
527 Ga0207686_10127984 3300025934 Unclassified 1738
528 Ga0207686_10841938 3300025934 Unclassified 737
529 Ga0207709_10000754 3300025935 Bacteria 25567
530 Ga0207709_10018169 3300025935 Bacteria 3933
531 Ga0207709_10051797 3300025935 Bacteria 2517
532 Ga0207709_10204051 3300025935 Bacteria 1414
533 Ga0207709_10204726 3300025935 Bacteria 1412
534 Ga0207709_10218273 3300025935 Bacteria 1373
535 Ga0207709_10765350 3300025935 Unclassified 777
536 Ga0207670_10004999 3300025936 Bacteria 7225
537 Ga0207670_10025119 3300025936 Bacteria 3735
538 Ga0207669_10419135 3300025937 Bacteria 1053
539 Ga0207704_10045559 3300025938 Unclassified 2606
540 Ga0207665_10311296 3300025939 Unclassified 1180
541 Ga0207665_10331144 3300025939 Bacteria 1145
542 Ga0207691_10170346 3300025940 Bacteria 1907
543 Ga0207691_10264749 3300025940 Unclassified 1481
544 Ga0207711_10014225 3300025941 Bacteria 6609
545 Ga0207711_10031649 3300025941 Bacteria 4467
546 Ga0207711_10077256 3300025941 Bacteria 2902
547 Ga0207711_10154903 3300025941 Unclassified 2070
548 Ga0207711_10183591 3300025941 Bacteria 1903
549 Ga0207711_10191113 3300025941 Unclassified 1866
550 Ga0207711_10212680 3300025941 Bacteria 1766
551 Ga0207689_10001985 3300025942 Bacteria 19327
552 Ga0207689_10016832 3300025942 Bacteria 6188
553 Ga0207689_10018626 3300025942 Bacteria 5857
554 Ga0207689_10030576 3300025942 Bacteria 4488
555 Ga0207689_10055831 3300025942 Bacteria 3249
556 Ga0207689_10075394 3300025942 Bacteria 2772
557 Ga0207689_10347858 3300025942 Bacteria 1232
558 Ga0207689_10395458 3300025942 Unclassified 1152
559 Ga0207679_10060003 3300025945 Unclassified 2824
560 Ga0207679_10709858 3300025945 Bacteria 913
561 Ga0207651_10023987 3300025960 Bacteria 3764
562 Ga0207651_10110530 3300025960 Bacteria 2062
563 Ga0207651_10229299 3300025960 Bacteria 1507
564 Ga0207651_10339171 3300025960 Bacteria 1262
565 Ga0207651_10828142 3300025960 Unclassified 821
566 Ga0207712_10000060 3300025961 Bacteria 136248
567 Ga0207712_10002854 3300025961 Bacteria 11068
568 Ga0207712_10175755 3300025961 Unclassified 1678
569 Ga0207712_10332787 3300025961 Bacteria 1257
570 Ga0207712_10342703 3300025961 Bacteria 1240
571 Ga0207668_10072733 3300025972 Unclassified 2461
572 Ga0207640_10050988 3300025981 Unclassified 2688
573 Ga0207640_10185052 3300025981 Bacteria 1565
574 Ga0207640_10329284 3300025981 Bacteria 1219
575 Ga0207640_10348673 3300025981 Unclassified 1189
576 Ga0207677_10089882 3300026023 Bacteria 2230
577 Ga0207677_10180364 3300026023 Bacteria 1660
578 Ga0207703_10000093 3300026035 Bacteria 104313
579 Ga0207703_10149736 3300026035 Bacteria 2033
580 Ga0207703_10177078 3300026035 Bacteria 1880
581 Ga0207703_10295746 3300026035 Unclassified 1475
582 Ga0207703_10298791 3300026035 Bacteria 1468
583 Ga0207703_10479728 3300026035 Bacteria 1165
584 Ga0207703_10834258 3300026035 Unclassified 881
585 Ga0207639_10160976 3300026041 Unclassified 1891
586 Ga0207639_10237452 3300026041 Bacteria 1583
587 Ga0207639_10381728 3300026041 Bacteria 1265
588 Ga0207708_10000331 3300026075 Bacteria 37200
589 Ga0207708_10006300 3300026075 Bacteria 8797
590 Ga0207708_10006438 3300026075 Bacteria 8702
591 Ga0207708_10105023 3300026075 Bacteria 2189
592 Ga0207708_10114058 3300026075 Bacteria 2100
593 Ga0207708_10185306 3300026075 Bacteria 1654
594 Ga0207708_10241248 3300026075 Bacteria 1454
595 Ga0207641_10089775 3300026088 Bacteria 2686
596 Ga0207641_10097529 3300026088 Bacteria 2584
597 Ga0207641_10159449 3300026088 Bacteria 2050
598 Ga0207641_10273772 3300026088 Bacteria 1585
599 Ga0207641_10819768 3300026088 Bacteria 921
600 Ga0207648_10006728 3300026089 Bacteria 11403
601 Ga0207648_10015111 3300026089 Bacteria 7106
602 Ga0207648_10205229 3300026089 Unclassified 1749
603 Ga0207648_10257454 3300026089 Bacteria 1557
604 Ga0207648_10399232 3300026089 Bacteria 1246
605 Ga0207648_10741829 3300026089 Bacteria 912
606 Ga0207676_10028127 3300026095 Bacteria 4196
607 Ga0207676_10158639 3300026095 Bacteria 1957
608 Ga0207676_10343720 3300026095 Bacteria 1378
609 Ga0207676_10378296 3300026095 Bacteria 1317
610 Ga0207674_10000023 3300026116 Bacteria 157752
611 Ga0207674_10023018 3300026116 Bacteria 6681
612 Ga0207674_10282694 3300026116 Bacteria 1607
613 Ga0207674_10446102 3300026116 Bacteria 1251
614 Ga0207674_10636113 3300026116 Bacteria 1030
615 Ga0207674_10669806 3300026116 Bacteria 1002
616 Ga0207674_10886500 3300026116 Unclassified 860
617 Ga0207675_100004103 3300026118 Bacteria 14102
618 Ga0207675_100006780 3300026118 Bacteria 10834
619 Ga0207675_100009590 3300026118 Bacteria 9056
620 Ga0207675_100045073 3300026118 Bacteria 4120
621 Ga0207675_100064591 3300026118 Bacteria 3421
622 Ga0207675_100134976 3300026118 Bacteria 2341
623 Ga0207675_100221658 3300026118 Unclassified 1822
624 Ga0207675_100222082 3300026118 Bacteria 1821
625 Ga0207675_100368885 3300026118 Bacteria 1410
626 Ga0207675_100502737 3300026118 Bacteria 1207
627 Ga0207675_100770966 3300026118 Bacteria 974
628 Ga0207698_10588605 3300026142 Bacteria 1095
629 Ga0209588_1029981 3300027671 Bacteria 1737
630 Ga0207428_10022748 3300027907 Bacteria 5285
631 Ga0207428_10050348 3300027907 Bacteria 3333
632 Ga0268265_10027886 3300028380 Bacteria 4037
633 Ga0268265_10047558 3300028380 Bacteria 3215
634 Ga0268265_11295255 3300028380 Unclassified 729
635 Ga0268264_10023780 3300028381 Bacteria 4998
636 Ga0268264_10074852 3300028381 Bacteria 2877
637 Ga0268264_10087510 3300028381 Bacteria 2679
638 Ga0268264_10224383 3300028381 Bacteria 1731
639 Ga0268264_10250750 3300028381 Bacteria 1644
640 Ga0268264_11249839 3300028381 Unclassified 752
641 Ga0307408_100119624 3300031548 Bacteria 2038
642 Ga0307405_10042653 3300031731 Bacteria 2763
643 Ga0307413_10345659 3300031824 Bacteria 1146
644 Ga0307410_10139968 3300031852 Bacteria 1789
645 Ga0307406_10005171 3300031901 Bacteria 7122
646 Ga0307407_10008746 3300031903 Bacteria 4669
647 Ga0307412_10065249 3300031911 Bacteria 2463
648 Ga0307409_100081370 3300031995 Bacteria 2618
649 Ga0307416_100089823 3300032002 Bacteria 2632
650 Ga0307416_100529145 3300032002 Bacteria 1248
651 Ga0307416_100924860 3300032002 Bacteria 973
652 Ga0307411_10102439 3300032005 Unclassified 2029
653 Ga0307411_10260298 3300032005 Bacteria 1369
654 Ga0307411_10767878 3300032005 Bacteria 846
655 Ga0307415_100189036 3300032126 Bacteria 1623
656 Ga0307415_100442320 3300032126 Bacteria 1121
657 Ga0373940_0053688 3300035088 Unclassified 1138
658 Ga0373931_0414081 3300035691 Bacteria 856
659 Ga0395899_0095073 3300037312 Bacteria 2156
660 Ga0395900_0052049 3300037418 Bacteria 4216
661 Ga0395900_0057058 3300037418 Bacteria 4020
662 Ga0395900_0289882 3300037418 Unclassified 1626
663 Ga0395900_0743959 3300037418 Unclassified 911
664 Ga0395898_0182257 3300037466 Bacteria 2007
665 Ga0395898_0205933 3300037466 Unclassified 1877
666 Ga0395898_0283673 3300037466 Bacteria 1580
667 Ga0436364_1457132 3300037853 Unclassified 1759
668 Ga0395901_0016085 3300038443 Bacteria 7622
669 Ga0395901_0232876 3300038443 Bacteria 1923
670 Ga0395901_0312254 3300038443 Bacteria 1628
671 Ga0242420_007642 3300038996 Bacteria 1739
672 Ga0436365_0101175 3300039437 Bacteria 11647
673 Ga0439462_0087909 3300042015 Unclassified 851
674 Ga0439446_0104204 3300042156 Unclassified 900
675 Ga0439458_0009559 3300042157 Bacteria 2160
676 Ga0451577_0726754 3300042876 Bacteria 899
677 Ga0453683_0012971 3300044673 Bacteria 5449
678 Ga0451576_0051461 3300045051 Bacteria 4318
679 Ga0451576_0753635 3300045051 Unclassified 1023
680 Ga0451576_0928086 3300045051 Unclassified 913
681 Ga0451576_1145670 3300045051 Unclassified 813
682 Ga0451576_1238793 3300045051 Unclassified 779
683 Ga0495582_0123882 3300046473 Bacteria 1458
684 Ga0495662_0080421 3300046476 Bacteria 1585
685 Ga0495632_0043222 3300046519 Bacteria 2253
686 Ga0495663_0000063 3300046525 Bacteria 49946
687 Ga0495598_0000170 3300046537 Bacteria 11194
688 Ga0495621_0000230 3300046539 Bacteria 13105
689 Ga0495621_0031183 3300046539 Bacteria 1827
690 Ga0495656_0314033 3300046615 Bacteria 806
691 Ga0495636_0042316 3300047318 Bacteria 1892
692 Ga0495672_0005738 3300047320 Bacteria 9777
693 Ga0496102_0366383 3300048905 Bacteria 1356
694 Ga0496103_0071631 3300048906 Bacteria 2170
695 Ga0496106_0003034 3300048909 Bacteria 12505
696 Ga0496106_0025482 3300048909 Bacteria 4402
697 Ga0496107_0256600 3300048910 Bacteria 1301
698 Ga0496108_0096509 3300048911 Bacteria 2518
699 Ga0496108_0109097 3300048911 Bacteria 2365
700 Ga0496109_0506260 3300048912 Bacteria 1140
701 Ga0496110_0335318 3300048913 Bacteria 1378
702 Ga0496112_0318140 3300048915 Bacteria 1501
703 Ga0496112_0371611 3300048915 Bacteria 1371
704 Ga0496112_0468658 3300048915 Bacteria 1197
705 Ga0496112_0530182 3300048915 Bacteria 1112
706 Ga0501291_001644 3300049514 Bacteria 2607
707 Ga0501292_018769 3300049515 Bacteria 1103
708 Ga0501296_001023 3300049519 Bacteria 2793
709 Ga0501297_017061 3300049520 Bacteria 882
710 Ga0501298_000778 3300049521 Bacteria 4481
711 Ga0501298_018480 3300049521 Bacteria 1282
712 Ga0501299_000882 3300049522 Bacteria 3691
713 Ga0501300_011593 3300049523 Bacteria 1283
714 Ga0501300_021451 3300049523 Bacteria 943
715 Ga0501038_0014457 3300049574 Bacteria 7193
716 Ga0501198_011262 3300049649 Bacteria 1332
717 Ga0501198_037087 3300049649 Bacteria 833
718 Ga0501201_004910 3300049651 Unclassified 1245
719 Ga0501207_017838 3300049654 Unclassified 1111
720 Ga0501209_118319 3300049656 Unclassified 785
721 Ga0501214_000501 3300049659 Bacteria 2634
722 Ga0501217_005298 3300049661 Bacteria 2690
723 Ga0501217_035143 3300049661 Bacteria 1252
724 Ga0501224_009323 3300049664 Unclassified 1436
725 Ga0501224_021996 3300049664 Bacteria 951
726 Ga0501227_050582 3300049665 Bacteria 1048
727 Ga0501230_013474 3300049667 Bacteria 1327
728 Ga0501233_001585 3300049668 Bacteria 3913
729 Ga0501233_003689 3300049668 Bacteria 2765
730 Ga0501235_010826 3300049669 Bacteria 1995
731 Ga0501235_014538 3300049669 Bacteria 1734
732 Ga0501240_018042 3300049673 Bacteria 1034
733 Ga0501253_016574 3300049683 Bacteria 1229
734 Ga0501256_004780 3300049685 Unclassified 1173
735 Ga0501256_006381 3300049685 Bacteria 1062
736 Ga0501257_066075 3300049686 Bacteria 919
737 Ga0501259_020974 3300049688 Unclassified 1163
738 Ga0501260_000313 3300049689 Bacteria 3816
739 Ga0501221_027512 3300049704 Bacteria 1163
740 Ga0501225_0003104 3300049705 Bacteria 5078
741 Ga0501225_0028764 3300049705 Unclassified 1527
742 Ga0501229_009424 3300049706 Bacteria 1226
743 Ga0501234_002650 3300049707 Bacteria 2819
744 Ga0501268_028705 3300049765 Bacteria 996
745 Ga0501268_041983 3300049765 Bacteria 863
746 Ga0501272_017523 3300049769 Bacteria 844
747 Ga0501273_010615 3300049770 Unclassified 1135
748 Ga0501278_008763 3300049774 Unclassified 785
749 Ga0501279_005537 3300049775 Bacteria 1660
750 Ga0501283_001160 3300049779 Bacteria 3468
751 Ga0501212_012601 3300049851 Bacteria 1232
752 Ga0501226_013431 3300049853 Bacteria 904
753 nmdc:mga05p37_145614_c1 3300050507 Bacteria 2901
754 nmdc:mga05p37_28431_c1 3300050507 Bacteria 6817
755 nmdc:mga05p37_321050_c1 3300050507 Bacteria 1833
756 nmdc:mga05p37_432003_c1 3300050507 Bacteria 1530
757 nmdc:mga05p37_46576_c1 3300050507 Bacteria 5331
758 nmdc:mga09592_128212_c1 3300050508 Bacteria 2182
759 nmdc:mga09592_22546_c1 3300050508 Bacteria 5198
760 nmdc:mga0qj67_27290_c1 3300050509 Bacteria 4424
761 nmdc:mga0qj67_568364_c1 3300050509 Bacteria 909
762 nmdc:mga06r32_1006934_c1 3300050510 Bacteria 786
763 nmdc:mga06r32_571931_c1 3300050510 Unclassified 1103
764 nmdc:mga06r32_760890_c1 3300050510 Bacteria 931
765 nmdc:mga06r32_782745_c1 3300050510 Unclassified 915
766 nmdc:mga08y16_142706_c1 3300050511 Bacteria 2490
767 nmdc:mga08y16_32049_c1 3300050511 Bacteria 5527
768 nmdc:mga08y16_46098_c1 3300050511 Bacteria 4565
769 nmdc:mga08y16_528898_c1 3300050511 Bacteria 1195
770 nmdc:mga0n895_124542_c1 3300050512 Bacteria 2600
771 nmdc:mga0n895_154635_c1 3300050512 Bacteria 2324
772 nmdc:mga0n895_245626_c1 3300050512 Bacteria 1816
773 nmdc:mga0n895_310769_c1 3300050512 Bacteria 1597
774 nmdc:mga0n895_349359_c1 3300050512 Bacteria 1498
775 nmdc:mga0n895_365691_c1 3300050512 Bacteria 1460
776 nmdc:mga0n895_451780_c1 3300050512 Bacteria 1297
777 nmdc:mga0n895_938006_c1 3300050512 Unclassified 849
778 nmdc:mga0rr50_11606_c1 3300050513 Bacteria 5651
779 nmdc:mga0rr50_697008_c1 3300050513 Bacteria 867
780 nmdc:mga0rr50_959_c1 3300050513 Bacteria 15638
781 nmdc:mga08x19_53_c1 3300050514 Bacteria 123767
782 nmdc:mga0a205_159048_c1 3300050515 Bacteria 2157
783 nmdc:mga0a205_300298_c1 3300050515 Bacteria 1479
784 nmdc:mga0a205_35711_c1 3300050515 Bacteria 4773
785 nmdc:mga0a205_471182_c1 3300050515 Unclassified 1115
786 nmdc:mga0a205_55034_c1 3300050515 Bacteria 3842
787 nmdc:mga0a205_695023_c1 3300050515 Bacteria 867

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005340 Ga0070689_100088331 Ga0070689_1000883311 199
2 3300009147 Ga0114129_10099787 Ga0114129_100997872 204
3 3300009174 Ga0105241_10178785 Ga0105241_101787852 204
4 3300005842 Ga0068858_100820826 Ga0068858_1008208262 205
5 3300009036 Ga0105244_10357370 Ga0105244_103573701 205
6 3300009177 Ga0105248_10559895 Ga0105248_105598952 205
7 3300013308 Ga0157375_10429129 Ga0157375_104291292 205
8 3300014745 Ga0157377_10266921 Ga0157377_102669212 205
9 3300025932 Ga0207690_10217625 Ga0207690_102176252 205
10 3300025942 Ga0207689_10347858 Ga0207689_103478582 205
11 3300048912 Ga0496109_0506260 Ga0496109_0506260_377_1018 205
12 3300035088 Ga0373940_0053688 Ga0373940_0053688_219_857 206
13 3300005518 Ga0070699_100125797 Ga0070699_1001257972 207
14 3300005290 Ga0065712_10002144 Ga0065712_100021443 210
15 3300005330 Ga0070690_100037832 Ga0070690_1000378322 210
16 3300005539 Ga0068853_100528466 Ga0068853_1005284662 210
17 3300005545 Ga0070695_100090421 Ga0070695_1000904212 210
18 3300009101 Ga0105247_10040702 Ga0105247_100407023 210
19 3300009174 Ga0105241_10279943 Ga0105241_102799432 210
20 3300025900 Ga0207710_10030646 Ga0207710_100306462 210
21 3300025911 Ga0207654_10182102 Ga0207654_101821022 210
22 3300026041 Ga0207639_10237452 Ga0207639_102374522 210
23 3300048915 Ga0496112_0468658 Ga0496112_0468658_518_1156 210
24 3300009147 Ga0114129_10022866 Ga0114129_100228665 211
25 3300050507 nmdc:mga05p37_46576_c1 nmdc:mga05p37_46576_c1_2605_3381 211
26 3300050513 nmdc:mga0rr50_697008_c1 nmdc:mga0rr50_697008_c1_75_812 211
27 3300002459 JGI24751J29686_10000098 JGI24751J29686_1000009823 212
28 3300005288 Ga0065714_10064594 Ga0065714_100645947 212
29 3300005290 Ga0065712_10000121 Ga0065712_100001218 212
30 3300005293 Ga0065715_10214433 Ga0065715_102144332 212
31 3300005295 Ga0065707_10310452 Ga0065707_103104522 212
32 3300005331 Ga0070670_100002046 Ga0070670_1000020464 212
33 3300005343 Ga0070687_100134904 Ga0070687_1001349042 212
34 3300005354 Ga0070675_100447190 Ga0070675_1004471902 212
35 3300005441 Ga0070700_100000157 Ga0070700_10000015717 212
36 3300005444 Ga0070694_100014780 Ga0070694_1000147802 212
37 3300005444 Ga0070694_100079171 Ga0070694_1000791712 212
38 3300005458 Ga0070681_10002833 Ga0070681_100028333 212
39 3300005518 Ga0070699_100327234 Ga0070699_1003272342 212
40 3300005547 Ga0070693_100504441 Ga0070693_1005044411 212
41 3300005549 Ga0070704_100211362 Ga0070704_1002113622 212
42 3300005564 Ga0070664_101297331 Ga0070664_1012973311 212
43 3300005617 Ga0068859_100008702 Ga0068859_10000870210 212
44 3300005617 Ga0068859_100012277 Ga0068859_1000122772 212
45 3300005617 Ga0068859_100017817 Ga0068859_1000178172 212
46 3300005617 Ga0068859_100628183 Ga0068859_1006281832 212
47 3300005840 Ga0068870_10137315 Ga0068870_101373152 212
48 3300005840 Ga0068870_10460825 Ga0068870_104608252 212
49 3300005841 Ga0068863_100114635 Ga0068863_1001146352 212
50 3300005841 Ga0068863_100773637 Ga0068863_1007736372 212
51 3300005841 Ga0068863_100896827 Ga0068863_1008968272 212
52 3300005842 Ga0068858_100349319 Ga0068858_1003493192 212
53 3300005985 Ga0081539_10000998 Ga0081539_1000099825 212
54 3300005985 Ga0081539_10057930 Ga0081539_100579303 212
55 3300006871 Ga0075434_100168493 Ga0075434_1001684932 212
56 3300006931 Ga0097620_100008702 Ga0097620_10000870210 212
57 3300006931 Ga0097620_100012277 Ga0097620_10001227712 212
58 3300006931 Ga0097620_100017817 Ga0097620_1000178172 212
59 3300006931 Ga0097620_100628182 Ga0097620_1006281822 212
60 3300009093 Ga0105240_10181726 Ga0105240_101817263 212
61 3300009101 Ga0105247_10019475 Ga0105247_100194754 212
62 3300009147 Ga0114129_10943793 Ga0114129_109437932 212
63 3300009148 Ga0105243_10009519 Ga0105243_1000951910 212
64 3300009148 Ga0105243_10196398 Ga0105243_101963982 212
65 3300009174 Ga0105241_10641128 Ga0105241_106411282 212
66 3300009174 Ga0105241_10856254 Ga0105241_108562542 212
67 3300009176 Ga0105242_10101463 Ga0105242_101014633 212
68 3300009176 Ga0105242_10983912 Ga0105242_109839121 212
69 3300009176 Ga0105242_11085999 Ga0105242_110859992 212
70 3300009176 Ga0105242_11307976 Ga0105242_113079761 212
71 3300009177 Ga0105248_10014780 Ga0105248_100147802 212
72 3300009177 Ga0105248_10014842 Ga0105248_100148427 212
73 3300009177 Ga0105248_10251027 Ga0105248_102510272 212
74 3300009545 Ga0105237_10279707 Ga0105237_102797072 212
75 3300009551 Ga0105238_10413537 Ga0105238_104135372 212
76 3300009553 Ga0105249_10140190 Ga0105249_101401903 212
77 3300010375 Ga0105239_10457824 Ga0105239_104578242 212
78 3300013100 Ga0157373_10153543 Ga0157373_101535433 212
79 3300013297 Ga0157378_10952927 Ga0157378_109529271 212
80 3300013308 Ga0157375_10364735 Ga0157375_103647352 212
81 3300014325 Ga0163163_10003484 Ga0163163_100034844 212
82 3300014968 Ga0157379_10116747 Ga0157379_101167472 212
83 3300015262 Ga0182007_10117888 Ga0182007_101178881 212
84 3300015265 Ga0182005_1068097 Ga0182005_10680972 212
85 3300017792 Ga0163161_10242148 Ga0163161_102421481 212
86 3300025901 Ga0207688_10130743 Ga0207688_101307432 212
87 3300025919 Ga0207657_10341907 Ga0207657_103419072 212
88 3300025924 Ga0207694_10026090 Ga0207694_100260904 212
89 3300025925 Ga0207650_10000001 Ga0207650_100000011087 212
90 3300025925 Ga0207650_10041897 Ga0207650_100418972 212
91 3300025934 Ga0207686_10127984 Ga0207686_101279842 212
92 3300025934 Ga0207686_10841938 Ga0207686_108419381 212
93 3300025935 Ga0207709_10018169 Ga0207709_100181692 212
94 3300025935 Ga0207709_10218273 Ga0207709_102182732 212
95 3300025939 Ga0207665_10311296 Ga0207665_103112962 212
96 3300025941 Ga0207711_10014225 Ga0207711_100142255 212
97 3300025941 Ga0207711_10191113 Ga0207711_101911132 212
98 3300025942 Ga0207689_10395458 Ga0207689_103954581 212
99 3300025945 Ga0207679_10709858 Ga0207679_107098582 212
100 3300025960 Ga0207651_10339171 Ga0207651_103391712 212
101 3300025961 Ga0207712_10002854 Ga0207712_100028549 212
102 3300025981 Ga0207640_10348673 Ga0207640_103486732 212
103 3300026035 Ga0207703_10149736 Ga0207703_101497362 212
104 3300026035 Ga0207703_10177078 Ga0207703_101770782 212
105 3300026035 Ga0207703_10295746 Ga0207703_102957462 212
106 3300026075 Ga0207708_10000331 Ga0207708_1000033115 212
107 3300026088 Ga0207641_10159449 Ga0207641_101594492 212
108 3300026089 Ga0207648_10205229 Ga0207648_102052293 212
109 3300026118 Ga0207675_100770966 Ga0207675_1007709662 212
110 3300028381 Ga0268264_10250750 Ga0268264_102507502 212
111 3300031548 Ga0307408_100119624 Ga0307408_1001196242 212
112 3300031824 Ga0307413_10345659 Ga0307413_103456592 212
113 3300031852 Ga0307410_10139968 Ga0307410_101399682 212
114 3300031901 Ga0307406_10005171 Ga0307406_100051712 212
115 3300031903 Ga0307407_10008746 Ga0307407_100087463 212
116 3300031911 Ga0307412_10065249 Ga0307412_100652492 212
117 3300031995 Ga0307409_100081370 Ga0307409_1000813702 212
118 3300032002 Ga0307416_100089823 Ga0307416_1000898232 212
119 3300032005 Ga0307411_10260298 Ga0307411_102602981 212
120 3300032126 Ga0307415_100189036 Ga0307415_1001890362 212
121 3300035691 Ga0373931_0414081 Ga0373931_0414081_19_657 212
122 3300037312 Ga0395899_0095073 Ga0395899_0095073_1156_1794 212
123 3300037418 Ga0395900_0052049 Ga0395900_0052049_2812_3450 212
124 3300037466 Ga0395898_0283673 Ga0395898_0283673_800_1438 212
125 3300038443 Ga0395901_0016085 Ga0395901_0016085_1813_2451 212
126 3300042157 Ga0439458_0009559 Ga0439458_0009559_347_985 212
127 3300045051 Ga0451576_1238793 Ga0451576_1238793_80_727 212
128 3300046476 Ga0495662_0080421 Ga0495662_0080421_367_1020 212
129 3300048909 Ga0496106_0025482 Ga0496106_0025482_1306_1947 212
130 3300048911 Ga0496108_0109097 Ga0496108_0109097_58_699 212
131 3300048915 Ga0496112_0318140 Ga0496112_0318140_62_703 212
132 3300048915 Ga0496112_0371611 Ga0496112_0371611_650_1288 212
133 3300048915 Ga0496112_0530182 Ga0496112_0530182_19_657 212
134 3300049520 Ga0501297_017061 Ga0501297_017061_231_869 212
135 3300049521 Ga0501298_018480 Ga0501298_018480_533_1171 212
136 3300049659 Ga0501214_000501 Ga0501214_000501_262_900 212
137 3300049661 Ga0501217_005298 Ga0501217_005298_456_1094 212
138 3300049664 Ga0501224_021996 Ga0501224_021996_296_934 212
139 3300049665 Ga0501227_050582 Ga0501227_050582_181_819 212
140 3300049667 Ga0501230_013474 Ga0501230_013474_448_1086 212
141 3300049668 Ga0501233_001585 Ga0501233_001585_538_1176 212
142 3300049669 Ga0501235_010826 Ga0501235_010826_1018_1656 212
143 3300049685 Ga0501256_006381 Ga0501256_006381_111_749 212
144 3300049686 Ga0501257_066075 Ga0501257_066075_202_840 212
145 3300049704 Ga0501221_027512 Ga0501221_027512_246_884 212
146 3300049705 Ga0501225_0003104 Ga0501225_0003104_855_1493 212
147 3300049706 Ga0501229_009424 Ga0501229_009424_326_964 212
148 3300049707 Ga0501234_002650 Ga0501234_002650_1948_2586 212
149 3300049769 Ga0501272_017523 Ga0501272_017523_22_660 212
150 3300049851 Ga0501212_012601 Ga0501212_012601_465_1103 212
151 3300049853 Ga0501226_013431 Ga0501226_013431_24_662 212
152 3300005343 Ga0070687_100131479 Ga0070687_1001314792 213
153 3300005445 Ga0070708_100446331 Ga0070708_1004463311 213
154 3300005459 Ga0068867_100098739 Ga0068867_1000987392 213
155 3300005468 Ga0070707_100023273 Ga0070707_1000232731 213
156 3300005471 Ga0070698_100183585 Ga0070698_1001835852 213
157 3300005471 Ga0070698_100503842 Ga0070698_1005038422 213
158 3300005518 Ga0070699_100239133 Ga0070699_1002391332 213
159 3300005544 Ga0070686_100119473 Ga0070686_1001194732 213
160 3300005549 Ga0070704_100422223 Ga0070704_1004222232 213
161 3300005578 Ga0068854_100558470 Ga0068854_1005584701 213
162 3300005615 Ga0070702_100883287 Ga0070702_1008832871 213
163 3300005617 Ga0068859_100067796 Ga0068859_1000677964 213
164 3300005618 Ga0068864_100224605 Ga0068864_1002246052 213
165 3300005719 Ga0068861_100643142 Ga0068861_1006431422 213
166 3300006914 Ga0075436_100000002 Ga0075436_100000002371 213
167 3300006931 Ga0097620_100067795 Ga0097620_1000677954 213
168 3300007076 Ga0075435_100000198 Ga0075435_1000001984 213
169 3300009148 Ga0105243_10115489 Ga0105243_101154892 213
170 3300009176 Ga0105242_10029809 Ga0105242_100298092 213
171 3300013297 Ga0157378_10025360 Ga0157378_100253602 213
172 3300013297 Ga0157378_10631851 Ga0157378_106318511 213
173 3300013306 Ga0163162_10125072 Ga0163162_101250722 213
174 3300013306 Ga0163162_10629769 Ga0163162_106297692 213
175 3300014326 Ga0157380_11048510 Ga0157380_110485102 213
176 3300017792 Ga0163161_10500896 Ga0163161_105008961 213
177 3300025918 Ga0207662_10087850 Ga0207662_100878502 213
178 3300025922 Ga0207646_10005566 Ga0207646_100055669 213
179 3300025922 Ga0207646_10024120 Ga0207646_100241206 213
180 3300025922 Ga0207646_10051924 Ga0207646_100519242 213
181 3300025934 Ga0207686_10000740 Ga0207686_1000074011 213
182 3300026118 Ga0207675_100222082 Ga0207675_1002220822 213
183 3300032005 Ga0307411_10767878 Ga0307411_107678782 213
184 3300050510 nmdc:mga06r32_760890_c1 nmdc:mga06r32_760890_c1_27_686 213
185 3300050512 nmdc:mga0n895_451780_c1 nmdc:mga0n895_451780_c1_358_1017 213
186 3300050513 nmdc:mga0rr50_959_c1 nmdc:mga0rr50_959_c1_10896_11552 213
187 3300050514 nmdc:mga08x19_53_c1 nmdc:mga08x19_53_c1_106989_107645 213
188 3300005289 Ga0065704_10150367 Ga0065704_101503672 214
189 3300005293 Ga0065715_10056236 Ga0065715_100562361 214
190 3300005295 Ga0065707_10242325 Ga0065707_102423252 214
191 3300005334 Ga0068869_100010916 Ga0068869_1000109164 214
192 3300005336 Ga0070680_100030063 Ga0070680_1000300632 214
193 3300005353 Ga0070669_100096862 Ga0070669_1000968622 214
194 3300005445 Ga0070708_100020885 Ga0070708_1000208853 214
195 3300005458 Ga0070681_10000065 Ga0070681_1000006532 214
196 3300005468 Ga0070707_100001118 Ga0070707_10000111816 214
197 3300005468 Ga0070707_100115491 Ga0070707_1001154912 214
198 3300005471 Ga0070698_100000008 Ga0070698_10000000886 214
199 3300005530 Ga0070679_100000013 Ga0070679_100000013105 214
200 3300005536 Ga0070697_100632833 Ga0070697_1006328331 214
201 3300005545 Ga0070695_100032167 Ga0070695_1000321673 214
202 3300005545 Ga0070695_100354895 Ga0070695_1003548951 214
203 3300005546 Ga0070696_100098187 Ga0070696_1000981873 214
204 3300005546 Ga0070696_100301934 Ga0070696_1003019342 214
205 3300005614 Ga0068856_100011053 Ga0068856_1000110535 214
206 3300005617 Ga0068859_100058943 Ga0068859_1000589432 214
207 3300005719 Ga0068861_100005742 Ga0068861_1000057424 214
208 3300005719 Ga0068861_100207828 Ga0068861_1002078281 214
209 3300005843 Ga0068860_100004968 Ga0068860_1000049687 214
210 3300006173 Ga0070716_100083496 Ga0070716_1000834962 214
211 3300006852 Ga0075433_10092654 Ga0075433_100926542 214
212 3300006852 Ga0075433_10135748 Ga0075433_101357483 214
213 3300006871 Ga0075434_100903844 Ga0075434_1009038441 214
214 3300006931 Ga0097620_100058944 Ga0097620_1000589442 214
215 3300007265 Ga0099794_10001385 Ga0099794_100013857 214
216 3300009147 Ga0114129_10576322 Ga0114129_105763222 214
217 3300009148 Ga0105243_10307311 Ga0105243_103073111 214
218 3300009177 Ga0105248_10021365 Ga0105248_100213653 214
219 3300009553 Ga0105249_10038874 Ga0105249_100388742 214
220 3300009553 Ga0105249_10043318 Ga0105249_100433182 214
221 3300010375 Ga0105239_10009646 Ga0105239_100096469 214
222 3300013297 Ga0157378_10637211 Ga0157378_106372111 214
223 3300013297 Ga0157378_10880946 Ga0157378_108809462 214
224 3300013306 Ga0163162_10011591 Ga0163162_100115913 214
225 3300013306 Ga0163162_10338188 Ga0163162_103381882 214
226 3300013307 Ga0157372_10010507 Ga0157372_100105076 214
227 3300014326 Ga0157380_10001117 Ga0157380_100011173 214
228 3300025912 Ga0207707_10000004 Ga0207707_10000004221 214
229 3300025917 Ga0207660_10016005 Ga0207660_100160052 214
230 3300025921 Ga0207652_10000122 Ga0207652_1000012249 214
231 3300025922 Ga0207646_10000576 Ga0207646_1000057616 214
232 3300025923 Ga0207681_10086629 Ga0207681_100866292 214
233 3300025927 Ga0207687_10779214 Ga0207687_107792141 214
234 3300025940 Ga0207691_10264749 Ga0207691_102647492 214
235 3300025941 Ga0207711_10031649 Ga0207711_100316495 214
236 3300025942 Ga0207689_10016832 Ga0207689_100168323 214
237 3300025961 Ga0207712_10175755 Ga0207712_101757552 214
238 3300025961 Ga0207712_10332787 Ga0207712_103327872 214
239 3300026118 Ga0207675_100009590 Ga0207675_1000095905 214
240 3300026118 Ga0207675_100221658 Ga0207675_1002216583 214
241 3300027671 Ga0209588_1029981 Ga0209588_10299812 214
242 3300028381 Ga0268264_10023780 Ga0268264_100237802 214
243 3300038996 Ga0242420_007642 Ga0242420_007642_317_982 214
244 3300042876 Ga0451577_0726754 Ga0451577_0726754_28_690 214
245 3300044673 Ga0453683_0012971 Ga0453683_0012971_341_1006 214
246 3300045051 Ga0451576_0051461 Ga0451576_0051461_998_1663 214
247 3300045051 Ga0451576_0928086 Ga0451576_0928086_15_680 214
248 3300048905 Ga0496102_0366383 Ga0496102_0366383_82_768 214
249 3300048906 Ga0496103_0071631 Ga0496103_0071631_77_760 214
250 3300050512 nmdc:mga0n895_124542_c1 nmdc:mga0n895_124542_c1_432_1109 214
251 3300050512 nmdc:mga0n895_310769_c1 nmdc:mga0n895_310769_c1_741_1409 214
252 3300050512 nmdc:mga0n895_938006_c1 nmdc:mga0n895_938006_c1_25_711 214
253 3300050515 nmdc:mga0a205_471182_c1 nmdc:mga0a205_471182_c1_418_1083 214
254 3300005295 Ga0065707_10260663 Ga0065707_102606632 215
255 3300005353 Ga0070669_100155261 Ga0070669_1001552612 215
256 3300005445 Ga0070708_100211799 Ga0070708_1002117992 215
257 3300005459 Ga0068867_100161279 Ga0068867_1001612791 215
258 3300005467 Ga0070706_100028799 Ga0070706_1000287992 215
259 3300005468 Ga0070707_100064574 Ga0070707_1000645742 215
260 3300005536 Ga0070697_100180771 Ga0070697_1001807712 215
261 3300005545 Ga0070695_100404577 Ga0070695_1004045772 215
262 3300005547 Ga0070693_100325774 Ga0070693_1003257742 215
263 3300005617 Ga0068859_100526428 Ga0068859_1005264282 215
264 3300005842 Ga0068858_100044544 Ga0068858_1000445442 215
265 3300006173 Ga0070716_100068529 Ga0070716_1000685292 215
266 3300006173 Ga0070716_100461628 Ga0070716_1004616282 215
267 3300006852 Ga0075433_10148887 Ga0075433_101488872 215
268 3300006871 Ga0075434_100039378 Ga0075434_1000393782 215
269 3300006931 Ga0097620_100526424 Ga0097620_1005264242 215
270 3300009147 Ga0114129_10085855 Ga0114129_100858552 215
271 3300009147 Ga0114129_11633033 Ga0114129_116330332 215
272 3300009148 Ga0105243_10001504 Ga0105243_100015043 215
273 3300009148 Ga0105243_10208720 Ga0105243_102087202 215
274 3300009174 Ga0105241_10373356 Ga0105241_103733562 215
275 3300009176 Ga0105242_10003404 Ga0105242_100034046 215
276 3300009176 Ga0105242_10109794 Ga0105242_101097942 215
277 3300009553 Ga0105249_10000003 Ga0105249_1000000352 215
278 3300013297 Ga0157378_10000090 Ga0157378_1000009026 215
279 3300013306 Ga0163162_10000033 Ga0163162_1000003372 215
280 3300013308 Ga0157375_10005668 Ga0157375_1000566810 215
281 3300014326 Ga0157380_10097785 Ga0157380_100977852 215
282 3300025907 Ga0207645_10086715 Ga0207645_100867153 215
283 3300025911 Ga0207654_10030797 Ga0207654_100307973 215
284 3300025918 Ga0207662_10518494 Ga0207662_105184941 215
285 3300025934 Ga0207686_10002448 Ga0207686_100024485 215
286 3300025935 Ga0207709_10000754 Ga0207709_1000075416 215
287 3300025939 Ga0207665_10331144 Ga0207665_103311441 215
288 3300025961 Ga0207712_10000060 Ga0207712_1000006046 215
289 3300025972 Ga0207668_10072733 Ga0207668_100727331 215
290 3300026089 Ga0207648_10399232 Ga0207648_103992322 215
291 3300045051 Ga0451576_1145670 Ga0451576_1145670_25_681 215
292 3300048909 Ga0496106_0003034 Ga0496106_0003034_1484_2152 215
293 3300048910 Ga0496107_0256600 Ga0496107_0256600_54_722 215
294 3300050507 nmdc:mga05p37_145614_c1 nmdc:mga05p37_145614_c1_2056_2736 215
295 3300050512 nmdc:mga0n895_349359_c1 nmdc:mga0n895_349359_c1_620_1288 215
296 3300050515 nmdc:mga0a205_300298_c1 nmdc:mga0a205_300298_c1_530_1210 215
297 3300002074 JGI24748J21848_1000035 JGI24748J21848_100003572 216
298 3300002239 JGI24034J26672_10000039 JGI24034J26672_1000003972 216
299 3300002244 JGI24742J22300_10012050 JGI24742J22300_100120501 216
300 3300005334 Ga0068869_100047112 Ga0068869_1000471122 216
301 3300005337 Ga0070682_100000058 Ga0070682_10000005841 216
302 3300005355 Ga0070671_100022824 Ga0070671_1000228245 216
303 3300005364 Ga0070673_100074245 Ga0070673_1000742452 216
304 3300005364 Ga0070673_100428643 Ga0070673_1004286432 216
305 3300005459 Ga0068867_100007155 Ga0068867_1000071557 216
306 3300005545 Ga0070695_100165974 Ga0070695_1001659742 216
307 3300005577 Ga0068857_100049265 Ga0068857_1000492654 216
308 3300005841 Ga0068863_100130469 Ga0068863_1001304692 216
309 3300005841 Ga0068863_100287103 Ga0068863_1002871032 216
310 3300005842 Ga0068858_100000053 Ga0068858_10000005351 216
311 3300005843 Ga0068860_100025602 Ga0068860_1000256021 216
312 3300006358 Ga0068871_100278527 Ga0068871_1002785272 216
313 3300006847 Ga0075431_100053880 Ga0075431_1000538803 216
314 3300006852 Ga0075433_10724345 Ga0075433_107243451 216
315 3300006871 Ga0075434_100148611 Ga0075434_1001486113 216
316 3300006880 Ga0075429_100349441 Ga0075429_1003494412 216
317 3300009011 Ga0105251_10065511 Ga0105251_100655111 216
318 3300009101 Ga0105247_10000052 Ga0105247_1000005267 216
319 3300009148 Ga0105243_10003856 Ga0105243_100038566 216
320 3300009174 Ga0105241_10111849 Ga0105241_101118492 216
321 3300009176 Ga0105242_10453231 Ga0105242_104532312 216
322 3300009177 Ga0105248_10292434 Ga0105248_102924342 216
323 3300010375 Ga0105239_10661803 Ga0105239_106618032 216
324 3300011119 Ga0105246_10022556 Ga0105246_100225565 216
325 3300013297 Ga0157378_10339260 Ga0157378_103392602 216
326 3300014325 Ga0163163_10257173 Ga0163163_102571733 216
327 3300014968 Ga0157379_10088304 Ga0157379_100883042 216
328 3300017792 Ga0163161_10074696 Ga0163161_100746962 216
329 3300025223 Ga0207672_1000693 Ga0207672_10006932 216
330 3300025900 Ga0207710_10000004 Ga0207710_10000004440 216
331 3300025925 Ga0207650_10099499 Ga0207650_100994992 216
332 3300025931 Ga0207644_10000206 Ga0207644_1000020634 216
333 3300025935 Ga0207709_10051797 Ga0207709_100517972 216
334 3300025942 Ga0207689_10055831 Ga0207689_100558312 216
335 3300025960 Ga0207651_10023987 Ga0207651_100239873 216
336 3300025960 Ga0207651_10229299 Ga0207651_102292992 216
337 3300026035 Ga0207703_10000093 Ga0207703_1000009351 216
338 3300026035 Ga0207703_10834258 Ga0207703_108342582 216
339 3300026088 Ga0207641_10097529 Ga0207641_100975292 216
340 3300026088 Ga0207641_10819768 Ga0207641_108197682 216
341 3300026089 Ga0207648_10015111 Ga0207648_100151113 216
342 3300026095 Ga0207676_10378296 Ga0207676_103782962 216
343 3300026116 Ga0207674_10669806 Ga0207674_106698062 216
344 3300028381 Ga0268264_10224383 Ga0268264_102243832 216
345 3300028381 Ga0268264_11249839 Ga0268264_112498391 216
346 3300037418 Ga0395900_0057058 Ga0395900_0057058_2436_3119 216
347 3300038443 Ga0395901_0312254 Ga0395901_0312254_703_1386 216
348 3300046525 Ga0495663_0000063 Ga0495663_0000063_31018_31677 216
349 3300046537 Ga0495598_0000170 Ga0495598_0000170_3929_4585 216
350 3300046539 Ga0495621_0000230 Ga0495621_0000230_4526_5182 216
351 3300048911 Ga0496108_0096509 Ga0496108_0096509_1216_1875 216
352 3300050508 nmdc:mga09592_128212_c1 nmdc:mga09592_128212_c1_957_1607 216
353 3300050509 nmdc:mga0qj67_27290_c1 nmdc:mga0qj67_27290_c1_921_1571 216
354 3300050509 nmdc:mga0qj67_568364_c1 nmdc:mga0qj67_568364_c1_186_836 216
355 3300050510 nmdc:mga06r32_1006934_c1 nmdc:mga06r32_1006934_c1_52_702 216
356 3300050510 nmdc:mga06r32_571931_c1 nmdc:mga06r32_571931_c1_191_850 216
357 3300050515 nmdc:mga0a205_159048_c1 nmdc:mga0a205_159048_c1_854_1510 216
358 3300000532 CNAas_1000021 CNAas_10000216 217
359 3300005290 Ga0065712_10320374 Ga0065712_103203741 217
360 3300005293 Ga0065715_10098674 Ga0065715_100986743 217
361 3300005331 Ga0070670_100005519 Ga0070670_10000551910 217
362 3300005334 Ga0068869_100013833 Ga0068869_1000138333 217
363 3300005337 Ga0070682_100035308 Ga0070682_1000353082 217
364 3300005338 Ga0068868_100158815 Ga0068868_1001588152 217
365 3300005340 Ga0070689_100070955 Ga0070689_1000709553 217
366 3300005345 Ga0070692_10148110 Ga0070692_101481102 217
367 3300005353 Ga0070669_100008727 Ga0070669_1000087275 217
368 3300005355 Ga0070671_100003674 Ga0070671_1000036743 217
369 3300005406 Ga0070703_10002571 Ga0070703_100025712 217
370 3300005438 Ga0070701_10394783 Ga0070701_103947831 217
371 3300005441 Ga0070700_100207097 Ga0070700_1002070972 217
372 3300005441 Ga0070700_100397835 Ga0070700_1003978351 217
373 3300005444 Ga0070694_100041531 Ga0070694_1000415314 217
374 3300005444 Ga0070694_100075001 Ga0070694_1000750012 217
375 3300005444 Ga0070694_100295507 Ga0070694_1002955072 217
376 3300005444 Ga0070694_100337418 Ga0070694_1003374182 217
377 3300005445 Ga0070708_100971501 Ga0070708_1009715011 217
378 3300005467 Ga0070706_100000431 Ga0070706_10000043135 217
379 3300005467 Ga0070706_100057839 Ga0070706_1000578393 217
380 3300005467 Ga0070706_100092982 Ga0070706_1000929823 217
381 3300005467 Ga0070706_100280197 Ga0070706_1002801972 217
382 3300005468 Ga0070707_100461013 Ga0070707_1004610132 217
383 3300005471 Ga0070698_100080843 Ga0070698_1000808432 217
384 3300005471 Ga0070698_100261221 Ga0070698_1002612211 217
385 3300005518 Ga0070699_100180025 Ga0070699_1001800252 217
386 3300005536 Ga0070697_100000014 Ga0070697_10000001455 217
387 3300005536 Ga0070697_100000343 Ga0070697_10000034314 217
388 3300005536 Ga0070697_100101613 Ga0070697_1001016132 217
389 3300005536 Ga0070697_100499816 Ga0070697_1004998161 217
390 3300005544 Ga0070686_100005948 Ga0070686_1000059482 217
391 3300005545 Ga0070695_100052270 Ga0070695_1000522702 217
392 3300005545 Ga0070695_100175146 Ga0070695_1001751462 217
393 3300005546 Ga0070696_100016199 Ga0070696_1000161992 217
394 3300005546 Ga0070696_100120059 Ga0070696_1001200591 217
395 3300005546 Ga0070696_100359715 Ga0070696_1003597152 217
396 3300005549 Ga0070704_100066968 Ga0070704_1000669683 217
397 3300005549 Ga0070704_100265848 Ga0070704_1002658482 217
398 3300005549 Ga0070704_100521119 Ga0070704_1005211191 217
399 3300005577 Ga0068857_100058962 Ga0068857_1000589622 217
400 3300005615 Ga0070702_100092716 Ga0070702_1000927162 217
401 3300005616 Ga0068852_100337509 Ga0068852_1003375092 217
402 3300005718 Ga0068866_10010008 Ga0068866_100100083 217
403 3300005719 Ga0068861_100408152 Ga0068861_1004081522 217
404 3300005834 Ga0068851_10007449 Ga0068851_100074492 217
405 3300005841 Ga0068863_100072842 Ga0068863_1000728423 217
406 3300005842 Ga0068858_100154917 Ga0068858_1001549172 217
407 3300005983 Ga0081540_1028728 Ga0081540_10287282 217
408 3300006844 Ga0075428_100458836 Ga0075428_1004588362 217
409 3300006914 Ga0075436_100166625 Ga0075436_1001666252 217
410 3300009093 Ga0105240_10241664 Ga0105240_102416642 217
411 3300009094 Ga0111539_10124845 Ga0111539_101248453 217
412 3300009094 Ga0111539_10212839 Ga0111539_102128391 217
413 3300009147 Ga0114129_10093871 Ga0114129_100938713 217
414 3300009147 Ga0114129_10925110 Ga0114129_109251101 217
415 3300009148 Ga0105243_10024493 Ga0105243_100244932 217
416 3300009176 Ga0105242_10517077 Ga0105242_105170772 217
417 3300009177 Ga0105248_10702106 Ga0105248_107021062 217
418 3300009545 Ga0105237_10000468 Ga0105237_1000046832 217
419 3300011119 Ga0105246_10112062 Ga0105246_101120622 217
420 3300011119 Ga0105246_10226107 Ga0105246_102261072 217
421 3300013297 Ga0157378_10220455 Ga0157378_102204551 217
422 3300013297 Ga0157378_10424945 Ga0157378_104249452 217
423 3300014325 Ga0163163_10104071 Ga0163163_101040712 217
424 3300014326 Ga0157380_10442213 Ga0157380_104422132 217
425 3300014326 Ga0157380_10527591 Ga0157380_105275911 217
426 3300014968 Ga0157379_10405133 Ga0157379_104051331 217
427 3300021384 Ga0213876_10015546 Ga0213876_100155464 217
428 3300025321 Ga0207656_10000731 Ga0207656_100007316 217
429 3300025885 Ga0207653_10003230 Ga0207653_100032307 217
430 3300025910 Ga0207684_10000316 Ga0207684_1000031625 217
431 3300025910 Ga0207684_10007906 Ga0207684_100079063 217
432 3300025910 Ga0207684_10073429 Ga0207684_100734293 217
433 3300025910 Ga0207684_10341189 Ga0207684_103411892 217
434 3300025913 Ga0207695_10114042 Ga0207695_101140422 217
435 3300025914 Ga0207671_10001108 Ga0207671_1000110813 217
436 3300025922 Ga0207646_10252253 Ga0207646_102522532 217
437 3300025923 Ga0207681_10006395 Ga0207681_100063953 217
438 3300025925 Ga0207650_10000555 Ga0207650_100005559 217
439 3300025931 Ga0207644_10019624 Ga0207644_100196243 217
440 3300025936 Ga0207670_10025119 Ga0207670_100251193 217
441 3300025942 Ga0207689_10001985 Ga0207689_100019854 217
442 3300025942 Ga0207689_10018626 Ga0207689_100186263 217
443 3300026023 Ga0207677_10180364 Ga0207677_101803642 217
444 3300026041 Ga0207639_10381728 Ga0207639_103817282 217
445 3300026075 Ga0207708_10105023 Ga0207708_101050232 217
446 3300026075 Ga0207708_10241248 Ga0207708_102412481 217
447 3300026088 Ga0207641_10089775 Ga0207641_100897751 217
448 3300026089 Ga0207648_10741829 Ga0207648_107418292 217
449 3300026116 Ga0207674_10023018 Ga0207674_100230184 217
450 3300026118 Ga0207675_100502737 Ga0207675_1005027372 217
451 3300026142 Ga0207698_10588605 Ga0207698_105886051 217
452 3300028380 Ga0268265_11295255 Ga0268265_112952551 217
453 3300032002 Ga0307416_100529145 Ga0307416_1005291452 217
454 3300032126 Ga0307415_100442320 Ga0307415_1004423202 217
455 3300037418 Ga0395900_0289882 Ga0395900_0289882_303_977 217
456 3300037466 Ga0395898_0182257 Ga0395898_0182257_132_785 217
457 3300037466 Ga0395898_0205933 Ga0395898_0205933_855_1517 217
458 3300038443 Ga0395901_0232876 Ga0395901_0232876_433_1095 217
459 3300039437 Ga0436365_0101175 Ga0436365_0101175_10309_10986 217
460 3300042156 Ga0439446_0104204 Ga0439446_0104204_41_745 217
461 3300046519 Ga0495632_0043222 Ga0495632_0043222_1328_2005 217
462 3300046539 Ga0495621_0031183 Ga0495621_0031183_103_795 217
463 3300046615 Ga0495656_0314033 Ga0495656_0314033_56_721 217
464 3300047318 Ga0495636_0042316 Ga0495636_0042316_486_1172 217
465 3300047320 Ga0495672_0005738 Ga0495672_0005738_6235_6897 217
466 3300048913 Ga0496110_0335318 Ga0496110_0335318_106_759 217
467 3300049515 Ga0501292_018769 Ga0501292_018769_202_864 217
468 3300049523 Ga0501300_021451 Ga0501300_021451_24_683 217
469 3300049649 Ga0501198_037087 Ga0501198_037087_105_764 217
470 3300049656 Ga0501209_118319 Ga0501209_118319_95_757 217
471 3300049661 Ga0501217_035143 Ga0501217_035143_169_831 217
472 3300049673 Ga0501240_018042 Ga0501240_018042_251_913 217
473 3300049765 Ga0501268_028705 Ga0501268_028705_305_964 217
474 3300049765 Ga0501268_041983 Ga0501268_041983_137_799 217
475 3300050507 nmdc:mga05p37_432003_c1 nmdc:mga05p37_432003_c1_511_1173 217
476 3300050511 nmdc:mga08y16_46098_c1 nmdc:mga08y16_46098_c1_3427_4089 217
477 3300050511 nmdc:mga08y16_528898_c1 nmdc:mga08y16_528898_c1_484_1155 217
478 3300000546 LJNas_1009394 LJNas_10093941 218
479 3300005289 Ga0065704_10094010 Ga0065704_100940103 218
480 3300005295 Ga0065707_10003206 Ga0065707_100032068 218
481 3300005328 Ga0070676_10284671 Ga0070676_102846712 218
482 3300005330 Ga0070690_100000567 Ga0070690_1000005678 218
483 3300005330 Ga0070690_100177763 Ga0070690_1001777632 218
484 3300005331 Ga0070670_100122872 Ga0070670_1001228722 218
485 3300005334 Ga0068869_100105449 Ga0068869_1001054491 218
486 3300005335 Ga0070666_10604571 Ga0070666_106045711 218
487 3300005338 Ga0068868_100022725 Ga0068868_1000227252 218
488 3300005343 Ga0070687_100029472 Ga0070687_1000294722 218
489 3300005343 Ga0070687_100085051 Ga0070687_1000850511 218
490 3300005353 Ga0070669_100180086 Ga0070669_1001800861 218
491 3300005353 Ga0070669_100394975 Ga0070669_1003949751 218
492 3300005355 Ga0070671_100086061 Ga0070671_1000860613 218
493 3300005356 Ga0070674_100559405 Ga0070674_1005594051 218
494 3300005364 Ga0070673_100132885 Ga0070673_1001328852 218
495 3300005364 Ga0070673_100295693 Ga0070673_1002956932 218
496 3300005367 Ga0070667_100065960 Ga0070667_1000659602 218
497 3300005438 Ga0070701_10037732 Ga0070701_100377322 218
498 3300005438 Ga0070701_10145139 Ga0070701_101451392 218
499 3300005438 Ga0070701_10199736 Ga0070701_101997362 218
500 3300005441 Ga0070700_100109848 Ga0070700_1001098482 218
501 3300005441 Ga0070700_100273428 Ga0070700_1002734281 218
502 3300005444 Ga0070694_100309790 Ga0070694_1003097902 218
503 3300005457 Ga0070662_100016062 Ga0070662_1000160625 218
504 3300005457 Ga0070662_100052204 Ga0070662_1000522042 218
505 3300005459 Ga0068867_100159470 Ga0068867_1001594702 218
506 3300005471 Ga0070698_100009412 Ga0070698_1000094129 218
507 3300005544 Ga0070686_100012198 Ga0070686_1000121983 218
508 3300005544 Ga0070686_100168331 Ga0070686_1001683312 218
509 3300005545 Ga0070695_100060072 Ga0070695_1000600722 218
510 3300005545 Ga0070695_100196446 Ga0070695_1001964462 218
511 3300005546 Ga0070696_100154084 Ga0070696_1001540842 218
512 3300005548 Ga0070665_100105216 Ga0070665_1001052162 218
513 3300005549 Ga0070704_100462978 Ga0070704_1004629781 218
514 3300005564 Ga0070664_100094606 Ga0070664_1000946063 218
515 3300005577 Ga0068857_100231978 Ga0068857_1002319782 218
516 3300005578 Ga0068854_100076078 Ga0068854_1000760782 218
517 3300005578 Ga0068854_100263338 Ga0068854_1002633382 218
518 3300005617 Ga0068859_100120850 Ga0068859_1001208502 218
519 3300005617 Ga0068859_100310636 Ga0068859_1003106362 218
520 3300005618 Ga0068864_100009780 Ga0068864_10000978010 218
521 3300005719 Ga0068861_100011809 Ga0068861_1000118095 218
522 3300005719 Ga0068861_100027856 Ga0068861_1000278563 218
523 3300005719 Ga0068861_100285173 Ga0068861_1002851732 218
524 3300005843 Ga0068860_100160847 Ga0068860_1001608472 218
525 3300005844 Ga0068862_100011968 Ga0068862_1000119686 218
526 3300005844 Ga0068862_100738739 Ga0068862_1007387391 218
527 3300006237 Ga0097621_100013953 Ga0097621_1000139533 218
528 3300006358 Ga0068871_100031887 Ga0068871_1000318874 218
529 3300006844 Ga0075428_100349297 Ga0075428_1003492972 218
530 3300006881 Ga0068865_100145726 Ga0068865_1001457262 218
531 3300006931 Ga0097620_100120849 Ga0097620_1001208492 218
532 3300006931 Ga0097620_100310619 Ga0097620_1003106192 218
533 3300009094 Ga0111539_10114236 Ga0111539_101142362 218
534 3300009098 Ga0105245_10297429 Ga0105245_102974292 218
535 3300009148 Ga0105243_10180898 Ga0105243_101808981 218
536 3300009176 Ga0105242_10320475 Ga0105242_103204752 218
537 3300009177 Ga0105248_10033630 Ga0105248_100336303 218
538 3300009177 Ga0105248_10048643 Ga0105248_100486432 218
539 3300009553 Ga0105249_10010278 Ga0105249_100102787 218
540 3300010375 Ga0105239_10450098 Ga0105239_104500981 218
541 3300013297 Ga0157378_10007028 Ga0157378_100070286 218
542 3300013297 Ga0157378_10062821 Ga0157378_100628214 218
543 3300013297 Ga0157378_10205599 Ga0157378_102055992 218
544 3300013306 Ga0163162_11402584 Ga0163162_114025841 218
545 3300013308 Ga0157375_10710596 Ga0157375_107105961 218
546 3300014325 Ga0163163_10011368 Ga0163163_100113686 218
547 3300014325 Ga0163163_10049931 Ga0163163_100499313 218
548 3300014326 Ga0157380_10008445 Ga0157380_100084454 218
549 3300014326 Ga0157380_10072483 Ga0157380_100724833 218
550 3300014326 Ga0157380_10088678 Ga0157380_100886781 218
551 3300014745 Ga0157377_10023493 Ga0157377_100234933 218
552 3300014968 Ga0157379_10123026 Ga0157379_101230262 218
553 3300014969 Ga0157376_10378801 Ga0157376_103788012 218
554 3300014969 Ga0157376_10419179 Ga0157376_104191792 218
555 3300025910 Ga0207684_10163094 Ga0207684_101630942 218
556 3300025918 Ga0207662_10012804 Ga0207662_100128042 218
557 3300025923 Ga0207681_10066022 Ga0207681_100660222 218
558 3300025925 Ga0207650_10109313 Ga0207650_101093132 218
559 3300025925 Ga0207650_10284223 Ga0207650_102842231 218
560 3300025927 Ga0207687_10218709 Ga0207687_102187092 218
561 3300025931 Ga0207644_10226816 Ga0207644_102268162 218
562 3300025932 Ga0207690_10287949 Ga0207690_102879491 218
563 3300025933 Ga0207706_10060196 Ga0207706_100601963 218
564 3300025935 Ga0207709_10765350 Ga0207709_107653501 218
565 3300025937 Ga0207669_10419135 Ga0207669_104191352 218
566 3300025940 Ga0207691_10170346 Ga0207691_101703463 218
567 3300025941 Ga0207711_10154903 Ga0207711_101549032 218
568 3300025941 Ga0207711_10212680 Ga0207711_102126802 218
569 3300025942 Ga0207689_10075394 Ga0207689_100753942 218
570 3300025960 Ga0207651_10110530 Ga0207651_101105302 218
571 3300025960 Ga0207651_10828142 Ga0207651_108281421 218
572 3300025961 Ga0207712_10342703 Ga0207712_103427032 218
573 3300025981 Ga0207640_10185052 Ga0207640_101850522 218
574 3300025981 Ga0207640_10329284 Ga0207640_103292842 218
575 3300026023 Ga0207677_10089882 Ga0207677_100898822 218
576 3300026075 Ga0207708_10006300 Ga0207708_100063006 218
577 3300026075 Ga0207708_10185306 Ga0207708_101853062 218
578 3300026089 Ga0207648_10257454 Ga0207648_102574542 218
579 3300026116 Ga0207674_10446102 Ga0207674_104461022 218
580 3300026118 Ga0207675_100006780 Ga0207675_1000067804 218
581 3300026118 Ga0207675_100064591 Ga0207675_1000645913 218
582 3300026118 Ga0207675_100368885 Ga0207675_1003688852 218
583 3300027907 Ga0207428_10050348 Ga0207428_100503482 218
584 3300028380 Ga0268265_10047558 Ga0268265_100475583 218
585 3300028381 Ga0268264_10087510 Ga0268264_100875102 218
586 3300031731 Ga0307405_10042653 Ga0307405_100426532 218
587 3300032002 Ga0307416_100924860 Ga0307416_1009248602 218
588 3300037853 Ga0436364_1457132 Ga0436364_1457132_885_1592 218
589 3300042015 Ga0439462_0087909 Ga0439462_0087909_141_809 218
590 3300046473 Ga0495582_0123882 Ga0495582_0123882_676_1446 218
591 3300050510 nmdc:mga06r32_782745_c1 nmdc:mga06r32_782745_c1_11_727 218
592 3300050511 nmdc:mga08y16_142706_c1 nmdc:mga08y16_142706_c1_970_1665 218
593 2162886007 SwRhRL2b_contig_699995 SwRhRL2b_0499.00007300 219
594 3300003203 JGI25406J46586_10075459 JGI25406J46586_100754592 219
595 3300005289 Ga0065704_10075225 Ga0065704_100752258 219
596 3300005295 Ga0065707_10007244 Ga0065707_100072447 219
597 3300005331 Ga0070670_100188623 Ga0070670_1001886232 219
598 3300005331 Ga0070670_100301303 Ga0070670_1003013032 219
599 3300005331 Ga0070670_100604196 Ga0070670_1006041961 219
600 3300005334 Ga0068869_100047108 Ga0068869_1000471083 219
601 3300005334 Ga0068869_100240009 Ga0068869_1002400091 219
602 3300005334 Ga0068869_100917290 Ga0068869_1009172901 219
603 3300005336 Ga0070680_100199240 Ga0070680_1001992402 219
604 3300005337 Ga0070682_100071595 Ga0070682_1000715953 219
605 3300005338 Ga0068868_100036004 Ga0068868_1000360041 219
606 3300005339 Ga0070660_100055252 Ga0070660_1000552522 219
607 3300005340 Ga0070689_100005379 Ga0070689_1000053798 219
608 3300005340 Ga0070689_100030638 Ga0070689_1000306383 219
609 3300005341 Ga0070691_10112000 Ga0070691_101120001 219
610 3300005344 Ga0070661_100013512 Ga0070661_1000135123 219
611 3300005345 Ga0070692_10096350 Ga0070692_100963502 219
612 3300005347 Ga0070668_100586531 Ga0070668_1005865311 219
613 3300005353 Ga0070669_100053620 Ga0070669_1000536202 219
614 3300005353 Ga0070669_100244719 Ga0070669_1002447192 219
615 3300005355 Ga0070671_100010870 Ga0070671_1000108704 219
616 3300005364 Ga0070673_100401037 Ga0070673_1004010372 219
617 3300005366 Ga0070659_100009251 Ga0070659_1000092514 219
618 3300005438 Ga0070701_10123090 Ga0070701_101230902 219
619 3300005441 Ga0070700_100037529 Ga0070700_1000375293 219
620 3300005445 Ga0070708_100008524 Ga0070708_1000085244 219
621 3300005457 Ga0070662_100087889 Ga0070662_1000878892 219
622 3300005457 Ga0070662_100847908 Ga0070662_1008479081 219
623 3300005458 Ga0070681_10037839 Ga0070681_100378392 219
624 3300005459 Ga0068867_100021246 Ga0068867_1000212462 219
625 3300005467 Ga0070706_100015492 Ga0070706_1000154924 219
626 3300005467 Ga0070706_100154266 Ga0070706_1001542662 219
627 3300005468 Ga0070707_100079132 Ga0070707_1000791323 219
628 3300005471 Ga0070698_100033195 Ga0070698_1000331954 219
629 3300005518 Ga0070699_100016622 Ga0070699_1000166224 219
630 3300005530 Ga0070679_100040983 Ga0070679_1000409832 219
631 3300005536 Ga0070697_100313858 Ga0070697_1003138581 219
632 3300005539 Ga0068853_100017537 Ga0068853_1000175372 219
633 3300005545 Ga0070695_100348500 Ga0070695_1003485002 219
634 3300005546 Ga0070696_100518192 Ga0070696_1005181921 219
635 3300005563 Ga0068855_100168180 Ga0068855_1001681803 219
636 3300005564 Ga0070664_100001208 Ga0070664_10000120815 219
637 3300005577 Ga0068857_100001249 Ga0068857_1000012492 219
638 3300005577 Ga0068857_100279441 Ga0068857_1002794413 219
639 3300005615 Ga0070702_100003806 Ga0070702_1000038065 219
640 3300005615 Ga0070702_100031429 Ga0070702_1000314292 219
641 3300005616 Ga0068852_100742341 Ga0068852_1007423411 219
642 3300005618 Ga0068864_100057920 Ga0068864_1000579202 219
643 3300005618 Ga0068864_100182502 Ga0068864_1001825022 219
644 3300005718 Ga0068866_10118306 Ga0068866_101183062 219
645 3300005719 Ga0068861_100189915 Ga0068861_1001899152 219
646 3300005840 Ga0068870_10014072 Ga0068870_100140723 219
647 3300005841 Ga0068863_100036585 Ga0068863_1000365855 219
648 3300005841 Ga0068863_100062950 Ga0068863_1000629503 219
649 3300005842 Ga0068858_100210917 Ga0068858_1002109171 219
650 3300005843 Ga0068860_100129750 Ga0068860_1001297502 219
651 3300005843 Ga0068860_100253686 Ga0068860_1002536862 219
652 3300005843 Ga0068860_100335605 Ga0068860_1003356052 219
653 3300005844 Ga0068862_100087027 Ga0068862_1000870273 219
654 3300005844 Ga0068862_100178538 Ga0068862_1001785382 219
655 3300005844 Ga0068862_100730526 Ga0068862_1007305262 219
656 3300005985 Ga0081539_10002508 Ga0081539_1000250810 219
657 3300006237 Ga0097621_100032515 Ga0097621_1000325154 219
658 3300006358 Ga0068871_100008976 Ga0068871_1000089765 219
659 3300006844 Ga0075428_100499377 Ga0075428_1004993772 219
660 3300006852 Ga0075433_10108274 Ga0075433_101082743 219
661 3300006852 Ga0075433_10174455 Ga0075433_101744552 219
662 3300006852 Ga0075433_10179311 Ga0075433_101793112 219
663 3300006852 Ga0075433_10875503 Ga0075433_108755031 219
664 3300006871 Ga0075434_100124658 Ga0075434_1001246582 219
665 3300006871 Ga0075434_100309585 Ga0075434_1003095852 219
666 3300007076 Ga0075435_100024836 Ga0075435_1000248364 219
667 3300009094 Ga0111539_10007031 Ga0111539_100070312 219
668 3300009094 Ga0111539_11180524 Ga0111539_111805241 219
669 3300009098 Ga0105245_10498687 Ga0105245_104986872 219
670 3300009147 Ga0114129_10015480 Ga0114129_100154806 219
671 3300009147 Ga0114129_10478683 Ga0114129_104786832 219
672 3300009147 Ga0114129_10827978 Ga0114129_108279782 219
673 3300009147 Ga0114129_11491569 Ga0114129_114915691 219
674 3300009148 Ga0105243_10176025 Ga0105243_101760253 219
675 3300009174 Ga0105241_10126184 Ga0105241_101261842 219
676 3300009174 Ga0105241_10145910 Ga0105241_101459102 219
677 3300009176 Ga0105242_10070549 Ga0105242_100705493 219
678 3300009177 Ga0105248_10030337 Ga0105248_100303372 219
679 3300009177 Ga0105248_10278088 Ga0105248_102780882 219
680 3300009551 Ga0105238_10002654 Ga0105238_1000265413 219
681 3300009553 Ga0105249_10553056 Ga0105249_105530561 219
682 3300010375 Ga0105239_10049188 Ga0105239_100491881 219
683 3300011119 Ga0105246_10395351 Ga0105246_103953512 219
684 3300013100 Ga0157373_10023272 Ga0157373_100232724 219
685 3300013100 Ga0157373_10052311 Ga0157373_100523112 219
686 3300013102 Ga0157371_10332497 Ga0157371_103324972 219
687 3300013296 Ga0157374_10930778 Ga0157374_109307782 219
688 3300013297 Ga0157378_10008063 Ga0157378_100080635 219
689 3300013306 Ga0163162_10078154 Ga0163162_100781542 219
690 3300013306 Ga0163162_10787373 Ga0163162_107873731 219
691 3300013307 Ga0157372_10238872 Ga0157372_102388722 219
692 3300013307 Ga0157372_11388662 Ga0157372_113886621 219
693 3300014325 Ga0163163_10103299 Ga0163163_101032993 219
694 3300014325 Ga0163163_10186477 Ga0163163_101864772 219
695 3300014325 Ga0163163_10226996 Ga0163163_102269963 219
696 3300014325 Ga0163163_10595755 Ga0163163_105957552 219
697 3300014326 Ga0157380_10684711 Ga0157380_106847112 219
698 3300014745 Ga0157377_10050448 Ga0157377_100504482 219
699 3300014968 Ga0157379_10449990 Ga0157379_104499902 219
700 3300014968 Ga0157379_10573942 Ga0157379_105739422 219
701 3300015262 Ga0182007_10062075 Ga0182007_100620752 219
702 3300017792 Ga0163161_10335628 Ga0163161_103356282 219
703 3300025899 Ga0207642_10149375 Ga0207642_101493751 219
704 3300025903 Ga0207680_10065045 Ga0207680_100650452 219
705 3300025904 Ga0207647_10028782 Ga0207647_100287822 219
706 3300025904 Ga0207647_10060937 Ga0207647_100609373 219
707 3300025908 Ga0207643_10031116 Ga0207643_100311163 219
708 3300025910 Ga0207684_10303875 Ga0207684_103038752 219
709 3300025911 Ga0207654_10371236 Ga0207654_103712362 219
710 3300025912 Ga0207707_10041799 Ga0207707_100417992 219
711 3300025917 Ga0207660_10374362 Ga0207660_103743622 219
712 3300025919 Ga0207657_10138729 Ga0207657_101387292 219
713 3300025920 Ga0207649_10037995 Ga0207649_100379952 219
714 3300025921 Ga0207652_10035361 Ga0207652_100353612 219
715 3300025922 Ga0207646_10355145 Ga0207646_103551451 219
716 3300025923 Ga0207681_10224768 Ga0207681_102247682 219
717 3300025924 Ga0207694_10034546 Ga0207694_100345464 219
718 3300025925 Ga0207650_10089544 Ga0207650_100895443 219
719 3300025926 Ga0207659_10487395 Ga0207659_104873951 219
720 3300025927 Ga0207687_10054774 Ga0207687_100547743 219
721 3300025931 Ga0207644_10053796 Ga0207644_100537962 219
722 3300025932 Ga0207690_10041616 Ga0207690_100416162 219
723 3300025933 Ga0207706_10113310 Ga0207706_101133102 219
724 3300025935 Ga0207709_10204051 Ga0207709_102040512 219
725 3300025935 Ga0207709_10204726 Ga0207709_102047262 219
726 3300025936 Ga0207670_10004999 Ga0207670_100049998 219
727 3300025938 Ga0207704_10045559 Ga0207704_100455591 219
728 3300025941 Ga0207711_10077256 Ga0207711_100772562 219
729 3300025941 Ga0207711_10183591 Ga0207711_101835912 219
730 3300025942 Ga0207689_10030576 Ga0207689_100305762 219
731 3300025945 Ga0207679_10060003 Ga0207679_100600033 219
732 3300025981 Ga0207640_10050988 Ga0207640_100509883 219
733 3300026035 Ga0207703_10298791 Ga0207703_102987912 219
734 3300026035 Ga0207703_10479728 Ga0207703_104797282 219
735 3300026041 Ga0207639_10160976 Ga0207639_101609762 219
736 3300026075 Ga0207708_10006438 Ga0207708_1000643810 219
737 3300026075 Ga0207708_10114058 Ga0207708_101140581 219
738 3300026088 Ga0207641_10273772 Ga0207641_102737722 219
739 3300026089 Ga0207648_10006728 Ga0207648_100067285 219
740 3300026095 Ga0207676_10028127 Ga0207676_100281273 219
741 3300026095 Ga0207676_10158639 Ga0207676_101586392 219
742 3300026095 Ga0207676_10343720 Ga0207676_103437202 219
743 3300026116 Ga0207674_10000023 Ga0207674_10000023108 219
744 3300026116 Ga0207674_10282694 Ga0207674_102826942 219
745 3300026116 Ga0207674_10636113 Ga0207674_106361132 219
746 3300026116 Ga0207674_10886500 Ga0207674_108865001 219
747 3300026118 Ga0207675_100004103 Ga0207675_1000041033 219
748 3300026118 Ga0207675_100045073 Ga0207675_1000450735 219
749 3300026118 Ga0207675_100134976 Ga0207675_1001349762 219
750 3300027907 Ga0207428_10022748 Ga0207428_100227482 219
751 3300028380 Ga0268265_10027886 Ga0268265_100278863 219
752 3300028381 Ga0268264_10074852 Ga0268264_100748522 219
753 3300032005 Ga0307411_10102439 Ga0307411_101024392 219
754 3300037418 Ga0395900_0743959 Ga0395900_0743959_21_704 219
755 3300045051 Ga0451576_0753635 Ga0451576_0753635_49_717 219
756 3300049514 Ga0501291_001644 Ga0501291_001644_1283_1948 219
757 3300049519 Ga0501296_001023 Ga0501296_001023_578_1243 219
758 3300049521 Ga0501298_000778 Ga0501298_000778_2145_2810 219
759 3300049522 Ga0501299_000882 Ga0501299_000882_1786_2451 219
760 3300049523 Ga0501300_011593 Ga0501300_011593_360_1025 219
761 3300049574 Ga0501038_0014457 Ga0501038_0014457_3387_4052 219
762 3300049649 Ga0501198_011262 Ga0501198_011262_531_1202 219
763 3300049651 Ga0501201_004910 Ga0501201_004910_408_1073 219
764 3300049654 Ga0501207_017838 Ga0501207_017838_192_863 219
765 3300049664 Ga0501224_009323 Ga0501224_009323_513_1178 219
766 3300049668 Ga0501233_003689 Ga0501233_003689_576_1241 219
767 3300049669 Ga0501235_014538 Ga0501235_014538_1029_1694 219
768 3300049683 Ga0501253_016574 Ga0501253_016574_137_808 219
769 3300049685 Ga0501256_004780 Ga0501256_004780_320_985 219
770 3300049688 Ga0501259_020974 Ga0501259_020974_97_762 219
771 3300049689 Ga0501260_000313 Ga0501260_000313_1112_1777 219
772 3300049705 Ga0501225_0028764 Ga0501225_0028764_534_1199 219
773 3300049770 Ga0501273_010615 Ga0501273_010615_179_850 219
774 3300049774 Ga0501278_008763 Ga0501278_008763_28_699 219
775 3300049775 Ga0501279_005537 Ga0501279_005537_218_883 219
776 3300049779 Ga0501283_001160 Ga0501283_001160_1585_2250 219
777 3300050507 nmdc:mga05p37_28431_c1 nmdc:mga05p37_28431_c1_1115_1834 219
778 3300050507 nmdc:mga05p37_321050_c1 nmdc:mga05p37_321050_c1_73_732 219
779 3300050508 nmdc:mga09592_22546_c1 nmdc:mga09592_22546_c1_4235_4954 219
780 3300050511 nmdc:mga08y16_32049_c1 nmdc:mga08y16_32049_c1_79_738 219
781 3300050512 nmdc:mga0n895_154635_c1 nmdc:mga0n895_154635_c1_1541_2209 219
782 3300050512 nmdc:mga0n895_245626_c1 nmdc:mga0n895_245626_c1_816_1475 219
783 3300050512 nmdc:mga0n895_365691_c1 nmdc:mga0n895_365691_c1_81_749 219
784 3300050513 nmdc:mga0rr50_11606_c1 nmdc:mga0rr50_11606_c1_2178_2846 219
785 3300050515 nmdc:mga0a205_35711_c1 nmdc:mga0a205_35711_c1_3254_3913 219
786 3300050515 nmdc:mga0a205_55034_c1 nmdc:mga0a205_55034_c1_1346_2014 219
787 3300050515 nmdc:mga0a205_695023_c1 nmdc:mga0a205_695023_c1_163_831 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

51

97

0.97

PF17932

TetR_C_24

Tetracyclin repressor-like, C-terminal domain

116

226

0.96

PF08359

TetR_C_4

YsiA-like protein, C-terminal region

98

225

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ccy-assembly1.cif.gz_A-2 crystal structure of a tetr-family transcriptional regulator from bordetella parapertussis 12822 0.9164 4 187
4w97-assembly1.cif.gz_A structure of ketosteroid transcriptional regulator kstr2 of mycobacterium tuberculosis 0.9013 5 189
3vpr-assembly2.cif.gz_C crystal structure of a tetr family transcriptional regulator pfmr from thermus thermophilus hb8 0.8817 11 186
3him-assembly1.cif.gz_A the crystal structure of a bacterial regulatory protein in the tetr family from rhodococcus rha1 to 2.2a 0.8796 5 187
5k7z-assembly2.cif.gz_C crystal structure of aibr in complex with isovaleryl coenzyme a and operator dna 0.8768 6 185
ID Description Score Start End Superfamily
2eh3A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9769 7 53 1.10.10.60
1jtyA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9618 6 53 1.10.10.60
3btlA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9587 6 53 1.10.10.60
3btjA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9586 6 53 1.10.10.60
1qvuA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9585 6 53 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A2E7Y6E4-F1-model_v4 HTH tetR-type domain-containing protein 0.9686 7 192 GO:0000976
GO:0003700
AF-A0A838RV32-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9569 2 181 GO:0000976
GO:0003700
AF-A0A1F2UTL5-F1-model_v4 HTH tetR-type domain-containing protein 0.9546 4 190 GO:0000976
GO:0003700
AF-A0A0S8H224-F1-model_v4 HTH tetR-type domain-containing protein 0.9531 6 196 GO:0000976
GO:0003700
AF-Q565X7-F1-model_v4 TetR-family transcriptional regulator 0.9524 4 196 GO:0000976
GO:0003700

Feature Viewer

pLDDT pTM Quality
83.16 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map