F480862

General Info

Members Datasets Scaffolds Average Seq Length
788 553 1576 330

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100057722|Ga0070704_1000577222
Length 390
Sequence VPHTRFVRGLGERGGHFWAPAYKIMLRARIIATGMSVPEPVVTNELLSRCMSTSDEWITQRTGIRERRMSPDTYRMLLRLAEAPDKPAFMREVRDRGLDGQIDSSLTVTDLALEASRMALKHAGIAAEDLDCIIQSSTLPDLAYPAPGCVMQGRLGLTSTPVFNLAQGCAGFVYGLALADQLIRGGMYRRVLVVGAELLSSAFDYTDEGRDMAVLFADGAGAAVLEAVETDAVRPRGLISHHLHSDGSALDALYGEMWGSSTFPPVSKKKIDDGRTRPRMNGRAVFVNAVRRVREVVQECLDANGLRAADVDCYLFHQANLRIIEAAAEHFQIPAERYFNNLDRYGNTAGASVPICLHEALSEARIKDGDLVMLVAFGTGFSWGATLLRW

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
70 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
72 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
73 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
109 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
114 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
117 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
129 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
136 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
139 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
149 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
150 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
189 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
192 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
228 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
229 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
230 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
240 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
241 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
244 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
245 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
246 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
250 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
251 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
252 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
253 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
254 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
255 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
256 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
257 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
258 2512875024
259 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
260 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
261 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
262 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
263 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
264 2534681786 Brucella suis 92/29 Isolate Unclassified
265 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
266 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
267 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
268 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
269 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
270 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
271 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
272 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
273 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
274 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
275 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
276 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
277 2643221719 Rhizobium sp. Root274 Isolate Unclassified
278 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
279 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
280 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
281 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
282 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
283 2738543024 Aminobacter sp. AP02 Isolate Unclassified
284 2751185800 Brucella pituitosa AA2 Isolate Unclassified
285 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
286 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
287 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
288 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
289 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
290 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
291 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
292 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
293 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
294 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
295 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
296 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
297 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
298 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
299 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
300 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
301 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
302 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
303 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
304 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
305 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
306 2854911287 Brucella lupini LUP21 Isolate Unclassified
307 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
308 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
309 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
310 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
311 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
312 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
313 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
314 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
315 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
316 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
317 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
318 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
319 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
320 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
321 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
322 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
323 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
324 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
325 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
326 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
327 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
328 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
329 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
330 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
331 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
332 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
333 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
334 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
335 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
336 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
337 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
338 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
339 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
340 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
341 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
342 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
343 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
344 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
345 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
346 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
347 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
348 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
349 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
350 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
351 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
352 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
353 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
354 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
355 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
356 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
357 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
358 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
359 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
360 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
361 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
362 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
363 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
364 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
365 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
366 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
367 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
368 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
369 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
370 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
371 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
372 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
373 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
374 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
375 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
376 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
377 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
378 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
379 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
380 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
381 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
382 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
383 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
384 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
385 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
386 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
387 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
388 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
389 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
390 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
391 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
392 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
393 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
394 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
395 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
396 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
397 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
398 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
399 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
400 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
401 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
402 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
403 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
404 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
405 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
406 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
407 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
408 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
409 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
410 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
411 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
412 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
413 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
414 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
415 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
416 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
417 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
418 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
419 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
420 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
421 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
422 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
423 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
424 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
425 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
426 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
427 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
428 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
429 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
430 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
431 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
432 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
433 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
434 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
435 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
436 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
437 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
438 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
439 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
440 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
441 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
442 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
443 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
444 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
445 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
446 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
447 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
448 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
449 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
450 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
451 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
452 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
453 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
454 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
455 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
456 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
457 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
458 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
459 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
460 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
461 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
462 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
463 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
464 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
465 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
466 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
467 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
468 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
469 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
470 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
471 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
472 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
473 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
474 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
475 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
476 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
477 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
478 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
479 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
480 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
481 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
482 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
483 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
484 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
485 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
486 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
487 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
488 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
489 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
490 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
491 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
492 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
493 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
494 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
495 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
496 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
497 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
498 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
499 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
500 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
501 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
502 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
503 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
504 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
505 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
506 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
507 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
508 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
509 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
510 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
511 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
512 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
513 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
514 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
515 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
516 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
517 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
518 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
519 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
520 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
521 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
522 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
523 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
524 3004167301 Mesorhizobium loti 582 Isolate Unclassified
525 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
526 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
527 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
528 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
529 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
530 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
531 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
532 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
533 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
534 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
535 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
536 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
537 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
538 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
539 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
540 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
541 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
542 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
543 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
544 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
545 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
546 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
547 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
548 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
549 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
550 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
551 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
552 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
553 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 60.91
Metatranscriptomes 0.38
Isolates 38.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.43
Nodule 29.19
Rhizoplane 1.02
Rhizosphere 56.22
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_100057722 3300005549 Bacteria 2761
2 JGI24740J21852_10007842 3300001979 Bacteria 4308
3 JGI24735J21928_10001139 3300002067 Bacteria 9487
4 JGI25157J39369_1000849 3300002741 Bacteria 15049
5 JGI25165J46597_1000219 3300003214 Bacteria 79946
6 rootH2_10025044 3300003320 Bacteria 3625
7 rootH1_10012854 3300003323 Bacteria 4783
8 Ga0006562J51391_1008400 3300003578 Bacteria 5010
9 Ga0055542_1000572 3300003762 Bacteria 32254
10 Ga0055529_1003128 3300003763 Bacteria 2864
11 Ga0058859_11785646 3300004798 Bacteria 5091
12 Ga0058860_11846802 3300004801 Bacteria 1401
13 Ga0065165_1001977 3300005262 Bacteria 19345
14 Ga0065704_10114003 3300005289 Bacteria 1901
15 Ga0065707_10130544 3300005295 Bacteria 1928
16 Ga0070676_10223955 3300005328 Bacteria 1244
17 Ga0068869_100008715 3300005334 Bacteria 6550
18 Ga0070682_100003380 3300005337 Bacteria 8849
19 Ga0070668_100149088 3300005347 Bacteria 1890
20 Ga0070668_100173088 3300005347 Bacteria 1759
21 Ga0070674_100061115 3300005356 Bacteria 2628
22 Ga0070714_100000144 3300005435 Bacteria 57133
23 Ga0070713_100138922 3300005436 Bacteria 2150
24 Ga0070694_100155277 3300005444 Bacteria 1675
25 Ga0070708_100008304 3300005445 Bacteria 8339
26 Ga0070708_100101575 3300005445 Bacteria 2634
27 Ga0068867_100080138 3300005459 Bacteria 2458
28 Ga0070706_100008474 3300005467 Bacteria 9578
29 Ga0070706_100193585 3300005467 Bacteria 1900
30 Ga0070706_100212818 3300005467 Unclassified 1805
31 Ga0070707_100004103 3300005468 Bacteria 13680
32 Ga0070707_100032977 3300005468 Bacteria 4936
33 Ga0070707_100128562 3300005468 Bacteria 2462
34 Ga0070698_100048437 3300005471 Bacteria 4342
35 Ga0070698_100088332 3300005471 Bacteria 3085
36 Ga0070698_100103437 3300005471 Bacteria 2818
37 Ga0070698_100140372 3300005471 Bacteria 2368
38 Ga0070699_100041963 3300005518 Bacteria 3958
39 Ga0070699_100042416 3300005518 Bacteria 3937
40 Ga0070697_100289025 3300005536 Unclassified 1408
41 Ga0070695_100001839 3300005545 Bacteria 11964
42 Ga0070696_100008411 3300005546 Bacteria 6904
43 Ga0070665_100003727 3300005548 Bacteria 16137
44 Ga0070665_100159776 3300005548 Bacteria 2255
45 Ga0068855_100065026 3300005563 Bacteria 4252
46 Ga0068855_100113372 3300005563 Bacteria 3110
47 Ga0070664_100118887 3300005564 Unclassified 2312
48 Ga0068857_100304351 3300005577 Bacteria 1470
49 Ga0068854_100089153 3300005578 Bacteria 2292
50 Ga0068856_100200983 3300005614 Bacteria 2007
51 Ga0068852_100094392 3300005616 Bacteria 2683
52 Ga0068859_100460918 3300005617 Bacteria 1367
53 Ga0068860_100017606 3300005843 Bacteria 6961
54 Ga0068860_100033861 3300005843 Bacteria 4902
55 Ga0068862_100010573 3300005844 Bacteria 7627
56 Ga0068862_100026271 3300005844 Bacteria 4894
57 Ga0081455_10000829 3300005937 Bacteria 39780
58 Ga0081455_10012592 3300005937 Bacteria 8430
59 Ga0081538_10002229 3300005981 Bacteria 19200
60 Ga0081538_10002703 3300005981 Bacteria 17055
61 Ga0075365_10002014 3300006038 Bacteria 9638
62 Ga0075365_10087327 3300006038 Bacteria 2120
63 Ga0075363_100028371 3300006048 Bacteria 2878
64 Ga0070715_10124045 3300006163 Bacteria 1235
65 Ga0070716_100019012 3300006173 Bacteria 3587
66 Ga0070712_100003421 3300006175 Bacteria 9763
67 Ga0075362_10019633 3300006177 Bacteria 2813
68 Ga0075367_10019474 3300006178 Bacteria 3764
69 Ga0068871_100064668 3300006358 Unclassified 2995
70 Ga0075428_100042448 3300006844 Bacteria 5000
71 Ga0075431_100090019 3300006847 Bacteria 3167
72 Ga0075431_100108453 3300006847 Bacteria 2865
73 Ga0075431_100273127 3300006847 Bacteria 1713
74 Ga0075434_100020904 3300006871 Bacteria 6355
75 Ga0075434_100314766 3300006871 Bacteria 1586
76 Ga0068865_100096498 3300006881 Bacteria 2156
77 Ga0097620_100460863 3300006931 Bacteria 1367
78 Ga0075435_100000577 3300007076 Bacteria 22442
79 Ga0099794_10103089 3300007265 Unclassified 1425
80 Ga0111539_10024445 3300009094 Bacteria 7412
81 Ga0111539_10164656 3300009094 Bacteria 2593
82 Ga0111539_10550105 3300009094 Bacteria 1344
83 Ga0105245_10041733 3300009098 Bacteria 4090
84 Ga0105245_10202004 3300009098 Bacteria 1909
85 Ga0114129_10000977 3300009147 Bacteria 37424
86 Ga0114129_10355517 3300009147 Bacteria 1939
87 Ga0114129_10448952 3300009147 Bacteria 1691
88 Ga0114129_10610156 3300009147 Bacteria 1413
89 Ga0105241_10042991 3300009174 Bacteria 3421
90 Ga0105249_10060995 3300009553 Bacteria 3460
91 Ga0105239_10159253 3300010375 Bacteria 2522
92 Ga0105246_10222363 3300011119 Bacteria 1481
93 Ga0157378_10317029 3300013297 Bacteria 1514
94 Ga0163162_10000446 3300013306 Bacteria 38191
95 Ga0163162_10463863 3300013306 Bacteria 1398
96 Ga0163162_10627519 3300013306 Bacteria 1199
97 Ga0209026_1000002 3300025250 Bacteria 1136158
98 Ga0209148_1000038 3300025254 Bacteria 493744
99 Ga0209759_1000156 3300025256 Bacteria 117222
100 Ga0209233_1000258 3300025261 Bacteria 80118
101 Ga0209233_1009319 3300025261 Bacteria 2993
102 Ga0209233_1011172 3300025261 Bacteria 2654
103 Ga0209455_1000376 3300025272 Bacteria 40749
104 Ga0209758_1008950 3300025297 Bacteria 6343
105 Ga0207680_10035673 3300025903 Bacteria 2857
106 Ga0207647_10008543 3300025904 Bacteria 7333
107 Ga0207685_10046411 3300025905 Bacteria 1653
108 Ga0207684_10007744 3300025910 Bacteria 9617
109 Ga0207695_10494764 3300025913 Bacteria 1105
110 Ga0207671_10014553 3300025914 Bacteria 6210
111 Ga0207671_10179387 3300025914 Bacteria 1647
112 Ga0207646_10015361 3300025922 Bacteria 7233
113 Ga0207646_10055940 3300025922 Bacteria 3527
114 Ga0207694_10010009 3300025924 Bacteria 7147
115 Ga0207687_10036370 3300025927 Bacteria 3354
116 Ga0207687_10158394 3300025927 Bacteria 1735
117 Ga0207664_10000494 3300025929 Bacteria 28084
118 Ga0207709_10201684 3300025935 Bacteria 1421
119 Ga0207665_10046375 3300025939 Bacteria 2912
120 Ga0207665_10136885 3300025939 Bacteria 1743
121 Ga0207689_10007335 3300025942 Bacteria 9671
122 Ga0207679_10164765 3300025945 Unclassified 1819
123 Ga0207667_10261796 3300025949 Bacteria 1768
124 Ga0207667_10266432 3300025949 Bacteria 1752
125 Ga0207712_10096398 3300025961 Bacteria 2189
126 Ga0207668_10103788 3300025972 Bacteria 2118
127 Ga0207640_10041060 3300025981 Bacteria 2940
128 Ga0207639_10042288 3300026041 Bacteria 3414
129 Ga0207639_10112174 3300026041 Bacteria 2224
130 Ga0207708_10161633 3300026075 Bacteria 1769
131 Ga0207702_10223646 3300026078 Bacteria 1755
132 Ga0207702_10294481 3300026078 Bacteria 1538
133 Ga0207641_10010425 3300026088 Bacteria 7637
134 Ga0207648_10097245 3300026089 Bacteria 2576
135 Ga0207648_10190385 3300026089 Bacteria 1818
136 Ga0207683_10094039 3300026121 Bacteria 2671
137 Ga0209813_10025597 3300027866 Bacteria 1699
138 Ga0207428_10033649 3300027907 Bacteria 4207
139 Ga0207428_10165991 3300027907 Bacteria 1674
140 Ga0268266_10054796 3300028379 Bacteria 3427
141 Ga0268266_10298381 3300028379 Bacteria 1502
142 Ga0268265_10013573 3300028380 Bacteria 5538
143 Ga0268264_10000558 3300028381 Bacteria 45913
144 Ga0268264_10041618 3300028381 Bacteria 3802
145 Ga0307515_10000056 3300028794 Bacteria 261973
146 Ga0265325_10060496 3300031241 Bacteria 1924
147 Ga0265313_10042643 3300031595 Bacteria 2227
148 Ga0265314_10006793 3300031711 Bacteria 10032
149 Ga0316576_10000975 3300031727 Bacteria 14705
150 Ga0316577_10001094 3300031733 Bacteria 12294
151 Ga0307413_10095618 3300031824 Bacteria 1948
152 Ga0307412_10000131 3300031911 Bacteria 54361
153 Ga0307416_100114071 3300032002 Bacteria 2390
154 Ga0373926_0039620 3300035083 Bacteria 1680
155 Ga0373923_0001019 3300035111 Bacteria 7610
156 Ga0373936_0000230 3300035113 Bacteria 18464
157 Ga0373945_0001082 3300035116 Bacteria 8196
158 Ga0373953_0000282 3300035117 Bacteria 14066
159 Ga0373954_0000163 3300035118 Bacteria 23852
160 Ga0373943_0080606 3300035170 Bacteria 1668
161 Ga0373946_0000412 3300035171 Bacteria 13925
162 Ga0373955_0000071 3300035172 Bacteria 40941
163 Ga0373924_0002670 3300035410 Bacteria 6013
164 Ga0373935_0001582 3300035692 Bacteria 12695
165 Ga0373927_0001396 3300035695 Bacteria 18191
166 Ga0373933_0002030 3300035724 Bacteria 11646
167 Ga0373947_0001895 3300035725 Bacteria 12777
168 Ga0373937_0000162 3300036401 Bacteria 64742
169 Ga0373937_0317528 3300036401 Bacteria 1474
170 Ga0316582_0064163 3300036647 Bacteria 2362
171 Ga0316584_0082462 3300036712 Bacteria 2409
172 Ga0373925_0000025 3300037068 Bacteria 154937
173 Ga0395900_0029285 3300037418 Bacteria 5649
174 Ga0395900_0054140 3300037418 Bacteria 4131
175 Ga0395898_0031042 3300037466 Bacteria 5344
176 Ga0395905_0000995 3300037471 Bacteria 36267
177 Ga0395905_0001481 3300037471 Bacteria 28106
178 Ga0395905_0027828 3300037471 Bacteria 5330
179 Ga0395905_0079042 3300037471 Bacteria 3083
180 Ga0395905_0152442 3300037471 Bacteria 2174
181 Ga0395905_0550889 3300037471 Bacteria 1054
182 Ga0395901_0221571 3300038443 Bacteria 1977
183 Ga0395901_0223331 3300038443 Bacteria 1968
184 Ga0439450_000521 3300042008 Bacteria 5010
185 Ga0439463_001336 3300042016 Bacteria 6574
186 Ga0451577_0001676 3300042876 Bacteria 28603
187 Ga0451577_0001818 3300042876 Bacteria 27291
188 Ga0451577_0002212 3300042876 Bacteria 23681
189 Ga0451577_0028398 3300042876 Bacteria 5059
190 Ga0451577_0095980 3300042876 Bacteria 2647
191 Ga0466972_0053238 3300044658 Bacteria 1949
192 Ga0453683_0001036 3300044673 Bacteria 26046
193 Ga0453683_0002536 3300044673 Bacteria 14094
194 Ga0453683_0010466 3300044673 Bacteria 6145
195 Ga0453683_0077158 3300044673 Bacteria 2086
196 Ga0453683_0120393 3300044673 Bacteria 1652
197 Ga0453683_0209860 3300044673 Bacteria 1237
198 Ga0453684_0000066 3300044712 Bacteria 465545
199 Ga0453684_0001327 3300044712 Bacteria 72967
200 Ga0453684_0003490 3300044712 Bacteria 35318
201 Ga0453684_0016384 3300044712 Bacteria 11595
202 Ga0453684_0021711 3300044712 Bacteria 9571
203 Ga0453684_0037244 3300044712 Bacteria 6679
204 Ga0453684_0102182 3300044712 Bacteria 3505
205 Ga0453684_0221830 3300044712 Bacteria 2189
206 Ga0453684_0370119 3300044712 Bacteria 1611
207 Ga0466960_0036087 3300044901 Bacteria 2314
208 Ga0451576_0007592 3300045051 Bacteria 12919
209 Ga0451576_0146542 3300045051 Bacteria 2461
210 Ga0451576_0169544 3300045051 Bacteria 2278
211 Ga0451576_0376490 3300045051 Bacteria 1488
212 Ga0451576_0401818 3300045051 Bacteria 1436
213 Ga0495592_0000132 3300046454 Bacteria 66310
214 Ga0495638_0183332 3300046460 Bacteria 1193
215 Ga0495651_0000308 3300046462 Bacteria 38022
216 Ga0495653_0000041 3300046463 Bacteria 118366
217 Ga0495582_0032493 3300046473 Bacteria 2869
218 Ga0495662_0003042 3300046476 Bacteria 8456
219 Ga0495664_0000005 3300046477 Bacteria 439635
220 Ga0495607_0071860 3300046501 Bacteria 1928
221 Ga0495608_0000003 3300046511 Bacteria 369831
222 Ga0495608_0001600 3300046511 Bacteria 16214
223 Ga0495610_0030806 3300046512 Bacteria 2805
224 Ga0495618_0000010 3300046514 Bacteria 189314
225 Ga0495620_0087605 3300046515 Bacteria 1252
226 Ga0495628_0000019 3300046516 Bacteria 154435
227 Ga0495628_0079751 3300046516 Bacteria 2545
228 Ga0495630_0016988 3300046517 Bacteria 5326
229 Ga0495643_0019534 3300046522 Bacteria 3918
230 Ga0495652_0000028 3300046529 Bacteria 157336
231 Ga0495665_0029847 3300046531 Bacteria 2920
232 Ga0495640_0000014 3300046533 Bacteria 161741
233 Ga0495587_0000026 3300046536 Bacteria 147819
234 Ga0495645_0000005 3300046543 Bacteria 443917
235 Ga0495667_0000003 3300046559 Bacteria 295404
236 Ga0495667_0001691 3300046559 Bacteria 14642
237 Ga0495667_0099095 3300046559 Bacteria 1887
238 Ga0495668_0098708 3300046616 Bacteria 1598
239 Ga0495634_0000017 3300046642 Bacteria 122411
240 Ga0495625_0083324 3300046660 Bacteria 2223
241 Ga0495625_0172444 3300046660 Bacteria 1444
242 Ga0495635_0000024 3300046663 Bacteria 148235
243 Ga0495657_0000034 3300046675 Bacteria 122360
244 Ga0495599_0000017 3300046678 Bacteria 162507
245 Ga0495623_0000028 3300046679 Bacteria 87634
246 Ga0495646_0000015 3300046680 Bacteria 141718
247 Ga0495624_0070657 3300046690 Bacteria 2173
248 Ga0495600_0000058 3300046809 Bacteria 65689
249 Ga0495581_0001732 3300047315 Bacteria 12161
250 Ga0495604_0000021 3300047317 Bacteria 169432
251 Ga0495674_0000005 3300047319 Bacteria 375129
252 Ga0495680_0000503 3300047322 Bacteria 44080
253 Ga0495675_0000085 3300047444 Bacteria 65846
254 Ga0495684_0000001 3300047471 Bacteria 369809
255 Ga0495593_0001873 3300047673 Bacteria 12527
256 Ga0495602_0000003 3300048088 Bacteria 357240
257 Ga0496102_0370096 3300048905 Bacteria 1349
258 Ga0496106_0233848 3300048909 Bacteria 1468
259 Ga0496110_0140347 3300048913 Bacteria 2185
260 Ga0496112_0008399 3300048915 Bacteria 9249
261 Ga0496116_0009549 3300048919 Bacteria 8261
262 Ga0496116_0117828 3300048919 Bacteria 1544
263 Ga0496118_0113767 3300048921 Bacteria 1786
264 Ga0496119_0009046 3300048922 Bacteria 8632
265 Ga0496119_0031911 3300048922 Bacteria 3520
266 Ga0496120_0001687 3300048923 Bacteria 25349
267 Ga0496120_0007399 3300048923 Bacteria 8176
268 Ga0496120_0039794 3300048923 Bacteria 2770
269 Ga0496121_0084884 3300048924 Bacteria 2494
270 Ga0496122_0000160 3300048925 Bacteria 159236
271 Ga0496122_0014530 3300048925 Bacteria 7601
272 Ga0496122_0061698 3300048925 Bacteria 2749
273 Ga0496123_0000034 3300048926 Bacteria 274836
274 Ga0496124_0000206 3300048927 Bacteria 116591
275 Ga0496124_0131601 3300048927 Bacteria 1987
276 Ga0496124_0131800 3300048927 Bacteria 1985
277 Ga0496126_0004064 3300048929 Bacteria 17751
278 Ga0501031_0000108 3300049568 Bacteria 44121
279 Ga0501031_0000220 3300049568 Bacteria 32658
280 Ga0501031_0001228 3300049568 Bacteria 15703
281 Ga0501031_0011891 3300049568 Bacteria 5674
282 Ga0501031_0018777 3300049568 Bacteria 4502
283 Ga0501031_0032347 3300049568 Bacteria 3410
284 Ga0501032_0000022 3300049569 Bacteria 146790
285 Ga0501032_0000031 3300049569 Bacteria 130204
286 Ga0501033_0000037 3300049570 Bacteria 146582
287 Ga0501033_0000763 3300049570 Bacteria 29600
288 Ga0501033_0001161 3300049570 Bacteria 23830
289 Ga0501033_0012044 3300049570 Bacteria 6603
290 Ga0501033_0070246 3300049570 Bacteria 2573
291 Ga0501034_0000064 3300049571 Bacteria 189461
292 Ga0501034_0000269 3300049571 Bacteria 94144
293 Ga0501034_0000302 3300049571 Bacteria 87888
294 Ga0501034_0017525 3300049571 Bacteria 7346
295 Ga0501034_0044693 3300049571 Bacteria 4478
296 Ga0501036_0000013 3300049572 Bacteria 155326
297 Ga0501036_0005240 3300049572 Bacteria 10490
298 Ga0501036_0014732 3300049572 Bacteria 6521
299 Ga0501036_0014748 3300049572 Bacteria 6517
300 Ga0501036_0033890 3300049572 Bacteria 4319
301 Ga0501036_0041544 3300049572 Bacteria 3890
302 Ga0501036_0087408 3300049572 Bacteria 2635
303 Ga0501036_0097160 3300049572 Bacteria 2490
304 Ga0501037_0000016 3300049573 Bacteria 161027
305 Ga0501037_0000132 3300049573 Bacteria 69775
306 Ga0501037_0023829 3300049573 Bacteria 4526
307 Ga0501037_0027918 3300049573 Bacteria 4170
308 Ga0501038_0000015 3300049574 Bacteria 161983
309 Ga0501038_0000055 3300049574 Bacteria 93761
310 Ga0501038_0020136 3300049574 Bacteria 6003
311 Ga0501038_0064922 3300049574 Bacteria 3112
312 Ga0501038_0099895 3300049574 Bacteria 2418
313 Ga0501038_0143485 3300049574 Bacteria 1951
314 Ga0501038_0203813 3300049574 Bacteria 1586
315 Ga0501039_0000013 3300049575 Bacteria 234418
316 Ga0501039_0000045 3300049575 Bacteria 104513
317 Ga0501039_0000503 3300049575 Bacteria 28338
318 Ga0501039_0001875 3300049575 Bacteria 15542
319 Ga0501039_0007918 3300049575 Bacteria 8097
320 Ga0501039_0039043 3300049575 Bacteria 3667
321 Ga0501039_0054009 3300049575 Bacteria 3110
322 Ga0501039_0055204 3300049575 Bacteria 3075
323 Ga0501039_0180005 3300049575 Bacteria 1663
324 Ga0501040_0000694 3300049576 Bacteria 20757
325 Ga0501040_0002047 3300049576 Bacteria 12981
326 Ga0501040_0008017 3300049576 Bacteria 6860
327 Ga0501040_0202135 3300049576 Bacteria 1411
328 Ga0501040_0221184 3300049576 Bacteria 1347
329 Ga0501041_0000010 3300049577 Bacteria 59427
330 Ga0501041_0001027 3300049577 Bacteria 15260
331 Ga0501041_0011454 3300049577 Bacteria 5242
332 Ga0501041_0057562 3300049577 Bacteria 2377
333 Ga0501041_0081698 3300049577 Bacteria 1990
334 Ga0501042_0000074 3300049578 Bacteria 37119
335 Ga0501042_0002854 3300049578 Bacteria 10711
336 Ga0501042_0017882 3300049578 Bacteria 4898
337 Ga0501042_0022515 3300049578 Bacteria 4402
338 Ga0501042_0037875 3300049578 Bacteria 3423
339 Ga0501042_0075894 3300049578 Bacteria 2405
340 Ga0501042_0328716 3300049578 Bacteria 1105
341 Ga0501043_0000015 3300049579 Bacteria 175932
342 Ga0501043_0000388 3300049579 Bacteria 39664
343 Ga0501043_0013030 3300049579 Bacteria 6500
344 Ga0501043_0094561 3300049579 Bacteria 2349
345 Ga0501043_0152995 3300049579 Bacteria 1805
346 Ga0501046_0001425 3300049580 Bacteria 23008
347 Ga0501046_0002776 3300049580 Bacteria 16297
348 Ga0501046_0004035 3300049580 Bacteria 13397
349 Ga0501046_0017760 3300049580 Bacteria 5934
350 Ga0501046_0168353 3300049580 Bacteria 1645
351 Ga0501046_0200897 3300049580 Bacteria 1483
352 Ga0501046_0291218 3300049580 Bacteria 1194
353 Ga0501046_0329402 3300049580 Bacteria 1111
354 Ga0501047_0000157 3300049581 Bacteria 82600
355 Ga0501047_0001528 3300049581 Bacteria 22604
356 Ga0501047_0003989 3300049581 Bacteria 13869
357 Ga0501047_0076477 3300049581 Bacteria 3221
358 Ga0501047_0186428 3300049581 Bacteria 1940
359 Ga0501048_0001631 3300049582 Bacteria 17077
360 Ga0501048_0014467 3300049582 Bacteria 5842
361 Ga0501048_0020719 3300049582 Bacteria 4820
362 Ga0501067_0083758 3300049583 Bacteria 1769
363 Ga0501068_0054184 3300049584 Bacteria 2429
364 Ga0501068_0129887 3300049584 Bacteria 1575
365 Ga0501068_0226754 3300049584 Bacteria 1188
366 Ga0501069_0076809 3300049585 Bacteria 1878
367 Ga0501070_0025811 3300049586 Bacteria 4929
368 Ga0501070_0069484 3300049586 Bacteria 2916
369 Ga0501070_0069539 3300049586 Bacteria 2915
370 Ga0501070_0173629 3300049586 Bacteria 1775
371 Ga0501070_0249781 3300049586 Bacteria 1451
372 Ga0501071_0000002 3300049587 Bacteria 101947
373 Ga0501071_0021035 3300049587 Bacteria 4542
374 Ga0501071_0110667 3300049587 Bacteria 2030
375 Ga0501071_0208424 3300049587 Bacteria 1469
376 Ga0501072_0000552 3300049588 Bacteria 26934
377 Ga0501072_0050712 3300049588 Bacteria 3268
378 Ga0501072_0120993 3300049588 Bacteria 2085
379 Ga0501072_0124529 3300049588 Bacteria 2053
380 Ga0501072_0249052 3300049588 Bacteria 1415
381 Ga0501074_0001117 3300049590 Bacteria 17526
382 Ga0501074_0059926 3300049590 Bacteria 2742
383 Ga0501074_0109723 3300049590 Bacteria 1974
384 Ga0501074_0143412 3300049590 Bacteria 1708
385 Ga0501074_0178739 3300049590 Bacteria 1514
386 Ga0501075_0000438 3300049591 Bacteria 24580
387 Ga0501075_0002105 3300049591 Bacteria 13168
388 Ga0501075_0071450 3300049591 Bacteria 2623
389 Ga0501075_0107371 3300049591 Bacteria 2122
390 Ga0501075_0242812 3300049591 Bacteria 1373
391 Ga0501075_0270091 3300049591 Bacteria 1296
392 Ga0501076_0001978 3300049592 Bacteria 13998
393 Ga0501076_0003443 3300049592 Bacteria 11097
394 Ga0501076_0019551 3300049592 Bacteria 5178
395 Ga0501076_0029963 3300049592 Bacteria 4236
396 Ga0501076_0060798 3300049592 Bacteria 3006
397 Ga0501076_0118373 3300049592 Bacteria 2144
398 Ga0501076_0158502 3300049592 Bacteria 1843
399 Ga0501076_0203272 3300049592 Bacteria 1618
400 Ga0501076_0369717 3300049592 Bacteria 1178
401 Ga0501077_0000579 3300049593 Bacteria 22191
402 Ga0501077_0079777 3300049593 Bacteria 2074
403 Ga0501077_0244915 3300049593 Bacteria 1139
404 Ga0501079_0000559 3300049741 Bacteria 24405
405 Ga0501079_0021956 3300049741 Bacteria 4889
406 Ga0501079_0071671 3300049741 Bacteria 2677
407 Ga0501080_0001834 3300049742 Bacteria 18215
408 Ga0501080_0048146 3300049742 Bacteria 3968
409 Ga0501080_0156703 3300049742 Bacteria 2103
410 Ga0501081_0003100 3300049743 Bacteria 10557
411 Ga0501081_0005987 3300049743 Bacteria 7872
412 Ga0501081_0008804 3300049743 Bacteria 6559
413 Ga0501081_0017358 3300049743 Bacteria 4763
414 Ga0501081_0069589 3300049743 Bacteria 2452
415 Ga0501081_0100003 3300049743 Bacteria 2049
416 Ga0501081_0209033 3300049743 Bacteria 1417
417 Ga0501083_0007292 3300049744 Bacteria 7841
418 Ga0501035_0000046 3300049822 Bacteria 146599
419 Ga0501035_0000287 3300049822 Bacteria 59891
420 Ga0501035_0000306 3300049822 Bacteria 57505
421 Ga0501035_0006656 3300049822 Bacteria 10807
422 Ga0501035_0006898 3300049822 Bacteria 10608
423 Ga0501035_0027158 3300049822 Bacteria 5234
424 Ga0501035_0096734 3300049822 Bacteria 2594
425 Ga0501035_0195149 3300049822 Bacteria 1739
426 Ga0501035_0213948 3300049822 Bacteria 1648
427 Ga0501044_0000038 3300049823 Bacteria 161027
428 Ga0501044_0011903 3300049823 Bacteria 9427
429 Ga0501044_0136312 3300049823 Bacteria 2446
430 Ga0501044_0137013 3300049823 Bacteria 2439
431 Ga0501044_0189941 3300049823 Bacteria 2017
432 Ga0501044_0200939 3300049823 Bacteria 1951
433 Ga0501044_0420207 3300049823 Bacteria 1247
434 Ga0501045_0000471 3300049824 Bacteria 24988
435 Ga0501045_0044858 3300049824 Bacteria 3220
436 Ga0501045_0057555 3300049824 Bacteria 2844
437 Ga0501045_0107355 3300049824 Bacteria 2069
438 Ga0501045_0141128 3300049824 Bacteria 1791
439 Ga0501045_0177201 3300049824 Unclassified 1588
440 nmdc:mga03683_98740_c1 3300050489 Bacteria 1281
441 nmdc:mga0yw44_136124_c1 3300050492 Bacteria 1594
442 nmdc:mga0yw44_5882_c1 3300050492 Bacteria 5860
443 nmdc:mga0yw44_6871_c1 3300050492 Bacteria 5540
444 nmdc:mga0k408_45530_c1 3300050493 Bacteria 2531
445 nmdc:mga04h51_55674_c1 3300050495 Bacteria 1340
446 nmdc:mga05p37_18875_c1 3300050507 Bacteria 8336
447 nmdc:mga05p37_29718_c1 3300050507 Bacteria 6668
448 nmdc:mga05p37_318_c1 3300050507 Bacteria 51124
449 nmdc:mga05p37_358455_c1 3300050507 Bacteria 1715
450 nmdc:mga0qj67_64675_c1 3300050509 Bacteria 2910
451 nmdc:mga06r32_176490_c1 3300050510 Bacteria 2121
452 nmdc:mga06r32_91044_c1 3300050510 Bacteria 2980
453 nmdc:mga08y16_16415_c1 3300050511 Bacteria 7785
454 nmdc:mga08y16_264624_c1 3300050511 Bacteria 1775
455 nmdc:mga0n895_178162_c1 3300050512 Bacteria 2157
456 nmdc:mga0rr50_8055_c1 3300050513 Bacteria 6536
457 nmdc:mga0a205_95769_c1 3300050515 Bacteria 2867
458 Ga0495601_0000005 3300053077 Bacteria 387079
459 Ga0495612_0000001 3300053078 Bacteria 418244
460 Ga0500610_0058742 3300053079 Bacteria 2007
461 Ga0495595_0000166 3300053084 Bacteria 25987
462 Ga0495619_0000007 3300053085 Bacteria 369936
463 Ga0500559_0090602 3300053136 Bacteria 1399
464 Ga0500604_0024871 3300053151 Bacteria 1718
465 Ga0500616_0004108 3300053153 Bacteria 10566
466 Ga0500627_0065300 3300053158 Bacteria 1605
467 Ga0501084_0000026 3300054114 Bacteria 132271
468 Ga0501084_0013773 3300054114 Bacteria 6692
469 Ga0501084_0018337 3300054114 Bacteria 5828
470 Ga0501084_0024487 3300054114 Bacteria 5036
471 Ga0501084_0036034 3300054114 Bacteria 4134
472 Ga0501084_0064107 3300054114 Bacteria 3075
473 Ga0501084_0096653 3300054114 Bacteria 2480
474 Ga0501082_0000675 3300060353 Bacteria 30010
475 Ga0501082_0087225 3300060353 Bacteria 2692
476 Ga0501082_0138363 3300060353 Bacteria 2113
477 Ga0501082_0166079 3300060353 Bacteria 1918
478 Ga0530510_0000525 3300061734 Bacteria 24486
479 Ga0530510_0001238 3300061734 Bacteria 17030
480 Ga0530510_0053252 3300061734 Bacteria 2925
481 Ga0530510_0073616 3300061734 Bacteria 2480
482 Ga0530510_0093004 3300061734 Bacteria 2201
483 Ga0530510_0149967 3300061734 Bacteria 1721
484 2503202963 2503198000 Bacteria 6884444
485 2509115316 2508501123 Bacteria 6283661
486 2509144319 2508501127 Bacteria 7037543
487 2509372455 2509276018 Bacteria 6910194
488 2509397440 2509276022 Bacteria 6200534
489 2510319480 2510065059 Bacteria 6847884
490 2511392524 2511231027 Bacteria 5013807
491 2512930215 2512875016 Bacteria 6529530
492 2512957934 2512875024 Bacteria 7195110
493 2513611703 2513237090 Bacteria 7096802
494 2514032897 2513237164 Bacteria 7563725
495 2514418788 2513237305 Bacteria 7293571
496 2514588841 2513237351 Bacteria 6968952
497 2524612876 2524023250 Bacteria 5457705
498 2535484516 2534681786 Bacteria 3308809
499 2588515851 2588253730 Bacteria 6881675
500 2597814420 2597489875 Bacteria 7010078
501 2599937479 2599185301 Bacteria 6161860
502 2643756299 2643221547 Bacteria 4740017
503 2643773160 2643221550 Bacteria 4619371
504 2643775246 2643221551 Bacteria 3750538
505 2643793692 2643221555 Bacteria 3749717
506 2643839884 2643221564 Bacteria 4193379
507 2643986809 2643221595 Bacteria 6565519
508 2644130169 2643221623 Bacteria 5239945
509 2644157654 2643221627 Bacteria 6761570
510 2644296739 2643221653 Bacteria 4569637
511 2644654993 2643221719 Bacteria 4568197
512 2688599844 2687453392 Bacteria 6880454
513 2694633885 2693429783 Bacteria 7019804
514 2694637710 2693429784 Bacteria 7241525
515 2723576597 2721755686 Bacteria 7343952
516 2723601854 2721755693 Bacteria 6126117
517 2739308793 2738543024 Bacteria 5603683
518 2753359077 2751185800 Bacteria 5467370
519 2753811825 2751185905 Bacteria 6142767
520 2756675590 2756170246 Bacteria 7451806
521 2757571672 2757320392 Bacteria 3737298
522 2758641316 2758568016 Bacteria 5645291
523 2765465331 2765235802 Bacteria 5618596
524 2770197801 2767802442 Bacteria 5747986
525 2776271834 2775506902 Bacteria 6208009
526 2776279651 2775506904 Bacteria 5954060
527 2792745874 2791355123 Bacteria 8049106
528 2802439259 2802428803 Bacteria 5806948
529 2819242439 2818991272 Bacteria 4622173
530 2819684014 2818991461 Bacteria 7026071
531 2837652706 2837651117 Bacteria 3772164
532 2839995774 2839993093 Bacteria 5512535
533 2840769805 2840764183 Bacteria 6358399
534 2841740778 2841734538 Bacteria 6784580
535 2842874390 2842871566 Bacteria 4827117
536 2844006089 2844002411 Bacteria 7168230
537 2844015105 2844009547 Bacteria 6728125
538 2847671026 2847670302 Bacteria 6165597
539 2847687191 2847686936 Bacteria 6278406
540 2854914613 2854911287 Bacteria 5582813
541 2856316521 2856314179 Bacteria 6477897
542 2856324703 2856320880 Bacteria 7263508
543 2856333096 2856328259 Bacteria 6528202
544 2856337655 2856334872 Bacteria 7037011
545 2856342629 2856342000 Bacteria 7176905
546 2856371093 2856364286 Bacteria 6939991
547 2857355442 2857349434 Bacteria 7926032
548 2857369366 2857367948 Bacteria 6965560
549 2869165547 2869162929 Bacteria 6399702
550 2869174678 2869169390 Bacteria 6659796
551 2869238370 2869234852 Bacteria 6654993
552 2869247307 2869242130 Bacteria 6609239
553 2869251341 2869249662 Bacteria 6868783
554 2869259928 2869256925 Bacteria 6981691
555 2869269242 2869264136 Bacteria 6880765
556 2869277033 2869271264 Bacteria 6908218
557 2869281302 2869278585 Bacteria 7077053
558 2869292014 2869285874 Bacteria 6901219
559 2871435221 2871429161 Bacteria 6547891
560 2871439915 2871435913 Bacteria 6880295
561 2871451294 2871444079 Bacteria 6423508
562 2871458334 2871451962 Bacteria 7336357
563 2871460878 2871459585 Bacteria 6866887
564 2871472150 2871466892 Bacteria 6923287
565 2871479832 2871474448 Bacteria 6806570
566 2871482261 2871481445 Bacteria 6700002
567 2871488934 2871488783 Bacteria 6929816
568 2871496100 2871495908 Bacteria 6935695
569 2874108124 2874102143 Bacteria 6342645
570 2874110097 2874109183 Bacteria 6517025
571 2874123424 2874116593 Bacteria 6674494
572 2874126187 2874123672 Bacteria 7238285
573 2874133164 2874131515 Bacteria 6820270
574 2874141032 2874139085 Bacteria 7021506
575 2874151145 2874146452 Bacteria 7533118
576 2874161172 2874155637 Bacteria 6724144
577 2874167805 2874162495 Bacteria 6174670
578 2874170287 2874168670 Bacteria 8062617
579 2876366220 2876363079 Bacteria 6544991
580 2876370102 2876369609 Bacteria 6807521
581 2876386266 2876386047 Bacteria 6698674
582 2876395399 2876392853 Bacteria 6660880
583 2876403497 2876399893 Bacteria 6927900
584 2876407438 2876406927 Bacteria 6191900
585 2876417165 2876413966 Bacteria 6831344
586 2876421309 2876420981 Bacteria 6687741
587 2878036855 2878035449 Bacteria 6555736
588 2878736137 2878730984 Bacteria 6380721
589 2878742812 2878738818 Bacteria 7136951
590 2878752356 2878745973 Bacteria 6867388
591 2878753696 2878753008 Bacteria 6922523
592 2878760333 2878760144 Bacteria 6823465
593 2878767293 2878767105 Bacteria 6898628
594 2878779868 2878774303 Bacteria 6108671
595 2878786869 2878781027 Bacteria 6834456
596 2878796589 2878788777 Bacteria 6567085
597 2881152424 2881147464 Bacteria 7779814
598 2881156556 2881155292 Bacteria 6461656
599 2881161935 2881161766 Bacteria 7127907
600 2881846161 2881845957 Bacteria 6611900
601 2881864102 2881861095 Bacteria 7128710
602 2882633615 2882632389 Bacteria 8154593
603 2882918545 2882912400 Bacteria 6801539
604 2885310816 2885305155 Bacteria 7348390
605 2885316716 2885312484 Bacteria 6415165
606 2885329084 2885326080 Bacteria 7134805
607 2885341251 2885334103 Bacteria 7216818
608 2885347807 2885342637 Bacteria 7011821
609 2885355540 2885350715 Bacteria 6787678
610 2888341007 2888337043 Bacteria 6629336
611 2888348203 2888343758 Bacteria 6611049
612 2888357068 2888350351 Bacteria 7372807
613 2889012083 2889010040 Bacteria 6749192
614 2889022988 2889016732 Bacteria 6700763
615 2889277929 2889276214 Bacteria 5979355
616 2889793951 2889790730 Bacteria 5689708
617 2889915821 2889914905 Bacteria 5702301
618 2894654762 2894652903 Bacteria 4587256
619 2894819779 2894817345 Bacteria 4892941
620 2903452424 2903448605 Bacteria 7357801
621 2903495593 2903492973 Bacteria 13473544
622 2903505471 2903492973 Bacteria 13473544
623 2903515046 2903513507 Bacteria 6344008
624 2903524088 2903521522 Bacteria 6525694
625 2903533729 2903528002 Bacteria 6586099
626 2903540895 2903540706 Bacteria 7062119
627 2904581499 2904578770 Bacteria 5302906
628 2904597864 2904595352 Bacteria 6124848
629 2904662029 2904659560 Bacteria 6685615
630 2906314750 2906308376 Bacteria 6841989
631 2906327922 2906321335 Bacteria 6579571
632 2906332796 2906328253 Bacteria 6585166
633 2906369784 2906363423 Bacteria 6856682
634 2906372719 2906370794 Bacteria 6881062
635 2906386378 2906378014 Bacteria 6911440
636 2906387843 2906386501 Bacteria 5977019
637 2906393975 2906393657 Bacteria 6790866
638 2906405873 2906401398 Bacteria 6693206
639 2906409522 2906408224 Bacteria 6162342
640 2906416658 2906414383 Bacteria 6580790
641 2906428122 2906427513 Bacteria 6375796
642 2915651589 2915650412 Bacteria 4288180
643 2919122733 2919119836 Bacteria 5208557
644 2922137828 2922130491 Bacteria 7173936
645 2922153835 2922151315 Bacteria 6902399
646 2922159132 2922158528 Bacteria 6573167
647 2922175927 2922172374 Bacteria 6167644
648 2922181462 2922178524 Bacteria 6025201
649 2922193029 2922185730 Bacteria 7113964
650 2924729968 2924726620 Bacteria 6271473
651 2924735088 2924733363 Bacteria 7574837
652 2924743371 2924741084 Bacteria 6661321
653 2924752074 2924748358 Bacteria 6154725
654 2924758359 2924754689 Bacteria 6774424
655 2924763482 2924762789 Bacteria 6561353
656 2924780612 2924776078 Bacteria 7492003
657 2924789985 2924784321 Bacteria 7416538
658 2928524572 2928521798 Bacteria 4960112
659 2937821077 2937813078 Bacteria 7783518
660 2937823629 2937822353 Bacteria 7290551
661 2937836949 2937836603 Bacteria 6811263
662 2937845451 2937843397 Bacteria 5256375
663 2937854417 2937848649 Bacteria 6983481
664 2937868839 2937861824 Bacteria 6660327
665 2937870889 2937868953 Bacteria 6639878
666 2937879886 2937877337 Bacteria 7246526
667 2937896685 2937891427 Bacteria 6357007
668 2937974518 2937972304 Bacteria 7532020
669 2937985970 2937980651 Bacteria 6517427
670 2937994750 2937994558 Bacteria 7036190
671 2954015234 2954011201 Bacteria 4762601
672 2958037264 2958034702 Bacteria 6989922
673 2958046976 2958041894 Bacteria 13082850
674 2958067489 2958064165 Bacteria 7158582
675 2958076776 2958071322 Bacteria 6815895
676 2958087064 2958084443 Bacteria 7312792
677 2958093041 2958092219 Bacteria 6861151
678 2958107975 2958100919 Bacteria 6800575
679 2958111197 2958108152 Bacteria 6681128
680 2958117827 2958115193 Bacteria 6923548
681 2958127689 2958122699 Bacteria 7280457
682 2958136414 2958130278 Bacteria 6897202
683 2958141523 2958137437 Bacteria 6050276
684 2958164551 2958158011 Bacteria 6058449
685 2958165228 2958165035 Bacteria 6906348
686 2958173310 2958172287 Bacteria 6716688
687 2958185881 2958179912 Bacteria 6874908
688 2961084362 2961077736 Bacteria 7079850
689 2961117183 2961114664 Bacteria 6680456
690 2961133165 2961127735 Bacteria 7196641
691 2961163689 2961163497 Bacteria 6901077
692 2961170884 2961170736 Bacteria 7072258
693 2961188600 2961183825 Bacteria 6688536
694 2963649016 2963644680 Bacteria 6530403
695 2965018491 2965018300 Bacteria 6883036
696 2965030369 2965025482 Bacteria 6532201
697 2965034161 2965032056 Bacteria 6887443
698 2965051644 2965047637 Bacteria 6623551
699 2965063943 2965062239 Bacteria 7412989
700 2965115245 2965110997 Bacteria 6693150
701 2965126311 2965119406 Bacteria 6956431
702 2968003463 2967996073 Bacteria 6787468
703 2968004230 2968003550 Bacteria 6929263
704 2968019917 2968016561 Bacteria 7022047
705 2968084204 2968083720 Bacteria 7351627
706 2968096841 2968091066 Bacteria 6052692
707 2968100118 2968097103 Bacteria 6107094
708 2968113091 2968110612 Bacteria 6814636
709 2968123743 2968117919 Bacteria 6536078
710 2968133005 2968128360 Bacteria 6270294
711 2968140101 2968138860 Bacteria 6605449
712 2968172091 2968171901 Bacteria 6894245
713 2970473238 2970469710 Bacteria 6969209
714 2970495368 2970489779 Bacteria 6517260
715 2970503474 2970503327 Bacteria 7099517
716 2970516193 2970510686 Bacteria 7006402
717 2970531458 2970524798 Bacteria 6840927
718 2970540729 2970540015 Bacteria 6977556
719 2970549105 2970547951 Bacteria 6931819
720 2970555183 2970554993 Bacteria 6814252
721 2970595906 2970593180 Bacteria 7073582
722 2970622016 2970619444 Bacteria 6986144
723 2970628923 2970627176 Bacteria 6680862
724 2977822911 2977821940 Bacteria 6906439
725 2977835522 2977828996 Bacteria 7007971
726 2977849721 2977843712 Bacteria 6753583
727 2977858017 2977851361 Bacteria 6694324
728 2977861759 2977858184 Bacteria 6215359
729 2977866732 2977864932 Bacteria 7534097
730 2977876271 2977872689 Bacteria 7270173
731 2977903524 2977898635 Bacteria 6675551
732 2977914520 2977907340 Bacteria 6577984
733 2977926831 2977922695 Bacteria 6956781
734 2977939268 2977935797 Bacteria 6252826
735 2977948945 2977942078 Bacteria 7570577
736 2977956860 2977950692 Bacteria 6893264
737 2977962618 2977957713 Bacteria 6877875
738 2977979925 2977971508 Bacteria 7472917
739 2977987182 2977986579 Bacteria 6581278
740 2979711683 2979710463 Bacteria 6785254
741 2979768504 2979764755 Bacteria 6610066
742 2979780268 2979779861 Bacteria 6219781
743 2979799228 2979793036 Bacteria 6808957
744 2979815703 2979808191 Bacteria 7179355
745 2987640575 2987636660 Bacteria 8088555
746 2987650978 2987645492 Bacteria 6117018
747 2987653780 2987652177 Bacteria 6969023
748 2987659696 2987659509 Bacteria 6966464
749 2987667691 2987666974 Bacteria 6509233
750 2989778281 2989776772 Bacteria 4843317
751 2996312192 2996310559 Bacteria 6357320
752 2996340761 2996336353 Bacteria 5511628
753 2996345739 2996341866 Bacteria 6643098
754 2996351660 2996348954 Bacteria 7239054
755 2996389460 2996386984 Bacteria 6978667
756 2996711476 2996706504 Bacteria 5757485
757 3000138940 3000135777 Bacteria 6891109
758 3002143470 3002141150 Bacteria 5254435
759 3004170542 3004167301 Bacteria 8330599
760 3004188740 3004188549 Bacteria 6952365
761 3004201191 3004195979 Bacteria 6776956
762 3004208773 3004203850 Bacteria 7307914
763 3004214957 3004211236 Bacteria 7417683
764 3004222452 3004218560 Bacteria 7421728
765 3004233099 3004232784 Bacteria 6662140
766 3004247177 3004239961 Bacteria 6892290
767 3004250978 3004248173 Bacteria 6563236
768 3004278360 3004275668 Bacteria 7114440
769 3004290510 3004289098 Bacteria 6135450
770 3004339773 3004334049 Bacteria 8449246
771 637079995 637000159 Bacteria 7596297
772 642425665 641736151 Bacteria 7477263
773 649874323 649633066 Bacteria 6690028
774 8002285316 8002285264 Bacteria 6717907
775 8004303649 8004300914 Bacteria 6132239
776 8004315465 8004312739 Bacteria 7444653
777 8004364198 8004361976 Bacteria 6858373
778 8004375267 8004374579 Bacteria 6898112
779 8004395006 8004387939 Bacteria 7049250
780 8004397195 8004395343 Bacteria 6620908
781 8004447454 8004445564 Bacteria 6322258
782 8004635900 8004633249 Bacteria 6723080
783 8004642960 8004640170 Bacteria 6723001
784 8004701503 8004695233 Bacteria 6731676
785 8004711710 8004703790 Bacteria 8006957
786 8004721011 8004714634 Bacteria 6776161
787 8004731591 8004727605 Bacteria 6643904
788 8055622380 8055617313 Bacteria 7548464
789 Ga0070704_100057722
790 JGI24740J21852_10007842
791 JGI24735J21928_10001139
792 JGI25157J39369_1000849
793 JGI25165J46597_1000219
794 rootH2_10025044
795 rootH1_10012854
796 Ga0006562J51391_1008400
797 Ga0055542_1000572
798 Ga0055529_1003128
799 Ga0058859_11785646
800 Ga0058860_11846802
801 Ga0065165_1001977
802 Ga0065704_10114003
803 Ga0065707_10130544
804 Ga0070676_10223955
805 Ga0068869_100008715
806 Ga0070682_100003380
807 Ga0070668_100149088
808 Ga0070668_100173088
809 Ga0070674_100061115
810 Ga0070714_100000144
811 Ga0070713_100138922
812 Ga0070694_100155277
813 Ga0070708_100008304
814 Ga0070708_100101575
815 Ga0068867_100080138
816 Ga0070706_100008474
817 Ga0070706_100193585
818 Ga0070706_100212818
819 Ga0070707_100004103
820 Ga0070707_100032977
821 Ga0070707_100128562
822 Ga0070698_100048437
823 Ga0070698_100088332
824 Ga0070698_100103437
825 Ga0070698_100140372
826 Ga0070699_100041963
827 Ga0070699_100042416
828 Ga0070697_100289025
829 Ga0070695_100001839
830 Ga0070696_100008411
831 Ga0070665_100003727
832 Ga0070665_100159776
833 Ga0068855_100065026
834 Ga0068855_100113372
835 Ga0070664_100118887
836 Ga0068857_100304351
837 Ga0068854_100089153
838 Ga0068856_100200983
839 Ga0068852_100094392
840 Ga0068859_100460918
841 Ga0068860_100017606
842 Ga0068860_100033861
843 Ga0068862_100010573
844 Ga0068862_100026271
845 Ga0081455_10000829
846 Ga0081455_10012592
847 Ga0081538_10002229
848 Ga0081538_10002703
849 Ga0075365_10002014
850 Ga0075365_10087327
851 Ga0075363_100028371
852 Ga0070715_10124045
853 Ga0070716_100019012
854 Ga0070712_100003421
855 Ga0075362_10019633
856 Ga0075367_10019474
857 Ga0068871_100064668
858 Ga0075428_100042448
859 Ga0075431_100090019
860 Ga0075431_100108453
861 Ga0075431_100273127
862 Ga0075434_100020904
863 Ga0075434_100314766
864 Ga0068865_100096498
865 Ga0097620_100460863
866 Ga0075435_100000577
867 Ga0099794_10103089
868 Ga0111539_10024445
869 Ga0111539_10164656
870 Ga0111539_10550105
871 Ga0105245_10041733
872 Ga0105245_10202004
873 Ga0114129_10000977
874 Ga0114129_10355517
875 Ga0114129_10448952
876 Ga0114129_10610156
877 Ga0105241_10042991
878 Ga0105249_10060995
879 Ga0105239_10159253
880 Ga0105246_10222363
881 Ga0157378_10317029
882 Ga0163162_10000446
883 Ga0163162_10463863
884 Ga0163162_10627519
885 Ga0209026_1000002
886 Ga0209148_1000038
887 Ga0209759_1000156
888 Ga0209233_1000258
889 Ga0209233_1009319
890 Ga0209233_1011172
891 Ga0209455_1000376
892 Ga0209758_1008950
893 Ga0207680_10035673
894 Ga0207647_10008543
895 Ga0207685_10046411
896 Ga0207684_10007744
897 Ga0207695_10494764
898 Ga0207671_10014553
899 Ga0207671_10179387
900 Ga0207646_10015361
901 Ga0207646_10055940
902 Ga0207694_10010009
903 Ga0207687_10036370
904 Ga0207687_10158394
905 Ga0207664_10000494
906 Ga0207709_10201684
907 Ga0207665_10046375
908 Ga0207665_10136885
909 Ga0207689_10007335
910 Ga0207679_10164765
911 Ga0207667_10261796
912 Ga0207667_10266432
913 Ga0207712_10096398
914 Ga0207668_10103788
915 Ga0207640_10041060
916 Ga0207639_10042288
917 Ga0207639_10112174
918 Ga0207708_10161633
919 Ga0207702_10223646
920 Ga0207702_10294481
921 Ga0207641_10010425
922 Ga0207648_10097245
923 Ga0207648_10190385
924 Ga0207683_10094039
925 Ga0209813_10025597
926 Ga0207428_10033649
927 Ga0207428_10165991
928 Ga0268266_10054796
929 Ga0268266_10298381
930 Ga0268265_10013573
931 Ga0268264_10000558
932 Ga0268264_10041618
933 Ga0307515_10000056
934 Ga0265325_10060496
935 Ga0265313_10042643
936 Ga0265314_10006793
937 Ga0316576_10000975
938 Ga0316577_10001094
939 Ga0307413_10095618
940 Ga0307412_10000131
941 Ga0307416_100114071
942 Ga0373926_0039620
943 Ga0373923_0001019
944 Ga0373936_0000230
945 Ga0373945_0001082
946 Ga0373953_0000282
947 Ga0373954_0000163
948 Ga0373943_0080606
949 Ga0373946_0000412
950 Ga0373955_0000071
951 Ga0373924_0002670
952 Ga0373935_0001582
953 Ga0373927_0001396
954 Ga0373933_0002030
955 Ga0373947_0001895
956 Ga0373937_0000162
957 Ga0373937_0317528
958 Ga0316582_0064163
959 Ga0316584_0082462
960 Ga0373925_0000025
961 Ga0395900_0029285
962 Ga0395900_0054140
963 Ga0395898_0031042
964 Ga0395905_0000995
965 Ga0395905_0001481
966 Ga0395905_0027828
967 Ga0395905_0079042
968 Ga0395905_0152442
969 Ga0395905_0550889
970 Ga0395901_0221571
971 Ga0395901_0223331
972 Ga0439450_000521
973 Ga0439463_001336
974 Ga0451577_0001676
975 Ga0451577_0001818
976 Ga0451577_0002212
977 Ga0451577_0028398
978 Ga0451577_0095980
979 Ga0466972_0053238
980 Ga0453683_0001036
981 Ga0453683_0002536
982 Ga0453683_0010466
983 Ga0453683_0077158
984 Ga0453683_0120393
985 Ga0453683_0209860
986 Ga0453684_0000066
987 Ga0453684_0001327
988 Ga0453684_0003490
989 Ga0453684_0016384
990 Ga0453684_0021711
991 Ga0453684_0037244
992 Ga0453684_0102182
993 Ga0453684_0221830
994 Ga0453684_0370119
995 Ga0466960_0036087
996 Ga0451576_0007592
997 Ga0451576_0146542
998 Ga0451576_0169544
999 Ga0451576_0376490
1000 Ga0451576_0401818
1001 Ga0495592_0000132
1002 Ga0495638_0183332
1003 Ga0495651_0000308
1004 Ga0495653_0000041
1005 Ga0495582_0032493
1006 Ga0495662_0003042
1007 Ga0495664_0000005
1008 Ga0495607_0071860
1009 Ga0495608_0000003
1010 Ga0495608_0001600
1011 Ga0495610_0030806
1012 Ga0495618_0000010
1013 Ga0495620_0087605
1014 Ga0495628_0000019
1015 Ga0495628_0079751
1016 Ga0495630_0016988
1017 Ga0495643_0019534
1018 Ga0495652_0000028
1019 Ga0495665_0029847
1020 Ga0495640_0000014
1021 Ga0495587_0000026
1022 Ga0495645_0000005
1023 Ga0495667_0000003
1024 Ga0495667_0001691
1025 Ga0495667_0099095
1026 Ga0495668_0098708
1027 Ga0495634_0000017
1028 Ga0495625_0083324
1029 Ga0495625_0172444
1030 Ga0495635_0000024
1031 Ga0495657_0000034
1032 Ga0495599_0000017
1033 Ga0495623_0000028
1034 Ga0495646_0000015
1035 Ga0495624_0070657
1036 Ga0495600_0000058
1037 Ga0495581_0001732
1038 Ga0495604_0000021
1039 Ga0495674_0000005
1040 Ga0495680_0000503
1041 Ga0495675_0000085
1042 Ga0495684_0000001
1043 Ga0495593_0001873
1044 Ga0495602_0000003
1045 Ga0496102_0370096
1046 Ga0496106_0233848
1047 Ga0496110_0140347
1048 Ga0496112_0008399
1049 Ga0496116_0009549
1050 Ga0496116_0117828
1051 Ga0496118_0113767
1052 Ga0496119_0009046
1053 Ga0496119_0031911
1054 Ga0496120_0001687
1055 Ga0496120_0007399
1056 Ga0496120_0039794
1057 Ga0496121_0084884
1058 Ga0496122_0000160
1059 Ga0496122_0014530
1060 Ga0496122_0061698
1061 Ga0496123_0000034
1062 Ga0496124_0000206
1063 Ga0496124_0131601
1064 Ga0496124_0131800
1065 Ga0496126_0004064
1066 Ga0501031_0000108
1067 Ga0501031_0000220
1068 Ga0501031_0001228
1069 Ga0501031_0011891
1070 Ga0501031_0018777
1071 Ga0501031_0032347
1072 Ga0501032_0000022
1073 Ga0501032_0000031
1074 Ga0501033_0000037
1075 Ga0501033_0000763
1076 Ga0501033_0001161
1077 Ga0501033_0012044
1078 Ga0501033_0070246
1079 Ga0501034_0000064
1080 Ga0501034_0000269
1081 Ga0501034_0000302
1082 Ga0501034_0017525
1083 Ga0501034_0044693
1084 Ga0501036_0000013
1085 Ga0501036_0005240
1086 Ga0501036_0014732
1087 Ga0501036_0014748
1088 Ga0501036_0033890
1089 Ga0501036_0041544
1090 Ga0501036_0087408
1091 Ga0501036_0097160
1092 Ga0501037_0000016
1093 Ga0501037_0000132
1094 Ga0501037_0023829
1095 Ga0501037_0027918
1096 Ga0501038_0000015
1097 Ga0501038_0000055
1098 Ga0501038_0020136
1099 Ga0501038_0064922
1100 Ga0501038_0099895
1101 Ga0501038_0143485
1102 Ga0501038_0203813
1103 Ga0501039_0000013
1104 Ga0501039_0000045
1105 Ga0501039_0000503
1106 Ga0501039_0001875
1107 Ga0501039_0007918
1108 Ga0501039_0039043
1109 Ga0501039_0054009
1110 Ga0501039_0055204
1111 Ga0501039_0180005
1112 Ga0501040_0000694
1113 Ga0501040_0002047
1114 Ga0501040_0008017
1115 Ga0501040_0202135
1116 Ga0501040_0221184
1117 Ga0501041_0000010
1118 Ga0501041_0001027
1119 Ga0501041_0011454
1120 Ga0501041_0057562
1121 Ga0501041_0081698
1122 Ga0501042_0000074
1123 Ga0501042_0002854
1124 Ga0501042_0017882
1125 Ga0501042_0022515
1126 Ga0501042_0037875
1127 Ga0501042_0075894
1128 Ga0501042_0328716
1129 Ga0501043_0000015
1130 Ga0501043_0000388
1131 Ga0501043_0013030
1132 Ga0501043_0094561
1133 Ga0501043_0152995
1134 Ga0501046_0001425
1135 Ga0501046_0002776
1136 Ga0501046_0004035
1137 Ga0501046_0017760
1138 Ga0501046_0168353
1139 Ga0501046_0200897
1140 Ga0501046_0291218
1141 Ga0501046_0329402
1142 Ga0501047_0000157
1143 Ga0501047_0001528
1144 Ga0501047_0003989
1145 Ga0501047_0076477
1146 Ga0501047_0186428
1147 Ga0501048_0001631
1148 Ga0501048_0014467
1149 Ga0501048_0020719
1150 Ga0501067_0083758
1151 Ga0501068_0054184
1152 Ga0501068_0129887
1153 Ga0501068_0226754
1154 Ga0501069_0076809
1155 Ga0501070_0025811
1156 Ga0501070_0069484
1157 Ga0501070_0069539
1158 Ga0501070_0173629
1159 Ga0501070_0249781
1160 Ga0501071_0000002
1161 Ga0501071_0021035
1162 Ga0501071_0110667
1163 Ga0501071_0208424
1164 Ga0501072_0000552
1165 Ga0501072_0050712
1166 Ga0501072_0120993
1167 Ga0501072_0124529
1168 Ga0501072_0249052
1169 Ga0501074_0001117
1170 Ga0501074_0059926
1171 Ga0501074_0109723
1172 Ga0501074_0143412
1173 Ga0501074_0178739
1174 Ga0501075_0000438
1175 Ga0501075_0002105
1176 Ga0501075_0071450
1177 Ga0501075_0107371
1178 Ga0501075_0242812
1179 Ga0501075_0270091
1180 Ga0501076_0001978
1181 Ga0501076_0003443
1182 Ga0501076_0019551
1183 Ga0501076_0029963
1184 Ga0501076_0060798
1185 Ga0501076_0118373
1186 Ga0501076_0158502
1187 Ga0501076_0203272
1188 Ga0501076_0369717
1189 Ga0501077_0000579
1190 Ga0501077_0079777
1191 Ga0501077_0244915
1192 Ga0501079_0000559
1193 Ga0501079_0021956
1194 Ga0501079_0071671
1195 Ga0501080_0001834
1196 Ga0501080_0048146
1197 Ga0501080_0156703
1198 Ga0501081_0003100
1199 Ga0501081_0005987
1200 Ga0501081_0008804
1201 Ga0501081_0017358
1202 Ga0501081_0069589
1203 Ga0501081_0100003
1204 Ga0501081_0209033
1205 Ga0501083_0007292
1206 Ga0501035_0000046
1207 Ga0501035_0000287
1208 Ga0501035_0000306
1209 Ga0501035_0006656
1210 Ga0501035_0006898
1211 Ga0501035_0027158
1212 Ga0501035_0096734
1213 Ga0501035_0195149
1214 Ga0501035_0213948
1215 Ga0501044_0000038
1216 Ga0501044_0011903
1217 Ga0501044_0136312
1218 Ga0501044_0137013
1219 Ga0501044_0189941
1220 Ga0501044_0200939
1221 Ga0501044_0420207
1222 Ga0501045_0000471
1223 Ga0501045_0044858
1224 Ga0501045_0057555
1225 Ga0501045_0107355
1226 Ga0501045_0141128
1227 Ga0501045_0177201
1228 nmdc:mga03683_98740_c1
1229 nmdc:mga0yw44_136124_c1
1230 nmdc:mga0yw44_5882_c1
1231 nmdc:mga0yw44_6871_c1
1232 nmdc:mga0k408_45530_c1
1233 nmdc:mga04h51_55674_c1
1234 nmdc:mga05p37_18875_c1
1235 nmdc:mga05p37_29718_c1
1236 nmdc:mga05p37_318_c1
1237 nmdc:mga05p37_358455_c1
1238 nmdc:mga0qj67_64675_c1
1239 nmdc:mga06r32_176490_c1
1240 nmdc:mga06r32_91044_c1
1241 nmdc:mga08y16_16415_c1
1242 nmdc:mga08y16_264624_c1
1243 nmdc:mga0n895_178162_c1
1244 nmdc:mga0rr50_8055_c1
1245 nmdc:mga0a205_95769_c1
1246 Ga0495601_0000005
1247 Ga0495612_0000001
1248 Ga0500610_0058742
1249 Ga0495595_0000166
1250 Ga0495619_0000007
1251 Ga0500559_0090602
1252 Ga0500604_0024871
1253 Ga0500616_0004108
1254 Ga0500627_0065300
1255 Ga0501084_0000026
1256 Ga0501084_0013773
1257 Ga0501084_0018337
1258 Ga0501084_0024487
1259 Ga0501084_0036034
1260 Ga0501084_0064107
1261 Ga0501084_0096653
1262 Ga0501082_0000675
1263 Ga0501082_0087225
1264 Ga0501082_0138363
1265 Ga0501082_0166079
1266 Ga0530510_0000525
1267 Ga0530510_0001238
1268 Ga0530510_0053252
1269 Ga0530510_0073616
1270 Ga0530510_0093004
1271 Ga0530510_0149967
1272 2503202963
1273 2509115316
1274 2509144319
1275 2509372455
1276 2509397440
1277 2510319480
1278 2511392524
1279 2512930215
1280 2512957934
1281 2513611703
1282 2514032897
1283 2514418788
1284 2514588841
1285 2524612876
1286 2535484516
1287 2588515851
1288 2597814420
1289 2599937479
1290 2643756299
1291 2643773160
1292 2643775246
1293 2643793692
1294 2643839884
1295 2643986809
1296 2644130169
1297 2644157654
1298 2644296739
1299 2644654993
1300 2688599844
1301 2694633885
1302 2694637710
1303 2723576597
1304 2723601854
1305 2739308793
1306 2753359077
1307 2753811825
1308 2756675590
1309 2757571672
1310 2758641316
1311 2765465331
1312 2770197801
1313 2776271834
1314 2776279651
1315 2792745874
1316 2802439259
1317 2819242439
1318 2819684014
1319 2837652706
1320 2839995774
1321 2840769805
1322 2841740778
1323 2842874390
1324 2844006089
1325 2844015105
1326 2847671026
1327 2847687191
1328 2854914613
1329 2856316521
1330 2856324703
1331 2856333096
1332 2856337655
1333 2856342629
1334 2856371093
1335 2857355442
1336 2857369366
1337 2869165547
1338 2869174678
1339 2869238370
1340 2869247307
1341 2869251341
1342 2869259928
1343 2869269242
1344 2869277033
1345 2869281302
1346 2869292014
1347 2871435221
1348 2871439915
1349 2871451294
1350 2871458334
1351 2871460878
1352 2871472150
1353 2871479832
1354 2871482261
1355 2871488934
1356 2871496100
1357 2874108124
1358 2874110097
1359 2874123424
1360 2874126187
1361 2874133164
1362 2874141032
1363 2874151145
1364 2874161172
1365 2874167805
1366 2874170287
1367 2876366220
1368 2876370102
1369 2876386266
1370 2876395399
1371 2876403497
1372 2876407438
1373 2876417165
1374 2876421309
1375 2878036855
1376 2878736137
1377 2878742812
1378 2878752356
1379 2878753696
1380 2878760333
1381 2878767293
1382 2878779868
1383 2878786869
1384 2878796589
1385 2881152424
1386 2881156556
1387 2881161935
1388 2881846161
1389 2881864102
1390 2882633615
1391 2882918545
1392 2885310816
1393 2885316716
1394 2885329084
1395 2885341251
1396 2885347807
1397 2885355540
1398 2888341007
1399 2888348203
1400 2888357068
1401 2889012083
1402 2889022988
1403 2889277929
1404 2889793951
1405 2889915821
1406 2894654762
1407 2894819779
1408 2903452424
1409 2903495593
1410 2903505471
1411 2903515046
1412 2903524088
1413 2903533729
1414 2903540895
1415 2904581499
1416 2904597864
1417 2904662029
1418 2906314750
1419 2906327922
1420 2906332796
1421 2906369784
1422 2906372719
1423 2906386378
1424 2906387843
1425 2906393975
1426 2906405873
1427 2906409522
1428 2906416658
1429 2906428122
1430 2915651589
1431 2919122733
1432 2922137828
1433 2922153835
1434 2922159132
1435 2922175927
1436 2922181462
1437 2922193029
1438 2924729968
1439 2924735088
1440 2924743371
1441 2924752074
1442 2924758359
1443 2924763482
1444 2924780612
1445 2924789985
1446 2928524572
1447 2937821077
1448 2937823629
1449 2937836949
1450 2937845451
1451 2937854417
1452 2937868839
1453 2937870889
1454 2937879886
1455 2937896685
1456 2937974518
1457 2937985970
1458 2937994750
1459 2954015234
1460 2958037264
1461 2958046976
1462 2958067489
1463 2958076776
1464 2958087064
1465 2958093041
1466 2958107975
1467 2958111197
1468 2958117827
1469 2958127689
1470 2958136414
1471 2958141523
1472 2958164551
1473 2958165228
1474 2958173310
1475 2958185881
1476 2961084362
1477 2961117183
1478 2961133165
1479 2961163689
1480 2961170884
1481 2961188600
1482 2963649016
1483 2965018491
1484 2965030369
1485 2965034161
1486 2965051644
1487 2965063943
1488 2965115245
1489 2965126311
1490 2968003463
1491 2968004230
1492 2968019917
1493 2968084204
1494 2968096841
1495 2968100118
1496 2968113091
1497 2968123743
1498 2968133005
1499 2968140101
1500 2968172091
1501 2970473238
1502 2970495368
1503 2970503474
1504 2970516193
1505 2970531458
1506 2970540729
1507 2970549105
1508 2970555183
1509 2970595906
1510 2970622016
1511 2970628923
1512 2977822911
1513 2977835522
1514 2977849721
1515 2977858017
1516 2977861759
1517 2977866732
1518 2977876271
1519 2977903524
1520 2977914520
1521 2977926831
1522 2977939268
1523 2977948945
1524 2977956860
1525 2977962618
1526 2977979925
1527 2977987182
1528 2979711683
1529 2979768504
1530 2979780268
1531 2979799228
1532 2979815703
1533 2987640575
1534 2987650978
1535 2987653780
1536 2987659696
1537 2987667691
1538 2989778281
1539 2996312192
1540 2996340761
1541 2996345739
1542 2996351660
1543 2996389460
1544 2996711476
1545 3000138940
1546 3002143470
1547 3004170542
1548 3004188740
1549 3004201191
1550 3004208773
1551 3004214957
1552 3004222452
1553 3004233099
1554 3004247177
1555 3004250978
1556 3004278360
1557 3004290510
1558 3004339773
1559 637079995
1560 642425665
1561 649874323
1562 8002285316
1563 8004303649
1564 8004315465
1565 8004364198
1566 8004375267
1567 8004395006
1568 8004397195
1569 8004447454
1570 8004635900
1571 8004642960
1572 8004701503
1573 8004711710
1574 8004721011
1575 8004731591
1576 8055622380

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08541

ACP_syn_III_C

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal

301

390

0.99

PF08545

ACP_syn_III

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III

163

247

0.89

PF00108

Thiolase_N

Thiolase, N-terminal domain

96

248

0.86

PF00195

Chal_sti_synt_N

Chalcone and stilbene synthases, N-terminal domain

25

228

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ylt-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis 0.9857 3 323
2ebd-assembly1.cif.gz_B crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from aquifex aeolicus vf5 0.9853 4 323
5bnr-assembly1.cif.gz_A-2 e. coli fabh with small molecule inhibitor 2 0.9805 3 323
4z19-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis with acetylated active site cysteine 0.9799 3 323
4ylt-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis 0.9794 3 323
ID Description Score Start End Superfamily
3il3A01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9877 3 171 3.40.47.10
2ebdB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9805 181 323 3.40.47.10
af_Q2FZS0_1_313_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9789 3 323 3.40.47.10
4ewpF01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9768 3 170 3.40.47.10
3il3A01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9762 3 171 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A4V1UGK4-F1-model_v4 3-oxoacyl-ACP synthase (EC 2.3.1.180) 0.9993 243 323 GO:0033818
GO:0044550
AF-A0A538M788-F1-model_v4 3-oxoacyl-ACP synthase 0.9945 224 323 GO:0016746
AF-A0A3B9NPJ8-F1-model_v4 3-oxoacyl-ACP synthase (EC 2.3.1.180) 0.9938 212 323 GO:0033818
AF-A0A661PT68-F1-model_v4 3-oxoacyl-ACP synthase 0.993 8 116 GO:0016746
GO:0044550
AF-A0A800M9R9-F1-model_v4 3-oxoacyl-ACP synthase 0.992 7 155 GO:0004315
GO:0006633
GO:0044550

Map