F480882
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 788 | 341 | 788 | 135 |
Family's Representative Sequence
| Representative Sequence | 3300050507|nmdc:mga05p37_812233_c1|nmdc:mga05p37_812233_c1_243_740 |
| Length | 142 |
| Sequence | MSRIDSGGPKLRLLVGKVGLDGHDRGAKIIARALRDAGFEVIYTGLHQTPEMVVATALQEDVDAISLSILSGAHNTLFPRVLSLLKEARVSVPVFGGGIIPEDDIPLLKKAGVRAIFTPGTSTQAVIDWVRKNIRPRRAAAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 3 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 4 | 3300003503 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM | Metagenome | Rhizosphere |
| 5 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 113 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 114 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 115 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 116 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 191 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 192 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 194 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 195 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 196 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 198 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 199 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 200 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 201 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 203 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 207 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 209 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 214 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 215 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 218 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 219 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 220 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 222 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 224 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 225 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 226 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 227 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 228 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 229 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 230 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 231 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 232 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 233 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 234 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 235 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 236 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 237 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 238 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 239 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 240 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 241 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 242 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 243 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 244 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 245 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 246 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 247 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 248 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 249 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 278 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 279 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 280 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 281 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 282 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 285 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 286 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 287 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 288 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 289 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 290 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 335 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 336 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 337 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 339 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 340 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.87 |
| Metatranscriptomes | 0.13 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.38 |
| Nodule | 0 |
| Rhizoplane | 2.66 |
| Rhizosphere | 94.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10046080 | 3300003320 | Bacteria | 11056 |
| 2 | JGI26128J50194_1003259 | 3300003347 | Bacteria | 1073 |
| 3 | JGI26129J50193_1008546 | 3300003349 | Bacteria | 743 |
| 4 | JGI26141J51220_1002903 | 3300003503 | Bacteria | 1052 |
| 5 | JGI25405J52794_10066965 | 3300003911 | Bacteria | 781 |
| 6 | Ga0065715_10168556 | 3300005293 | Bacteria | 1566 |
| 7 | Ga0065707_10457094 | 3300005295 | Bacteria | 795 |
| 8 | Ga0070676_10000588 | 3300005328 | Bacteria | 17589 |
| 9 | Ga0070683_100081286 | 3300005329 | Bacteria | 3034 |
| 10 | Ga0070690_100028494 | 3300005330 | Bacteria | 3460 |
| 11 | Ga0070670_100001663 | 3300005331 | Bacteria | 18035 |
| 12 | Ga0070670_100200107 | 3300005331 | Bacteria | 1736 |
| 13 | Ga0070677_10224682 | 3300005333 | Bacteria | 919 |
| 14 | Ga0068869_100018988 | 3300005334 | Bacteria | 4688 |
| 15 | Ga0070680_100016878 | 3300005336 | Bacteria | 5747 |
| 16 | Ga0070680_100089019 | 3300005336 | Bacteria | 2554 |
| 17 | Ga0070680_100373061 | 3300005336 | Bacteria | 1214 |
| 18 | Ga0070680_101266934 | 3300005336 | Bacteria | 638 |
| 19 | Ga0070682_100082204 | 3300005337 | Bacteria | 2087 |
| 20 | Ga0068868_100014751 | 3300005338 | Bacteria | 5765 |
| 21 | Ga0070660_100001299 | 3300005339 | Bacteria | 17019 |
| 22 | Ga0070660_100251598 | 3300005339 | Bacteria | 1441 |
| 23 | Ga0070660_101401850 | 3300005339 | Bacteria | 594 |
| 24 | Ga0070689_100978689 | 3300005340 | Bacteria | 752 |
| 25 | Ga0070691_10014159 | 3300005341 | Bacteria | 3657 |
| 26 | Ga0070691_10402884 | 3300005341 | Bacteria | 771 |
| 27 | Ga0070687_100070949 | 3300005343 | Bacteria | 1870 |
| 28 | Ga0070687_100117754 | 3300005343 | Bacteria | 1514 |
| 29 | Ga0070687_100154021 | 3300005343 | Bacteria | 1352 |
| 30 | Ga0070687_101059744 | 3300005343 | Bacteria | 591 |
| 31 | Ga0070661_100002142 | 3300005344 | Bacteria | 13609 |
| 32 | Ga0070692_10001477 | 3300005345 | Bacteria | 8570 |
| 33 | Ga0070692_10120813 | 3300005345 | Bacteria | 1461 |
| 34 | Ga0070692_10240396 | 3300005345 | Bacteria | 1079 |
| 35 | Ga0070668_100161454 | 3300005347 | Bacteria | 1819 |
| 36 | Ga0070668_100289726 | 3300005347 | Bacteria | 1370 |
| 37 | Ga0070668_100461098 | 3300005347 | Bacteria | 1094 |
| 38 | Ga0070668_100481021 | 3300005347 | Bacteria | 1072 |
| 39 | Ga0070669_100880646 | 3300005353 | Bacteria | 764 |
| 40 | Ga0070675_100056445 | 3300005354 | Bacteria | 3237 |
| 41 | Ga0070674_100009683 | 3300005356 | Bacteria | 5783 |
| 42 | Ga0070673_100046374 | 3300005364 | Bacteria | 3375 |
| 43 | Ga0070673_100326736 | 3300005364 | Bacteria | 1356 |
| 44 | Ga0070688_100942391 | 3300005365 | Bacteria | 683 |
| 45 | Ga0070659_100000151 | 3300005366 | Bacteria | 53009 |
| 46 | Ga0070703_10000082 | 3300005406 | Bacteria | 47826 |
| 47 | Ga0070703_10008942 | 3300005406 | Bacteria | 2823 |
| 48 | Ga0070703_10115699 | 3300005406 | Bacteria | 966 |
| 49 | Ga0070714_100425045 | 3300005435 | Bacteria | 1259 |
| 50 | Ga0070714_101350923 | 3300005435 | Bacteria | 696 |
| 51 | Ga0070701_10005927 | 3300005438 | Bacteria | 5100 |
| 52 | Ga0070701_10082461 | 3300005438 | Bacteria | 1744 |
| 53 | Ga0070701_10445794 | 3300005438 | Bacteria | 830 |
| 54 | Ga0070711_100307370 | 3300005439 | Bacteria | 1263 |
| 55 | Ga0070705_100005341 | 3300005440 | Bacteria | 6255 |
| 56 | Ga0070705_100057718 | 3300005440 | Bacteria | 2291 |
| 57 | Ga0070700_100200567 | 3300005441 | Bacteria | 1401 |
| 58 | Ga0070694_100009064 | 3300005444 | Bacteria | 6100 |
| 59 | Ga0070694_100022828 | 3300005444 | Bacteria | 4015 |
| 60 | Ga0070694_100269427 | 3300005444 | Bacteria | 1294 |
| 61 | Ga0070694_100436069 | 3300005444 | Bacteria | 1032 |
| 62 | Ga0070694_100617933 | 3300005444 | Bacteria | 874 |
| 63 | Ga0070694_101192361 | 3300005444 | Bacteria | 638 |
| 64 | Ga0070708_100000583 | 3300005445 | Bacteria | 27405 |
| 65 | Ga0070708_100021021 | 3300005445 | Bacteria | 5511 |
| 66 | Ga0070708_100028244 | 3300005445 | Bacteria | 4826 |
| 67 | Ga0070708_100038331 | 3300005445 | Bacteria | 4187 |
| 68 | Ga0070708_100214732 | 3300005445 | Bacteria | 1803 |
| 69 | Ga0070708_100296705 | 3300005445 | Bacteria | 1522 |
| 70 | Ga0070708_100509691 | 3300005445 | Bacteria | 1135 |
| 71 | Ga0070708_100517088 | 3300005445 | Bacteria | 1126 |
| 72 | Ga0070708_100823439 | 3300005445 | Bacteria | 872 |
| 73 | Ga0070708_101589985 | 3300005445 | Bacteria | 608 |
| 74 | Ga0070663_100003733 | 3300005455 | Bacteria | 8830 |
| 75 | Ga0070662_100108506 | 3300005457 | Bacteria | 2111 |
| 76 | Ga0070681_10037836 | 3300005458 | Bacteria | 4839 |
| 77 | Ga0068867_100004614 | 3300005459 | Bacteria | 9695 |
| 78 | Ga0068867_100116016 | 3300005459 | Bacteria | 2063 |
| 79 | Ga0070706_100000283 | 3300005467 | Bacteria | 61748 |
| 80 | Ga0070706_100006190 | 3300005467 | Bacteria | 11322 |
| 81 | Ga0070706_100071250 | 3300005467 | Bacteria | 3214 |
| 82 | Ga0070706_100180124 | 3300005467 | Bacteria | 1973 |
| 83 | Ga0070706_100514968 | 3300005467 | Bacteria | 1113 |
| 84 | Ga0070706_100672185 | 3300005467 | Bacteria | 961 |
| 85 | Ga0070706_100934286 | 3300005467 | Bacteria | 801 |
| 86 | Ga0070707_100001868 | 3300005468 | Bacteria | 20255 |
| 87 | Ga0070707_100009176 | 3300005468 | Bacteria | 9176 |
| 88 | Ga0070707_100045990 | 3300005468 | Bacteria | 4177 |
| 89 | Ga0070707_100263414 | 3300005468 | Bacteria | 1677 |
| 90 | Ga0070707_100630077 | 3300005468 | Bacteria | 1035 |
| 91 | Ga0070707_100838032 | 3300005468 | Bacteria | 884 |
| 92 | Ga0070698_100006229 | 3300005471 | Bacteria | 12983 |
| 93 | Ga0070698_100011760 | 3300005471 | Bacteria | 9285 |
| 94 | Ga0070698_100045170 | 3300005471 | Bacteria | 4509 |
| 95 | Ga0070698_100072254 | 3300005471 | Bacteria | 3458 |
| 96 | Ga0070698_100125706 | 3300005471 | Bacteria | 2522 |
| 97 | Ga0070698_100269410 | 3300005471 | Bacteria | 1635 |
| 98 | Ga0070698_100324111 | 3300005471 | Bacteria | 1471 |
| 99 | Ga0070698_100531121 | 3300005471 | Bacteria | 1115 |
| 100 | Ga0070699_100002671 | 3300005518 | Bacteria | 15939 |
| 101 | Ga0070699_100009735 | 3300005518 | Bacteria | 8316 |
| 102 | Ga0070699_100010530 | 3300005518 | Bacteria | 8001 |
| 103 | Ga0070699_100010909 | 3300005518 | Bacteria | 7859 |
| 104 | Ga0070699_100051831 | 3300005518 | Bacteria | 3553 |
| 105 | Ga0070699_100128281 | 3300005518 | Bacteria | 2235 |
| 106 | Ga0070699_100276075 | 3300005518 | Bacteria | 1505 |
| 107 | Ga0070699_100576939 | 3300005518 | Bacteria | 1025 |
| 108 | Ga0070699_101441603 | 3300005518 | Bacteria | 631 |
| 109 | Ga0070699_101586919 | 3300005518 | Bacteria | 600 |
| 110 | Ga0070699_101619268 | 3300005518 | Bacteria | 593 |
| 111 | Ga0070679_100018431 | 3300005530 | Bacteria | 6774 |
| 112 | Ga0070684_100247826 | 3300005535 | Bacteria | 1628 |
| 113 | Ga0070684_100556989 | 3300005535 | Bacteria | 1064 |
| 114 | Ga0070684_102130774 | 3300005535 | Bacteria | 529 |
| 115 | Ga0070697_100012401 | 3300005536 | Bacteria | 6678 |
| 116 | Ga0070697_100025737 | 3300005536 | Bacteria | 4694 |
| 117 | Ga0070697_100057701 | 3300005536 | Bacteria | 3158 |
| 118 | Ga0070697_100111234 | 3300005536 | Bacteria | 2283 |
| 119 | Ga0070697_100343119 | 3300005536 | Bacteria | 1289 |
| 120 | Ga0070697_101152304 | 3300005536 | Bacteria | 691 |
| 121 | Ga0070697_101236456 | 3300005536 | Bacteria | 666 |
| 122 | Ga0070697_101407410 | 3300005536 | Bacteria | 623 |
| 123 | Ga0068853_100000770 | 3300005539 | Bacteria | 22242 |
| 124 | Ga0070672_100335794 | 3300005543 | Bacteria | 1286 |
| 125 | Ga0070686_101791548 | 3300005544 | Bacteria | 522 |
| 126 | Ga0070695_100000741 | 3300005545 | Bacteria | 17438 |
| 127 | Ga0070695_100009086 | 3300005545 | Bacteria | 5907 |
| 128 | Ga0070695_100012118 | 3300005545 | Bacteria | 5168 |
| 129 | Ga0070695_100036925 | 3300005545 | Bacteria | 3077 |
| 130 | Ga0070695_100037828 | 3300005545 | Bacteria | 3043 |
| 131 | Ga0070695_100369162 | 3300005545 | Bacteria | 1080 |
| 132 | Ga0070696_100006635 | 3300005546 | Bacteria | 7732 |
| 133 | Ga0070696_100045225 | 3300005546 | Bacteria | 3050 |
| 134 | Ga0070696_100053630 | 3300005546 | Bacteria | 2807 |
| 135 | Ga0070693_100036152 | 3300005547 | Bacteria | 2743 |
| 136 | Ga0070665_100127346 | 3300005548 | Bacteria | 2549 |
| 137 | Ga0070704_100000772 | 3300005549 | Bacteria | 15796 |
| 138 | Ga0070704_100013537 | 3300005549 | Bacteria | 5063 |
| 139 | Ga0070704_100169732 | 3300005549 | Bacteria | 1733 |
| 140 | Ga0070704_100394023 | 3300005549 | Bacteria | 1180 |
| 141 | Ga0070704_101142999 | 3300005549 | Bacteria | 708 |
| 142 | Ga0068855_100001154 | 3300005563 | Bacteria | 32715 |
| 143 | Ga0070664_100002406 | 3300005564 | Bacteria | 15035 |
| 144 | Ga0068857_100051090 | 3300005577 | Bacteria | 3666 |
| 145 | Ga0068857_100080218 | 3300005577 | Bacteria | 2914 |
| 146 | Ga0068854_100245480 | 3300005578 | Bacteria | 1428 |
| 147 | Ga0068856_100002395 | 3300005614 | Bacteria | 19288 |
| 148 | Ga0068856_100308124 | 3300005614 | Bacteria | 1601 |
| 149 | Ga0068856_102190458 | 3300005614 | Bacteria | 562 |
| 150 | Ga0070702_100009072 | 3300005615 | Bacteria | 4852 |
| 151 | Ga0070702_100099464 | 3300005615 | Bacteria | 1781 |
| 152 | Ga0068852_100238455 | 3300005616 | Bacteria | 1737 |
| 153 | Ga0068859_100006563 | 3300005617 | Bacteria | 11808 |
| 154 | Ga0068864_100005076 | 3300005618 | Bacteria | 10783 |
| 155 | Ga0068864_100923613 | 3300005618 | Bacteria | 863 |
| 156 | Ga0068866_10009087 | 3300005718 | Bacteria | 4212 |
| 157 | Ga0068861_100003765 | 3300005719 | Bacteria | 10123 |
| 158 | Ga0068861_100024113 | 3300005719 | Bacteria | 4396 |
| 159 | Ga0068861_100717266 | 3300005719 | Bacteria | 931 |
| 160 | Ga0068861_101683835 | 3300005719 | Bacteria | 627 |
| 161 | Ga0068851_10070783 | 3300005834 | Bacteria | 1804 |
| 162 | Ga0068870_10000998 | 3300005840 | Bacteria | 11176 |
| 163 | Ga0068863_100018853 | 3300005841 | Bacteria | 6603 |
| 164 | Ga0068863_101183513 | 3300005841 | Bacteria | 770 |
| 165 | Ga0068858_100009267 | 3300005842 | Bacteria | 9400 |
| 166 | Ga0068858_101512905 | 3300005842 | Bacteria | 662 |
| 167 | Ga0068860_100008113 | 3300005843 | Bacteria | 10457 |
| 168 | Ga0068860_100042525 | 3300005843 | Bacteria | 4338 |
| 169 | Ga0068860_100213371 | 3300005843 | Bacteria | 1873 |
| 170 | Ga0068860_100807077 | 3300005843 | Bacteria | 952 |
| 171 | Ga0068862_100000162 | 3300005844 | Bacteria | 74622 |
| 172 | Ga0068862_100003260 | 3300005844 | Bacteria | 14037 |
| 173 | Ga0068862_100011451 | 3300005844 | Bacteria | 7321 |
| 174 | Ga0068862_100316117 | 3300005844 | Bacteria | 1440 |
| 175 | Ga0068862_100499838 | 3300005844 | Bacteria | 1154 |
| 176 | Ga0068862_100907800 | 3300005844 | Unclassified | 866 |
| 177 | Ga0068862_100926655 | 3300005844 | Bacteria | 858 |
| 178 | Ga0081455_10000614 | 3300005937 | Bacteria | 46194 |
| 179 | Ga0081455_10003792 | 3300005937 | Bacteria | 17254 |
| 180 | Ga0081455_10058331 | 3300005937 | Bacteria | 3266 |
| 181 | Ga0070717_10176569 | 3300006028 | Bacteria | 1860 |
| 182 | Ga0070715_10930975 | 3300006163 | Bacteria | 537 |
| 183 | Ga0070716_100024053 | 3300006173 | Bacteria | 3238 |
| 184 | Ga0070716_101385537 | 3300006173 | Bacteria | 571 |
| 185 | Ga0097621_100048524 | 3300006237 | Bacteria | 3445 |
| 186 | Ga0097621_101188553 | 3300006237 | Unclassified | 718 |
| 187 | Ga0075428_100000357 | 3300006844 | Bacteria | 45378 |
| 188 | Ga0075428_100023841 | 3300006844 | Bacteria | 6771 |
| 189 | Ga0075428_100294503 | 3300006844 | Bacteria | 1745 |
| 190 | Ga0075428_100511804 | 3300006844 | Bacteria | 1284 |
| 191 | Ga0075430_100001708 | 3300006846 | Bacteria | 17901 |
| 192 | Ga0075430_100016571 | 3300006846 | Bacteria | 6276 |
| 193 | Ga0075430_100097232 | 3300006846 | Bacteria | 2460 |
| 194 | Ga0075431_100002572 | 3300006847 | Bacteria | 17520 |
| 195 | Ga0075431_100563872 | 3300006847 | Bacteria | 1125 |
| 196 | Ga0075431_101193434 | 3300006847 | Bacteria | 724 |
| 197 | Ga0075433_10004677 | 3300006852 | Bacteria | 10670 |
| 198 | Ga0075433_10014405 | 3300006852 | Bacteria | 6458 |
| 199 | Ga0075433_10211345 | 3300006852 | Bacteria | 1724 |
| 200 | Ga0075434_100016588 | 3300006871 | Bacteria | 7082 |
| 201 | Ga0075434_100027771 | 3300006871 | Bacteria | 5557 |
| 202 | Ga0075434_100452403 | 3300006871 | Bacteria | 1305 |
| 203 | Ga0075429_100003314 | 3300006880 | Bacteria | 13714 |
| 204 | Ga0075429_100033678 | 3300006880 | Bacteria | 4452 |
| 205 | Ga0075429_100305698 | 3300006880 | Bacteria | 1392 |
| 206 | Ga0068865_100130243 | 3300006881 | Bacteria | 1884 |
| 207 | Ga0068865_100248538 | 3300006881 | Bacteria | 1403 |
| 208 | Ga0075436_100060804 | 3300006914 | Bacteria | 2610 |
| 209 | Ga0097620_100006563 | 3300006931 | Bacteria | 11808 |
| 210 | Ga0075435_100003548 | 3300007076 | Bacteria | 10596 |
| 211 | Ga0075435_100012212 | 3300007076 | Bacteria | 6352 |
| 212 | Ga0075435_100043942 | 3300007076 | Bacteria | 3578 |
| 213 | Ga0099794_10008989 | 3300007265 | Bacteria | 4171 |
| 214 | Ga0111539_10073323 | 3300009094 | Bacteria | 4036 |
| 215 | Ga0111539_10106643 | 3300009094 | Bacteria | 3287 |
| 216 | Ga0111539_12097470 | 3300009094 | Bacteria | 656 |
| 217 | Ga0105245_10094169 | 3300009098 | Bacteria | 2761 |
| 218 | Ga0105245_10459602 | 3300009098 | Bacteria | 1283 |
| 219 | Ga0105245_10513612 | 3300009098 | Bacteria | 1216 |
| 220 | Ga0105245_11741846 | 3300009098 | Bacteria | 676 |
| 221 | Ga0105245_11957739 | 3300009098 | Unclassified | 639 |
| 222 | Ga0105247_10004607 | 3300009101 | Bacteria | 8791 |
| 223 | Ga0114129_10005541 | 3300009147 | Bacteria | 17859 |
| 224 | Ga0114129_10007147 | 3300009147 | Bacteria | 15887 |
| 225 | Ga0114129_10040034 | 3300009147 | Bacteria | 6610 |
| 226 | Ga0114129_10363000 | 3300009147 | Bacteria | 1916 |
| 227 | Ga0114129_10373878 | 3300009147 | Bacteria | 1883 |
| 228 | Ga0114129_10483732 | 3300009147 | Bacteria | 1619 |
| 229 | Ga0114129_10882586 | 3300009147 | Bacteria | 1134 |
| 230 | Ga0114129_11097435 | 3300009147 | Bacteria | 996 |
| 231 | Ga0105243_10003778 | 3300009148 | Bacteria | 12134 |
| 232 | Ga0105243_10013620 | 3300009148 | Bacteria | 6151 |
| 233 | Ga0105243_10152234 | 3300009148 | Bacteria | 1985 |
| 234 | Ga0105241_10000054 | 3300009174 | Bacteria | 93205 |
| 235 | Ga0105241_10106019 | 3300009174 | Bacteria | 2242 |
| 236 | Ga0105242_10026733 | 3300009176 | Bacteria | 4576 |
| 237 | Ga0105242_10031653 | 3300009176 | Bacteria | 4228 |
| 238 | Ga0105249_10032330 | 3300009553 | Bacteria | 4732 |
| 239 | Ga0105249_10364517 | 3300009553 | Bacteria | 1467 |
| 240 | Ga0105249_11280044 | 3300009553 | Bacteria | 805 |
| 241 | Ga0105249_12575724 | 3300009553 | Bacteria | 581 |
| 242 | Ga0105239_10305422 | 3300010375 | Bacteria | 1792 |
| 243 | Ga0105239_10355027 | 3300010375 | Bacteria | 1655 |
| 244 | Ga0105246_10090821 | 3300011119 | Bacteria | 2200 |
| 245 | Ga0105246_10449335 | 3300011119 | Bacteria | 1083 |
| 246 | Ga0157373_10003678 | 3300013100 | Bacteria | 11600 |
| 247 | Ga0157371_10369429 | 3300013102 | Bacteria | 1046 |
| 248 | Ga0157370_11775756 | 3300013104 | Bacteria | 554 |
| 249 | Ga0157369_10367991 | 3300013105 | Bacteria | 1492 |
| 250 | Ga0157369_10478043 | 3300013105 | Bacteria | 1289 |
| 251 | Ga0157378_10958046 | 3300013297 | Bacteria | 889 |
| 252 | Ga0163162_10093658 | 3300013306 | Bacteria | 3089 |
| 253 | Ga0163162_10856273 | 3300013306 | Bacteria | 1024 |
| 254 | Ga0157372_10027062 | 3300013307 | Bacteria | 6242 |
| 255 | Ga0163163_11604912 | 3300014325 | Bacteria | 711 |
| 256 | Ga0157380_10289878 | 3300014326 | Bacteria | 1502 |
| 257 | Ga0157380_10470460 | 3300014326 | Bacteria | 1213 |
| 258 | Ga0157380_10520639 | 3300014326 | Bacteria | 1160 |
| 259 | Ga0157380_10867307 | 3300014326 | Bacteria | 926 |
| 260 | Ga0157380_10885020 | 3300014326 | Bacteria | 918 |
| 261 | Ga0157380_12487862 | 3300014326 | Bacteria | 583 |
| 262 | Ga0157377_10103879 | 3300014745 | Bacteria | 1698 |
| 263 | Ga0157379_10648610 | 3300014968 | Bacteria | 988 |
| 264 | Ga0206353_12000993 | 3300020082 | Bacteria | 1180 |
| 265 | Ga0213873_10044432 | 3300021358 | Bacteria | 1156 |
| 266 | Ga0213876_10001046 | 3300021384 | Bacteria | 17885 |
| 267 | Ga0213876_10004607 | 3300021384 | Bacteria | 7687 |
| 268 | Ga0213876_10061746 | 3300021384 | Bacteria | 1977 |
| 269 | Ga0213875_10339567 | 3300021388 | Bacteria | 713 |
| 270 | Ga0224572_1058690 | 3300024225 | Bacteria | 714 |
| 271 | Ga0207653_10000045 | 3300025885 | Bacteria | 94691 |
| 272 | Ga0207653_10007436 | 3300025885 | Bacteria | 3414 |
| 273 | Ga0207653_10028141 | 3300025885 | Bacteria | 1807 |
| 274 | Ga0207653_10033016 | 3300025885 | Bacteria | 1677 |
| 275 | Ga0207682_10441383 | 3300025893 | Bacteria | 616 |
| 276 | Ga0207642_10084475 | 3300025899 | Bacteria | 1551 |
| 277 | Ga0207642_10274023 | 3300025899 | Bacteria | 968 |
| 278 | Ga0207710_10002166 | 3300025900 | Bacteria | 9227 |
| 279 | Ga0207688_10032149 | 3300025901 | Bacteria | 2899 |
| 280 | Ga0207647_10049868 | 3300025904 | Bacteria | 2595 |
| 281 | Ga0207699_10000078 | 3300025906 | Bacteria | 76220 |
| 282 | Ga0207645_10000059 | 3300025907 | Bacteria | 78254 |
| 283 | Ga0207645_10076164 | 3300025907 | Bacteria | 2148 |
| 284 | Ga0207643_10000014 | 3300025908 | Bacteria | 128891 |
| 285 | Ga0207684_10000058 | 3300025910 | Bacteria | 211166 |
| 286 | Ga0207684_10002971 | 3300025910 | Bacteria | 16802 |
| 287 | Ga0207684_10029482 | 3300025910 | Bacteria | 4672 |
| 288 | Ga0207684_10053561 | 3300025910 | Bacteria | 3424 |
| 289 | Ga0207684_10095377 | 3300025910 | Bacteria | 2538 |
| 290 | Ga0207684_10504636 | 3300025910 | Bacteria | 1037 |
| 291 | Ga0207684_11150406 | 3300025910 | Bacteria | 644 |
| 292 | Ga0207654_10012260 | 3300025911 | Bacteria | 4389 |
| 293 | Ga0207654_10044278 | 3300025911 | Bacteria | 2527 |
| 294 | Ga0207707_10000138 | 3300025912 | Bacteria | 74881 |
| 295 | Ga0207663_10265842 | 3300025916 | Bacteria | 1268 |
| 296 | Ga0207660_10009143 | 3300025917 | Bacteria | 6417 |
| 297 | Ga0207660_10056932 | 3300025917 | Bacteria | 2799 |
| 298 | Ga0207662_10071208 | 3300025918 | Bacteria | 2105 |
| 299 | Ga0207662_10491034 | 3300025918 | Bacteria | 844 |
| 300 | Ga0207657_10000135 | 3300025919 | Bacteria | 75248 |
| 301 | Ga0207649_10009708 | 3300025920 | Bacteria | 5271 |
| 302 | Ga0207652_10004746 | 3300025921 | Bacteria | 11015 |
| 303 | Ga0207646_10001054 | 3300025922 | Bacteria | 35091 |
| 304 | Ga0207646_10008859 | 3300025922 | Bacteria | 10021 |
| 305 | Ga0207646_10031170 | 3300025922 | Bacteria | 4828 |
| 306 | Ga0207646_10061793 | 3300025922 | Bacteria | 3343 |
| 307 | Ga0207646_10071144 | 3300025922 | Bacteria | 3106 |
| 308 | Ga0207646_10112763 | 3300025922 | Bacteria | 2440 |
| 309 | Ga0207646_10117855 | 3300025922 | Bacteria | 2385 |
| 310 | Ga0207646_10149153 | 3300025922 | Bacteria | 2108 |
| 311 | Ga0207681_10070863 | 3300025923 | Bacteria | 2429 |
| 312 | Ga0207681_10756343 | 3300025923 | Bacteria | 810 |
| 313 | Ga0207681_11368700 | 3300025923 | Bacteria | 594 |
| 314 | Ga0207650_10012843 | 3300025925 | Bacteria | 5787 |
| 315 | Ga0207650_10472322 | 3300025925 | Bacteria | 1046 |
| 316 | Ga0207659_10070486 | 3300025926 | Bacteria | 2549 |
| 317 | Ga0207659_10778842 | 3300025926 | Bacteria | 821 |
| 318 | Ga0207659_11211582 | 3300025926 | Bacteria | 649 |
| 319 | Ga0207687_10089735 | 3300025927 | Bacteria | 2239 |
| 320 | Ga0207687_10103469 | 3300025927 | Bacteria | 2100 |
| 321 | Ga0207687_10800515 | 3300025927 | Bacteria | 804 |
| 322 | Ga0207687_10997216 | 3300025927 | Bacteria | 718 |
| 323 | Ga0207644_10007383 | 3300025931 | Bacteria | 7161 |
| 324 | Ga0207644_11485042 | 3300025931 | Bacteria | 569 |
| 325 | Ga0207690_10010140 | 3300025932 | Bacteria | 5596 |
| 326 | Ga0207706_10006677 | 3300025933 | Bacteria | 10670 |
| 327 | Ga0207706_10189614 | 3300025933 | Bacteria | 1805 |
| 328 | Ga0207686_10018333 | 3300025934 | Bacteria | 3962 |
| 329 | Ga0207686_10025017 | 3300025934 | Bacteria | 3467 |
| 330 | Ga0207686_10181575 | 3300025934 | Bacteria | 1492 |
| 331 | Ga0207709_10027194 | 3300025935 | Bacteria | 3292 |
| 332 | Ga0207709_10604517 | 3300025935 | Bacteria | 869 |
| 333 | Ga0207670_10056231 | 3300025936 | Bacteria | 2663 |
| 334 | Ga0207670_10253548 | 3300025936 | Bacteria | 1361 |
| 335 | Ga0207670_10840774 | 3300025936 | Bacteria | 766 |
| 336 | Ga0207670_11731054 | 3300025936 | Bacteria | 532 |
| 337 | Ga0207669_10406942 | 3300025937 | Bacteria | 1067 |
| 338 | Ga0207704_10142358 | 3300025938 | Bacteria | 1680 |
| 339 | Ga0207704_10174569 | 3300025938 | Bacteria | 1546 |
| 340 | Ga0207704_10541625 | 3300025938 | Bacteria | 944 |
| 341 | Ga0207665_10004861 | 3300025939 | Bacteria | 8945 |
| 342 | Ga0207691_10327973 | 3300025940 | Bacteria | 1312 |
| 343 | Ga0207689_10000340 | 3300025942 | Bacteria | 43593 |
| 344 | Ga0207689_10006849 | 3300025942 | Bacteria | 10023 |
| 345 | Ga0207689_10177125 | 3300025942 | Bacteria | 1758 |
| 346 | Ga0207689_10720620 | 3300025942 | Bacteria | 841 |
| 347 | Ga0207679_10000212 | 3300025945 | Bacteria | 46385 |
| 348 | Ga0207679_11484122 | 3300025945 | Bacteria | 622 |
| 349 | Ga0207667_10000296 | 3300025949 | Bacteria | 68803 |
| 350 | Ga0207651_10158798 | 3300025960 | Bacteria | 1770 |
| 351 | Ga0207651_10967057 | 3300025960 | Bacteria | 760 |
| 352 | Ga0207651_11014433 | 3300025960 | Bacteria | 742 |
| 353 | Ga0207712_10224682 | 3300025961 | Bacteria | 1503 |
| 354 | Ga0207712_10326470 | 3300025961 | Bacteria | 1268 |
| 355 | Ga0207712_10382039 | 3300025961 | Bacteria | 1179 |
| 356 | Ga0207668_10356651 | 3300025972 | Bacteria | 1224 |
| 357 | Ga0207640_10430247 | 3300025981 | Bacteria | 1082 |
| 358 | Ga0207640_11408326 | 3300025981 | Bacteria | 625 |
| 359 | Ga0207658_10176741 | 3300025986 | Bacteria | 1764 |
| 360 | Ga0207677_10059785 | 3300026023 | Bacteria | 2630 |
| 361 | Ga0207677_10106326 | 3300026023 | Bacteria | 2079 |
| 362 | Ga0207703_10070426 | 3300026035 | Bacteria | 2886 |
| 363 | Ga0207639_10001773 | 3300026041 | Bacteria | 14523 |
| 364 | Ga0207678_10008386 | 3300026067 | Bacteria | 9116 |
| 365 | Ga0207708_10332147 | 3300026075 | Bacteria | 1243 |
| 366 | Ga0207708_10981637 | 3300026075 | Unclassified | 733 |
| 367 | Ga0207702_10001150 | 3300026078 | Bacteria | 27070 |
| 368 | Ga0207702_10878038 | 3300026078 | Bacteria | 888 |
| 369 | Ga0207641_10015083 | 3300026088 | Bacteria | 6333 |
| 370 | Ga0207641_10847736 | 3300026088 | Bacteria | 906 |
| 371 | Ga0207641_11486583 | 3300026088 | Bacteria | 679 |
| 372 | Ga0207641_12031528 | 3300026088 | Bacteria | 576 |
| 373 | Ga0207648_10001239 | 3300026089 | Bacteria | 28649 |
| 374 | Ga0207648_10170983 | 3300026089 | Bacteria | 1921 |
| 375 | Ga0207648_10870627 | 3300026089 | Bacteria | 841 |
| 376 | Ga0207676_10001946 | 3300026095 | Bacteria | 15063 |
| 377 | Ga0207674_10000684 | 3300026116 | Bacteria | 44066 |
| 378 | Ga0207674_10092508 | 3300026116 | Bacteria | 3014 |
| 379 | Ga0207674_12092395 | 3300026116 | Bacteria | 530 |
| 380 | Ga0207675_100007470 | 3300026118 | Bacteria | 10328 |
| 381 | Ga0207675_100013598 | 3300026118 | Bacteria | 7598 |
| 382 | Ga0207675_100228367 | 3300026118 | Bacteria | 1795 |
| 383 | Ga0207675_100353683 | 3300026118 | Bacteria | 1440 |
| 384 | Ga0207683_10309953 | 3300026121 | Bacteria | 1445 |
| 385 | Ga0207698_10258374 | 3300026142 | Bacteria | 1599 |
| 386 | Ga0209969_1004099 | 3300027360 | Bacteria | 2037 |
| 387 | Ga0209981_1000769 | 3300027378 | Bacteria | 4058 |
| 388 | Ga0209996_1019501 | 3300027395 | Bacteria | 947 |
| 389 | Ga0209984_1004388 | 3300027424 | Bacteria | 1661 |
| 390 | Ga0210000_1000448 | 3300027462 | Bacteria | 5673 |
| 391 | Ga0209995_1000374 | 3300027471 | Bacteria | 6947 |
| 392 | Ga0209968_1001337 | 3300027526 | Bacteria | 3744 |
| 393 | Ga0209999_1000584 | 3300027543 | Bacteria | 5759 |
| 394 | Ga0209982_1000382 | 3300027552 | Bacteria | 5370 |
| 395 | Ga0209970_1003011 | 3300027614 | Bacteria | 2839 |
| 396 | Ga0210002_1000361 | 3300027617 | Bacteria | 6201 |
| 397 | Ga0209983_1000369 | 3300027665 | Bacteria | 9555 |
| 398 | Ga0209588_1000615 | 3300027671 | Bacteria | 9019 |
| 399 | Ga0209971_1000010 | 3300027682 | Bacteria | 84272 |
| 400 | Ga0209971_1014366 | 3300027682 | Bacteria | 1876 |
| 401 | Ga0209966_1000255 | 3300027695 | Bacteria | 19477 |
| 402 | Ga0209998_10000131 | 3300027717 | Bacteria | 29645 |
| 403 | Ga0209974_10011978 | 3300027876 | Bacteria | 2905 |
| 404 | Ga0209974_10090727 | 3300027876 | Bacteria | 1059 |
| 405 | Ga0207428_10042512 | 3300027907 | Bacteria | 3675 |
| 406 | Ga0207428_10393401 | 3300027907 | Bacteria | 1015 |
| 407 | Ga0268265_10003910 | 3300028380 | Bacteria | 10504 |
| 408 | Ga0268265_10103562 | 3300028380 | Bacteria | 2305 |
| 409 | Ga0268265_10159525 | 3300028380 | Bacteria | 1914 |
| 410 | Ga0268265_10645417 | 3300028380 | Bacteria | 1017 |
| 411 | Ga0268265_10837138 | 3300028380 | Unclassified | 899 |
| 412 | Ga0268264_10005855 | 3300028381 | Bacteria | 10408 |
| 413 | Ga0268264_10030130 | 3300028381 | Bacteria | 4448 |
| 414 | Ga0268264_10057388 | 3300028381 | Bacteria | 3257 |
| 415 | Ga0268264_10373112 | 3300028381 | Bacteria | 1364 |
| 416 | Ga0268264_11031500 | 3300028381 | Bacteria | 830 |
| 417 | Ga0268264_11090185 | 3300028381 | Bacteria | 807 |
| 418 | Ga0265318_10102767 | 3300028577 | Bacteria | 1051 |
| 419 | Ga0307508_10136445 | 3300031616 | Bacteria | 2057 |
| 420 | Ga0265314_10211614 | 3300031711 | Bacteria | 1138 |
| 421 | Ga0316576_10085343 | 3300031727 | Unclassified | 2347 |
| 422 | Ga0316576_10285515 | 3300031727 | Bacteria | 1235 |
| 423 | Ga0307406_10041134 | 3300031901 | Bacteria | 2878 |
| 424 | Ga0307407_10005376 | 3300031903 | Bacteria | 5554 |
| 425 | Ga0307412_10256423 | 3300031911 | Bacteria | 1361 |
| 426 | Ga0307409_100570645 | 3300031995 | Bacteria | 1114 |
| 427 | Ga0307409_100904098 | 3300031995 | Bacteria | 897 |
| 428 | Ga0307416_100176682 | 3300032002 | Bacteria | 1996 |
| 429 | Ga0307416_101048583 | 3300032002 | Bacteria | 919 |
| 430 | Ga0307411_10695716 | 3300032005 | Bacteria | 885 |
| 431 | Ga0307415_100073836 | 3300032126 | Bacteria | 2408 |
| 432 | Ga0307415_100312714 | 3300032126 | Bacteria | 1306 |
| 433 | Ga0373948_0049804 | 3300034817 | Bacteria | 897 |
| 434 | Ga0373929_0000028 | 3300035085 | Bacteria | 51775 |
| 435 | Ga0373934_0043704 | 3300035086 | Bacteria | 1771 |
| 436 | Ga0373949_0013924 | 3300035090 | Bacteria | 1788 |
| 437 | Ga0373949_0015575 | 3300035090 | Bacteria | 1700 |
| 438 | Ga0373951_0008441 | 3300035091 | Bacteria | 2328 |
| 439 | Ga0373952_0008087 | 3300035092 | Bacteria | 1988 |
| 440 | Ga0373923_0063776 | 3300035111 | Bacteria | 1570 |
| 441 | Ga0373939_0065523 | 3300035114 | Bacteria | 1169 |
| 442 | Ga0373956_0009666 | 3300035119 | Bacteria | 3926 |
| 443 | Ga0373956_0376109 | 3300035119 | Bacteria | 677 |
| 444 | Ga0373960_0088943 | 3300035121 | Bacteria | 984 |
| 445 | Ga0373955_0024400 | 3300035172 | Bacteria | 3093 |
| 446 | Ga0373961_0013978 | 3300035241 | Bacteria | 2032 |
| 447 | Ga0373962_0191583 | 3300035242 | Bacteria | 688 |
| 448 | Ga0373924_0057007 | 3300035410 | Bacteria | 1628 |
| 449 | Ga0373931_0100911 | 3300035691 | Bacteria | 1623 |
| 450 | Ga0373935_0107433 | 3300035692 | Bacteria | 1848 |
| 451 | Ga0373935_0764871 | 3300035692 | Bacteria | 712 |
| 452 | Ga0373927_0177129 | 3300035695 | Bacteria | 1398 |
| 453 | Ga0373927_0743036 | 3300035695 | Bacteria | 648 |
| 454 | Ga0373933_0037611 | 3300035724 | Bacteria | 2840 |
| 455 | Ga0373933_0099958 | 3300035724 | Bacteria | 1799 |
| 456 | Ga0373947_0093565 | 3300035725 | Bacteria | 1879 |
| 457 | Ga0373947_0191145 | 3300035725 | Bacteria | 1336 |
| 458 | Ga0373947_0953908 | 3300035725 | Bacteria | 585 |
| 459 | Ga0373937_0026867 | 3300036401 | Bacteria | 5203 |
| 460 | Ga0373937_1537906 | 3300036401 | Bacteria | 613 |
| 461 | Ga0373937_1953352 | 3300036401 | Bacteria | 533 |
| 462 | Ga0316584_0020695 | 3300036712 | Bacteria | 4773 |
| 463 | Ga0373925_0875889 | 3300037068 | Bacteria | 740 |
| 464 | Ga0395899_0530276 | 3300037312 | Bacteria | 760 |
| 465 | Ga0395900_1265827 | 3300037418 | Bacteria | 652 |
| 466 | Ga0395905_1102576 | 3300037471 | Bacteria | 697 |
| 467 | Ga0436364_1035773 | 3300037853 | Bacteria | 1027 |
| 468 | Ga0436364_1556529 | 3300037853 | Bacteria | 20506 |
| 469 | Ga0242419_007769 | 3300038698 | Bacteria | 795 |
| 470 | Ga0436365_0065915 | 3300039437 | Bacteria | 6828 |
| 471 | Ga0436365_0149285 | 3300039437 | Bacteria | 9298 |
| 472 | Ga0436365_0159496 | 3300039437 | Bacteria | 17926 |
| 473 | Ga0436365_0798370 | 3300039437 | Bacteria | 1269 |
| 474 | Ga0436365_1038217 | 3300039437 | Bacteria | 1138 |
| 475 | Ga0436365_1188467 | 3300039437 | Bacteria | 8003 |
| 476 | Ga0436365_1923113 | 3300039437 | Bacteria | 57992 |
| 477 | Ga0436360_0649357 | 3300039438 | Bacteria | 581 |
| 478 | Ga0436361_0972566 | 3300039447 | Bacteria | 640 |
| 479 | Ga0436363_0853455 | 3300039450 | Bacteria | 563 |
| 480 | Ga0436362_0627738 | 3300039453 | Bacteria | 1790 |
| 481 | Ga0436362_0639565 | 3300039453 | Bacteria | 1737 |
| 482 | Ga0436362_1060922 | 3300039453 | Bacteria | 510 |
| 483 | Ga0439465_0347289 | 3300041413 | Bacteria | 560 |
| 484 | Ga0451845_0815444 | 3300041501 | Bacteria | 626 |
| 485 | Ga0451853_3803030 | 3300041512 | Bacteria | 653 |
| 486 | Ga0439448_0003629 | 3300042005 | Bacteria | 4299 |
| 487 | Ga0439448_0007395 | 3300042005 | Bacteria | 3184 |
| 488 | Ga0439454_054371 | 3300042011 | Bacteria | 683 |
| 489 | Ga0439463_034283 | 3300042016 | Bacteria | 1284 |
| 490 | Ga0439458_0006751 | 3300042157 | Bacteria | 2557 |
| 491 | Ga0439458_0014062 | 3300042157 | Bacteria | 1805 |
| 492 | Ga0439458_0163144 | 3300042157 | Bacteria | 600 |
| 493 | Ga0439464_0017027 | 3300042439 | Bacteria | 1968 |
| 494 | Ga0439460_0000656 | 3300042461 | Bacteria | 7607 |
| 495 | Ga0439460_0200733 | 3300042461 | Bacteria | 679 |
| 496 | Ga0451577_0003247 | 3300042876 | Bacteria | 18283 |
| 497 | Ga0451577_0009390 | 3300042876 | Bacteria | 9428 |
| 498 | Ga0451577_0044898 | 3300042876 | Bacteria | 3955 |
| 499 | Ga0451577_0222053 | 3300042876 | Bacteria | 1708 |
| 500 | Ga0451577_0293457 | 3300042876 | Bacteria | 1473 |
| 501 | Ga0451577_0908790 | 3300042876 | Bacteria | 793 |
| 502 | Ga0451577_1162853 | 3300042876 | Bacteria | 689 |
| 503 | Ga0453683_0011056 | 3300044673 | Bacteria | 5967 |
| 504 | Ga0453683_0022003 | 3300044673 | Bacteria | 4067 |
| 505 | Ga0453683_0022838 | 3300044673 | Bacteria | 3989 |
| 506 | Ga0453683_0190765 | 3300044673 | Bacteria | 1300 |
| 507 | Ga0453683_0299343 | 3300044673 | Bacteria | 1029 |
| 508 | Ga0453684_0001130 | 3300044712 | Bacteria | 83545 |
| 509 | Ga0453684_0035005 | 3300044712 | Bacteria | 6953 |
| 510 | Ga0453684_0061790 | 3300044712 | Bacteria | 4806 |
| 511 | Ga0453684_0132775 | 3300044712 | Bacteria | 2985 |
| 512 | Ga0453684_0199755 | 3300044712 | Bacteria | 2332 |
| 513 | Ga0453684_0357088 | 3300044712 | Bacteria | 1646 |
| 514 | Ga0453684_1893686 | 3300044712 | Bacteria | 604 |
| 515 | Ga0466960_0013814 | 3300044901 | Bacteria | 3441 |
| 516 | Ga0466959_0067718 | 3300045049 | Bacteria | 2588 |
| 517 | Ga0451576_0014386 | 3300045051 | Bacteria | 8809 |
| 518 | Ga0451576_0020073 | 3300045051 | Bacteria | 7283 |
| 519 | Ga0451576_0093517 | 3300045051 | Bacteria | 3126 |
| 520 | Ga0451576_0192138 | 3300045051 | Bacteria | 2132 |
| 521 | Ga0451576_0372843 | 3300045051 | Bacteria | 1495 |
| 522 | Ga0451576_2229617 | 3300045051 | Bacteria | 562 |
| 523 | Ga0466967_0425912 | 3300045976 | Bacteria | 1294 |
| 524 | Ga0495592_0275108 | 3300046454 | Bacteria | 1103 |
| 525 | Ga0495603_0004360 | 3300046455 | Bacteria | 8441 |
| 526 | Ga0495651_0037217 | 3300046462 | Bacteria | 3788 |
| 527 | Ga0495580_0106354 | 3300046472 | Bacteria | 1949 |
| 528 | Ga0495580_0416772 | 3300046472 | Bacteria | 904 |
| 529 | Ga0495580_0425687 | 3300046472 | Bacteria | 892 |
| 530 | Ga0495580_0528159 | 3300046472 | Bacteria | 786 |
| 531 | Ga0495662_0431744 | 3300046476 | Bacteria | 647 |
| 532 | Ga0495584_0237315 | 3300046491 | Bacteria | 927 |
| 533 | Ga0495596_0187756 | 3300046500 | Bacteria | 804 |
| 534 | Ga0495628_0145056 | 3300046516 | Bacteria | 1810 |
| 535 | Ga0495631_0260290 | 3300046518 | Bacteria | 739 |
| 536 | Ga0495644_0141544 | 3300046523 | Bacteria | 919 |
| 537 | Ga0495663_0084865 | 3300046525 | Bacteria | 1025 |
| 538 | Ga0495642_0163843 | 3300046528 | Bacteria | 965 |
| 539 | Ga0495598_0074727 | 3300046537 | Bacteria | 1075 |
| 540 | Ga0495609_0040345 | 3300046538 | Bacteria | 2101 |
| 541 | Ga0495656_0115743 | 3300046615 | Bacteria | 1260 |
| 542 | Ga0495656_0401558 | 3300046615 | Bacteria | 717 |
| 543 | Ga0495659_0058969 | 3300046664 | Bacteria | 1414 |
| 544 | Ga0495588_0044320 | 3300046674 | Bacteria | 2278 |
| 545 | Ga0495658_0382657 | 3300046683 | Bacteria | 896 |
| 546 | Ga0495658_0449008 | 3300046683 | Bacteria | 823 |
| 547 | Ga0495613_0453497 | 3300046689 | Bacteria | 869 |
| 548 | Ga0495670_0069468 | 3300046691 | Bacteria | 1781 |
| 549 | Ga0495589_0352612 | 3300046794 | Bacteria | 678 |
| 550 | Ga0495676_0029660 | 3300047321 | Bacteria | 4656 |
| 551 | Ga0495680_0253393 | 3300047322 | Bacteria | 1247 |
| 552 | Ga0495593_0450376 | 3300047673 | Bacteria | 644 |
| 553 | Ga0495615_0307389 | 3300048090 | Bacteria | 515 |
| 554 | Ga0495626_0350011 | 3300048091 | Bacteria | 577 |
| 555 | Ga0496100_0009320 | 3300048903 | Bacteria | 5515 |
| 556 | Ga0496101_0033968 | 3300048904 | Bacteria | 3601 |
| 557 | Ga0496102_0120610 | 3300048905 | Bacteria | 2449 |
| 558 | Ga0496102_0322978 | 3300048905 | Bacteria | 1454 |
| 559 | Ga0496103_0125572 | 3300048906 | Bacteria | 1636 |
| 560 | Ga0496103_1052771 | 3300048906 | Bacteria | 505 |
| 561 | Ga0496104_0139756 | 3300048907 | Bacteria | 2327 |
| 562 | Ga0496104_0240883 | 3300048907 | Bacteria | 1721 |
| 563 | Ga0496104_0389654 | 3300048907 | Bacteria | 1306 |
| 564 | Ga0496106_0005863 | 3300048909 | Bacteria | 9086 |
| 565 | Ga0496107_0056043 | 3300048910 | Bacteria | 2847 |
| 566 | Ga0496108_0341688 | 3300048911 | Bacteria | 1306 |
| 567 | Ga0496109_0330170 | 3300048912 | Bacteria | 1440 |
| 568 | Ga0496109_1810577 | 3300048912 | Bacteria | 544 |
| 569 | Ga0496110_0105058 | 3300048913 | Bacteria | 2534 |
| 570 | Ga0496110_0274048 | 3300048913 | Bacteria | 1536 |
| 571 | Ga0496112_0259028 | 3300048915 | Bacteria | 1689 |
| 572 | Ga0496113_0230130 | 3300048916 | Bacteria | 1478 |
| 573 | Ga0496114_0193498 | 3300048917 | Bacteria | 1780 |
| 574 | Ga0496114_1635590 | 3300048917 | Bacteria | 532 |
| 575 | Ga0496115_1058152 | 3300048918 | Bacteria | 617 |
| 576 | Ga0496121_0239401 | 3300048924 | Bacteria | 1266 |
| 577 | Ga0501031_0013951 | 3300049568 | Bacteria | 5233 |
| 578 | Ga0501031_0025568 | 3300049568 | Bacteria | 3850 |
| 579 | Ga0501031_0709142 | 3300049568 | Bacteria | 646 |
| 580 | Ga0501032_0329505 | 3300049569 | Bacteria | 985 |
| 581 | Ga0501032_0693990 | 3300049569 | Bacteria | 645 |
| 582 | Ga0501033_0073110 | 3300049570 | Bacteria | 2517 |
| 583 | Ga0501033_0168364 | 3300049570 | Bacteria | 1574 |
| 584 | Ga0501033_0318659 | 3300049570 | Bacteria | 1092 |
| 585 | Ga0501033_0322376 | 3300049570 | Bacteria | 1085 |
| 586 | Ga0501034_0003490 | 3300049571 | Bacteria | 17860 |
| 587 | Ga0501036_0007145 | 3300049572 | Bacteria | 9093 |
| 588 | Ga0501036_0180149 | 3300049572 | Bacteria | 1779 |
| 589 | Ga0501036_0305736 | 3300049572 | Bacteria | 1330 |
| 590 | Ga0501036_0328150 | 3300049572 | Bacteria | 1278 |
| 591 | Ga0501036_0705688 | 3300049572 | Bacteria | 833 |
| 592 | Ga0501036_0716310 | 3300049572 | Bacteria | 826 |
| 593 | Ga0501036_0831054 | 3300049572 | Bacteria | 760 |
| 594 | Ga0501036_1231675 | 3300049572 | Bacteria | 609 |
| 595 | Ga0501037_0032414 | 3300049573 | Bacteria | 3858 |
| 596 | Ga0501037_0053145 | 3300049573 | Bacteria | 2963 |
| 597 | Ga0501038_0017563 | 3300049574 | Bacteria | 6468 |
| 598 | Ga0501038_0021842 | 3300049574 | Bacteria | 5740 |
| 599 | Ga0501038_0030031 | 3300049574 | Bacteria | 4812 |
| 600 | Ga0501039_0007616 | 3300049575 | Bacteria | 8272 |
| 601 | Ga0501039_0010519 | 3300049575 | Bacteria | 7051 |
| 602 | Ga0501039_0020587 | 3300049575 | Bacteria | 5055 |
| 603 | Ga0501039_0153733 | 3300049575 | Bacteria | 1807 |
| 604 | Ga0501039_0192267 | 3300049575 | Bacteria | 1605 |
| 605 | Ga0501039_0212800 | 3300049575 | Bacteria | 1520 |
| 606 | Ga0501039_0397720 | 3300049575 | Bacteria | 1082 |
| 607 | Ga0501040_0000885 | 3300049576 | Bacteria | 18814 |
| 608 | Ga0501040_0006494 | 3300049576 | Bacteria | 7594 |
| 609 | Ga0501040_0010600 | 3300049576 | Bacteria | 6027 |
| 610 | Ga0501040_0036168 | 3300049576 | Bacteria | 3350 |
| 611 | Ga0501040_0043429 | 3300049576 | Bacteria | 3064 |
| 612 | Ga0501040_0231372 | 3300049576 | Bacteria | 1316 |
| 613 | Ga0501040_0357348 | 3300049576 | Bacteria | 1047 |
| 614 | Ga0501041_0012864 | 3300049577 | Bacteria | 4957 |
| 615 | Ga0501041_0158836 | 3300049577 | Bacteria | 1413 |
| 616 | Ga0501041_0162426 | 3300049577 | Bacteria | 1397 |
| 617 | Ga0501041_0187160 | 3300049577 | Bacteria | 1296 |
| 618 | Ga0501041_0365065 | 3300049577 | Bacteria | 913 |
| 619 | Ga0501042_0002826 | 3300049578 | Bacteria | 10752 |
| 620 | Ga0501042_0007869 | 3300049578 | Bacteria | 7011 |
| 621 | Ga0501042_0017392 | 3300049578 | Bacteria | 4958 |
| 622 | Ga0501042_0080804 | 3300049578 | Bacteria | 2329 |
| 623 | Ga0501042_0114812 | 3300049578 | Bacteria | 1939 |
| 624 | Ga0501043_0079293 | 3300049579 | Bacteria | 2580 |
| 625 | Ga0501043_0598354 | 3300049579 | Bacteria | 815 |
| 626 | Ga0501046_0012826 | 3300049580 | Bacteria | 7129 |
| 627 | Ga0501046_0131160 | 3300049580 | Bacteria | 1901 |
| 628 | Ga0501046_0195152 | 3300049580 | Bacteria | 1509 |
| 629 | Ga0501047_0439684 | 3300049581 | Bacteria | 1134 |
| 630 | Ga0501047_1083825 | 3300049581 | Bacteria | 614 |
| 631 | Ga0501048_0007737 | 3300049582 | Bacteria | 8146 |
| 632 | Ga0501048_0010796 | 3300049582 | Bacteria | 6809 |
| 633 | Ga0501048_0493595 | 3300049582 | Bacteria | 878 |
| 634 | Ga0501067_0108009 | 3300049583 | Bacteria | 1547 |
| 635 | Ga0501067_0338877 | 3300049583 | Bacteria | 838 |
| 636 | Ga0501067_0538702 | 3300049583 | Bacteria | 654 |
| 637 | Ga0501068_0013113 | 3300049584 | Bacteria | 4711 |
| 638 | Ga0501068_0034399 | 3300049584 | Bacteria | 3022 |
| 639 | Ga0501068_0037885 | 3300049584 | Bacteria | 2887 |
| 640 | Ga0501068_0252952 | 3300049584 | Bacteria | 1123 |
| 641 | Ga0501068_1017447 | 3300049584 | Bacteria | 547 |
| 642 | Ga0501069_0058078 | 3300049585 | Bacteria | 2158 |
| 643 | Ga0501070_0122104 | 3300049586 | Bacteria | 2153 |
| 644 | Ga0501070_1079479 | 3300049586 | Bacteria | 620 |
| 645 | Ga0501070_1388773 | 3300049586 | Bacteria | 534 |
| 646 | Ga0501071_0011839 | 3300049587 | Bacteria | 5888 |
| 647 | Ga0501071_0027014 | 3300049587 | Bacteria | 4035 |
| 648 | Ga0501071_0034337 | 3300049587 | Bacteria | 3609 |
| 649 | Ga0501071_0062016 | 3300049587 | Bacteria | 2708 |
| 650 | Ga0501071_0120637 | 3300049587 | Bacteria | 1943 |
| 651 | Ga0501071_0276282 | 3300049587 | Bacteria | 1271 |
| 652 | Ga0501072_0005345 | 3300049588 | Bacteria | 9775 |
| 653 | Ga0501072_0039140 | 3300049588 | Bacteria | 3723 |
| 654 | Ga0501072_0096302 | 3300049588 | Bacteria | 2352 |
| 655 | Ga0501072_0170743 | 3300049588 | Bacteria | 1735 |
| 656 | Ga0501072_0739054 | 3300049588 | Bacteria | 772 |
| 657 | Ga0501074_0011455 | 3300049590 | Bacteria | 6451 |
| 658 | Ga0501074_0019507 | 3300049590 | Bacteria | 4923 |
| 659 | Ga0501074_0044122 | 3300049590 | Bacteria | 3228 |
| 660 | Ga0501074_0200388 | 3300049590 | Bacteria | 1423 |
| 661 | Ga0501074_0244486 | 3300049590 | Bacteria | 1276 |
| 662 | Ga0501074_0258165 | 3300049590 | Bacteria | 1239 |
| 663 | Ga0501074_0279054 | 3300049590 | Bacteria | 1188 |
| 664 | Ga0501074_0480048 | 3300049590 | Bacteria | 881 |
| 665 | Ga0501075_0003166 | 3300049591 | Bacteria | 11013 |
| 666 | Ga0501075_0005476 | 3300049591 | Bacteria | 8679 |
| 667 | Ga0501075_0007758 | 3300049591 | Bacteria | 7447 |
| 668 | Ga0501075_0030602 | 3300049591 | Bacteria | 3988 |
| 669 | Ga0501075_0042762 | 3300049591 | Bacteria | 3398 |
| 670 | Ga0501075_0049635 | 3300049591 | Bacteria | 3154 |
| 671 | Ga0501075_0057804 | 3300049591 | Bacteria | 2920 |
| 672 | Ga0501075_0118040 | 3300049591 | Bacteria | 2017 |
| 673 | Ga0501075_0345191 | 3300049591 | Bacteria | 1134 |
| 674 | Ga0501076_0014869 | 3300049592 | Bacteria | 5873 |
| 675 | Ga0501076_0020633 | 3300049592 | Bacteria | 5044 |
| 676 | Ga0501076_0033458 | 3300049592 | Bacteria | 4013 |
| 677 | Ga0501076_0118119 | 3300049592 | Bacteria | 2146 |
| 678 | Ga0501077_0005709 | 3300049593 | Bacteria | 7577 |
| 679 | Ga0501077_0013053 | 3300049593 | Bacteria | 5205 |
| 680 | Ga0501077_0027984 | 3300049593 | Bacteria | 3582 |
| 681 | Ga0501077_0051345 | 3300049593 | Bacteria | 2620 |
| 682 | Ga0501077_0054086 | 3300049593 | Bacteria | 2549 |
| 683 | Ga0501077_0186555 | 3300049593 | Bacteria | 1318 |
| 684 | Ga0501077_0247044 | 3300049593 | Bacteria | 1134 |
| 685 | Ga0501077_0873358 | 3300049593 | Bacteria | 578 |
| 686 | Ga0501079_0009197 | 3300049741 | Bacteria | 7483 |
| 687 | Ga0501079_0009731 | 3300049741 | Bacteria | 7290 |
| 688 | Ga0501079_0028150 | 3300049741 | Bacteria | 4311 |
| 689 | Ga0501079_0066696 | 3300049741 | Bacteria | 2777 |
| 690 | Ga0501079_0203906 | 3300049741 | Bacteria | 1545 |
| 691 | Ga0501079_0210680 | 3300049741 | Bacteria | 1518 |
| 692 | Ga0501079_0306306 | 3300049741 | Bacteria | 1243 |
| 693 | Ga0501079_0655325 | 3300049741 | Bacteria | 826 |
| 694 | Ga0501080_0061904 | 3300049742 | Bacteria | 3483 |
| 695 | Ga0501080_0152626 | 3300049742 | Bacteria | 2134 |
| 696 | Ga0501080_0623023 | 3300049742 | Bacteria | 956 |
| 697 | Ga0501080_0642030 | 3300049742 | Bacteria | 940 |
| 698 | Ga0501081_0002929 | 3300049743 | Bacteria | 10827 |
| 699 | Ga0501081_0003735 | 3300049743 | Bacteria | 9757 |
| 700 | Ga0501081_0009042 | 3300049743 | Bacteria | 6476 |
| 701 | Ga0501081_0042247 | 3300049743 | Bacteria | 3123 |
| 702 | Ga0501081_0288431 | 3300049743 | Bacteria | 1203 |
| 703 | Ga0501081_0339687 | 3300049743 | Bacteria | 1106 |
| 704 | Ga0501081_0615870 | 3300049743 | Bacteria | 813 |
| 705 | Ga0501083_0038291 | 3300049744 | Bacteria | 3261 |
| 706 | Ga0501083_0116688 | 3300049744 | Bacteria | 1752 |
| 707 | Ga0501083_0707257 | 3300049744 | Bacteria | 655 |
| 708 | Ga0501035_0016960 | 3300049822 | Bacteria | 6713 |
| 709 | Ga0501035_0045706 | 3300049822 | Bacteria | 3939 |
| 710 | Ga0501035_0126569 | 3300049822 | Bacteria | 2230 |
| 711 | Ga0501035_0504818 | 3300049822 | Bacteria | 995 |
| 712 | Ga0501044_0209536 | 3300049823 | Bacteria | 1904 |
| 713 | Ga0501045_0008137 | 3300049824 | Bacteria | 7304 |
| 714 | Ga0501045_0008966 | 3300049824 | Bacteria | 6986 |
| 715 | Ga0501045_0009528 | 3300049824 | Bacteria | 6794 |
| 716 | Ga0501045_0025545 | 3300049824 | Bacteria | 4247 |
| 717 | Ga0501045_0410569 | 3300049824 | Bacteria | 1007 |
| 718 | Ga0501045_0443670 | 3300049824 | Bacteria | 965 |
| 719 | Ga0501045_0632829 | 3300049824 | Bacteria | 791 |
| 720 | nmdc:mga05p37_1563043_c1 | 3300050507 | Bacteria | 652 |
| 721 | nmdc:mga05p37_26584_c1 | 3300050507 | Bacteria | 7037 |
| 722 | nmdc:mga05p37_272902_c1 | 3300050507 | Bacteria | 2020 |
| 723 | nmdc:mga05p37_273740_c1 | 3300050507 | Bacteria | 2016 |
| 724 | nmdc:mga05p37_28340_c1 | 3300050507 | Bacteria | 6829 |
| 725 | nmdc:mga05p37_433989_c1 | 3300050507 | Bacteria | 1525 |
| 726 | nmdc:mga05p37_680441_c1 | 3300050507 | Bacteria | 1147 |
| 727 | nmdc:mga05p37_812233_c1 | 3300050507 | Bacteria | 1021 |
| 728 | nmdc:mga05p37_98011_c1 | 3300050507 | Bacteria | 3611 |
| 729 | nmdc:mga05p37_99530_c1 | 3300050507 | Bacteria | 3581 |
| 730 | nmdc:mga09592_149218_c1 | 3300050508 | Bacteria | 2017 |
| 731 | nmdc:mga09592_671355_c1 | 3300050508 | Bacteria | 884 |
| 732 | nmdc:mga09592_88802_c1 | 3300050508 | Bacteria | 2640 |
| 733 | nmdc:mga0qj67_12234_c1 | 3300050509 | Bacteria | 6461 |
| 734 | nmdc:mga0qj67_4345_c1 | 3300050509 | Bacteria | 10265 |
| 735 | nmdc:mga0qj67_964082_c1 | 3300050509 | Bacteria | 670 |
| 736 | nmdc:mga06r32_430972_c1 | 3300050510 | Bacteria | 1299 |
| 737 | nmdc:mga06r32_498544_c1 | 3300050510 | Bacteria | 1195 |
| 738 | nmdc:mga06r32_703_c1 | 3300050510 | Bacteria | 29212 |
| 739 | nmdc:mga06r32_803524_c1 | 3300050510 | Bacteria | 901 |
| 740 | nmdc:mga08y16_16924_c1 | 3300050511 | Bacteria | 7678 |
| 741 | nmdc:mga08y16_329624_c1 | 3300050511 | Bacteria | 1571 |
| 742 | nmdc:mga08y16_724760_c1 | 3300050511 | Bacteria | 992 |
| 743 | nmdc:mga0n895_1499482_c1 | 3300050512 | Bacteria | 641 |
| 744 | nmdc:mga0n895_179144_c1 | 3300050512 | Bacteria | 2151 |
| 745 | nmdc:mga0n895_668_c1 | 3300050512 | Bacteria | 24028 |
| 746 | nmdc:mga0rr50_20722_c1 | 3300050513 | Bacteria | 4471 |
| 747 | nmdc:mga0rr50_2913_c1 | 3300050513 | Bacteria | 9767 |
| 748 | nmdc:mga0rr50_36476_c1 | 3300050513 | Bacteria | 3541 |
| 749 | nmdc:mga08x19_1014015_c1 | 3300050514 | Bacteria | 590 |
| 750 | nmdc:mga08x19_104417_c1 | 3300050514 | Bacteria | 1883 |
| 751 | nmdc:mga08x19_342440_c1 | 3300050514 | Bacteria | 1043 |
| 752 | nmdc:mga0a205_155086_c1 | 3300050515 | Bacteria | 2189 |
| 753 | nmdc:mga0a205_63894_c1 | 3300050515 | Bacteria | 3556 |
| 754 | Ga0495601_0000762 | 3300053077 | Bacteria | 17373 |
| 755 | Ga0495655_0172144 | 3300053083 | Bacteria | 694 |
| 756 | Ga0495655_0269400 | 3300053083 | Bacteria | 577 |
| 757 | Ga0495619_0147497 | 3300053085 | Bacteria | 1622 |
| 758 | Ga0500555_029926 | 3300053103 | Bacteria | 1547 |
| 759 | Ga0500588_0023315 | 3300053146 | Bacteria | 1695 |
| 760 | Ga0500616_0068560 | 3300053153 | Bacteria | 1816 |
| 761 | Ga0501084_0003271 | 3300054114 | Bacteria | 13106 |
| 762 | Ga0501084_0007539 | 3300054114 | Bacteria | 8973 |
| 763 | Ga0501084_0017956 | 3300054114 | Bacteria | 5890 |
| 764 | Ga0501084_0021951 | 3300054114 | Bacteria | 5324 |
| 765 | Ga0501084_0034515 | 3300054114 | Bacteria | 4230 |
| 766 | Ga0501084_0041563 | 3300054114 | Bacteria | 3846 |
| 767 | Ga0501084_0422315 | 3300054114 | Bacteria | 1127 |
| 768 | Ga0501084_0465829 | 3300054114 | Bacteria | 1068 |
| 769 | Ga0501084_0481214 | 3300054114 | Bacteria | 1049 |
| 770 | Ga0501084_0794106 | 3300054114 | Bacteria | 797 |
| 771 | Ga0501084_1725565 | 3300054114 | Bacteria | 523 |
| 772 | Ga0590075_012782 | 3300059424 | Bacteria | 2041 |
| 773 | Ga0590077_025123 | 3300059426 | Bacteria | 1282 |
| 774 | Ga0501082_0023555 | 3300060353 | Bacteria | 5311 |
| 775 | Ga0501082_0082580 | 3300060353 | Bacteria | 2772 |
| 776 | Ga0501082_0213485 | 3300060353 | Bacteria | 1679 |
| 777 | Ga0501082_0222189 | 3300060353 | Bacteria | 1643 |
| 778 | Ga0501082_0225619 | 3300060353 | Bacteria | 1630 |
| 779 | Ga0501082_0362076 | 3300060353 | Bacteria | 1265 |
| 780 | Ga0501082_0676467 | 3300060353 | Bacteria | 903 |
| 781 | Ga0501082_0766326 | 3300060353 | Bacteria | 844 |
| 782 | Ga0530510_0008059 | 3300061734 | Bacteria | 7348 |
| 783 | Ga0530510_0052923 | 3300061734 | Bacteria | 2933 |
| 784 | Ga0530510_0172641 | 3300061734 | Bacteria | 1601 |
| 785 | Ga0530510_0260285 | 3300061734 | Bacteria | 1294 |
| 786 | Ga0530510_0309684 | 3300061734 | Bacteria | 1183 |
| 787 | Ga0530510_0427310 | 3300061734 | Bacteria | 1000 |
| 788 | Ga0530510_1139024 | 3300061734 | Bacteria | 598 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026088 | Ga0207641_12031528 | Ga0207641_120315281 | 126 |
| 2 | 3300050511 | nmdc:mga08y16_724760_c1 | nmdc:mga08y16_724760_c1_213_656 | 128 |
| 3 | 3300025934 | Ga0207686_10181575 | Ga0207686_101815752 | 129 |
| 4 | 3300021358 | Ga0213873_10044432 | Ga0213873_100444321 | 130 |
| 5 | 3300031727 | Ga0316576_10285515 | Ga0316576_102855151 | 130 |
| 6 | 3300036712 | Ga0316584_0020695 | Ga0316584_0020695_2618_3028 | 130 |
| 7 | 3300005467 | Ga0070706_100672185 | Ga0070706_1006721851 | 131 |
| 8 | 3300005467 | Ga0070706_100934286 | Ga0070706_1009342862 | 131 |
| 9 | 3300006844 | Ga0075428_100000357 | Ga0075428_10000035742 | 131 |
| 10 | 3300006846 | Ga0075430_100001708 | Ga0075430_10000170812 | 131 |
| 11 | 3300006880 | Ga0075429_100003314 | Ga0075429_1000033143 | 131 |
| 12 | 3300005844 | Ga0068862_100000162 | Ga0068862_10000016239 | 132 |
| 13 | 3300025936 | Ga0207670_11731054 | Ga0207670_117310541 | 132 |
| 14 | 3300025960 | Ga0207651_10967057 | Ga0207651_109670571 | 132 |
| 15 | 3300026088 | Ga0207641_10847736 | Ga0207641_108477362 | 132 |
| 16 | 3300031901 | Ga0307406_10041134 | Ga0307406_100411342 | 132 |
| 17 | 3300031995 | Ga0307409_100904098 | Ga0307409_1009040982 | 132 |
| 18 | 3300035692 | Ga0373935_0107433 | Ga0373935_0107433_286_696 | 132 |
| 19 | 3300035725 | Ga0373947_0093565 | Ga0373947_0093565_1137_1547 | 132 |
| 20 | 3300039438 | Ga0436360_0649357 | Ga0436360_0649357_15_437 | 132 |
| 21 | 3300049570 | Ga0501033_0318659 | Ga0501033_0318659_88_486 | 132 |
| 22 | 3300049572 | Ga0501036_0328150 | Ga0501036_0328150_637_1035 | 132 |
| 23 | 3300049574 | Ga0501038_0030031 | Ga0501038_0030031_34_432 | 132 |
| 24 | 3300049575 | Ga0501039_0153733 | Ga0501039_0153733_416_814 | 132 |
| 25 | 3300049576 | Ga0501040_0006494 | Ga0501040_0006494_5041_5439 | 132 |
| 26 | 3300049578 | Ga0501042_0002826 | Ga0501042_0002826_8816_9214 | 132 |
| 27 | 3300049582 | Ga0501048_0010796 | Ga0501048_0010796_1238_1636 | 132 |
| 28 | 3300049587 | Ga0501071_0034337 | Ga0501071_0034337_1537_1935 | 132 |
| 29 | 3300049588 | Ga0501072_0039140 | Ga0501072_0039140_2203_2601 | 132 |
| 30 | 3300049590 | Ga0501074_0044122 | Ga0501074_0044122_2116_2514 | 132 |
| 31 | 3300049591 | Ga0501075_0007758 | Ga0501075_0007758_6098_6496 | 132 |
| 32 | 3300049592 | Ga0501076_0033458 | Ga0501076_0033458_2618_3016 | 132 |
| 33 | 3300049741 | Ga0501079_0028150 | Ga0501079_0028150_2374_2772 | 132 |
| 34 | 3300049742 | Ga0501080_0152626 | Ga0501080_0152626_949_1347 | 132 |
| 35 | 3300049743 | Ga0501081_0003735 | Ga0501081_0003735_7440_7838 | 132 |
| 36 | 3300049744 | Ga0501083_0116688 | Ga0501083_0116688_1180_1578 | 132 |
| 37 | 3300049822 | Ga0501035_0045706 | Ga0501035_0045706_1767_2165 | 132 |
| 38 | 3300049824 | Ga0501045_0025545 | Ga0501045_0025545_2794_3192 | 132 |
| 39 | 3300054114 | Ga0501084_0041563 | Ga0501084_0041563_1131_1529 | 132 |
| 40 | 3300060353 | Ga0501082_0023555 | Ga0501082_0023555_1847_2245 | 132 |
| 41 | 3300061734 | Ga0530510_0052923 | Ga0530510_0052923_1477_1875 | 132 |
| 42 | 3300005339 | Ga0070660_101401850 | Ga0070660_1014018501 | 133 |
| 43 | 3300005345 | Ga0070692_10240396 | Ga0070692_102403962 | 133 |
| 44 | 3300005435 | Ga0070714_100425045 | Ga0070714_1004250452 | 133 |
| 45 | 3300005445 | Ga0070708_100214732 | Ga0070708_1002147322 | 133 |
| 46 | 3300005843 | Ga0068860_100008113 | Ga0068860_10000811310 | 133 |
| 47 | 3300005844 | Ga0068862_100316117 | Ga0068862_1003161172 | 133 |
| 48 | 3300005937 | Ga0081455_10058331 | Ga0081455_100583312 | 133 |
| 49 | 3300006844 | Ga0075428_100023841 | Ga0075428_1000238415 | 133 |
| 50 | 3300006844 | Ga0075428_100294503 | Ga0075428_1002945032 | 133 |
| 51 | 3300009094 | Ga0111539_10073323 | Ga0111539_100733232 | 133 |
| 52 | 3300009147 | Ga0114129_10005541 | Ga0114129_100055414 | 133 |
| 53 | 3300009147 | Ga0114129_10040034 | Ga0114129_100400346 | 133 |
| 54 | 3300009147 | Ga0114129_10373878 | Ga0114129_103738782 | 133 |
| 55 | 3300009553 | Ga0105249_11280044 | Ga0105249_112800441 | 133 |
| 56 | 3300013105 | Ga0157369_10367991 | Ga0157369_103679912 | 133 |
| 57 | 3300013306 | Ga0163162_10856273 | Ga0163162_108562731 | 133 |
| 58 | 3300014326 | Ga0157380_10289878 | Ga0157380_102898782 | 133 |
| 59 | 3300021384 | Ga0213876_10004607 | Ga0213876_100046075 | 133 |
| 60 | 3300025926 | Ga0207659_11211582 | Ga0207659_112115821 | 133 |
| 61 | 3300026078 | Ga0207702_10878038 | Ga0207702_108780382 | 133 |
| 62 | 3300027907 | Ga0207428_10042512 | Ga0207428_100425123 | 133 |
| 63 | 3300028380 | Ga0268265_10159525 | Ga0268265_101595252 | 133 |
| 64 | 3300028381 | Ga0268264_10005855 | Ga0268264_100058559 | 133 |
| 65 | 3300035085 | Ga0373929_0000028 | Ga0373929_0000028_4379_4780 | 133 |
| 66 | 3300037418 | Ga0395900_1265827 | Ga0395900_1265827_155_556 | 133 |
| 67 | 3300037853 | Ga0436364_1035773 | Ga0436364_1035773_489_899 | 133 |
| 68 | 3300037853 | Ga0436364_1556529 | Ga0436364_1556529_16693_17103 | 133 |
| 69 | 3300039437 | Ga0436365_0149285 | Ga0436365_0149285_3096_3506 | 133 |
| 70 | 3300039437 | Ga0436365_1923113 | Ga0436365_1923113_5319_5729 | 133 |
| 71 | 3300039450 | Ga0436363_0853455 | Ga0436363_0853455_77_487 | 133 |
| 72 | 3300039453 | Ga0436362_0627738 | Ga0436362_0627738_913_1323 | 133 |
| 73 | 3300041413 | Ga0439465_0347289 | Ga0439465_0347289_128_529 | 133 |
| 74 | 3300044712 | Ga0453684_0061790 | Ga0453684_0061790_1006_1407 | 133 |
| 75 | 3300044901 | Ga0466960_0013814 | Ga0466960_0013814_1523_1933 | 133 |
| 76 | 3300045976 | Ga0466967_0425912 | Ga0466967_0425912_67_477 | 133 |
| 77 | 3300046518 | Ga0495631_0260290 | Ga0495631_0260290_326_727 | 133 |
| 78 | 3300046523 | Ga0495644_0141544 | Ga0495644_0141544_122_523 | 133 |
| 79 | 3300046537 | Ga0495598_0074727 | Ga0495598_0074727_361_762 | 133 |
| 80 | 3300046615 | Ga0495656_0115743 | Ga0495656_0115743_498_899 | 133 |
| 81 | 3300046691 | Ga0495670_0069468 | Ga0495670_0069468_1157_1558 | 133 |
| 82 | 3300046794 | Ga0495589_0352612 | Ga0495589_0352612_163_564 | 133 |
| 83 | 3300048090 | Ga0495615_0307389 | Ga0495615_0307389_39_440 | 133 |
| 84 | 3300049572 | Ga0501036_0831054 | Ga0501036_0831054_193_594 | 133 |
| 85 | 3300049575 | Ga0501039_0212800 | Ga0501039_0212800_1045_1446 | 133 |
| 86 | 3300049576 | Ga0501040_0231372 | Ga0501040_0231372_316_717 | 133 |
| 87 | 3300049577 | Ga0501041_0162426 | Ga0501041_0162426_345_746 | 133 |
| 88 | 3300049579 | Ga0501043_0598354 | Ga0501043_0598354_115_516 | 133 |
| 89 | 3300049582 | Ga0501048_0493595 | Ga0501048_0493595_111_512 | 133 |
| 90 | 3300049583 | Ga0501067_0108009 | Ga0501067_0108009_103_504 | 133 |
| 91 | 3300049584 | Ga0501068_0252952 | Ga0501068_0252952_673_1074 | 133 |
| 92 | 3300049584 | Ga0501068_1017447 | Ga0501068_1017447_98_499 | 133 |
| 93 | 3300049587 | Ga0501071_0120637 | Ga0501071_0120637_1129_1530 | 133 |
| 94 | 3300049587 | Ga0501071_0276282 | Ga0501071_0276282_344_745 | 133 |
| 95 | 3300049588 | Ga0501072_0170743 | Ga0501072_0170743_1174_1575 | 133 |
| 96 | 3300049588 | Ga0501072_0739054 | Ga0501072_0739054_210_611 | 133 |
| 97 | 3300049591 | Ga0501075_0057804 | Ga0501075_0057804_2251_2652 | 133 |
| 98 | 3300049592 | Ga0501076_0118119 | Ga0501076_0118119_1456_1857 | 133 |
| 99 | 3300049593 | Ga0501077_0054086 | Ga0501077_0054086_1021_1422 | 133 |
| 100 | 3300049593 | Ga0501077_0873358 | Ga0501077_0873358_100_501 | 133 |
| 101 | 3300049741 | Ga0501079_0655325 | Ga0501079_0655325_102_503 | 133 |
| 102 | 3300049742 | Ga0501080_0061904 | Ga0501080_0061904_1630_2031 | 133 |
| 103 | 3300049742 | Ga0501080_0642030 | Ga0501080_0642030_29_430 | 133 |
| 104 | 3300049743 | Ga0501081_0042247 | Ga0501081_0042247_1133_1534 | 133 |
| 105 | 3300049743 | Ga0501081_0615870 | Ga0501081_0615870_117_518 | 133 |
| 106 | 3300049744 | Ga0501083_0707257 | Ga0501083_0707257_194_595 | 133 |
| 107 | 3300049822 | Ga0501035_0504818 | Ga0501035_0504818_287_688 | 133 |
| 108 | 3300049824 | Ga0501045_0443670 | Ga0501045_0443670_142_543 | 133 |
| 109 | 3300050507 | nmdc:mga05p37_28340_c1 | nmdc:mga05p37_28340_c1_2169_2570 | 133 |
| 110 | 3300050507 | nmdc:mga05p37_433989_c1 | nmdc:mga05p37_433989_c1_804_1205 | 133 |
| 111 | 3300050511 | nmdc:mga08y16_329624_c1 | nmdc:mga08y16_329624_c1_1117_1518 | 133 |
| 112 | 3300054114 | Ga0501084_0034515 | Ga0501084_0034515_1502_1903 | 133 |
| 113 | 3300054114 | Ga0501084_0481214 | Ga0501084_0481214_169_570 | 133 |
| 114 | 3300059424 | Ga0590075_012782 | Ga0590075_012782_662_1063 | 133 |
| 115 | 3300059426 | Ga0590077_025123 | Ga0590077_025123_692_1093 | 133 |
| 116 | 3300060353 | Ga0501082_0222189 | Ga0501082_0222189_232_633 | 133 |
| 117 | 3300060353 | Ga0501082_0225619 | Ga0501082_0225619_1095_1496 | 133 |
| 118 | 3300061734 | Ga0530510_0260285 | Ga0530510_0260285_766_1167 | 133 |
| 119 | 3300003347 | JGI26128J50194_1003259 | JGI26128J50194_10032593 | 134 |
| 120 | 3300003349 | JGI26129J50193_1008546 | JGI26129J50193_10085462 | 134 |
| 121 | 3300003503 | JGI26141J51220_1002903 | JGI26141J51220_10029031 | 134 |
| 122 | 3300003911 | JGI25405J52794_10066965 | JGI25405J52794_100669651 | 134 |
| 123 | 3300005293 | Ga0065715_10168556 | Ga0065715_101685562 | 134 |
| 124 | 3300005328 | Ga0070676_10000588 | Ga0070676_1000058811 | 134 |
| 125 | 3300005329 | Ga0070683_100081286 | Ga0070683_1000812861 | 134 |
| 126 | 3300005330 | Ga0070690_100028494 | Ga0070690_1000284945 | 134 |
| 127 | 3300005331 | Ga0070670_100001663 | Ga0070670_1000016633 | 134 |
| 128 | 3300005331 | Ga0070670_100200107 | Ga0070670_1002001072 | 134 |
| 129 | 3300005333 | Ga0070677_10224682 | Ga0070677_102246821 | 134 |
| 130 | 3300005334 | Ga0068869_100018988 | Ga0068869_1000189883 | 134 |
| 131 | 3300005336 | Ga0070680_100016878 | Ga0070680_1000168783 | 134 |
| 132 | 3300005336 | Ga0070680_100089019 | Ga0070680_1000890194 | 134 |
| 133 | 3300005336 | Ga0070680_101266934 | Ga0070680_1012669341 | 134 |
| 134 | 3300005337 | Ga0070682_100082204 | Ga0070682_1000822043 | 134 |
| 135 | 3300005338 | Ga0068868_100014751 | Ga0068868_1000147514 | 134 |
| 136 | 3300005339 | Ga0070660_100001299 | Ga0070660_10000129911 | 134 |
| 137 | 3300005340 | Ga0070689_100978689 | Ga0070689_1009786892 | 134 |
| 138 | 3300005341 | Ga0070691_10014159 | Ga0070691_100141594 | 134 |
| 139 | 3300005343 | Ga0070687_100070949 | Ga0070687_1000709493 | 134 |
| 140 | 3300005343 | Ga0070687_101059744 | Ga0070687_1010597441 | 134 |
| 141 | 3300005344 | Ga0070661_100002142 | Ga0070661_1000021428 | 134 |
| 142 | 3300005345 | Ga0070692_10001477 | Ga0070692_100014779 | 134 |
| 143 | 3300005345 | Ga0070692_10120813 | Ga0070692_101208133 | 134 |
| 144 | 3300005347 | Ga0070668_100161454 | Ga0070668_1001614542 | 134 |
| 145 | 3300005347 | Ga0070668_100289726 | Ga0070668_1002897262 | 134 |
| 146 | 3300005347 | Ga0070668_100461098 | Ga0070668_1004610982 | 134 |
| 147 | 3300005353 | Ga0070669_100880646 | Ga0070669_1008806462 | 134 |
| 148 | 3300005354 | Ga0070675_100056445 | Ga0070675_1000564454 | 134 |
| 149 | 3300005364 | Ga0070673_100046374 | Ga0070673_1000463744 | 134 |
| 150 | 3300005364 | Ga0070673_100326736 | Ga0070673_1003267362 | 134 |
| 151 | 3300005365 | Ga0070688_100942391 | Ga0070688_1009423911 | 134 |
| 152 | 3300005366 | Ga0070659_100000151 | Ga0070659_10000015138 | 134 |
| 153 | 3300005406 | Ga0070703_10008942 | Ga0070703_100089423 | 134 |
| 154 | 3300005406 | Ga0070703_10115699 | Ga0070703_101156992 | 134 |
| 155 | 3300005438 | Ga0070701_10005927 | Ga0070701_100059273 | 134 |
| 156 | 3300005438 | Ga0070701_10082461 | Ga0070701_100824613 | 134 |
| 157 | 3300005439 | Ga0070711_100307370 | Ga0070711_1003073702 | 134 |
| 158 | 3300005440 | Ga0070705_100005341 | Ga0070705_1000053413 | 134 |
| 159 | 3300005444 | Ga0070694_100009064 | Ga0070694_1000090647 | 134 |
| 160 | 3300005444 | Ga0070694_100022828 | Ga0070694_1000228281 | 134 |
| 161 | 3300005444 | Ga0070694_100269427 | Ga0070694_1002694272 | 134 |
| 162 | 3300005444 | Ga0070694_100436069 | Ga0070694_1004360692 | 134 |
| 163 | 3300005444 | Ga0070694_101192361 | Ga0070694_1011923612 | 134 |
| 164 | 3300005445 | Ga0070708_100021021 | Ga0070708_1000210214 | 134 |
| 165 | 3300005445 | Ga0070708_100028244 | Ga0070708_1000282444 | 134 |
| 166 | 3300005445 | Ga0070708_100038331 | Ga0070708_1000383314 | 134 |
| 167 | 3300005445 | Ga0070708_100296705 | Ga0070708_1002967052 | 134 |
| 168 | 3300005445 | Ga0070708_100509691 | Ga0070708_1005096911 | 134 |
| 169 | 3300005445 | Ga0070708_100517088 | Ga0070708_1005170882 | 134 |
| 170 | 3300005445 | Ga0070708_100823439 | Ga0070708_1008234392 | 134 |
| 171 | 3300005445 | Ga0070708_101589985 | Ga0070708_1015899851 | 134 |
| 172 | 3300005455 | Ga0070663_100003733 | Ga0070663_1000037335 | 134 |
| 173 | 3300005457 | Ga0070662_100108506 | Ga0070662_1001085062 | 134 |
| 174 | 3300005458 | Ga0070681_10037836 | Ga0070681_100378365 | 134 |
| 175 | 3300005459 | Ga0068867_100004614 | Ga0068867_1000046145 | 134 |
| 176 | 3300005459 | Ga0068867_100116016 | Ga0068867_1001160162 | 134 |
| 177 | 3300005467 | Ga0070706_100006190 | Ga0070706_1000061905 | 134 |
| 178 | 3300005467 | Ga0070706_100071250 | Ga0070706_1000712501 | 134 |
| 179 | 3300005467 | Ga0070706_100514968 | Ga0070706_1005149682 | 134 |
| 180 | 3300005468 | Ga0070707_100001868 | Ga0070707_10000186810 | 134 |
| 181 | 3300005468 | Ga0070707_100045990 | Ga0070707_1000459902 | 134 |
| 182 | 3300005468 | Ga0070707_100263414 | Ga0070707_1002634143 | 134 |
| 183 | 3300005468 | Ga0070707_100630077 | Ga0070707_1006300772 | 134 |
| 184 | 3300005468 | Ga0070707_100838032 | Ga0070707_1008380321 | 134 |
| 185 | 3300005471 | Ga0070698_100006229 | Ga0070698_1000062294 | 134 |
| 186 | 3300005471 | Ga0070698_100011760 | Ga0070698_1000117601 | 134 |
| 187 | 3300005471 | Ga0070698_100072254 | Ga0070698_1000722544 | 134 |
| 188 | 3300005471 | Ga0070698_100269410 | Ga0070698_1002694102 | 134 |
| 189 | 3300005471 | Ga0070698_100324111 | Ga0070698_1003241113 | 134 |
| 190 | 3300005518 | Ga0070699_100002671 | Ga0070699_10000267112 | 134 |
| 191 | 3300005518 | Ga0070699_100009735 | Ga0070699_1000097352 | 134 |
| 192 | 3300005518 | Ga0070699_100010530 | Ga0070699_1000105304 | 134 |
| 193 | 3300005518 | Ga0070699_100010909 | Ga0070699_1000109098 | 134 |
| 194 | 3300005518 | Ga0070699_100051831 | Ga0070699_1000518312 | 134 |
| 195 | 3300005518 | Ga0070699_100128281 | Ga0070699_1001282813 | 134 |
| 196 | 3300005518 | Ga0070699_101619268 | Ga0070699_1016192681 | 134 |
| 197 | 3300005530 | Ga0070679_100018431 | Ga0070679_1000184316 | 134 |
| 198 | 3300005535 | Ga0070684_100247826 | Ga0070684_1002478263 | 134 |
| 199 | 3300005535 | Ga0070684_100556989 | Ga0070684_1005569892 | 134 |
| 200 | 3300005536 | Ga0070697_100012401 | Ga0070697_1000124012 | 134 |
| 201 | 3300005536 | Ga0070697_100025737 | Ga0070697_1000257373 | 134 |
| 202 | 3300005536 | Ga0070697_100111234 | Ga0070697_1001112342 | 134 |
| 203 | 3300005536 | Ga0070697_100343119 | Ga0070697_1003431192 | 134 |
| 204 | 3300005536 | Ga0070697_101407410 | Ga0070697_1014074101 | 134 |
| 205 | 3300005539 | Ga0068853_100000770 | Ga0068853_1000007705 | 134 |
| 206 | 3300005543 | Ga0070672_100335794 | Ga0070672_1003357942 | 134 |
| 207 | 3300005545 | Ga0070695_100000741 | Ga0070695_10000074114 | 134 |
| 208 | 3300005545 | Ga0070695_100009086 | Ga0070695_1000090865 | 134 |
| 209 | 3300005545 | Ga0070695_100012118 | Ga0070695_1000121182 | 134 |
| 210 | 3300005545 | Ga0070695_100036925 | Ga0070695_1000369253 | 134 |
| 211 | 3300005545 | Ga0070695_100037828 | Ga0070695_1000378283 | 134 |
| 212 | 3300005546 | Ga0070696_100006635 | Ga0070696_1000066359 | 134 |
| 213 | 3300005546 | Ga0070696_100045225 | Ga0070696_1000452252 | 134 |
| 214 | 3300005547 | Ga0070693_100036152 | Ga0070693_1000361522 | 134 |
| 215 | 3300005548 | Ga0070665_100127346 | Ga0070665_1001273462 | 134 |
| 216 | 3300005549 | Ga0070704_100000772 | Ga0070704_1000007724 | 134 |
| 217 | 3300005549 | Ga0070704_100013537 | Ga0070704_1000135374 | 134 |
| 218 | 3300005549 | Ga0070704_100169732 | Ga0070704_1001697321 | 134 |
| 219 | 3300005549 | Ga0070704_100394023 | Ga0070704_1003940232 | 134 |
| 220 | 3300005549 | Ga0070704_101142999 | Ga0070704_1011429991 | 134 |
| 221 | 3300005563 | Ga0068855_100001154 | Ga0068855_10000115426 | 134 |
| 222 | 3300005564 | Ga0070664_100002406 | Ga0070664_10000240611 | 134 |
| 223 | 3300005577 | Ga0068857_100051090 | Ga0068857_1000510902 | 134 |
| 224 | 3300005577 | Ga0068857_100080218 | Ga0068857_1000802182 | 134 |
| 225 | 3300005578 | Ga0068854_100245480 | Ga0068854_1002454803 | 134 |
| 226 | 3300005614 | Ga0068856_100002395 | Ga0068856_1000023953 | 134 |
| 227 | 3300005614 | Ga0068856_100308124 | Ga0068856_1003081243 | 134 |
| 228 | 3300005614 | Ga0068856_102190458 | Ga0068856_1021904582 | 134 |
| 229 | 3300005615 | Ga0070702_100009072 | Ga0070702_1000090724 | 134 |
| 230 | 3300005615 | Ga0070702_100099464 | Ga0070702_1000994643 | 134 |
| 231 | 3300005616 | Ga0068852_100238455 | Ga0068852_1002384553 | 134 |
| 232 | 3300005617 | Ga0068859_100006563 | Ga0068859_1000065638 | 134 |
| 233 | 3300005618 | Ga0068864_100005076 | Ga0068864_1000050766 | 134 |
| 234 | 3300005618 | Ga0068864_100923613 | Ga0068864_1009236132 | 134 |
| 235 | 3300005719 | Ga0068861_100024113 | Ga0068861_1000241132 | 134 |
| 236 | 3300005719 | Ga0068861_101683835 | Ga0068861_1016838351 | 134 |
| 237 | 3300005834 | Ga0068851_10070783 | Ga0068851_100707833 | 134 |
| 238 | 3300005840 | Ga0068870_10000998 | Ga0068870_100009989 | 134 |
| 239 | 3300005841 | Ga0068863_100018853 | Ga0068863_1000188533 | 134 |
| 240 | 3300005842 | Ga0068858_100009267 | Ga0068858_10000926710 | 134 |
| 241 | 3300005842 | Ga0068858_101512905 | Ga0068858_1015129052 | 134 |
| 242 | 3300005843 | Ga0068860_100042525 | Ga0068860_1000425252 | 134 |
| 243 | 3300005843 | Ga0068860_100213371 | Ga0068860_1002133713 | 134 |
| 244 | 3300005844 | Ga0068862_100003260 | Ga0068862_1000032604 | 134 |
| 245 | 3300005844 | Ga0068862_100011451 | Ga0068862_1000114514 | 134 |
| 246 | 3300005844 | Ga0068862_100499838 | Ga0068862_1004998381 | 134 |
| 247 | 3300005844 | Ga0068862_100926655 | Ga0068862_1009266552 | 134 |
| 248 | 3300005937 | Ga0081455_10000614 | Ga0081455_1000061426 | 134 |
| 249 | 3300006173 | Ga0070716_100024053 | Ga0070716_1000240533 | 134 |
| 250 | 3300006237 | Ga0097621_100048524 | Ga0097621_1000485242 | 134 |
| 251 | 3300006237 | Ga0097621_101188553 | Ga0097621_1011885532 | 134 |
| 252 | 3300006846 | Ga0075430_100097232 | Ga0075430_1000972323 | 134 |
| 253 | 3300006847 | Ga0075431_100002572 | Ga0075431_1000025723 | 134 |
| 254 | 3300006847 | Ga0075431_101193434 | Ga0075431_1011934342 | 134 |
| 255 | 3300006852 | Ga0075433_10004677 | Ga0075433_100046779 | 134 |
| 256 | 3300006852 | Ga0075433_10014405 | Ga0075433_100144057 | 134 |
| 257 | 3300006871 | Ga0075434_100016588 | Ga0075434_1000165883 | 134 |
| 258 | 3300006871 | Ga0075434_100027771 | Ga0075434_1000277715 | 134 |
| 259 | 3300006880 | Ga0075429_100033678 | Ga0075429_1000336785 | 134 |
| 260 | 3300006881 | Ga0068865_100248538 | Ga0068865_1002485383 | 134 |
| 261 | 3300006914 | Ga0075436_100060804 | Ga0075436_1000608043 | 134 |
| 262 | 3300006931 | Ga0097620_100006563 | Ga0097620_1000065638 | 134 |
| 263 | 3300007076 | Ga0075435_100012212 | Ga0075435_1000122125 | 134 |
| 264 | 3300007076 | Ga0075435_100043942 | Ga0075435_1000439424 | 134 |
| 265 | 3300007265 | Ga0099794_10008989 | Ga0099794_100089892 | 134 |
| 266 | 3300009098 | Ga0105245_10459602 | Ga0105245_104596022 | 134 |
| 267 | 3300009098 | Ga0105245_10513612 | Ga0105245_105136122 | 134 |
| 268 | 3300009147 | Ga0114129_10007147 | Ga0114129_1000714717 | 134 |
| 269 | 3300009147 | Ga0114129_10363000 | Ga0114129_103630003 | 134 |
| 270 | 3300009147 | Ga0114129_10483732 | Ga0114129_104837322 | 134 |
| 271 | 3300009148 | Ga0105243_10003778 | Ga0105243_100037784 | 134 |
| 272 | 3300009148 | Ga0105243_10152234 | Ga0105243_101522342 | 134 |
| 273 | 3300009174 | Ga0105241_10000054 | Ga0105241_1000005457 | 134 |
| 274 | 3300009174 | Ga0105241_10106019 | Ga0105241_101060193 | 134 |
| 275 | 3300009176 | Ga0105242_10031653 | Ga0105242_100316534 | 134 |
| 276 | 3300009553 | Ga0105249_10364517 | Ga0105249_103645173 | 134 |
| 277 | 3300010375 | Ga0105239_10355027 | Ga0105239_103550273 | 134 |
| 278 | 3300011119 | Ga0105246_10090821 | Ga0105246_100908214 | 134 |
| 279 | 3300013100 | Ga0157373_10003678 | Ga0157373_1000367810 | 134 |
| 280 | 3300013102 | Ga0157371_10369429 | Ga0157371_103694292 | 134 |
| 281 | 3300013104 | Ga0157370_11775756 | Ga0157370_117757562 | 134 |
| 282 | 3300013105 | Ga0157369_10478043 | Ga0157369_104780432 | 134 |
| 283 | 3300013297 | Ga0157378_10958046 | Ga0157378_109580462 | 134 |
| 284 | 3300013307 | Ga0157372_10027062 | Ga0157372_100270627 | 134 |
| 285 | 3300014325 | Ga0163163_11604912 | Ga0163163_116049122 | 134 |
| 286 | 3300014326 | Ga0157380_10520639 | Ga0157380_105206392 | 134 |
| 287 | 3300014745 | Ga0157377_10103879 | Ga0157377_101038793 | 134 |
| 288 | 3300014968 | Ga0157379_10648610 | Ga0157379_106486102 | 134 |
| 289 | 3300020082 | Ga0206353_12000993 | Ga0206353_120009932 | 134 |
| 290 | 3300024225 | Ga0224572_1058690 | Ga0224572_10586902 | 134 |
| 291 | 3300025885 | Ga0207653_10007436 | Ga0207653_100074362 | 134 |
| 292 | 3300025885 | Ga0207653_10028141 | Ga0207653_100281412 | 134 |
| 293 | 3300025885 | Ga0207653_10033016 | Ga0207653_100330161 | 134 |
| 294 | 3300025893 | Ga0207682_10441383 | Ga0207682_104413832 | 134 |
| 295 | 3300025899 | Ga0207642_10274023 | Ga0207642_102740232 | 134 |
| 296 | 3300025901 | Ga0207688_10032149 | Ga0207688_100321493 | 134 |
| 297 | 3300025904 | Ga0207647_10049868 | Ga0207647_100498683 | 134 |
| 298 | 3300025907 | Ga0207645_10000059 | Ga0207645_1000005911 | 134 |
| 299 | 3300025907 | Ga0207645_10076164 | Ga0207645_100761642 | 134 |
| 300 | 3300025908 | Ga0207643_10000014 | Ga0207643_1000001463 | 134 |
| 301 | 3300025910 | Ga0207684_10002971 | Ga0207684_1000297112 | 134 |
| 302 | 3300025910 | Ga0207684_10053561 | Ga0207684_100535612 | 134 |
| 303 | 3300025910 | Ga0207684_10095377 | Ga0207684_100953774 | 134 |
| 304 | 3300025910 | Ga0207684_10504636 | Ga0207684_105046361 | 134 |
| 305 | 3300025911 | Ga0207654_10012260 | Ga0207654_100122605 | 134 |
| 306 | 3300025911 | Ga0207654_10044278 | Ga0207654_100442782 | 134 |
| 307 | 3300025912 | Ga0207707_10000138 | Ga0207707_100001386 | 134 |
| 308 | 3300025916 | Ga0207663_10265842 | Ga0207663_102658422 | 134 |
| 309 | 3300025917 | Ga0207660_10009143 | Ga0207660_100091435 | 134 |
| 310 | 3300025917 | Ga0207660_10056932 | Ga0207660_100569322 | 134 |
| 311 | 3300025918 | Ga0207662_10071208 | Ga0207662_100712082 | 134 |
| 312 | 3300025918 | Ga0207662_10491034 | Ga0207662_104910342 | 134 |
| 313 | 3300025919 | Ga0207657_10000135 | Ga0207657_1000013571 | 134 |
| 314 | 3300025920 | Ga0207649_10009708 | Ga0207649_100097085 | 134 |
| 315 | 3300025921 | Ga0207652_10004746 | Ga0207652_100047466 | 134 |
| 316 | 3300025922 | Ga0207646_10001054 | Ga0207646_1000105431 | 134 |
| 317 | 3300025922 | Ga0207646_10031170 | Ga0207646_100311705 | 134 |
| 318 | 3300025922 | Ga0207646_10061793 | Ga0207646_100617934 | 134 |
| 319 | 3300025922 | Ga0207646_10071144 | Ga0207646_100711444 | 134 |
| 320 | 3300025922 | Ga0207646_10117855 | Ga0207646_101178554 | 134 |
| 321 | 3300025922 | Ga0207646_10149153 | Ga0207646_101491533 | 134 |
| 322 | 3300025923 | Ga0207681_10070863 | Ga0207681_100708634 | 134 |
| 323 | 3300025923 | Ga0207681_10756343 | Ga0207681_107563432 | 134 |
| 324 | 3300025923 | Ga0207681_11368700 | Ga0207681_113687002 | 134 |
| 325 | 3300025925 | Ga0207650_10012843 | Ga0207650_100128437 | 134 |
| 326 | 3300025925 | Ga0207650_10472322 | Ga0207650_104723222 | 134 |
| 327 | 3300025926 | Ga0207659_10070486 | Ga0207659_100704864 | 134 |
| 328 | 3300025926 | Ga0207659_10778842 | Ga0207659_107788422 | 134 |
| 329 | 3300025927 | Ga0207687_10800515 | Ga0207687_108005152 | 134 |
| 330 | 3300025931 | Ga0207644_11485042 | Ga0207644_114850421 | 134 |
| 331 | 3300025932 | Ga0207690_10010140 | Ga0207690_100101404 | 134 |
| 332 | 3300025933 | Ga0207706_10006677 | Ga0207706_100066777 | 134 |
| 333 | 3300025933 | Ga0207706_10189614 | Ga0207706_101896143 | 134 |
| 334 | 3300025934 | Ga0207686_10018333 | Ga0207686_100183334 | 134 |
| 335 | 3300025935 | Ga0207709_10604517 | Ga0207709_106045172 | 134 |
| 336 | 3300025936 | Ga0207670_10253548 | Ga0207670_102535482 | 134 |
| 337 | 3300025936 | Ga0207670_10840774 | Ga0207670_108407742 | 134 |
| 338 | 3300025938 | Ga0207704_10142358 | Ga0207704_101423583 | 134 |
| 339 | 3300025938 | Ga0207704_10541625 | Ga0207704_105416252 | 134 |
| 340 | 3300025939 | Ga0207665_10004861 | Ga0207665_100048616 | 134 |
| 341 | 3300025940 | Ga0207691_10327973 | Ga0207691_103279733 | 134 |
| 342 | 3300025942 | Ga0207689_10000340 | Ga0207689_1000034038 | 134 |
| 343 | 3300025942 | Ga0207689_10006849 | Ga0207689_1000684910 | 134 |
| 344 | 3300025942 | Ga0207689_10177125 | Ga0207689_101771252 | 134 |
| 345 | 3300025945 | Ga0207679_10000212 | Ga0207679_1000021221 | 134 |
| 346 | 3300025949 | Ga0207667_10000296 | Ga0207667_1000029642 | 134 |
| 347 | 3300025960 | Ga0207651_10158798 | Ga0207651_101587983 | 134 |
| 348 | 3300025960 | Ga0207651_11014433 | Ga0207651_110144332 | 134 |
| 349 | 3300025961 | Ga0207712_10224682 | Ga0207712_102246823 | 134 |
| 350 | 3300025961 | Ga0207712_10382039 | Ga0207712_103820392 | 134 |
| 351 | 3300025972 | Ga0207668_10356651 | Ga0207668_103566512 | 134 |
| 352 | 3300025981 | Ga0207640_11408326 | Ga0207640_114083262 | 134 |
| 353 | 3300025986 | Ga0207658_10176741 | Ga0207658_101767412 | 134 |
| 354 | 3300026023 | Ga0207677_10059785 | Ga0207677_100597853 | 134 |
| 355 | 3300026035 | Ga0207703_10070426 | Ga0207703_100704264 | 134 |
| 356 | 3300026041 | Ga0207639_10001773 | Ga0207639_1000177312 | 134 |
| 357 | 3300026067 | Ga0207678_10008386 | Ga0207678_100083868 | 134 |
| 358 | 3300026078 | Ga0207702_10001150 | Ga0207702_100011506 | 134 |
| 359 | 3300026088 | Ga0207641_10015083 | Ga0207641_100150834 | 134 |
| 360 | 3300026089 | Ga0207648_10001239 | Ga0207648_1000123925 | 134 |
| 361 | 3300026089 | Ga0207648_10170983 | Ga0207648_101709832 | 134 |
| 362 | 3300026095 | Ga0207676_10001946 | Ga0207676_1000194615 | 134 |
| 363 | 3300026116 | Ga0207674_10000684 | Ga0207674_1000068438 | 134 |
| 364 | 3300026116 | Ga0207674_10092508 | Ga0207674_100925082 | 134 |
| 365 | 3300026118 | Ga0207675_100013598 | Ga0207675_1000135982 | 134 |
| 366 | 3300026118 | Ga0207675_100228367 | Ga0207675_1002283672 | 134 |
| 367 | 3300026142 | Ga0207698_10258374 | Ga0207698_102583742 | 134 |
| 368 | 3300027360 | Ga0209969_1004099 | Ga0209969_10040992 | 134 |
| 369 | 3300027378 | Ga0209981_1000769 | Ga0209981_10007694 | 134 |
| 370 | 3300027395 | Ga0209996_1019501 | Ga0209996_10195012 | 134 |
| 371 | 3300027424 | Ga0209984_1004388 | Ga0209984_10043882 | 134 |
| 372 | 3300027462 | Ga0210000_1000448 | Ga0210000_10004486 | 134 |
| 373 | 3300027471 | Ga0209995_1000374 | Ga0209995_10003745 | 134 |
| 374 | 3300027526 | Ga0209968_1001337 | Ga0209968_10013373 | 134 |
| 375 | 3300027543 | Ga0209999_1000584 | Ga0209999_10005842 | 134 |
| 376 | 3300027552 | Ga0209982_1000382 | Ga0209982_10003822 | 134 |
| 377 | 3300027614 | Ga0209970_1003011 | Ga0209970_10030114 | 134 |
| 378 | 3300027617 | Ga0210002_1000361 | Ga0210002_10003615 | 134 |
| 379 | 3300027665 | Ga0209983_1000369 | Ga0209983_10003697 | 134 |
| 380 | 3300027671 | Ga0209588_1000615 | Ga0209588_10006158 | 134 |
| 381 | 3300027682 | Ga0209971_1000010 | Ga0209971_100001029 | 134 |
| 382 | 3300027682 | Ga0209971_1014366 | Ga0209971_10143662 | 134 |
| 383 | 3300027695 | Ga0209966_1000255 | Ga0209966_100025514 | 134 |
| 384 | 3300027717 | Ga0209998_10000131 | Ga0209998_1000013126 | 134 |
| 385 | 3300027876 | Ga0209974_10011978 | Ga0209974_100119783 | 134 |
| 386 | 3300027876 | Ga0209974_10090727 | Ga0209974_100907271 | 134 |
| 387 | 3300028380 | Ga0268265_10003910 | Ga0268265_100039107 | 134 |
| 388 | 3300028380 | Ga0268265_10103562 | Ga0268265_101035623 | 134 |
| 389 | 3300028380 | Ga0268265_10645417 | Ga0268265_106454172 | 134 |
| 390 | 3300028381 | Ga0268264_10030130 | Ga0268264_100301304 | 134 |
| 391 | 3300028381 | Ga0268264_10057388 | Ga0268264_100573885 | 134 |
| 392 | 3300028381 | Ga0268264_10373112 | Ga0268264_103731123 | 134 |
| 393 | 3300028381 | Ga0268264_11031500 | Ga0268264_110315002 | 134 |
| 394 | 3300031911 | Ga0307412_10256423 | Ga0307412_102564231 | 134 |
| 395 | 3300034817 | Ga0373948_0049804 | Ga0373948_0049804_92_502 | 134 |
| 396 | 3300035090 | Ga0373949_0013924 | Ga0373949_0013924_286_690 | 134 |
| 397 | 3300035090 | Ga0373949_0015575 | Ga0373949_0015575_546_956 | 134 |
| 398 | 3300035091 | Ga0373951_0008441 | Ga0373951_0008441_1237_1641 | 134 |
| 399 | 3300035092 | Ga0373952_0008087 | Ga0373952_0008087_1178_1582 | 134 |
| 400 | 3300035114 | Ga0373939_0065523 | Ga0373939_0065523_256_660 | 134 |
| 401 | 3300035121 | Ga0373960_0088943 | Ga0373960_0088943_182_586 | 134 |
| 402 | 3300035241 | Ga0373961_0013978 | Ga0373961_0013978_749_1153 | 134 |
| 403 | 3300035242 | Ga0373962_0191583 | Ga0373962_0191583_264_668 | 134 |
| 404 | 3300035691 | Ga0373931_0100911 | Ga0373931_0100911_655_1059 | 134 |
| 405 | 3300036401 | Ga0373937_1537906 | Ga0373937_1537906_12_431 | 134 |
| 406 | 3300037312 | Ga0395899_0530276 | Ga0395899_0530276_93_497 | 134 |
| 407 | 3300038698 | Ga0242419_007769 | Ga0242419_007769_105_509 | 134 |
| 408 | 3300039437 | Ga0436365_1038217 | Ga0436365_1038217_20_424 | 134 |
| 409 | 3300041501 | Ga0451845_0815444 | Ga0451845_0815444_126_530 | 134 |
| 410 | 3300042005 | Ga0439448_0003629 | Ga0439448_0003629_2104_2508 | 134 |
| 411 | 3300042005 | Ga0439448_0007395 | Ga0439448_0007395_2215_2619 | 134 |
| 412 | 3300042011 | Ga0439454_054371 | Ga0439454_054371_18_422 | 134 |
| 413 | 3300042016 | Ga0439463_034283 | Ga0439463_034283_478_882 | 134 |
| 414 | 3300042157 | Ga0439458_0006751 | Ga0439458_0006751_614_1018 | 134 |
| 415 | 3300042157 | Ga0439458_0014062 | Ga0439458_0014062_149_553 | 134 |
| 416 | 3300042157 | Ga0439458_0163144 | Ga0439458_0163144_13_417 | 134 |
| 417 | 3300042439 | Ga0439464_0017027 | Ga0439464_0017027_1135_1539 | 134 |
| 418 | 3300042461 | Ga0439460_0000656 | Ga0439460_0000656_3107_3511 | 134 |
| 419 | 3300042461 | Ga0439460_0200733 | Ga0439460_0200733_64_468 | 134 |
| 420 | 3300042876 | Ga0451577_0003247 | Ga0451577_0003247_9747_10151 | 134 |
| 421 | 3300042876 | Ga0451577_0009390 | Ga0451577_0009390_279_683 | 134 |
| 422 | 3300042876 | Ga0451577_0044898 | Ga0451577_0044898_2137_2541 | 134 |
| 423 | 3300044673 | Ga0453683_0011056 | Ga0453683_0011056_5384_5788 | 134 |
| 424 | 3300044673 | Ga0453683_0022003 | Ga0453683_0022003_1301_1705 | 134 |
| 425 | 3300044712 | Ga0453684_0199755 | Ga0453684_0199755_1052_1456 | 134 |
| 426 | 3300044712 | Ga0453684_0357088 | Ga0453684_0357088_626_1030 | 134 |
| 427 | 3300045051 | Ga0451576_0014386 | Ga0451576_0014386_8022_8426 | 134 |
| 428 | 3300045051 | Ga0451576_0020073 | Ga0451576_0020073_2187_2591 | 134 |
| 429 | 3300045051 | Ga0451576_0093517 | Ga0451576_0093517_1688_2098 | 134 |
| 430 | 3300045051 | Ga0451576_0192138 | Ga0451576_0192138_1196_1600 | 134 |
| 431 | 3300045051 | Ga0451576_0372843 | Ga0451576_0372843_893_1297 | 134 |
| 432 | 3300046454 | Ga0495592_0275108 | Ga0495592_0275108_591_995 | 134 |
| 433 | 3300046462 | Ga0495651_0037217 | Ga0495651_0037217_907_1311 | 134 |
| 434 | 3300046472 | Ga0495580_0106354 | Ga0495580_0106354_188_592 | 134 |
| 435 | 3300046472 | Ga0495580_0416772 | Ga0495580_0416772_406_816 | 134 |
| 436 | 3300046491 | Ga0495584_0237315 | Ga0495584_0237315_438_845 | 134 |
| 437 | 3300046516 | Ga0495628_0145056 | Ga0495628_0145056_391_795 | 134 |
| 438 | 3300046683 | Ga0495658_0382657 | Ga0495658_0382657_113_517 | 134 |
| 439 | 3300047322 | Ga0495680_0253393 | Ga0495680_0253393_95_499 | 134 |
| 440 | 3300048905 | Ga0496102_0120610 | Ga0496102_0120610_1139_1543 | 134 |
| 441 | 3300048906 | Ga0496103_0125572 | Ga0496103_0125572_800_1204 | 134 |
| 442 | 3300048907 | Ga0496104_0240883 | Ga0496104_0240883_150_554 | 134 |
| 443 | 3300048907 | Ga0496104_0389654 | Ga0496104_0389654_402_806 | 134 |
| 444 | 3300048911 | Ga0496108_0341688 | Ga0496108_0341688_529_933 | 134 |
| 445 | 3300048912 | Ga0496109_0330170 | Ga0496109_0330170_378_782 | 134 |
| 446 | 3300048913 | Ga0496110_0105058 | Ga0496110_0105058_918_1322 | 134 |
| 447 | 3300048915 | Ga0496112_0259028 | Ga0496112_0259028_135_539 | 134 |
| 448 | 3300048916 | Ga0496113_0230130 | Ga0496113_0230130_182_586 | 134 |
| 449 | 3300048924 | Ga0496121_0239401 | Ga0496121_0239401_538_942 | 134 |
| 450 | 3300049568 | Ga0501031_0025568 | Ga0501031_0025568_3390_3794 | 134 |
| 451 | 3300049570 | Ga0501033_0168364 | Ga0501033_0168364_288_692 | 134 |
| 452 | 3300049572 | Ga0501036_0180149 | Ga0501036_0180149_1219_1623 | 134 |
| 453 | 3300049572 | Ga0501036_0305736 | Ga0501036_0305736_368_775 | 134 |
| 454 | 3300049572 | Ga0501036_1231675 | Ga0501036_1231675_85_489 | 134 |
| 455 | 3300049573 | Ga0501037_0032414 | Ga0501037_0032414_331_735 | 134 |
| 456 | 3300049573 | Ga0501037_0053145 | Ga0501037_0053145_400_804 | 134 |
| 457 | 3300049574 | Ga0501038_0017563 | Ga0501038_0017563_2874_3278 | 134 |
| 458 | 3300049576 | Ga0501040_0036168 | Ga0501040_0036168_2040_2444 | 134 |
| 459 | 3300049576 | Ga0501040_0043429 | Ga0501040_0043429_128_535 | 134 |
| 460 | 3300049577 | Ga0501041_0365065 | Ga0501041_0365065_239_643 | 134 |
| 461 | 3300049578 | Ga0501042_0080804 | Ga0501042_0080804_707_1114 | 134 |
| 462 | 3300049580 | Ga0501046_0012826 | Ga0501046_0012826_6517_6921 | 134 |
| 463 | 3300049580 | Ga0501046_0195152 | Ga0501046_0195152_64_468 | 134 |
| 464 | 3300049581 | Ga0501047_1083825 | Ga0501047_1083825_11_415 | 134 |
| 465 | 3300049584 | Ga0501068_0013113 | Ga0501068_0013113_3903_4307 | 134 |
| 466 | 3300049585 | Ga0501069_0058078 | Ga0501069_0058078_1494_1898 | 134 |
| 467 | 3300049586 | Ga0501070_1079479 | Ga0501070_1079479_104_508 | 134 |
| 468 | 3300049586 | Ga0501070_1388773 | Ga0501070_1388773_22_426 | 134 |
| 469 | 3300049587 | Ga0501071_0027014 | Ga0501071_0027014_234_638 | 134 |
| 470 | 3300049588 | Ga0501072_0096302 | Ga0501072_0096302_1499_1906 | 134 |
| 471 | 3300049590 | Ga0501074_0258165 | Ga0501074_0258165_162_569 | 134 |
| 472 | 3300049590 | Ga0501074_0279054 | Ga0501074_0279054_516_920 | 134 |
| 473 | 3300049591 | Ga0501075_0005476 | Ga0501075_0005476_8150_8554 | 134 |
| 474 | 3300049591 | Ga0501075_0030602 | Ga0501075_0030602_264_668 | 134 |
| 475 | 3300049591 | Ga0501075_0042762 | Ga0501075_0042762_1316_1723 | 134 |
| 476 | 3300049591 | Ga0501075_0118040 | Ga0501075_0118040_746_1150 | 134 |
| 477 | 3300049592 | Ga0501076_0020633 | Ga0501076_0020633_357_761 | 134 |
| 478 | 3300049593 | Ga0501077_0013053 | Ga0501077_0013053_2098_2505 | 134 |
| 479 | 3300049593 | Ga0501077_0247044 | Ga0501077_0247044_473_877 | 134 |
| 480 | 3300049741 | Ga0501079_0009197 | Ga0501079_0009197_6967_7371 | 134 |
| 481 | 3300049741 | Ga0501079_0066696 | Ga0501079_0066696_933_1340 | 134 |
| 482 | 3300049741 | Ga0501079_0203906 | Ga0501079_0203906_419_823 | 134 |
| 483 | 3300049741 | Ga0501079_0306306 | Ga0501079_0306306_298_702 | 134 |
| 484 | 3300049742 | Ga0501080_0623023 | Ga0501080_0623023_53_460 | 134 |
| 485 | 3300049822 | Ga0501035_0016960 | Ga0501035_0016960_6100_6504 | 134 |
| 486 | 3300049824 | Ga0501045_0008137 | Ga0501045_0008137_6221_6625 | 134 |
| 487 | 3300049824 | Ga0501045_0410569 | Ga0501045_0410569_365_769 | 134 |
| 488 | 3300050507 | nmdc:mga05p37_273740_c1 | nmdc:mga05p37_273740_c1_755_1159 | 134 |
| 489 | 3300050507 | nmdc:mga05p37_680441_c1 | nmdc:mga05p37_680441_c1_582_986 | 134 |
| 490 | 3300050507 | nmdc:mga05p37_98011_c1 | nmdc:mga05p37_98011_c1_2249_2656 | 134 |
| 491 | 3300050507 | nmdc:mga05p37_99530_c1 | nmdc:mga05p37_99530_c1_1937_2344 | 134 |
| 492 | 3300050508 | nmdc:mga09592_149218_c1 | nmdc:mga09592_149218_c1_758_1165 | 134 |
| 493 | 3300050508 | nmdc:mga09592_88802_c1 | nmdc:mga09592_88802_c1_186_590 | 134 |
| 494 | 3300050509 | nmdc:mga0qj67_4345_c1 | nmdc:mga0qj67_4345_c1_8709_9116 | 134 |
| 495 | 3300050509 | nmdc:mga0qj67_964082_c1 | nmdc:mga0qj67_964082_c1_34_438 | 134 |
| 496 | 3300050510 | nmdc:mga06r32_430972_c1 | nmdc:mga06r32_430972_c1_189_593 | 134 |
| 497 | 3300050510 | nmdc:mga06r32_498544_c1 | nmdc:mga06r32_498544_c1_464_868 | 134 |
| 498 | 3300050510 | nmdc:mga06r32_703_c1 | nmdc:mga06r32_703_c1_14853_15260 | 134 |
| 499 | 3300050512 | nmdc:mga0n895_179144_c1 | nmdc:mga0n895_179144_c1_472_876 | 134 |
| 500 | 3300050512 | nmdc:mga0n895_668_c1 | nmdc:mga0n895_668_c1_11158_11562 | 134 |
| 501 | 3300050513 | nmdc:mga0rr50_20722_c1 | nmdc:mga0rr50_20722_c1_1354_1758 | 134 |
| 502 | 3300050513 | nmdc:mga0rr50_2913_c1 | nmdc:mga0rr50_2913_c1_5202_5606 | 134 |
| 503 | 3300050514 | nmdc:mga08x19_1014015_c1 | nmdc:mga08x19_1014015_c1_130_534 | 134 |
| 504 | 3300050514 | nmdc:mga08x19_104417_c1 | nmdc:mga08x19_104417_c1_911_1315 | 134 |
| 505 | 3300050515 | nmdc:mga0a205_155086_c1 | nmdc:mga0a205_155086_c1_1460_1864 | 134 |
| 506 | 3300050515 | nmdc:mga0a205_63894_c1 | nmdc:mga0a205_63894_c1_1428_1832 | 134 |
| 507 | 3300053077 | Ga0495601_0000762 | Ga0495601_0000762_13924_14328 | 134 |
| 508 | 3300053085 | Ga0495619_0147497 | Ga0495619_0147497_769_1173 | 134 |
| 509 | 3300054114 | Ga0501084_0007539 | Ga0501084_0007539_3627_4034 | 134 |
| 510 | 3300054114 | Ga0501084_0017956 | Ga0501084_0017956_5310_5714 | 134 |
| 511 | 3300054114 | Ga0501084_0465829 | Ga0501084_0465829_40_444 | 134 |
| 512 | 3300060353 | Ga0501082_0362076 | Ga0501082_0362076_590_994 | 134 |
| 513 | 3300061734 | Ga0530510_0427310 | Ga0530510_0427310_26_451 | 134 |
| 514 | 3300005339 | Ga0070660_100251598 | Ga0070660_1002515982 | 135 |
| 515 | 3300005341 | Ga0070691_10402884 | Ga0070691_104028841 | 135 |
| 516 | 3300005356 | Ga0070674_100009683 | Ga0070674_1000096835 | 135 |
| 517 | 3300005406 | Ga0070703_10000082 | Ga0070703_1000008220 | 135 |
| 518 | 3300005440 | Ga0070705_100057718 | Ga0070705_1000577183 | 135 |
| 519 | 3300005441 | Ga0070700_100200567 | Ga0070700_1002005672 | 135 |
| 520 | 3300005445 | Ga0070708_100000583 | Ga0070708_10000058319 | 135 |
| 521 | 3300005467 | Ga0070706_100000283 | Ga0070706_1000002832 | 135 |
| 522 | 3300005467 | Ga0070706_100180124 | Ga0070706_1001801243 | 135 |
| 523 | 3300005468 | Ga0070707_100009176 | Ga0070707_1000091762 | 135 |
| 524 | 3300005471 | Ga0070698_100045170 | Ga0070698_1000451705 | 135 |
| 525 | 3300005471 | Ga0070698_100531121 | Ga0070698_1005311212 | 135 |
| 526 | 3300005518 | Ga0070699_100576939 | Ga0070699_1005769392 | 135 |
| 527 | 3300005536 | Ga0070697_100057701 | Ga0070697_1000577014 | 135 |
| 528 | 3300005536 | Ga0070697_101236456 | Ga0070697_1012364562 | 135 |
| 529 | 3300005545 | Ga0070695_100369162 | Ga0070695_1003691622 | 135 |
| 530 | 3300005546 | Ga0070696_100053630 | Ga0070696_1000536302 | 135 |
| 531 | 3300005718 | Ga0068866_10009087 | Ga0068866_100090874 | 135 |
| 532 | 3300005719 | Ga0068861_100717266 | Ga0068861_1007172662 | 135 |
| 533 | 3300005843 | Ga0068860_100807077 | Ga0068860_1008070772 | 135 |
| 534 | 3300005844 | Ga0068862_100907800 | Ga0068862_1009078002 | 135 |
| 535 | 3300006173 | Ga0070716_101385537 | Ga0070716_1013855371 | 135 |
| 536 | 3300006846 | Ga0075430_100016571 | Ga0075430_1000165712 | 135 |
| 537 | 3300006847 | Ga0075431_100563872 | Ga0075431_1005638722 | 135 |
| 538 | 3300006881 | Ga0068865_100130243 | Ga0068865_1001302432 | 135 |
| 539 | 3300007076 | Ga0075435_100003548 | Ga0075435_1000035486 | 135 |
| 540 | 3300009094 | Ga0111539_10106643 | Ga0111539_101066432 | 135 |
| 541 | 3300009094 | Ga0111539_12097470 | Ga0111539_120974702 | 135 |
| 542 | 3300009098 | Ga0105245_10094169 | Ga0105245_100941692 | 135 |
| 543 | 3300009098 | Ga0105245_11741846 | Ga0105245_117418462 | 135 |
| 544 | 3300009148 | Ga0105243_10013620 | Ga0105243_100136204 | 135 |
| 545 | 3300009176 | Ga0105242_10026733 | Ga0105242_100267332 | 135 |
| 546 | 3300009553 | Ga0105249_12575724 | Ga0105249_125757242 | 135 |
| 547 | 3300010375 | Ga0105239_10305422 | Ga0105239_103054223 | 135 |
| 548 | 3300011119 | Ga0105246_10449335 | Ga0105246_104493352 | 135 |
| 549 | 3300013306 | Ga0163162_10093658 | Ga0163162_100936582 | 135 |
| 550 | 3300014326 | Ga0157380_10867307 | Ga0157380_108673072 | 135 |
| 551 | 3300014326 | Ga0157380_12487862 | Ga0157380_124878621 | 135 |
| 552 | 3300025885 | Ga0207653_10000045 | Ga0207653_1000004594 | 135 |
| 553 | 3300025899 | Ga0207642_10084475 | Ga0207642_100844752 | 135 |
| 554 | 3300025910 | Ga0207684_10000058 | Ga0207684_1000005825 | 135 |
| 555 | 3300025922 | Ga0207646_10008859 | Ga0207646_100088596 | 135 |
| 556 | 3300025922 | Ga0207646_10112763 | Ga0207646_101127633 | 135 |
| 557 | 3300025927 | Ga0207687_10089735 | Ga0207687_100897353 | 135 |
| 558 | 3300025927 | Ga0207687_10103469 | Ga0207687_101034692 | 135 |
| 559 | 3300025927 | Ga0207687_10997216 | Ga0207687_109972162 | 135 |
| 560 | 3300025934 | Ga0207686_10025017 | Ga0207686_100250174 | 135 |
| 561 | 3300025935 | Ga0207709_10027194 | Ga0207709_100271942 | 135 |
| 562 | 3300025937 | Ga0207669_10406942 | Ga0207669_104069422 | 135 |
| 563 | 3300025938 | Ga0207704_10174569 | Ga0207704_101745691 | 135 |
| 564 | 3300025942 | Ga0207689_10720620 | Ga0207689_107206202 | 135 |
| 565 | 3300025945 | Ga0207679_11484122 | Ga0207679_114841222 | 135 |
| 566 | 3300025981 | Ga0207640_10430247 | Ga0207640_104302472 | 135 |
| 567 | 3300026023 | Ga0207677_10106326 | Ga0207677_101063262 | 135 |
| 568 | 3300026075 | Ga0207708_10332147 | Ga0207708_103321472 | 135 |
| 569 | 3300026075 | Ga0207708_10981637 | Ga0207708_109816371 | 135 |
| 570 | 3300026089 | Ga0207648_10870627 | Ga0207648_108706271 | 135 |
| 571 | 3300026118 | Ga0207675_100353683 | Ga0207675_1003536832 | 135 |
| 572 | 3300026121 | Ga0207683_10309953 | Ga0207683_103099531 | 135 |
| 573 | 3300027907 | Ga0207428_10393401 | Ga0207428_103934012 | 135 |
| 574 | 3300028380 | Ga0268265_10837138 | Ga0268265_108371382 | 135 |
| 575 | 3300032002 | Ga0307416_100176682 | Ga0307416_1001766822 | 135 |
| 576 | 3300035086 | Ga0373934_0043704 | Ga0373934_0043704_189_596 | 135 |
| 577 | 3300035111 | Ga0373923_0063776 | Ga0373923_0063776_764_1171 | 135 |
| 578 | 3300035119 | Ga0373956_0009666 | Ga0373956_0009666_1915_2322 | 135 |
| 579 | 3300035172 | Ga0373955_0024400 | Ga0373955_0024400_1764_2171 | 135 |
| 580 | 3300035410 | Ga0373924_0057007 | Ga0373924_0057007_1124_1531 | 135 |
| 581 | 3300035692 | Ga0373935_0764871 | Ga0373935_0764871_295_702 | 135 |
| 582 | 3300035695 | Ga0373927_0177129 | Ga0373927_0177129_44_451 | 135 |
| 583 | 3300035695 | Ga0373927_0743036 | Ga0373927_0743036_123_533 | 135 |
| 584 | 3300035725 | Ga0373947_0191145 | Ga0373947_0191145_411_818 | 135 |
| 585 | 3300035725 | Ga0373947_0953908 | Ga0373947_0953908_78_488 | 135 |
| 586 | 3300036401 | Ga0373937_0026867 | Ga0373937_0026867_1135_1542 | 135 |
| 587 | 3300036401 | Ga0373937_1953352 | Ga0373937_1953352_69_476 | 135 |
| 588 | 3300037068 | Ga0373925_0875889 | Ga0373925_0875889_203_610 | 135 |
| 589 | 3300037471 | Ga0395905_1102576 | Ga0395905_1102576_116_529 | 135 |
| 590 | 3300039437 | Ga0436365_0065915 | Ga0436365_0065915_824_1246 | 135 |
| 591 | 3300039437 | Ga0436365_0159496 | Ga0436365_0159496_13716_14135 | 135 |
| 592 | 3300039437 | Ga0436365_0798370 | Ga0436365_0798370_580_1002 | 135 |
| 593 | 3300039453 | Ga0436362_0639565 | Ga0436362_0639565_256_678 | 135 |
| 594 | 3300039453 | Ga0436362_1060922 | Ga0436362_1060922_75_497 | 135 |
| 595 | 3300045049 | Ga0466959_0067718 | Ga0466959_0067718_284_697 | 135 |
| 596 | 3300046455 | Ga0495603_0004360 | Ga0495603_0004360_6037_6444 | 135 |
| 597 | 3300046472 | Ga0495580_0425687 | Ga0495580_0425687_315_725 | 135 |
| 598 | 3300046472 | Ga0495580_0528159 | Ga0495580_0528159_231_638 | 135 |
| 599 | 3300046476 | Ga0495662_0431744 | Ga0495662_0431744_138_548 | 135 |
| 600 | 3300046500 | Ga0495596_0187756 | Ga0495596_0187756_203_616 | 135 |
| 601 | 3300046525 | Ga0495663_0084865 | Ga0495663_0084865_463_870 | 135 |
| 602 | 3300046528 | Ga0495642_0163843 | Ga0495642_0163843_475_882 | 135 |
| 603 | 3300046538 | Ga0495609_0040345 | Ga0495609_0040345_723_1130 | 135 |
| 604 | 3300046615 | Ga0495656_0401558 | Ga0495656_0401558_107_517 | 135 |
| 605 | 3300046664 | Ga0495659_0058969 | Ga0495659_0058969_987_1394 | 135 |
| 606 | 3300046674 | Ga0495588_0044320 | Ga0495588_0044320_1173_1583 | 135 |
| 607 | 3300046683 | Ga0495658_0449008 | Ga0495658_0449008_401_808 | 135 |
| 608 | 3300046689 | Ga0495613_0453497 | Ga0495613_0453497_315_722 | 135 |
| 609 | 3300047321 | Ga0495676_0029660 | Ga0495676_0029660_1850_2260 | 135 |
| 610 | 3300047673 | Ga0495593_0450376 | Ga0495593_0450376_185_595 | 135 |
| 611 | 3300048091 | Ga0495626_0350011 | Ga0495626_0350011_131_538 | 135 |
| 612 | 3300048903 | Ga0496100_0009320 | Ga0496100_0009320_2184_2591 | 135 |
| 613 | 3300048904 | Ga0496101_0033968 | Ga0496101_0033968_1036_1443 | 135 |
| 614 | 3300048905 | Ga0496102_0322978 | Ga0496102_0322978_1026_1433 | 135 |
| 615 | 3300048906 | Ga0496103_1052771 | Ga0496103_1052771_43_450 | 135 |
| 616 | 3300048909 | Ga0496106_0005863 | Ga0496106_0005863_6225_6632 | 135 |
| 617 | 3300048910 | Ga0496107_0056043 | Ga0496107_0056043_1941_2348 | 135 |
| 618 | 3300048912 | Ga0496109_1810577 | Ga0496109_1810577_26_442 | 135 |
| 619 | 3300048913 | Ga0496110_0274048 | Ga0496110_0274048_383_790 | 135 |
| 620 | 3300048917 | Ga0496114_1635590 | Ga0496114_1635590_40_453 | 135 |
| 621 | 3300048918 | Ga0496115_1058152 | Ga0496115_1058152_37_444 | 135 |
| 622 | 3300049568 | Ga0501031_0013951 | Ga0501031_0013951_464_871 | 135 |
| 623 | 3300049568 | Ga0501031_0709142 | Ga0501031_0709142_201_608 | 135 |
| 624 | 3300049569 | Ga0501032_0329505 | Ga0501032_0329505_148_555 | 135 |
| 625 | 3300049569 | Ga0501032_0693990 | Ga0501032_0693990_54_461 | 135 |
| 626 | 3300049570 | Ga0501033_0073110 | Ga0501033_0073110_842_1249 | 135 |
| 627 | 3300049571 | Ga0501034_0003490 | Ga0501034_0003490_4872_5288 | 135 |
| 628 | 3300049572 | Ga0501036_0007145 | Ga0501036_0007145_4627_5034 | 135 |
| 629 | 3300049572 | Ga0501036_0716310 | Ga0501036_0716310_309_716 | 135 |
| 630 | 3300049574 | Ga0501038_0021842 | Ga0501038_0021842_4439_4846 | 135 |
| 631 | 3300049575 | Ga0501039_0007616 | Ga0501039_0007616_1527_1934 | 135 |
| 632 | 3300049575 | Ga0501039_0020587 | Ga0501039_0020587_1302_1709 | 135 |
| 633 | 3300049575 | Ga0501039_0397720 | Ga0501039_0397720_245_652 | 135 |
| 634 | 3300049576 | Ga0501040_0000885 | Ga0501040_0000885_13050_13457 | 135 |
| 635 | 3300049576 | Ga0501040_0010600 | Ga0501040_0010600_4861_5268 | 135 |
| 636 | 3300049576 | Ga0501040_0357348 | Ga0501040_0357348_332_739 | 135 |
| 637 | 3300049577 | Ga0501041_0012864 | Ga0501041_0012864_188_595 | 135 |
| 638 | 3300049577 | Ga0501041_0187160 | Ga0501041_0187160_202_609 | 135 |
| 639 | 3300049578 | Ga0501042_0007869 | Ga0501042_0007869_1386_1793 | 135 |
| 640 | 3300049578 | Ga0501042_0017392 | Ga0501042_0017392_4353_4760 | 135 |
| 641 | 3300049578 | Ga0501042_0114812 | Ga0501042_0114812_174_581 | 135 |
| 642 | 3300049579 | Ga0501043_0079293 | Ga0501043_0079293_1783_2190 | 135 |
| 643 | 3300049580 | Ga0501046_0131160 | Ga0501046_0131160_1130_1537 | 135 |
| 644 | 3300049581 | Ga0501047_0439684 | Ga0501047_0439684_16_423 | 135 |
| 645 | 3300049582 | Ga0501048_0007737 | Ga0501048_0007737_3546_3953 | 135 |
| 646 | 3300049583 | Ga0501067_0338877 | Ga0501067_0338877_128_535 | 135 |
| 647 | 3300049584 | Ga0501068_0034399 | Ga0501068_0034399_1473_1880 | 135 |
| 648 | 3300049584 | Ga0501068_0037885 | Ga0501068_0037885_1653_2060 | 135 |
| 649 | 3300049586 | Ga0501070_0122104 | Ga0501070_0122104_1674_2081 | 135 |
| 650 | 3300049587 | Ga0501071_0011839 | Ga0501071_0011839_1826_2233 | 135 |
| 651 | 3300049587 | Ga0501071_0062016 | Ga0501071_0062016_307_714 | 135 |
| 652 | 3300049588 | Ga0501072_0005345 | Ga0501072_0005345_5800_6207 | 135 |
| 653 | 3300049590 | Ga0501074_0011455 | Ga0501074_0011455_205_612 | 135 |
| 654 | 3300049590 | Ga0501074_0019507 | Ga0501074_0019507_3146_3553 | 135 |
| 655 | 3300049590 | Ga0501074_0200388 | Ga0501074_0200388_970_1377 | 135 |
| 656 | 3300049590 | Ga0501074_0244486 | Ga0501074_0244486_81_488 | 135 |
| 657 | 3300049591 | Ga0501075_0003166 | Ga0501075_0003166_4444_4851 | 135 |
| 658 | 3300049591 | Ga0501075_0049635 | Ga0501075_0049635_2105_2512 | 135 |
| 659 | 3300049591 | Ga0501075_0345191 | Ga0501075_0345191_630_1037 | 135 |
| 660 | 3300049592 | Ga0501076_0014869 | Ga0501076_0014869_1527_1934 | 135 |
| 661 | 3300049593 | Ga0501077_0005709 | Ga0501077_0005709_3104_3511 | 135 |
| 662 | 3300049593 | Ga0501077_0027984 | Ga0501077_0027984_143_550 | 135 |
| 663 | 3300049593 | Ga0501077_0186555 | Ga0501077_0186555_263_670 | 135 |
| 664 | 3300049741 | Ga0501079_0009731 | Ga0501079_0009731_1689_2096 | 135 |
| 665 | 3300049741 | Ga0501079_0210680 | Ga0501079_0210680_908_1315 | 135 |
| 666 | 3300049743 | Ga0501081_0002929 | Ga0501081_0002929_6641_7048 | 135 |
| 667 | 3300049743 | Ga0501081_0009042 | Ga0501081_0009042_3381_3788 | 135 |
| 668 | 3300049743 | Ga0501081_0288431 | Ga0501081_0288431_240_647 | 135 |
| 669 | 3300049743 | Ga0501081_0339687 | Ga0501081_0339687_458_865 | 135 |
| 670 | 3300049744 | Ga0501083_0038291 | Ga0501083_0038291_2108_2515 | 135 |
| 671 | 3300049822 | Ga0501035_0126569 | Ga0501035_0126569_1137_1544 | 135 |
| 672 | 3300049823 | Ga0501044_0209536 | Ga0501044_0209536_656_1063 | 135 |
| 673 | 3300049824 | Ga0501045_0008966 | Ga0501045_0008966_208_615 | 135 |
| 674 | 3300049824 | Ga0501045_0009528 | Ga0501045_0009528_3232_3639 | 135 |
| 675 | 3300049824 | Ga0501045_0632829 | Ga0501045_0632829_158_565 | 135 |
| 676 | 3300050509 | nmdc:mga0qj67_12234_c1 | nmdc:mga0qj67_12234_c1_3924_4331 | 135 |
| 677 | 3300050510 | nmdc:mga06r32_803524_c1 | nmdc:mga06r32_803524_c1_197_604 | 135 |
| 678 | 3300050511 | nmdc:mga08y16_16924_c1 | nmdc:mga08y16_16924_c1_4429_4836 | 135 |
| 679 | 3300050512 | nmdc:mga0n895_1499482_c1 | nmdc:mga0n895_1499482_c1_190_597 | 135 |
| 680 | 3300050513 | nmdc:mga0rr50_36476_c1 | nmdc:mga0rr50_36476_c1_2390_2797 | 135 |
| 681 | 3300050514 | nmdc:mga08x19_342440_c1 | nmdc:mga08x19_342440_c1_202_609 | 135 |
| 682 | 3300053083 | Ga0495655_0172144 | Ga0495655_0172144_55_462 | 135 |
| 683 | 3300053083 | Ga0495655_0269400 | Ga0495655_0269400_135_548 | 135 |
| 684 | 3300053103 | Ga0500555_029926 | Ga0500555_029926_271_678 | 135 |
| 685 | 3300053153 | Ga0500616_0068560 | Ga0500616_0068560_629_1051 | 135 |
| 686 | 3300054114 | Ga0501084_0003271 | Ga0501084_0003271_6390_6797 | 135 |
| 687 | 3300054114 | Ga0501084_0021951 | Ga0501084_0021951_3662_4069 | 135 |
| 688 | 3300054114 | Ga0501084_0422315 | Ga0501084_0422315_350_757 | 135 |
| 689 | 3300054114 | Ga0501084_1725565 | Ga0501084_1725565_48_458 | 135 |
| 690 | 3300060353 | Ga0501082_0082580 | Ga0501082_0082580_832_1239 | 135 |
| 691 | 3300060353 | Ga0501082_0213485 | Ga0501082_0213485_902_1309 | 135 |
| 692 | 3300060353 | Ga0501082_0676467 | Ga0501082_0676467_399_806 | 135 |
| 693 | 3300060353 | Ga0501082_0766326 | Ga0501082_0766326_153_569 | 135 |
| 694 | 3300061734 | Ga0530510_0008059 | Ga0530510_0008059_4376_4783 | 135 |
| 695 | 3300061734 | Ga0530510_0172641 | Ga0530510_0172641_187_594 | 135 |
| 696 | 3300061734 | Ga0530510_0309684 | Ga0530510_0309684_419_826 | 135 |
| 697 | 3300061734 | Ga0530510_1139024 | Ga0530510_1139024_179_586 | 135 |
| 698 | 3300005343 | Ga0070687_100117754 | Ga0070687_1001177541 | 136 |
| 699 | 3300005343 | Ga0070687_100154021 | Ga0070687_1001540212 | 136 |
| 700 | 3300005435 | Ga0070714_101350923 | Ga0070714_1013509231 | 136 |
| 701 | 3300005518 | Ga0070699_100276075 | Ga0070699_1002760752 | 136 |
| 702 | 3300005518 | Ga0070699_101441603 | Ga0070699_1014416032 | 136 |
| 703 | 3300005535 | Ga0070684_102130774 | Ga0070684_1021307741 | 136 |
| 704 | 3300005536 | Ga0070697_101152304 | Ga0070697_1011523042 | 136 |
| 705 | 3300005544 | Ga0070686_101791548 | Ga0070686_1017915481 | 136 |
| 706 | 3300005841 | Ga0068863_101183513 | Ga0068863_1011835131 | 136 |
| 707 | 3300005937 | Ga0081455_10003792 | Ga0081455_100037928 | 136 |
| 708 | 3300006163 | Ga0070715_10930975 | Ga0070715_109309751 | 136 |
| 709 | 3300006844 | Ga0075428_100511804 | Ga0075428_1005118042 | 136 |
| 710 | 3300006852 | Ga0075433_10211345 | Ga0075433_102113451 | 136 |
| 711 | 3300006871 | Ga0075434_100452403 | Ga0075434_1004524032 | 136 |
| 712 | 3300009098 | Ga0105245_11957739 | Ga0105245_119577392 | 136 |
| 713 | 3300014326 | Ga0157380_10885020 | Ga0157380_108850201 | 136 |
| 714 | 3300021384 | Ga0213876_10061746 | Ga0213876_100617461 | 136 |
| 715 | 3300021388 | Ga0213875_10339567 | Ga0213875_103395672 | 136 |
| 716 | 3300025910 | Ga0207684_11150406 | Ga0207684_111504062 | 136 |
| 717 | 3300025931 | Ga0207644_10007383 | Ga0207644_100073837 | 136 |
| 718 | 3300025936 | Ga0207670_10056231 | Ga0207670_100562312 | 136 |
| 719 | 3300025961 | Ga0207712_10326470 | Ga0207712_103264701 | 136 |
| 720 | 3300026088 | Ga0207641_11486583 | Ga0207641_114865832 | 136 |
| 721 | 3300028381 | Ga0268264_11090185 | Ga0268264_110901851 | 136 |
| 722 | 3300031727 | Ga0316576_10085343 | Ga0316576_100853432 | 136 |
| 723 | 3300032126 | Ga0307415_100312714 | Ga0307415_1003127142 | 136 |
| 724 | 3300035724 | Ga0373933_0099958 | Ga0373933_0099958_810_1223 | 136 |
| 725 | 3300039437 | Ga0436365_1188467 | Ga0436365_1188467_3319_3741 | 136 |
| 726 | 3300044673 | Ga0453683_0299343 | Ga0453683_0299343_417_830 | 136 |
| 727 | 3300048917 | Ga0496114_0193498 | Ga0496114_0193498_898_1308 | 136 |
| 728 | 3300049583 | Ga0501067_0538702 | Ga0501067_0538702_190_615 | 136 |
| 729 | 3300049593 | Ga0501077_0051345 | Ga0501077_0051345_416_829 | 136 |
| 730 | 3300050507 | nmdc:mga05p37_1563043_c1 | nmdc:mga05p37_1563043_c1_10_420 | 136 |
| 731 | 3300053146 | Ga0500588_0023315 | Ga0500588_0023315_171_584 | 136 |
| 732 | 3300005295 | Ga0065707_10457094 | Ga0065707_104570941 | 137 |
| 733 | 3300005336 | Ga0070680_100373061 | Ga0070680_1003730611 | 137 |
| 734 | 3300005444 | Ga0070694_100617933 | Ga0070694_1006179332 | 137 |
| 735 | 3300006028 | Ga0070717_10176569 | Ga0070717_101765692 | 137 |
| 736 | 3300025906 | Ga0207699_10000078 | Ga0207699_1000007847 | 137 |
| 737 | 3300035119 | Ga0373956_0376109 | Ga0373956_0376109_52_471 | 137 |
| 738 | 3300035724 | Ga0373933_0037611 | Ga0373933_0037611_2180_2599 | 137 |
| 739 | 3300039447 | Ga0436361_0972566 | Ga0436361_0972566_98_517 | 137 |
| 740 | 3300041512 | Ga0451853_3803030 | Ga0451853_3803030_148_561 | 137 |
| 741 | 3300049575 | Ga0501039_0010519 | Ga0501039_0010519_4829_5245 | 137 |
| 742 | 3300006880 | Ga0075429_100305698 | Ga0075429_1003056983 | 138 |
| 743 | 3300028577 | Ga0265318_10102767 | Ga0265318_101027672 | 138 |
| 744 | 3300031711 | Ga0265314_10211614 | Ga0265314_102116142 | 138 |
| 745 | 3300045051 | Ga0451576_2229617 | Ga0451576_2229617_108_524 | 138 |
| 746 | 3300048907 | Ga0496104_0139756 | Ga0496104_0139756_54_473 | 138 |
| 747 | 3300005347 | Ga0070668_100481021 | Ga0070668_1004810212 | 139 |
| 748 | 3300005471 | Ga0070698_100125706 | Ga0070698_1001257063 | 139 |
| 749 | 3300005518 | Ga0070699_101586919 | Ga0070699_1015869191 | 139 |
| 750 | 3300005719 | Ga0068861_100003765 | Ga0068861_1000037653 | 139 |
| 751 | 3300009101 | Ga0105247_10004607 | Ga0105247_100046077 | 139 |
| 752 | 3300009147 | Ga0114129_11097435 | Ga0114129_110974352 | 139 |
| 753 | 3300009553 | Ga0105249_10032330 | Ga0105249_100323303 | 139 |
| 754 | 3300014326 | Ga0157380_10470460 | Ga0157380_104704602 | 139 |
| 755 | 3300025900 | Ga0207710_10002166 | Ga0207710_100021667 | 139 |
| 756 | 3300026118 | Ga0207675_100007470 | Ga0207675_1000074709 | 139 |
| 757 | 3300031616 | Ga0307508_10136445 | Ga0307508_101364453 | 139 |
| 758 | 3300031903 | Ga0307407_10005376 | Ga0307407_100053766 | 139 |
| 759 | 3300031995 | Ga0307409_100570645 | Ga0307409_1005706452 | 139 |
| 760 | 3300032002 | Ga0307416_101048583 | Ga0307416_1010485831 | 139 |
| 761 | 3300032005 | Ga0307411_10695716 | Ga0307411_106957161 | 139 |
| 762 | 3300032126 | Ga0307415_100073836 | Ga0307415_1000738362 | 139 |
| 763 | 3300042876 | Ga0451577_0222053 | Ga0451577_0222053_177_596 | 139 |
| 764 | 3300042876 | Ga0451577_0293457 | Ga0451577_0293457_500_922 | 139 |
| 765 | 3300042876 | Ga0451577_0908790 | Ga0451577_0908790_78_497 | 139 |
| 766 | 3300042876 | Ga0451577_1162853 | Ga0451577_1162853_175_597 | 139 |
| 767 | 3300044673 | Ga0453683_0022838 | Ga0453683_0022838_3347_3769 | 139 |
| 768 | 3300044673 | Ga0453683_0190765 | Ga0453683_0190765_709_1131 | 139 |
| 769 | 3300044712 | Ga0453684_0001130 | Ga0453684_0001130_61545_61967 | 139 |
| 770 | 3300044712 | Ga0453684_0035005 | Ga0453684_0035005_2128_2550 | 139 |
| 771 | 3300044712 | Ga0453684_0132775 | Ga0453684_0132775_2117_2539 | 139 |
| 772 | 3300044712 | Ga0453684_1893686 | Ga0453684_1893686_80_502 | 139 |
| 773 | 3300049570 | Ga0501033_0322376 | Ga0501033_0322376_288_710 | 139 |
| 774 | 3300049572 | Ga0501036_0705688 | Ga0501036_0705688_47_469 | 139 |
| 775 | 3300049575 | Ga0501039_0192267 | Ga0501039_0192267_1091_1513 | 139 |
| 776 | 3300049577 | Ga0501041_0158836 | Ga0501041_0158836_535_957 | 139 |
| 777 | 3300049590 | Ga0501074_0480048 | Ga0501074_0480048_414_836 | 139 |
| 778 | 3300050507 | nmdc:mga05p37_26584_c1 | nmdc:mga05p37_26584_c1_2635_3126 | 139 |
| 779 | 3300050507 | nmdc:mga05p37_272902_c1 | nmdc:mga05p37_272902_c1_1138_1629 | 139 |
| 780 | 3300050508 | nmdc:mga09592_671355_c1 | nmdc:mga09592_671355_c1_65_487 | 139 |
| 781 | 3300054114 | Ga0501084_0794106 | Ga0501084_0794106_132_554 | 139 |
| 782 | 3300009147 | Ga0114129_10882586 | Ga0114129_108825862 | 140 |
| 783 | 3300026116 | Ga0207674_12092395 | Ga0207674_120923951 | 140 |
| 784 | 3300050507 | nmdc:mga05p37_812233_c1 | nmdc:mga05p37_812233_c1_243_740 | 140 |
| 785 | 3300003320 | rootH2_10046080 | rootH2_100460805 | 141 |
| 786 | 3300005438 | Ga0070701_10445794 | Ga0070701_104457941 | 141 |
| 787 | 3300021384 | Ga0213876_10001046 | Ga0213876_1000104613 | 141 |
| 788 | 3300025910 | Ga0207684_10029482 | Ga0207684_100294823 | 141 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3bic-assembly3.cif.gz_B | crystal structure of human methylmalonyl-coa mutase | 0.9634 | 12 | 134 |
| 3bic-assembly1.cif.gz_A | crystal structure of human methylmalonyl-coa mutase | 0.9632 | 12 | 134 |
| 8dyl-assembly1.cif.gz_B | crystal structure of human methylmalonyl-coa mutase bound to aquocobalamin | 0.963 | 12 | 134 |
| 2xiq-assembly1.cif.gz_A | crystal structure of human methylmalonyl-coa mutase in complex with adenosylcobalamin and malonyl-coa | 0.9591 | 11 | 134 |
| 4r3u-assembly1.cif.gz_C | crystal structure of 2-hydroxyisobutyryl-coa mutase | 0.9477 | 7 | 133 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4I2L1_581_723_3.40.50.280 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain | 0.9647 | 12 | 133 | 3.40.50.280 |
| 3bicB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain | 0.9634 | 12 | 134 | 3.40.50.280 |
| 4r3uD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain | 0.9572 | 10 | 133 | 3.40.50.280 |
| 4r3uD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain | 0.9145 | 10 | 133 | 3.40.50.280 |
| 4jgiA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain | 0.8766 | 9 | 133 | 3.40.50.280 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A512CZW4-F1-model_v4 | Methylmalonyl-CoA mutase | 0.9811 | 10 | 138 |
GO:0016853
GO:0031419 GO:0046872 |
| AF-A0A7W0FPV3-F1-model_v4 | Cobalamin B12-binding domain-containing protein | 0.9808 | 10 | 133 |
GO:0016853
GO:0031419 GO:0046872 |
| AF-A0A6J7NVJ9-F1-model_v4 | Unannotated protein | 0.9808 | 10 | 133 |
GO:0016853
GO:0031419 GO:0046872 |
| AF-A0A538P5B2-F1-model_v4 | B12-binding domain-containing protein | 0.9807 | 25 | 133 |
GO:0004494
GO:0031419 GO:0046872 |
| AF-A0A521KGE8-F1-model_v4 | Cobalamin B12-binding domain-containing protein | 0.9805 | 10 | 133 |
GO:0016853
GO:0031419 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar