F480882

General Info

Members Datasets Scaffolds Average Seq Length
788 341 788 135

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_812233_c1|nmdc:mga05p37_812233_c1_243_740
Length 142
Sequence MSRIDSGGPKLRLLVGKVGLDGHDRGAKIIARALRDAGFEVIYTGLHQTPEMVVATALQEDVDAISLSILSGAHNTLFPRVLSLLKEARVSVPVFGGGIIPEDDIPLLKKAGVRAIFTPGTSTQAVIDWVRKNIRPRRAAAG

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
3 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
4 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
191 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
202 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
203 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
204 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
205 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
206 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
207 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
209 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
210 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
213 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
214 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
218 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
219 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
227 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
228 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
229 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
230 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
231 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
232 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
233 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
234 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
235 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
236 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
237 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
238 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
239 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
240 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
241 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
242 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
243 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
244 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
245 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
246 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
247 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
250 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
251 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
254 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
255 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
258 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
259 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
260 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
261 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
262 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
263 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
264 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
265 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
266 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
267 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
268 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
269 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
270 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
271 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
272 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
273 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
274 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
287 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
290 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
306 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
307 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
308 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
309 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
310 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
311 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
312 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
313 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
314 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
315 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
316 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
317 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
318 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
322 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
323 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
324 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
325 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
328 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
329 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
330 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
331 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
332 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
333 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
334 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
335 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
336 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
337 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
338 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
339 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
340 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
341 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 2.66
Rhizosphere 94.54
Stem 0
Stem Tuber 0
Unclassified 2.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10046080 3300003320 Bacteria 11056
2 JGI26128J50194_1003259 3300003347 Bacteria 1073
3 JGI26129J50193_1008546 3300003349 Bacteria 743
4 JGI26141J51220_1002903 3300003503 Bacteria 1052
5 JGI25405J52794_10066965 3300003911 Bacteria 781
6 Ga0065715_10168556 3300005293 Bacteria 1566
7 Ga0065707_10457094 3300005295 Bacteria 795
8 Ga0070676_10000588 3300005328 Bacteria 17589
9 Ga0070683_100081286 3300005329 Bacteria 3034
10 Ga0070690_100028494 3300005330 Bacteria 3460
11 Ga0070670_100001663 3300005331 Bacteria 18035
12 Ga0070670_100200107 3300005331 Bacteria 1736
13 Ga0070677_10224682 3300005333 Bacteria 919
14 Ga0068869_100018988 3300005334 Bacteria 4688
15 Ga0070680_100016878 3300005336 Bacteria 5747
16 Ga0070680_100089019 3300005336 Bacteria 2554
17 Ga0070680_100373061 3300005336 Bacteria 1214
18 Ga0070680_101266934 3300005336 Bacteria 638
19 Ga0070682_100082204 3300005337 Bacteria 2087
20 Ga0068868_100014751 3300005338 Bacteria 5765
21 Ga0070660_100001299 3300005339 Bacteria 17019
22 Ga0070660_100251598 3300005339 Bacteria 1441
23 Ga0070660_101401850 3300005339 Bacteria 594
24 Ga0070689_100978689 3300005340 Bacteria 752
25 Ga0070691_10014159 3300005341 Bacteria 3657
26 Ga0070691_10402884 3300005341 Bacteria 771
27 Ga0070687_100070949 3300005343 Bacteria 1870
28 Ga0070687_100117754 3300005343 Bacteria 1514
29 Ga0070687_100154021 3300005343 Bacteria 1352
30 Ga0070687_101059744 3300005343 Bacteria 591
31 Ga0070661_100002142 3300005344 Bacteria 13609
32 Ga0070692_10001477 3300005345 Bacteria 8570
33 Ga0070692_10120813 3300005345 Bacteria 1461
34 Ga0070692_10240396 3300005345 Bacteria 1079
35 Ga0070668_100161454 3300005347 Bacteria 1819
36 Ga0070668_100289726 3300005347 Bacteria 1370
37 Ga0070668_100461098 3300005347 Bacteria 1094
38 Ga0070668_100481021 3300005347 Bacteria 1072
39 Ga0070669_100880646 3300005353 Bacteria 764
40 Ga0070675_100056445 3300005354 Bacteria 3237
41 Ga0070674_100009683 3300005356 Bacteria 5783
42 Ga0070673_100046374 3300005364 Bacteria 3375
43 Ga0070673_100326736 3300005364 Bacteria 1356
44 Ga0070688_100942391 3300005365 Bacteria 683
45 Ga0070659_100000151 3300005366 Bacteria 53009
46 Ga0070703_10000082 3300005406 Bacteria 47826
47 Ga0070703_10008942 3300005406 Bacteria 2823
48 Ga0070703_10115699 3300005406 Bacteria 966
49 Ga0070714_100425045 3300005435 Bacteria 1259
50 Ga0070714_101350923 3300005435 Bacteria 696
51 Ga0070701_10005927 3300005438 Bacteria 5100
52 Ga0070701_10082461 3300005438 Bacteria 1744
53 Ga0070701_10445794 3300005438 Bacteria 830
54 Ga0070711_100307370 3300005439 Bacteria 1263
55 Ga0070705_100005341 3300005440 Bacteria 6255
56 Ga0070705_100057718 3300005440 Bacteria 2291
57 Ga0070700_100200567 3300005441 Bacteria 1401
58 Ga0070694_100009064 3300005444 Bacteria 6100
59 Ga0070694_100022828 3300005444 Bacteria 4015
60 Ga0070694_100269427 3300005444 Bacteria 1294
61 Ga0070694_100436069 3300005444 Bacteria 1032
62 Ga0070694_100617933 3300005444 Bacteria 874
63 Ga0070694_101192361 3300005444 Bacteria 638
64 Ga0070708_100000583 3300005445 Bacteria 27405
65 Ga0070708_100021021 3300005445 Bacteria 5511
66 Ga0070708_100028244 3300005445 Bacteria 4826
67 Ga0070708_100038331 3300005445 Bacteria 4187
68 Ga0070708_100214732 3300005445 Bacteria 1803
69 Ga0070708_100296705 3300005445 Bacteria 1522
70 Ga0070708_100509691 3300005445 Bacteria 1135
71 Ga0070708_100517088 3300005445 Bacteria 1126
72 Ga0070708_100823439 3300005445 Bacteria 872
73 Ga0070708_101589985 3300005445 Bacteria 608
74 Ga0070663_100003733 3300005455 Bacteria 8830
75 Ga0070662_100108506 3300005457 Bacteria 2111
76 Ga0070681_10037836 3300005458 Bacteria 4839
77 Ga0068867_100004614 3300005459 Bacteria 9695
78 Ga0068867_100116016 3300005459 Bacteria 2063
79 Ga0070706_100000283 3300005467 Bacteria 61748
80 Ga0070706_100006190 3300005467 Bacteria 11322
81 Ga0070706_100071250 3300005467 Bacteria 3214
82 Ga0070706_100180124 3300005467 Bacteria 1973
83 Ga0070706_100514968 3300005467 Bacteria 1113
84 Ga0070706_100672185 3300005467 Bacteria 961
85 Ga0070706_100934286 3300005467 Bacteria 801
86 Ga0070707_100001868 3300005468 Bacteria 20255
87 Ga0070707_100009176 3300005468 Bacteria 9176
88 Ga0070707_100045990 3300005468 Bacteria 4177
89 Ga0070707_100263414 3300005468 Bacteria 1677
90 Ga0070707_100630077 3300005468 Bacteria 1035
91 Ga0070707_100838032 3300005468 Bacteria 884
92 Ga0070698_100006229 3300005471 Bacteria 12983
93 Ga0070698_100011760 3300005471 Bacteria 9285
94 Ga0070698_100045170 3300005471 Bacteria 4509
95 Ga0070698_100072254 3300005471 Bacteria 3458
96 Ga0070698_100125706 3300005471 Bacteria 2522
97 Ga0070698_100269410 3300005471 Bacteria 1635
98 Ga0070698_100324111 3300005471 Bacteria 1471
99 Ga0070698_100531121 3300005471 Bacteria 1115
100 Ga0070699_100002671 3300005518 Bacteria 15939
101 Ga0070699_100009735 3300005518 Bacteria 8316
102 Ga0070699_100010530 3300005518 Bacteria 8001
103 Ga0070699_100010909 3300005518 Bacteria 7859
104 Ga0070699_100051831 3300005518 Bacteria 3553
105 Ga0070699_100128281 3300005518 Bacteria 2235
106 Ga0070699_100276075 3300005518 Bacteria 1505
107 Ga0070699_100576939 3300005518 Bacteria 1025
108 Ga0070699_101441603 3300005518 Bacteria 631
109 Ga0070699_101586919 3300005518 Bacteria 600
110 Ga0070699_101619268 3300005518 Bacteria 593
111 Ga0070679_100018431 3300005530 Bacteria 6774
112 Ga0070684_100247826 3300005535 Bacteria 1628
113 Ga0070684_100556989 3300005535 Bacteria 1064
114 Ga0070684_102130774 3300005535 Bacteria 529
115 Ga0070697_100012401 3300005536 Bacteria 6678
116 Ga0070697_100025737 3300005536 Bacteria 4694
117 Ga0070697_100057701 3300005536 Bacteria 3158
118 Ga0070697_100111234 3300005536 Bacteria 2283
119 Ga0070697_100343119 3300005536 Bacteria 1289
120 Ga0070697_101152304 3300005536 Bacteria 691
121 Ga0070697_101236456 3300005536 Bacteria 666
122 Ga0070697_101407410 3300005536 Bacteria 623
123 Ga0068853_100000770 3300005539 Bacteria 22242
124 Ga0070672_100335794 3300005543 Bacteria 1286
125 Ga0070686_101791548 3300005544 Bacteria 522
126 Ga0070695_100000741 3300005545 Bacteria 17438
127 Ga0070695_100009086 3300005545 Bacteria 5907
128 Ga0070695_100012118 3300005545 Bacteria 5168
129 Ga0070695_100036925 3300005545 Bacteria 3077
130 Ga0070695_100037828 3300005545 Bacteria 3043
131 Ga0070695_100369162 3300005545 Bacteria 1080
132 Ga0070696_100006635 3300005546 Bacteria 7732
133 Ga0070696_100045225 3300005546 Bacteria 3050
134 Ga0070696_100053630 3300005546 Bacteria 2807
135 Ga0070693_100036152 3300005547 Bacteria 2743
136 Ga0070665_100127346 3300005548 Bacteria 2549
137 Ga0070704_100000772 3300005549 Bacteria 15796
138 Ga0070704_100013537 3300005549 Bacteria 5063
139 Ga0070704_100169732 3300005549 Bacteria 1733
140 Ga0070704_100394023 3300005549 Bacteria 1180
141 Ga0070704_101142999 3300005549 Bacteria 708
142 Ga0068855_100001154 3300005563 Bacteria 32715
143 Ga0070664_100002406 3300005564 Bacteria 15035
144 Ga0068857_100051090 3300005577 Bacteria 3666
145 Ga0068857_100080218 3300005577 Bacteria 2914
146 Ga0068854_100245480 3300005578 Bacteria 1428
147 Ga0068856_100002395 3300005614 Bacteria 19288
148 Ga0068856_100308124 3300005614 Bacteria 1601
149 Ga0068856_102190458 3300005614 Bacteria 562
150 Ga0070702_100009072 3300005615 Bacteria 4852
151 Ga0070702_100099464 3300005615 Bacteria 1781
152 Ga0068852_100238455 3300005616 Bacteria 1737
153 Ga0068859_100006563 3300005617 Bacteria 11808
154 Ga0068864_100005076 3300005618 Bacteria 10783
155 Ga0068864_100923613 3300005618 Bacteria 863
156 Ga0068866_10009087 3300005718 Bacteria 4212
157 Ga0068861_100003765 3300005719 Bacteria 10123
158 Ga0068861_100024113 3300005719 Bacteria 4396
159 Ga0068861_100717266 3300005719 Bacteria 931
160 Ga0068861_101683835 3300005719 Bacteria 627
161 Ga0068851_10070783 3300005834 Bacteria 1804
162 Ga0068870_10000998 3300005840 Bacteria 11176
163 Ga0068863_100018853 3300005841 Bacteria 6603
164 Ga0068863_101183513 3300005841 Bacteria 770
165 Ga0068858_100009267 3300005842 Bacteria 9400
166 Ga0068858_101512905 3300005842 Bacteria 662
167 Ga0068860_100008113 3300005843 Bacteria 10457
168 Ga0068860_100042525 3300005843 Bacteria 4338
169 Ga0068860_100213371 3300005843 Bacteria 1873
170 Ga0068860_100807077 3300005843 Bacteria 952
171 Ga0068862_100000162 3300005844 Bacteria 74622
172 Ga0068862_100003260 3300005844 Bacteria 14037
173 Ga0068862_100011451 3300005844 Bacteria 7321
174 Ga0068862_100316117 3300005844 Bacteria 1440
175 Ga0068862_100499838 3300005844 Bacteria 1154
176 Ga0068862_100907800 3300005844 Unclassified 866
177 Ga0068862_100926655 3300005844 Bacteria 858
178 Ga0081455_10000614 3300005937 Bacteria 46194
179 Ga0081455_10003792 3300005937 Bacteria 17254
180 Ga0081455_10058331 3300005937 Bacteria 3266
181 Ga0070717_10176569 3300006028 Bacteria 1860
182 Ga0070715_10930975 3300006163 Bacteria 537
183 Ga0070716_100024053 3300006173 Bacteria 3238
184 Ga0070716_101385537 3300006173 Bacteria 571
185 Ga0097621_100048524 3300006237 Bacteria 3445
186 Ga0097621_101188553 3300006237 Unclassified 718
187 Ga0075428_100000357 3300006844 Bacteria 45378
188 Ga0075428_100023841 3300006844 Bacteria 6771
189 Ga0075428_100294503 3300006844 Bacteria 1745
190 Ga0075428_100511804 3300006844 Bacteria 1284
191 Ga0075430_100001708 3300006846 Bacteria 17901
192 Ga0075430_100016571 3300006846 Bacteria 6276
193 Ga0075430_100097232 3300006846 Bacteria 2460
194 Ga0075431_100002572 3300006847 Bacteria 17520
195 Ga0075431_100563872 3300006847 Bacteria 1125
196 Ga0075431_101193434 3300006847 Bacteria 724
197 Ga0075433_10004677 3300006852 Bacteria 10670
198 Ga0075433_10014405 3300006852 Bacteria 6458
199 Ga0075433_10211345 3300006852 Bacteria 1724
200 Ga0075434_100016588 3300006871 Bacteria 7082
201 Ga0075434_100027771 3300006871 Bacteria 5557
202 Ga0075434_100452403 3300006871 Bacteria 1305
203 Ga0075429_100003314 3300006880 Bacteria 13714
204 Ga0075429_100033678 3300006880 Bacteria 4452
205 Ga0075429_100305698 3300006880 Bacteria 1392
206 Ga0068865_100130243 3300006881 Bacteria 1884
207 Ga0068865_100248538 3300006881 Bacteria 1403
208 Ga0075436_100060804 3300006914 Bacteria 2610
209 Ga0097620_100006563 3300006931 Bacteria 11808
210 Ga0075435_100003548 3300007076 Bacteria 10596
211 Ga0075435_100012212 3300007076 Bacteria 6352
212 Ga0075435_100043942 3300007076 Bacteria 3578
213 Ga0099794_10008989 3300007265 Bacteria 4171
214 Ga0111539_10073323 3300009094 Bacteria 4036
215 Ga0111539_10106643 3300009094 Bacteria 3287
216 Ga0111539_12097470 3300009094 Bacteria 656
217 Ga0105245_10094169 3300009098 Bacteria 2761
218 Ga0105245_10459602 3300009098 Bacteria 1283
219 Ga0105245_10513612 3300009098 Bacteria 1216
220 Ga0105245_11741846 3300009098 Bacteria 676
221 Ga0105245_11957739 3300009098 Unclassified 639
222 Ga0105247_10004607 3300009101 Bacteria 8791
223 Ga0114129_10005541 3300009147 Bacteria 17859
224 Ga0114129_10007147 3300009147 Bacteria 15887
225 Ga0114129_10040034 3300009147 Bacteria 6610
226 Ga0114129_10363000 3300009147 Bacteria 1916
227 Ga0114129_10373878 3300009147 Bacteria 1883
228 Ga0114129_10483732 3300009147 Bacteria 1619
229 Ga0114129_10882586 3300009147 Bacteria 1134
230 Ga0114129_11097435 3300009147 Bacteria 996
231 Ga0105243_10003778 3300009148 Bacteria 12134
232 Ga0105243_10013620 3300009148 Bacteria 6151
233 Ga0105243_10152234 3300009148 Bacteria 1985
234 Ga0105241_10000054 3300009174 Bacteria 93205
235 Ga0105241_10106019 3300009174 Bacteria 2242
236 Ga0105242_10026733 3300009176 Bacteria 4576
237 Ga0105242_10031653 3300009176 Bacteria 4228
238 Ga0105249_10032330 3300009553 Bacteria 4732
239 Ga0105249_10364517 3300009553 Bacteria 1467
240 Ga0105249_11280044 3300009553 Bacteria 805
241 Ga0105249_12575724 3300009553 Bacteria 581
242 Ga0105239_10305422 3300010375 Bacteria 1792
243 Ga0105239_10355027 3300010375 Bacteria 1655
244 Ga0105246_10090821 3300011119 Bacteria 2200
245 Ga0105246_10449335 3300011119 Bacteria 1083
246 Ga0157373_10003678 3300013100 Bacteria 11600
247 Ga0157371_10369429 3300013102 Bacteria 1046
248 Ga0157370_11775756 3300013104 Bacteria 554
249 Ga0157369_10367991 3300013105 Bacteria 1492
250 Ga0157369_10478043 3300013105 Bacteria 1289
251 Ga0157378_10958046 3300013297 Bacteria 889
252 Ga0163162_10093658 3300013306 Bacteria 3089
253 Ga0163162_10856273 3300013306 Bacteria 1024
254 Ga0157372_10027062 3300013307 Bacteria 6242
255 Ga0163163_11604912 3300014325 Bacteria 711
256 Ga0157380_10289878 3300014326 Bacteria 1502
257 Ga0157380_10470460 3300014326 Bacteria 1213
258 Ga0157380_10520639 3300014326 Bacteria 1160
259 Ga0157380_10867307 3300014326 Bacteria 926
260 Ga0157380_10885020 3300014326 Bacteria 918
261 Ga0157380_12487862 3300014326 Bacteria 583
262 Ga0157377_10103879 3300014745 Bacteria 1698
263 Ga0157379_10648610 3300014968 Bacteria 988
264 Ga0206353_12000993 3300020082 Bacteria 1180
265 Ga0213873_10044432 3300021358 Bacteria 1156
266 Ga0213876_10001046 3300021384 Bacteria 17885
267 Ga0213876_10004607 3300021384 Bacteria 7687
268 Ga0213876_10061746 3300021384 Bacteria 1977
269 Ga0213875_10339567 3300021388 Bacteria 713
270 Ga0224572_1058690 3300024225 Bacteria 714
271 Ga0207653_10000045 3300025885 Bacteria 94691
272 Ga0207653_10007436 3300025885 Bacteria 3414
273 Ga0207653_10028141 3300025885 Bacteria 1807
274 Ga0207653_10033016 3300025885 Bacteria 1677
275 Ga0207682_10441383 3300025893 Bacteria 616
276 Ga0207642_10084475 3300025899 Bacteria 1551
277 Ga0207642_10274023 3300025899 Bacteria 968
278 Ga0207710_10002166 3300025900 Bacteria 9227
279 Ga0207688_10032149 3300025901 Bacteria 2899
280 Ga0207647_10049868 3300025904 Bacteria 2595
281 Ga0207699_10000078 3300025906 Bacteria 76220
282 Ga0207645_10000059 3300025907 Bacteria 78254
283 Ga0207645_10076164 3300025907 Bacteria 2148
284 Ga0207643_10000014 3300025908 Bacteria 128891
285 Ga0207684_10000058 3300025910 Bacteria 211166
286 Ga0207684_10002971 3300025910 Bacteria 16802
287 Ga0207684_10029482 3300025910 Bacteria 4672
288 Ga0207684_10053561 3300025910 Bacteria 3424
289 Ga0207684_10095377 3300025910 Bacteria 2538
290 Ga0207684_10504636 3300025910 Bacteria 1037
291 Ga0207684_11150406 3300025910 Bacteria 644
292 Ga0207654_10012260 3300025911 Bacteria 4389
293 Ga0207654_10044278 3300025911 Bacteria 2527
294 Ga0207707_10000138 3300025912 Bacteria 74881
295 Ga0207663_10265842 3300025916 Bacteria 1268
296 Ga0207660_10009143 3300025917 Bacteria 6417
297 Ga0207660_10056932 3300025917 Bacteria 2799
298 Ga0207662_10071208 3300025918 Bacteria 2105
299 Ga0207662_10491034 3300025918 Bacteria 844
300 Ga0207657_10000135 3300025919 Bacteria 75248
301 Ga0207649_10009708 3300025920 Bacteria 5271
302 Ga0207652_10004746 3300025921 Bacteria 11015
303 Ga0207646_10001054 3300025922 Bacteria 35091
304 Ga0207646_10008859 3300025922 Bacteria 10021
305 Ga0207646_10031170 3300025922 Bacteria 4828
306 Ga0207646_10061793 3300025922 Bacteria 3343
307 Ga0207646_10071144 3300025922 Bacteria 3106
308 Ga0207646_10112763 3300025922 Bacteria 2440
309 Ga0207646_10117855 3300025922 Bacteria 2385
310 Ga0207646_10149153 3300025922 Bacteria 2108
311 Ga0207681_10070863 3300025923 Bacteria 2429
312 Ga0207681_10756343 3300025923 Bacteria 810
313 Ga0207681_11368700 3300025923 Bacteria 594
314 Ga0207650_10012843 3300025925 Bacteria 5787
315 Ga0207650_10472322 3300025925 Bacteria 1046
316 Ga0207659_10070486 3300025926 Bacteria 2549
317 Ga0207659_10778842 3300025926 Bacteria 821
318 Ga0207659_11211582 3300025926 Bacteria 649
319 Ga0207687_10089735 3300025927 Bacteria 2239
320 Ga0207687_10103469 3300025927 Bacteria 2100
321 Ga0207687_10800515 3300025927 Bacteria 804
322 Ga0207687_10997216 3300025927 Bacteria 718
323 Ga0207644_10007383 3300025931 Bacteria 7161
324 Ga0207644_11485042 3300025931 Bacteria 569
325 Ga0207690_10010140 3300025932 Bacteria 5596
326 Ga0207706_10006677 3300025933 Bacteria 10670
327 Ga0207706_10189614 3300025933 Bacteria 1805
328 Ga0207686_10018333 3300025934 Bacteria 3962
329 Ga0207686_10025017 3300025934 Bacteria 3467
330 Ga0207686_10181575 3300025934 Bacteria 1492
331 Ga0207709_10027194 3300025935 Bacteria 3292
332 Ga0207709_10604517 3300025935 Bacteria 869
333 Ga0207670_10056231 3300025936 Bacteria 2663
334 Ga0207670_10253548 3300025936 Bacteria 1361
335 Ga0207670_10840774 3300025936 Bacteria 766
336 Ga0207670_11731054 3300025936 Bacteria 532
337 Ga0207669_10406942 3300025937 Bacteria 1067
338 Ga0207704_10142358 3300025938 Bacteria 1680
339 Ga0207704_10174569 3300025938 Bacteria 1546
340 Ga0207704_10541625 3300025938 Bacteria 944
341 Ga0207665_10004861 3300025939 Bacteria 8945
342 Ga0207691_10327973 3300025940 Bacteria 1312
343 Ga0207689_10000340 3300025942 Bacteria 43593
344 Ga0207689_10006849 3300025942 Bacteria 10023
345 Ga0207689_10177125 3300025942 Bacteria 1758
346 Ga0207689_10720620 3300025942 Bacteria 841
347 Ga0207679_10000212 3300025945 Bacteria 46385
348 Ga0207679_11484122 3300025945 Bacteria 622
349 Ga0207667_10000296 3300025949 Bacteria 68803
350 Ga0207651_10158798 3300025960 Bacteria 1770
351 Ga0207651_10967057 3300025960 Bacteria 760
352 Ga0207651_11014433 3300025960 Bacteria 742
353 Ga0207712_10224682 3300025961 Bacteria 1503
354 Ga0207712_10326470 3300025961 Bacteria 1268
355 Ga0207712_10382039 3300025961 Bacteria 1179
356 Ga0207668_10356651 3300025972 Bacteria 1224
357 Ga0207640_10430247 3300025981 Bacteria 1082
358 Ga0207640_11408326 3300025981 Bacteria 625
359 Ga0207658_10176741 3300025986 Bacteria 1764
360 Ga0207677_10059785 3300026023 Bacteria 2630
361 Ga0207677_10106326 3300026023 Bacteria 2079
362 Ga0207703_10070426 3300026035 Bacteria 2886
363 Ga0207639_10001773 3300026041 Bacteria 14523
364 Ga0207678_10008386 3300026067 Bacteria 9116
365 Ga0207708_10332147 3300026075 Bacteria 1243
366 Ga0207708_10981637 3300026075 Unclassified 733
367 Ga0207702_10001150 3300026078 Bacteria 27070
368 Ga0207702_10878038 3300026078 Bacteria 888
369 Ga0207641_10015083 3300026088 Bacteria 6333
370 Ga0207641_10847736 3300026088 Bacteria 906
371 Ga0207641_11486583 3300026088 Bacteria 679
372 Ga0207641_12031528 3300026088 Bacteria 576
373 Ga0207648_10001239 3300026089 Bacteria 28649
374 Ga0207648_10170983 3300026089 Bacteria 1921
375 Ga0207648_10870627 3300026089 Bacteria 841
376 Ga0207676_10001946 3300026095 Bacteria 15063
377 Ga0207674_10000684 3300026116 Bacteria 44066
378 Ga0207674_10092508 3300026116 Bacteria 3014
379 Ga0207674_12092395 3300026116 Bacteria 530
380 Ga0207675_100007470 3300026118 Bacteria 10328
381 Ga0207675_100013598 3300026118 Bacteria 7598
382 Ga0207675_100228367 3300026118 Bacteria 1795
383 Ga0207675_100353683 3300026118 Bacteria 1440
384 Ga0207683_10309953 3300026121 Bacteria 1445
385 Ga0207698_10258374 3300026142 Bacteria 1599
386 Ga0209969_1004099 3300027360 Bacteria 2037
387 Ga0209981_1000769 3300027378 Bacteria 4058
388 Ga0209996_1019501 3300027395 Bacteria 947
389 Ga0209984_1004388 3300027424 Bacteria 1661
390 Ga0210000_1000448 3300027462 Bacteria 5673
391 Ga0209995_1000374 3300027471 Bacteria 6947
392 Ga0209968_1001337 3300027526 Bacteria 3744
393 Ga0209999_1000584 3300027543 Bacteria 5759
394 Ga0209982_1000382 3300027552 Bacteria 5370
395 Ga0209970_1003011 3300027614 Bacteria 2839
396 Ga0210002_1000361 3300027617 Bacteria 6201
397 Ga0209983_1000369 3300027665 Bacteria 9555
398 Ga0209588_1000615 3300027671 Bacteria 9019
399 Ga0209971_1000010 3300027682 Bacteria 84272
400 Ga0209971_1014366 3300027682 Bacteria 1876
401 Ga0209966_1000255 3300027695 Bacteria 19477
402 Ga0209998_10000131 3300027717 Bacteria 29645
403 Ga0209974_10011978 3300027876 Bacteria 2905
404 Ga0209974_10090727 3300027876 Bacteria 1059
405 Ga0207428_10042512 3300027907 Bacteria 3675
406 Ga0207428_10393401 3300027907 Bacteria 1015
407 Ga0268265_10003910 3300028380 Bacteria 10504
408 Ga0268265_10103562 3300028380 Bacteria 2305
409 Ga0268265_10159525 3300028380 Bacteria 1914
410 Ga0268265_10645417 3300028380 Bacteria 1017
411 Ga0268265_10837138 3300028380 Unclassified 899
412 Ga0268264_10005855 3300028381 Bacteria 10408
413 Ga0268264_10030130 3300028381 Bacteria 4448
414 Ga0268264_10057388 3300028381 Bacteria 3257
415 Ga0268264_10373112 3300028381 Bacteria 1364
416 Ga0268264_11031500 3300028381 Bacteria 830
417 Ga0268264_11090185 3300028381 Bacteria 807
418 Ga0265318_10102767 3300028577 Bacteria 1051
419 Ga0307508_10136445 3300031616 Bacteria 2057
420 Ga0265314_10211614 3300031711 Bacteria 1138
421 Ga0316576_10085343 3300031727 Unclassified 2347
422 Ga0316576_10285515 3300031727 Bacteria 1235
423 Ga0307406_10041134 3300031901 Bacteria 2878
424 Ga0307407_10005376 3300031903 Bacteria 5554
425 Ga0307412_10256423 3300031911 Bacteria 1361
426 Ga0307409_100570645 3300031995 Bacteria 1114
427 Ga0307409_100904098 3300031995 Bacteria 897
428 Ga0307416_100176682 3300032002 Bacteria 1996
429 Ga0307416_101048583 3300032002 Bacteria 919
430 Ga0307411_10695716 3300032005 Bacteria 885
431 Ga0307415_100073836 3300032126 Bacteria 2408
432 Ga0307415_100312714 3300032126 Bacteria 1306
433 Ga0373948_0049804 3300034817 Bacteria 897
434 Ga0373929_0000028 3300035085 Bacteria 51775
435 Ga0373934_0043704 3300035086 Bacteria 1771
436 Ga0373949_0013924 3300035090 Bacteria 1788
437 Ga0373949_0015575 3300035090 Bacteria 1700
438 Ga0373951_0008441 3300035091 Bacteria 2328
439 Ga0373952_0008087 3300035092 Bacteria 1988
440 Ga0373923_0063776 3300035111 Bacteria 1570
441 Ga0373939_0065523 3300035114 Bacteria 1169
442 Ga0373956_0009666 3300035119 Bacteria 3926
443 Ga0373956_0376109 3300035119 Bacteria 677
444 Ga0373960_0088943 3300035121 Bacteria 984
445 Ga0373955_0024400 3300035172 Bacteria 3093
446 Ga0373961_0013978 3300035241 Bacteria 2032
447 Ga0373962_0191583 3300035242 Bacteria 688
448 Ga0373924_0057007 3300035410 Bacteria 1628
449 Ga0373931_0100911 3300035691 Bacteria 1623
450 Ga0373935_0107433 3300035692 Bacteria 1848
451 Ga0373935_0764871 3300035692 Bacteria 712
452 Ga0373927_0177129 3300035695 Bacteria 1398
453 Ga0373927_0743036 3300035695 Bacteria 648
454 Ga0373933_0037611 3300035724 Bacteria 2840
455 Ga0373933_0099958 3300035724 Bacteria 1799
456 Ga0373947_0093565 3300035725 Bacteria 1879
457 Ga0373947_0191145 3300035725 Bacteria 1336
458 Ga0373947_0953908 3300035725 Bacteria 585
459 Ga0373937_0026867 3300036401 Bacteria 5203
460 Ga0373937_1537906 3300036401 Bacteria 613
461 Ga0373937_1953352 3300036401 Bacteria 533
462 Ga0316584_0020695 3300036712 Bacteria 4773
463 Ga0373925_0875889 3300037068 Bacteria 740
464 Ga0395899_0530276 3300037312 Bacteria 760
465 Ga0395900_1265827 3300037418 Bacteria 652
466 Ga0395905_1102576 3300037471 Bacteria 697
467 Ga0436364_1035773 3300037853 Bacteria 1027
468 Ga0436364_1556529 3300037853 Bacteria 20506
469 Ga0242419_007769 3300038698 Bacteria 795
470 Ga0436365_0065915 3300039437 Bacteria 6828
471 Ga0436365_0149285 3300039437 Bacteria 9298
472 Ga0436365_0159496 3300039437 Bacteria 17926
473 Ga0436365_0798370 3300039437 Bacteria 1269
474 Ga0436365_1038217 3300039437 Bacteria 1138
475 Ga0436365_1188467 3300039437 Bacteria 8003
476 Ga0436365_1923113 3300039437 Bacteria 57992
477 Ga0436360_0649357 3300039438 Bacteria 581
478 Ga0436361_0972566 3300039447 Bacteria 640
479 Ga0436363_0853455 3300039450 Bacteria 563
480 Ga0436362_0627738 3300039453 Bacteria 1790
481 Ga0436362_0639565 3300039453 Bacteria 1737
482 Ga0436362_1060922 3300039453 Bacteria 510
483 Ga0439465_0347289 3300041413 Bacteria 560
484 Ga0451845_0815444 3300041501 Bacteria 626
485 Ga0451853_3803030 3300041512 Bacteria 653
486 Ga0439448_0003629 3300042005 Bacteria 4299
487 Ga0439448_0007395 3300042005 Bacteria 3184
488 Ga0439454_054371 3300042011 Bacteria 683
489 Ga0439463_034283 3300042016 Bacteria 1284
490 Ga0439458_0006751 3300042157 Bacteria 2557
491 Ga0439458_0014062 3300042157 Bacteria 1805
492 Ga0439458_0163144 3300042157 Bacteria 600
493 Ga0439464_0017027 3300042439 Bacteria 1968
494 Ga0439460_0000656 3300042461 Bacteria 7607
495 Ga0439460_0200733 3300042461 Bacteria 679
496 Ga0451577_0003247 3300042876 Bacteria 18283
497 Ga0451577_0009390 3300042876 Bacteria 9428
498 Ga0451577_0044898 3300042876 Bacteria 3955
499 Ga0451577_0222053 3300042876 Bacteria 1708
500 Ga0451577_0293457 3300042876 Bacteria 1473
501 Ga0451577_0908790 3300042876 Bacteria 793
502 Ga0451577_1162853 3300042876 Bacteria 689
503 Ga0453683_0011056 3300044673 Bacteria 5967
504 Ga0453683_0022003 3300044673 Bacteria 4067
505 Ga0453683_0022838 3300044673 Bacteria 3989
506 Ga0453683_0190765 3300044673 Bacteria 1300
507 Ga0453683_0299343 3300044673 Bacteria 1029
508 Ga0453684_0001130 3300044712 Bacteria 83545
509 Ga0453684_0035005 3300044712 Bacteria 6953
510 Ga0453684_0061790 3300044712 Bacteria 4806
511 Ga0453684_0132775 3300044712 Bacteria 2985
512 Ga0453684_0199755 3300044712 Bacteria 2332
513 Ga0453684_0357088 3300044712 Bacteria 1646
514 Ga0453684_1893686 3300044712 Bacteria 604
515 Ga0466960_0013814 3300044901 Bacteria 3441
516 Ga0466959_0067718 3300045049 Bacteria 2588
517 Ga0451576_0014386 3300045051 Bacteria 8809
518 Ga0451576_0020073 3300045051 Bacteria 7283
519 Ga0451576_0093517 3300045051 Bacteria 3126
520 Ga0451576_0192138 3300045051 Bacteria 2132
521 Ga0451576_0372843 3300045051 Bacteria 1495
522 Ga0451576_2229617 3300045051 Bacteria 562
523 Ga0466967_0425912 3300045976 Bacteria 1294
524 Ga0495592_0275108 3300046454 Bacteria 1103
525 Ga0495603_0004360 3300046455 Bacteria 8441
526 Ga0495651_0037217 3300046462 Bacteria 3788
527 Ga0495580_0106354 3300046472 Bacteria 1949
528 Ga0495580_0416772 3300046472 Bacteria 904
529 Ga0495580_0425687 3300046472 Bacteria 892
530 Ga0495580_0528159 3300046472 Bacteria 786
531 Ga0495662_0431744 3300046476 Bacteria 647
532 Ga0495584_0237315 3300046491 Bacteria 927
533 Ga0495596_0187756 3300046500 Bacteria 804
534 Ga0495628_0145056 3300046516 Bacteria 1810
535 Ga0495631_0260290 3300046518 Bacteria 739
536 Ga0495644_0141544 3300046523 Bacteria 919
537 Ga0495663_0084865 3300046525 Bacteria 1025
538 Ga0495642_0163843 3300046528 Bacteria 965
539 Ga0495598_0074727 3300046537 Bacteria 1075
540 Ga0495609_0040345 3300046538 Bacteria 2101
541 Ga0495656_0115743 3300046615 Bacteria 1260
542 Ga0495656_0401558 3300046615 Bacteria 717
543 Ga0495659_0058969 3300046664 Bacteria 1414
544 Ga0495588_0044320 3300046674 Bacteria 2278
545 Ga0495658_0382657 3300046683 Bacteria 896
546 Ga0495658_0449008 3300046683 Bacteria 823
547 Ga0495613_0453497 3300046689 Bacteria 869
548 Ga0495670_0069468 3300046691 Bacteria 1781
549 Ga0495589_0352612 3300046794 Bacteria 678
550 Ga0495676_0029660 3300047321 Bacteria 4656
551 Ga0495680_0253393 3300047322 Bacteria 1247
552 Ga0495593_0450376 3300047673 Bacteria 644
553 Ga0495615_0307389 3300048090 Bacteria 515
554 Ga0495626_0350011 3300048091 Bacteria 577
555 Ga0496100_0009320 3300048903 Bacteria 5515
556 Ga0496101_0033968 3300048904 Bacteria 3601
557 Ga0496102_0120610 3300048905 Bacteria 2449
558 Ga0496102_0322978 3300048905 Bacteria 1454
559 Ga0496103_0125572 3300048906 Bacteria 1636
560 Ga0496103_1052771 3300048906 Bacteria 505
561 Ga0496104_0139756 3300048907 Bacteria 2327
562 Ga0496104_0240883 3300048907 Bacteria 1721
563 Ga0496104_0389654 3300048907 Bacteria 1306
564 Ga0496106_0005863 3300048909 Bacteria 9086
565 Ga0496107_0056043 3300048910 Bacteria 2847
566 Ga0496108_0341688 3300048911 Bacteria 1306
567 Ga0496109_0330170 3300048912 Bacteria 1440
568 Ga0496109_1810577 3300048912 Bacteria 544
569 Ga0496110_0105058 3300048913 Bacteria 2534
570 Ga0496110_0274048 3300048913 Bacteria 1536
571 Ga0496112_0259028 3300048915 Bacteria 1689
572 Ga0496113_0230130 3300048916 Bacteria 1478
573 Ga0496114_0193498 3300048917 Bacteria 1780
574 Ga0496114_1635590 3300048917 Bacteria 532
575 Ga0496115_1058152 3300048918 Bacteria 617
576 Ga0496121_0239401 3300048924 Bacteria 1266
577 Ga0501031_0013951 3300049568 Bacteria 5233
578 Ga0501031_0025568 3300049568 Bacteria 3850
579 Ga0501031_0709142 3300049568 Bacteria 646
580 Ga0501032_0329505 3300049569 Bacteria 985
581 Ga0501032_0693990 3300049569 Bacteria 645
582 Ga0501033_0073110 3300049570 Bacteria 2517
583 Ga0501033_0168364 3300049570 Bacteria 1574
584 Ga0501033_0318659 3300049570 Bacteria 1092
585 Ga0501033_0322376 3300049570 Bacteria 1085
586 Ga0501034_0003490 3300049571 Bacteria 17860
587 Ga0501036_0007145 3300049572 Bacteria 9093
588 Ga0501036_0180149 3300049572 Bacteria 1779
589 Ga0501036_0305736 3300049572 Bacteria 1330
590 Ga0501036_0328150 3300049572 Bacteria 1278
591 Ga0501036_0705688 3300049572 Bacteria 833
592 Ga0501036_0716310 3300049572 Bacteria 826
593 Ga0501036_0831054 3300049572 Bacteria 760
594 Ga0501036_1231675 3300049572 Bacteria 609
595 Ga0501037_0032414 3300049573 Bacteria 3858
596 Ga0501037_0053145 3300049573 Bacteria 2963
597 Ga0501038_0017563 3300049574 Bacteria 6468
598 Ga0501038_0021842 3300049574 Bacteria 5740
599 Ga0501038_0030031 3300049574 Bacteria 4812
600 Ga0501039_0007616 3300049575 Bacteria 8272
601 Ga0501039_0010519 3300049575 Bacteria 7051
602 Ga0501039_0020587 3300049575 Bacteria 5055
603 Ga0501039_0153733 3300049575 Bacteria 1807
604 Ga0501039_0192267 3300049575 Bacteria 1605
605 Ga0501039_0212800 3300049575 Bacteria 1520
606 Ga0501039_0397720 3300049575 Bacteria 1082
607 Ga0501040_0000885 3300049576 Bacteria 18814
608 Ga0501040_0006494 3300049576 Bacteria 7594
609 Ga0501040_0010600 3300049576 Bacteria 6027
610 Ga0501040_0036168 3300049576 Bacteria 3350
611 Ga0501040_0043429 3300049576 Bacteria 3064
612 Ga0501040_0231372 3300049576 Bacteria 1316
613 Ga0501040_0357348 3300049576 Bacteria 1047
614 Ga0501041_0012864 3300049577 Bacteria 4957
615 Ga0501041_0158836 3300049577 Bacteria 1413
616 Ga0501041_0162426 3300049577 Bacteria 1397
617 Ga0501041_0187160 3300049577 Bacteria 1296
618 Ga0501041_0365065 3300049577 Bacteria 913
619 Ga0501042_0002826 3300049578 Bacteria 10752
620 Ga0501042_0007869 3300049578 Bacteria 7011
621 Ga0501042_0017392 3300049578 Bacteria 4958
622 Ga0501042_0080804 3300049578 Bacteria 2329
623 Ga0501042_0114812 3300049578 Bacteria 1939
624 Ga0501043_0079293 3300049579 Bacteria 2580
625 Ga0501043_0598354 3300049579 Bacteria 815
626 Ga0501046_0012826 3300049580 Bacteria 7129
627 Ga0501046_0131160 3300049580 Bacteria 1901
628 Ga0501046_0195152 3300049580 Bacteria 1509
629 Ga0501047_0439684 3300049581 Bacteria 1134
630 Ga0501047_1083825 3300049581 Bacteria 614
631 Ga0501048_0007737 3300049582 Bacteria 8146
632 Ga0501048_0010796 3300049582 Bacteria 6809
633 Ga0501048_0493595 3300049582 Bacteria 878
634 Ga0501067_0108009 3300049583 Bacteria 1547
635 Ga0501067_0338877 3300049583 Bacteria 838
636 Ga0501067_0538702 3300049583 Bacteria 654
637 Ga0501068_0013113 3300049584 Bacteria 4711
638 Ga0501068_0034399 3300049584 Bacteria 3022
639 Ga0501068_0037885 3300049584 Bacteria 2887
640 Ga0501068_0252952 3300049584 Bacteria 1123
641 Ga0501068_1017447 3300049584 Bacteria 547
642 Ga0501069_0058078 3300049585 Bacteria 2158
643 Ga0501070_0122104 3300049586 Bacteria 2153
644 Ga0501070_1079479 3300049586 Bacteria 620
645 Ga0501070_1388773 3300049586 Bacteria 534
646 Ga0501071_0011839 3300049587 Bacteria 5888
647 Ga0501071_0027014 3300049587 Bacteria 4035
648 Ga0501071_0034337 3300049587 Bacteria 3609
649 Ga0501071_0062016 3300049587 Bacteria 2708
650 Ga0501071_0120637 3300049587 Bacteria 1943
651 Ga0501071_0276282 3300049587 Bacteria 1271
652 Ga0501072_0005345 3300049588 Bacteria 9775
653 Ga0501072_0039140 3300049588 Bacteria 3723
654 Ga0501072_0096302 3300049588 Bacteria 2352
655 Ga0501072_0170743 3300049588 Bacteria 1735
656 Ga0501072_0739054 3300049588 Bacteria 772
657 Ga0501074_0011455 3300049590 Bacteria 6451
658 Ga0501074_0019507 3300049590 Bacteria 4923
659 Ga0501074_0044122 3300049590 Bacteria 3228
660 Ga0501074_0200388 3300049590 Bacteria 1423
661 Ga0501074_0244486 3300049590 Bacteria 1276
662 Ga0501074_0258165 3300049590 Bacteria 1239
663 Ga0501074_0279054 3300049590 Bacteria 1188
664 Ga0501074_0480048 3300049590 Bacteria 881
665 Ga0501075_0003166 3300049591 Bacteria 11013
666 Ga0501075_0005476 3300049591 Bacteria 8679
667 Ga0501075_0007758 3300049591 Bacteria 7447
668 Ga0501075_0030602 3300049591 Bacteria 3988
669 Ga0501075_0042762 3300049591 Bacteria 3398
670 Ga0501075_0049635 3300049591 Bacteria 3154
671 Ga0501075_0057804 3300049591 Bacteria 2920
672 Ga0501075_0118040 3300049591 Bacteria 2017
673 Ga0501075_0345191 3300049591 Bacteria 1134
674 Ga0501076_0014869 3300049592 Bacteria 5873
675 Ga0501076_0020633 3300049592 Bacteria 5044
676 Ga0501076_0033458 3300049592 Bacteria 4013
677 Ga0501076_0118119 3300049592 Bacteria 2146
678 Ga0501077_0005709 3300049593 Bacteria 7577
679 Ga0501077_0013053 3300049593 Bacteria 5205
680 Ga0501077_0027984 3300049593 Bacteria 3582
681 Ga0501077_0051345 3300049593 Bacteria 2620
682 Ga0501077_0054086 3300049593 Bacteria 2549
683 Ga0501077_0186555 3300049593 Bacteria 1318
684 Ga0501077_0247044 3300049593 Bacteria 1134
685 Ga0501077_0873358 3300049593 Bacteria 578
686 Ga0501079_0009197 3300049741 Bacteria 7483
687 Ga0501079_0009731 3300049741 Bacteria 7290
688 Ga0501079_0028150 3300049741 Bacteria 4311
689 Ga0501079_0066696 3300049741 Bacteria 2777
690 Ga0501079_0203906 3300049741 Bacteria 1545
691 Ga0501079_0210680 3300049741 Bacteria 1518
692 Ga0501079_0306306 3300049741 Bacteria 1243
693 Ga0501079_0655325 3300049741 Bacteria 826
694 Ga0501080_0061904 3300049742 Bacteria 3483
695 Ga0501080_0152626 3300049742 Bacteria 2134
696 Ga0501080_0623023 3300049742 Bacteria 956
697 Ga0501080_0642030 3300049742 Bacteria 940
698 Ga0501081_0002929 3300049743 Bacteria 10827
699 Ga0501081_0003735 3300049743 Bacteria 9757
700 Ga0501081_0009042 3300049743 Bacteria 6476
701 Ga0501081_0042247 3300049743 Bacteria 3123
702 Ga0501081_0288431 3300049743 Bacteria 1203
703 Ga0501081_0339687 3300049743 Bacteria 1106
704 Ga0501081_0615870 3300049743 Bacteria 813
705 Ga0501083_0038291 3300049744 Bacteria 3261
706 Ga0501083_0116688 3300049744 Bacteria 1752
707 Ga0501083_0707257 3300049744 Bacteria 655
708 Ga0501035_0016960 3300049822 Bacteria 6713
709 Ga0501035_0045706 3300049822 Bacteria 3939
710 Ga0501035_0126569 3300049822 Bacteria 2230
711 Ga0501035_0504818 3300049822 Bacteria 995
712 Ga0501044_0209536 3300049823 Bacteria 1904
713 Ga0501045_0008137 3300049824 Bacteria 7304
714 Ga0501045_0008966 3300049824 Bacteria 6986
715 Ga0501045_0009528 3300049824 Bacteria 6794
716 Ga0501045_0025545 3300049824 Bacteria 4247
717 Ga0501045_0410569 3300049824 Bacteria 1007
718 Ga0501045_0443670 3300049824 Bacteria 965
719 Ga0501045_0632829 3300049824 Bacteria 791
720 nmdc:mga05p37_1563043_c1 3300050507 Bacteria 652
721 nmdc:mga05p37_26584_c1 3300050507 Bacteria 7037
722 nmdc:mga05p37_272902_c1 3300050507 Bacteria 2020
723 nmdc:mga05p37_273740_c1 3300050507 Bacteria 2016
724 nmdc:mga05p37_28340_c1 3300050507 Bacteria 6829
725 nmdc:mga05p37_433989_c1 3300050507 Bacteria 1525
726 nmdc:mga05p37_680441_c1 3300050507 Bacteria 1147
727 nmdc:mga05p37_812233_c1 3300050507 Bacteria 1021
728 nmdc:mga05p37_98011_c1 3300050507 Bacteria 3611
729 nmdc:mga05p37_99530_c1 3300050507 Bacteria 3581
730 nmdc:mga09592_149218_c1 3300050508 Bacteria 2017
731 nmdc:mga09592_671355_c1 3300050508 Bacteria 884
732 nmdc:mga09592_88802_c1 3300050508 Bacteria 2640
733 nmdc:mga0qj67_12234_c1 3300050509 Bacteria 6461
734 nmdc:mga0qj67_4345_c1 3300050509 Bacteria 10265
735 nmdc:mga0qj67_964082_c1 3300050509 Bacteria 670
736 nmdc:mga06r32_430972_c1 3300050510 Bacteria 1299
737 nmdc:mga06r32_498544_c1 3300050510 Bacteria 1195
738 nmdc:mga06r32_703_c1 3300050510 Bacteria 29212
739 nmdc:mga06r32_803524_c1 3300050510 Bacteria 901
740 nmdc:mga08y16_16924_c1 3300050511 Bacteria 7678
741 nmdc:mga08y16_329624_c1 3300050511 Bacteria 1571
742 nmdc:mga08y16_724760_c1 3300050511 Bacteria 992
743 nmdc:mga0n895_1499482_c1 3300050512 Bacteria 641
744 nmdc:mga0n895_179144_c1 3300050512 Bacteria 2151
745 nmdc:mga0n895_668_c1 3300050512 Bacteria 24028
746 nmdc:mga0rr50_20722_c1 3300050513 Bacteria 4471
747 nmdc:mga0rr50_2913_c1 3300050513 Bacteria 9767
748 nmdc:mga0rr50_36476_c1 3300050513 Bacteria 3541
749 nmdc:mga08x19_1014015_c1 3300050514 Bacteria 590
750 nmdc:mga08x19_104417_c1 3300050514 Bacteria 1883
751 nmdc:mga08x19_342440_c1 3300050514 Bacteria 1043
752 nmdc:mga0a205_155086_c1 3300050515 Bacteria 2189
753 nmdc:mga0a205_63894_c1 3300050515 Bacteria 3556
754 Ga0495601_0000762 3300053077 Bacteria 17373
755 Ga0495655_0172144 3300053083 Bacteria 694
756 Ga0495655_0269400 3300053083 Bacteria 577
757 Ga0495619_0147497 3300053085 Bacteria 1622
758 Ga0500555_029926 3300053103 Bacteria 1547
759 Ga0500588_0023315 3300053146 Bacteria 1695
760 Ga0500616_0068560 3300053153 Bacteria 1816
761 Ga0501084_0003271 3300054114 Bacteria 13106
762 Ga0501084_0007539 3300054114 Bacteria 8973
763 Ga0501084_0017956 3300054114 Bacteria 5890
764 Ga0501084_0021951 3300054114 Bacteria 5324
765 Ga0501084_0034515 3300054114 Bacteria 4230
766 Ga0501084_0041563 3300054114 Bacteria 3846
767 Ga0501084_0422315 3300054114 Bacteria 1127
768 Ga0501084_0465829 3300054114 Bacteria 1068
769 Ga0501084_0481214 3300054114 Bacteria 1049
770 Ga0501084_0794106 3300054114 Bacteria 797
771 Ga0501084_1725565 3300054114 Bacteria 523
772 Ga0590075_012782 3300059424 Bacteria 2041
773 Ga0590077_025123 3300059426 Bacteria 1282
774 Ga0501082_0023555 3300060353 Bacteria 5311
775 Ga0501082_0082580 3300060353 Bacteria 2772
776 Ga0501082_0213485 3300060353 Bacteria 1679
777 Ga0501082_0222189 3300060353 Bacteria 1643
778 Ga0501082_0225619 3300060353 Bacteria 1630
779 Ga0501082_0362076 3300060353 Bacteria 1265
780 Ga0501082_0676467 3300060353 Bacteria 903
781 Ga0501082_0766326 3300060353 Bacteria 844
782 Ga0530510_0008059 3300061734 Bacteria 7348
783 Ga0530510_0052923 3300061734 Bacteria 2933
784 Ga0530510_0172641 3300061734 Bacteria 1601
785 Ga0530510_0260285 3300061734 Bacteria 1294
786 Ga0530510_0309684 3300061734 Bacteria 1183
787 Ga0530510_0427310 3300061734 Bacteria 1000
788 Ga0530510_1139024 3300061734 Bacteria 598

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026088 Ga0207641_12031528 Ga0207641_120315281 126
2 3300050511 nmdc:mga08y16_724760_c1 nmdc:mga08y16_724760_c1_213_656 128
3 3300025934 Ga0207686_10181575 Ga0207686_101815752 129
4 3300021358 Ga0213873_10044432 Ga0213873_100444321 130
5 3300031727 Ga0316576_10285515 Ga0316576_102855151 130
6 3300036712 Ga0316584_0020695 Ga0316584_0020695_2618_3028 130
7 3300005467 Ga0070706_100672185 Ga0070706_1006721851 131
8 3300005467 Ga0070706_100934286 Ga0070706_1009342862 131
9 3300006844 Ga0075428_100000357 Ga0075428_10000035742 131
10 3300006846 Ga0075430_100001708 Ga0075430_10000170812 131
11 3300006880 Ga0075429_100003314 Ga0075429_1000033143 131
12 3300005844 Ga0068862_100000162 Ga0068862_10000016239 132
13 3300025936 Ga0207670_11731054 Ga0207670_117310541 132
14 3300025960 Ga0207651_10967057 Ga0207651_109670571 132
15 3300026088 Ga0207641_10847736 Ga0207641_108477362 132
16 3300031901 Ga0307406_10041134 Ga0307406_100411342 132
17 3300031995 Ga0307409_100904098 Ga0307409_1009040982 132
18 3300035692 Ga0373935_0107433 Ga0373935_0107433_286_696 132
19 3300035725 Ga0373947_0093565 Ga0373947_0093565_1137_1547 132
20 3300039438 Ga0436360_0649357 Ga0436360_0649357_15_437 132
21 3300049570 Ga0501033_0318659 Ga0501033_0318659_88_486 132
22 3300049572 Ga0501036_0328150 Ga0501036_0328150_637_1035 132
23 3300049574 Ga0501038_0030031 Ga0501038_0030031_34_432 132
24 3300049575 Ga0501039_0153733 Ga0501039_0153733_416_814 132
25 3300049576 Ga0501040_0006494 Ga0501040_0006494_5041_5439 132
26 3300049578 Ga0501042_0002826 Ga0501042_0002826_8816_9214 132
27 3300049582 Ga0501048_0010796 Ga0501048_0010796_1238_1636 132
28 3300049587 Ga0501071_0034337 Ga0501071_0034337_1537_1935 132
29 3300049588 Ga0501072_0039140 Ga0501072_0039140_2203_2601 132
30 3300049590 Ga0501074_0044122 Ga0501074_0044122_2116_2514 132
31 3300049591 Ga0501075_0007758 Ga0501075_0007758_6098_6496 132
32 3300049592 Ga0501076_0033458 Ga0501076_0033458_2618_3016 132
33 3300049741 Ga0501079_0028150 Ga0501079_0028150_2374_2772 132
34 3300049742 Ga0501080_0152626 Ga0501080_0152626_949_1347 132
35 3300049743 Ga0501081_0003735 Ga0501081_0003735_7440_7838 132
36 3300049744 Ga0501083_0116688 Ga0501083_0116688_1180_1578 132
37 3300049822 Ga0501035_0045706 Ga0501035_0045706_1767_2165 132
38 3300049824 Ga0501045_0025545 Ga0501045_0025545_2794_3192 132
39 3300054114 Ga0501084_0041563 Ga0501084_0041563_1131_1529 132
40 3300060353 Ga0501082_0023555 Ga0501082_0023555_1847_2245 132
41 3300061734 Ga0530510_0052923 Ga0530510_0052923_1477_1875 132
42 3300005339 Ga0070660_101401850 Ga0070660_1014018501 133
43 3300005345 Ga0070692_10240396 Ga0070692_102403962 133
44 3300005435 Ga0070714_100425045 Ga0070714_1004250452 133
45 3300005445 Ga0070708_100214732 Ga0070708_1002147322 133
46 3300005843 Ga0068860_100008113 Ga0068860_10000811310 133
47 3300005844 Ga0068862_100316117 Ga0068862_1003161172 133
48 3300005937 Ga0081455_10058331 Ga0081455_100583312 133
49 3300006844 Ga0075428_100023841 Ga0075428_1000238415 133
50 3300006844 Ga0075428_100294503 Ga0075428_1002945032 133
51 3300009094 Ga0111539_10073323 Ga0111539_100733232 133
52 3300009147 Ga0114129_10005541 Ga0114129_100055414 133
53 3300009147 Ga0114129_10040034 Ga0114129_100400346 133
54 3300009147 Ga0114129_10373878 Ga0114129_103738782 133
55 3300009553 Ga0105249_11280044 Ga0105249_112800441 133
56 3300013105 Ga0157369_10367991 Ga0157369_103679912 133
57 3300013306 Ga0163162_10856273 Ga0163162_108562731 133
58 3300014326 Ga0157380_10289878 Ga0157380_102898782 133
59 3300021384 Ga0213876_10004607 Ga0213876_100046075 133
60 3300025926 Ga0207659_11211582 Ga0207659_112115821 133
61 3300026078 Ga0207702_10878038 Ga0207702_108780382 133
62 3300027907 Ga0207428_10042512 Ga0207428_100425123 133
63 3300028380 Ga0268265_10159525 Ga0268265_101595252 133
64 3300028381 Ga0268264_10005855 Ga0268264_100058559 133
65 3300035085 Ga0373929_0000028 Ga0373929_0000028_4379_4780 133
66 3300037418 Ga0395900_1265827 Ga0395900_1265827_155_556 133
67 3300037853 Ga0436364_1035773 Ga0436364_1035773_489_899 133
68 3300037853 Ga0436364_1556529 Ga0436364_1556529_16693_17103 133
69 3300039437 Ga0436365_0149285 Ga0436365_0149285_3096_3506 133
70 3300039437 Ga0436365_1923113 Ga0436365_1923113_5319_5729 133
71 3300039450 Ga0436363_0853455 Ga0436363_0853455_77_487 133
72 3300039453 Ga0436362_0627738 Ga0436362_0627738_913_1323 133
73 3300041413 Ga0439465_0347289 Ga0439465_0347289_128_529 133
74 3300044712 Ga0453684_0061790 Ga0453684_0061790_1006_1407 133
75 3300044901 Ga0466960_0013814 Ga0466960_0013814_1523_1933 133
76 3300045976 Ga0466967_0425912 Ga0466967_0425912_67_477 133
77 3300046518 Ga0495631_0260290 Ga0495631_0260290_326_727 133
78 3300046523 Ga0495644_0141544 Ga0495644_0141544_122_523 133
79 3300046537 Ga0495598_0074727 Ga0495598_0074727_361_762 133
80 3300046615 Ga0495656_0115743 Ga0495656_0115743_498_899 133
81 3300046691 Ga0495670_0069468 Ga0495670_0069468_1157_1558 133
82 3300046794 Ga0495589_0352612 Ga0495589_0352612_163_564 133
83 3300048090 Ga0495615_0307389 Ga0495615_0307389_39_440 133
84 3300049572 Ga0501036_0831054 Ga0501036_0831054_193_594 133
85 3300049575 Ga0501039_0212800 Ga0501039_0212800_1045_1446 133
86 3300049576 Ga0501040_0231372 Ga0501040_0231372_316_717 133
87 3300049577 Ga0501041_0162426 Ga0501041_0162426_345_746 133
88 3300049579 Ga0501043_0598354 Ga0501043_0598354_115_516 133
89 3300049582 Ga0501048_0493595 Ga0501048_0493595_111_512 133
90 3300049583 Ga0501067_0108009 Ga0501067_0108009_103_504 133
91 3300049584 Ga0501068_0252952 Ga0501068_0252952_673_1074 133
92 3300049584 Ga0501068_1017447 Ga0501068_1017447_98_499 133
93 3300049587 Ga0501071_0120637 Ga0501071_0120637_1129_1530 133
94 3300049587 Ga0501071_0276282 Ga0501071_0276282_344_745 133
95 3300049588 Ga0501072_0170743 Ga0501072_0170743_1174_1575 133
96 3300049588 Ga0501072_0739054 Ga0501072_0739054_210_611 133
97 3300049591 Ga0501075_0057804 Ga0501075_0057804_2251_2652 133
98 3300049592 Ga0501076_0118119 Ga0501076_0118119_1456_1857 133
99 3300049593 Ga0501077_0054086 Ga0501077_0054086_1021_1422 133
100 3300049593 Ga0501077_0873358 Ga0501077_0873358_100_501 133
101 3300049741 Ga0501079_0655325 Ga0501079_0655325_102_503 133
102 3300049742 Ga0501080_0061904 Ga0501080_0061904_1630_2031 133
103 3300049742 Ga0501080_0642030 Ga0501080_0642030_29_430 133
104 3300049743 Ga0501081_0042247 Ga0501081_0042247_1133_1534 133
105 3300049743 Ga0501081_0615870 Ga0501081_0615870_117_518 133
106 3300049744 Ga0501083_0707257 Ga0501083_0707257_194_595 133
107 3300049822 Ga0501035_0504818 Ga0501035_0504818_287_688 133
108 3300049824 Ga0501045_0443670 Ga0501045_0443670_142_543 133
109 3300050507 nmdc:mga05p37_28340_c1 nmdc:mga05p37_28340_c1_2169_2570 133
110 3300050507 nmdc:mga05p37_433989_c1 nmdc:mga05p37_433989_c1_804_1205 133
111 3300050511 nmdc:mga08y16_329624_c1 nmdc:mga08y16_329624_c1_1117_1518 133
112 3300054114 Ga0501084_0034515 Ga0501084_0034515_1502_1903 133
113 3300054114 Ga0501084_0481214 Ga0501084_0481214_169_570 133
114 3300059424 Ga0590075_012782 Ga0590075_012782_662_1063 133
115 3300059426 Ga0590077_025123 Ga0590077_025123_692_1093 133
116 3300060353 Ga0501082_0222189 Ga0501082_0222189_232_633 133
117 3300060353 Ga0501082_0225619 Ga0501082_0225619_1095_1496 133
118 3300061734 Ga0530510_0260285 Ga0530510_0260285_766_1167 133
119 3300003347 JGI26128J50194_1003259 JGI26128J50194_10032593 134
120 3300003349 JGI26129J50193_1008546 JGI26129J50193_10085462 134
121 3300003503 JGI26141J51220_1002903 JGI26141J51220_10029031 134
122 3300003911 JGI25405J52794_10066965 JGI25405J52794_100669651 134
123 3300005293 Ga0065715_10168556 Ga0065715_101685562 134
124 3300005328 Ga0070676_10000588 Ga0070676_1000058811 134
125 3300005329 Ga0070683_100081286 Ga0070683_1000812861 134
126 3300005330 Ga0070690_100028494 Ga0070690_1000284945 134
127 3300005331 Ga0070670_100001663 Ga0070670_1000016633 134
128 3300005331 Ga0070670_100200107 Ga0070670_1002001072 134
129 3300005333 Ga0070677_10224682 Ga0070677_102246821 134
130 3300005334 Ga0068869_100018988 Ga0068869_1000189883 134
131 3300005336 Ga0070680_100016878 Ga0070680_1000168783 134
132 3300005336 Ga0070680_100089019 Ga0070680_1000890194 134
133 3300005336 Ga0070680_101266934 Ga0070680_1012669341 134
134 3300005337 Ga0070682_100082204 Ga0070682_1000822043 134
135 3300005338 Ga0068868_100014751 Ga0068868_1000147514 134
136 3300005339 Ga0070660_100001299 Ga0070660_10000129911 134
137 3300005340 Ga0070689_100978689 Ga0070689_1009786892 134
138 3300005341 Ga0070691_10014159 Ga0070691_100141594 134
139 3300005343 Ga0070687_100070949 Ga0070687_1000709493 134
140 3300005343 Ga0070687_101059744 Ga0070687_1010597441 134
141 3300005344 Ga0070661_100002142 Ga0070661_1000021428 134
142 3300005345 Ga0070692_10001477 Ga0070692_100014779 134
143 3300005345 Ga0070692_10120813 Ga0070692_101208133 134
144 3300005347 Ga0070668_100161454 Ga0070668_1001614542 134
145 3300005347 Ga0070668_100289726 Ga0070668_1002897262 134
146 3300005347 Ga0070668_100461098 Ga0070668_1004610982 134
147 3300005353 Ga0070669_100880646 Ga0070669_1008806462 134
148 3300005354 Ga0070675_100056445 Ga0070675_1000564454 134
149 3300005364 Ga0070673_100046374 Ga0070673_1000463744 134
150 3300005364 Ga0070673_100326736 Ga0070673_1003267362 134
151 3300005365 Ga0070688_100942391 Ga0070688_1009423911 134
152 3300005366 Ga0070659_100000151 Ga0070659_10000015138 134
153 3300005406 Ga0070703_10008942 Ga0070703_100089423 134
154 3300005406 Ga0070703_10115699 Ga0070703_101156992 134
155 3300005438 Ga0070701_10005927 Ga0070701_100059273 134
156 3300005438 Ga0070701_10082461 Ga0070701_100824613 134
157 3300005439 Ga0070711_100307370 Ga0070711_1003073702 134
158 3300005440 Ga0070705_100005341 Ga0070705_1000053413 134
159 3300005444 Ga0070694_100009064 Ga0070694_1000090647 134
160 3300005444 Ga0070694_100022828 Ga0070694_1000228281 134
161 3300005444 Ga0070694_100269427 Ga0070694_1002694272 134
162 3300005444 Ga0070694_100436069 Ga0070694_1004360692 134
163 3300005444 Ga0070694_101192361 Ga0070694_1011923612 134
164 3300005445 Ga0070708_100021021 Ga0070708_1000210214 134
165 3300005445 Ga0070708_100028244 Ga0070708_1000282444 134
166 3300005445 Ga0070708_100038331 Ga0070708_1000383314 134
167 3300005445 Ga0070708_100296705 Ga0070708_1002967052 134
168 3300005445 Ga0070708_100509691 Ga0070708_1005096911 134
169 3300005445 Ga0070708_100517088 Ga0070708_1005170882 134
170 3300005445 Ga0070708_100823439 Ga0070708_1008234392 134
171 3300005445 Ga0070708_101589985 Ga0070708_1015899851 134
172 3300005455 Ga0070663_100003733 Ga0070663_1000037335 134
173 3300005457 Ga0070662_100108506 Ga0070662_1001085062 134
174 3300005458 Ga0070681_10037836 Ga0070681_100378365 134
175 3300005459 Ga0068867_100004614 Ga0068867_1000046145 134
176 3300005459 Ga0068867_100116016 Ga0068867_1001160162 134
177 3300005467 Ga0070706_100006190 Ga0070706_1000061905 134
178 3300005467 Ga0070706_100071250 Ga0070706_1000712501 134
179 3300005467 Ga0070706_100514968 Ga0070706_1005149682 134
180 3300005468 Ga0070707_100001868 Ga0070707_10000186810 134
181 3300005468 Ga0070707_100045990 Ga0070707_1000459902 134
182 3300005468 Ga0070707_100263414 Ga0070707_1002634143 134
183 3300005468 Ga0070707_100630077 Ga0070707_1006300772 134
184 3300005468 Ga0070707_100838032 Ga0070707_1008380321 134
185 3300005471 Ga0070698_100006229 Ga0070698_1000062294 134
186 3300005471 Ga0070698_100011760 Ga0070698_1000117601 134
187 3300005471 Ga0070698_100072254 Ga0070698_1000722544 134
188 3300005471 Ga0070698_100269410 Ga0070698_1002694102 134
189 3300005471 Ga0070698_100324111 Ga0070698_1003241113 134
190 3300005518 Ga0070699_100002671 Ga0070699_10000267112 134
191 3300005518 Ga0070699_100009735 Ga0070699_1000097352 134
192 3300005518 Ga0070699_100010530 Ga0070699_1000105304 134
193 3300005518 Ga0070699_100010909 Ga0070699_1000109098 134
194 3300005518 Ga0070699_100051831 Ga0070699_1000518312 134
195 3300005518 Ga0070699_100128281 Ga0070699_1001282813 134
196 3300005518 Ga0070699_101619268 Ga0070699_1016192681 134
197 3300005530 Ga0070679_100018431 Ga0070679_1000184316 134
198 3300005535 Ga0070684_100247826 Ga0070684_1002478263 134
199 3300005535 Ga0070684_100556989 Ga0070684_1005569892 134
200 3300005536 Ga0070697_100012401 Ga0070697_1000124012 134
201 3300005536 Ga0070697_100025737 Ga0070697_1000257373 134
202 3300005536 Ga0070697_100111234 Ga0070697_1001112342 134
203 3300005536 Ga0070697_100343119 Ga0070697_1003431192 134
204 3300005536 Ga0070697_101407410 Ga0070697_1014074101 134
205 3300005539 Ga0068853_100000770 Ga0068853_1000007705 134
206 3300005543 Ga0070672_100335794 Ga0070672_1003357942 134
207 3300005545 Ga0070695_100000741 Ga0070695_10000074114 134
208 3300005545 Ga0070695_100009086 Ga0070695_1000090865 134
209 3300005545 Ga0070695_100012118 Ga0070695_1000121182 134
210 3300005545 Ga0070695_100036925 Ga0070695_1000369253 134
211 3300005545 Ga0070695_100037828 Ga0070695_1000378283 134
212 3300005546 Ga0070696_100006635 Ga0070696_1000066359 134
213 3300005546 Ga0070696_100045225 Ga0070696_1000452252 134
214 3300005547 Ga0070693_100036152 Ga0070693_1000361522 134
215 3300005548 Ga0070665_100127346 Ga0070665_1001273462 134
216 3300005549 Ga0070704_100000772 Ga0070704_1000007724 134
217 3300005549 Ga0070704_100013537 Ga0070704_1000135374 134
218 3300005549 Ga0070704_100169732 Ga0070704_1001697321 134
219 3300005549 Ga0070704_100394023 Ga0070704_1003940232 134
220 3300005549 Ga0070704_101142999 Ga0070704_1011429991 134
221 3300005563 Ga0068855_100001154 Ga0068855_10000115426 134
222 3300005564 Ga0070664_100002406 Ga0070664_10000240611 134
223 3300005577 Ga0068857_100051090 Ga0068857_1000510902 134
224 3300005577 Ga0068857_100080218 Ga0068857_1000802182 134
225 3300005578 Ga0068854_100245480 Ga0068854_1002454803 134
226 3300005614 Ga0068856_100002395 Ga0068856_1000023953 134
227 3300005614 Ga0068856_100308124 Ga0068856_1003081243 134
228 3300005614 Ga0068856_102190458 Ga0068856_1021904582 134
229 3300005615 Ga0070702_100009072 Ga0070702_1000090724 134
230 3300005615 Ga0070702_100099464 Ga0070702_1000994643 134
231 3300005616 Ga0068852_100238455 Ga0068852_1002384553 134
232 3300005617 Ga0068859_100006563 Ga0068859_1000065638 134
233 3300005618 Ga0068864_100005076 Ga0068864_1000050766 134
234 3300005618 Ga0068864_100923613 Ga0068864_1009236132 134
235 3300005719 Ga0068861_100024113 Ga0068861_1000241132 134
236 3300005719 Ga0068861_101683835 Ga0068861_1016838351 134
237 3300005834 Ga0068851_10070783 Ga0068851_100707833 134
238 3300005840 Ga0068870_10000998 Ga0068870_100009989 134
239 3300005841 Ga0068863_100018853 Ga0068863_1000188533 134
240 3300005842 Ga0068858_100009267 Ga0068858_10000926710 134
241 3300005842 Ga0068858_101512905 Ga0068858_1015129052 134
242 3300005843 Ga0068860_100042525 Ga0068860_1000425252 134
243 3300005843 Ga0068860_100213371 Ga0068860_1002133713 134
244 3300005844 Ga0068862_100003260 Ga0068862_1000032604 134
245 3300005844 Ga0068862_100011451 Ga0068862_1000114514 134
246 3300005844 Ga0068862_100499838 Ga0068862_1004998381 134
247 3300005844 Ga0068862_100926655 Ga0068862_1009266552 134
248 3300005937 Ga0081455_10000614 Ga0081455_1000061426 134
249 3300006173 Ga0070716_100024053 Ga0070716_1000240533 134
250 3300006237 Ga0097621_100048524 Ga0097621_1000485242 134
251 3300006237 Ga0097621_101188553 Ga0097621_1011885532 134
252 3300006846 Ga0075430_100097232 Ga0075430_1000972323 134
253 3300006847 Ga0075431_100002572 Ga0075431_1000025723 134
254 3300006847 Ga0075431_101193434 Ga0075431_1011934342 134
255 3300006852 Ga0075433_10004677 Ga0075433_100046779 134
256 3300006852 Ga0075433_10014405 Ga0075433_100144057 134
257 3300006871 Ga0075434_100016588 Ga0075434_1000165883 134
258 3300006871 Ga0075434_100027771 Ga0075434_1000277715 134
259 3300006880 Ga0075429_100033678 Ga0075429_1000336785 134
260 3300006881 Ga0068865_100248538 Ga0068865_1002485383 134
261 3300006914 Ga0075436_100060804 Ga0075436_1000608043 134
262 3300006931 Ga0097620_100006563 Ga0097620_1000065638 134
263 3300007076 Ga0075435_100012212 Ga0075435_1000122125 134
264 3300007076 Ga0075435_100043942 Ga0075435_1000439424 134
265 3300007265 Ga0099794_10008989 Ga0099794_100089892 134
266 3300009098 Ga0105245_10459602 Ga0105245_104596022 134
267 3300009098 Ga0105245_10513612 Ga0105245_105136122 134
268 3300009147 Ga0114129_10007147 Ga0114129_1000714717 134
269 3300009147 Ga0114129_10363000 Ga0114129_103630003 134
270 3300009147 Ga0114129_10483732 Ga0114129_104837322 134
271 3300009148 Ga0105243_10003778 Ga0105243_100037784 134
272 3300009148 Ga0105243_10152234 Ga0105243_101522342 134
273 3300009174 Ga0105241_10000054 Ga0105241_1000005457 134
274 3300009174 Ga0105241_10106019 Ga0105241_101060193 134
275 3300009176 Ga0105242_10031653 Ga0105242_100316534 134
276 3300009553 Ga0105249_10364517 Ga0105249_103645173 134
277 3300010375 Ga0105239_10355027 Ga0105239_103550273 134
278 3300011119 Ga0105246_10090821 Ga0105246_100908214 134
279 3300013100 Ga0157373_10003678 Ga0157373_1000367810 134
280 3300013102 Ga0157371_10369429 Ga0157371_103694292 134
281 3300013104 Ga0157370_11775756 Ga0157370_117757562 134
282 3300013105 Ga0157369_10478043 Ga0157369_104780432 134
283 3300013297 Ga0157378_10958046 Ga0157378_109580462 134
284 3300013307 Ga0157372_10027062 Ga0157372_100270627 134
285 3300014325 Ga0163163_11604912 Ga0163163_116049122 134
286 3300014326 Ga0157380_10520639 Ga0157380_105206392 134
287 3300014745 Ga0157377_10103879 Ga0157377_101038793 134
288 3300014968 Ga0157379_10648610 Ga0157379_106486102 134
289 3300020082 Ga0206353_12000993 Ga0206353_120009932 134
290 3300024225 Ga0224572_1058690 Ga0224572_10586902 134
291 3300025885 Ga0207653_10007436 Ga0207653_100074362 134
292 3300025885 Ga0207653_10028141 Ga0207653_100281412 134
293 3300025885 Ga0207653_10033016 Ga0207653_100330161 134
294 3300025893 Ga0207682_10441383 Ga0207682_104413832 134
295 3300025899 Ga0207642_10274023 Ga0207642_102740232 134
296 3300025901 Ga0207688_10032149 Ga0207688_100321493 134
297 3300025904 Ga0207647_10049868 Ga0207647_100498683 134
298 3300025907 Ga0207645_10000059 Ga0207645_1000005911 134
299 3300025907 Ga0207645_10076164 Ga0207645_100761642 134
300 3300025908 Ga0207643_10000014 Ga0207643_1000001463 134
301 3300025910 Ga0207684_10002971 Ga0207684_1000297112 134
302 3300025910 Ga0207684_10053561 Ga0207684_100535612 134
303 3300025910 Ga0207684_10095377 Ga0207684_100953774 134
304 3300025910 Ga0207684_10504636 Ga0207684_105046361 134
305 3300025911 Ga0207654_10012260 Ga0207654_100122605 134
306 3300025911 Ga0207654_10044278 Ga0207654_100442782 134
307 3300025912 Ga0207707_10000138 Ga0207707_100001386 134
308 3300025916 Ga0207663_10265842 Ga0207663_102658422 134
309 3300025917 Ga0207660_10009143 Ga0207660_100091435 134
310 3300025917 Ga0207660_10056932 Ga0207660_100569322 134
311 3300025918 Ga0207662_10071208 Ga0207662_100712082 134
312 3300025918 Ga0207662_10491034 Ga0207662_104910342 134
313 3300025919 Ga0207657_10000135 Ga0207657_1000013571 134
314 3300025920 Ga0207649_10009708 Ga0207649_100097085 134
315 3300025921 Ga0207652_10004746 Ga0207652_100047466 134
316 3300025922 Ga0207646_10001054 Ga0207646_1000105431 134
317 3300025922 Ga0207646_10031170 Ga0207646_100311705 134
318 3300025922 Ga0207646_10061793 Ga0207646_100617934 134
319 3300025922 Ga0207646_10071144 Ga0207646_100711444 134
320 3300025922 Ga0207646_10117855 Ga0207646_101178554 134
321 3300025922 Ga0207646_10149153 Ga0207646_101491533 134
322 3300025923 Ga0207681_10070863 Ga0207681_100708634 134
323 3300025923 Ga0207681_10756343 Ga0207681_107563432 134
324 3300025923 Ga0207681_11368700 Ga0207681_113687002 134
325 3300025925 Ga0207650_10012843 Ga0207650_100128437 134
326 3300025925 Ga0207650_10472322 Ga0207650_104723222 134
327 3300025926 Ga0207659_10070486 Ga0207659_100704864 134
328 3300025926 Ga0207659_10778842 Ga0207659_107788422 134
329 3300025927 Ga0207687_10800515 Ga0207687_108005152 134
330 3300025931 Ga0207644_11485042 Ga0207644_114850421 134
331 3300025932 Ga0207690_10010140 Ga0207690_100101404 134
332 3300025933 Ga0207706_10006677 Ga0207706_100066777 134
333 3300025933 Ga0207706_10189614 Ga0207706_101896143 134
334 3300025934 Ga0207686_10018333 Ga0207686_100183334 134
335 3300025935 Ga0207709_10604517 Ga0207709_106045172 134
336 3300025936 Ga0207670_10253548 Ga0207670_102535482 134
337 3300025936 Ga0207670_10840774 Ga0207670_108407742 134
338 3300025938 Ga0207704_10142358 Ga0207704_101423583 134
339 3300025938 Ga0207704_10541625 Ga0207704_105416252 134
340 3300025939 Ga0207665_10004861 Ga0207665_100048616 134
341 3300025940 Ga0207691_10327973 Ga0207691_103279733 134
342 3300025942 Ga0207689_10000340 Ga0207689_1000034038 134
343 3300025942 Ga0207689_10006849 Ga0207689_1000684910 134
344 3300025942 Ga0207689_10177125 Ga0207689_101771252 134
345 3300025945 Ga0207679_10000212 Ga0207679_1000021221 134
346 3300025949 Ga0207667_10000296 Ga0207667_1000029642 134
347 3300025960 Ga0207651_10158798 Ga0207651_101587983 134
348 3300025960 Ga0207651_11014433 Ga0207651_110144332 134
349 3300025961 Ga0207712_10224682 Ga0207712_102246823 134
350 3300025961 Ga0207712_10382039 Ga0207712_103820392 134
351 3300025972 Ga0207668_10356651 Ga0207668_103566512 134
352 3300025981 Ga0207640_11408326 Ga0207640_114083262 134
353 3300025986 Ga0207658_10176741 Ga0207658_101767412 134
354 3300026023 Ga0207677_10059785 Ga0207677_100597853 134
355 3300026035 Ga0207703_10070426 Ga0207703_100704264 134
356 3300026041 Ga0207639_10001773 Ga0207639_1000177312 134
357 3300026067 Ga0207678_10008386 Ga0207678_100083868 134
358 3300026078 Ga0207702_10001150 Ga0207702_100011506 134
359 3300026088 Ga0207641_10015083 Ga0207641_100150834 134
360 3300026089 Ga0207648_10001239 Ga0207648_1000123925 134
361 3300026089 Ga0207648_10170983 Ga0207648_101709832 134
362 3300026095 Ga0207676_10001946 Ga0207676_1000194615 134
363 3300026116 Ga0207674_10000684 Ga0207674_1000068438 134
364 3300026116 Ga0207674_10092508 Ga0207674_100925082 134
365 3300026118 Ga0207675_100013598 Ga0207675_1000135982 134
366 3300026118 Ga0207675_100228367 Ga0207675_1002283672 134
367 3300026142 Ga0207698_10258374 Ga0207698_102583742 134
368 3300027360 Ga0209969_1004099 Ga0209969_10040992 134
369 3300027378 Ga0209981_1000769 Ga0209981_10007694 134
370 3300027395 Ga0209996_1019501 Ga0209996_10195012 134
371 3300027424 Ga0209984_1004388 Ga0209984_10043882 134
372 3300027462 Ga0210000_1000448 Ga0210000_10004486 134
373 3300027471 Ga0209995_1000374 Ga0209995_10003745 134
374 3300027526 Ga0209968_1001337 Ga0209968_10013373 134
375 3300027543 Ga0209999_1000584 Ga0209999_10005842 134
376 3300027552 Ga0209982_1000382 Ga0209982_10003822 134
377 3300027614 Ga0209970_1003011 Ga0209970_10030114 134
378 3300027617 Ga0210002_1000361 Ga0210002_10003615 134
379 3300027665 Ga0209983_1000369 Ga0209983_10003697 134
380 3300027671 Ga0209588_1000615 Ga0209588_10006158 134
381 3300027682 Ga0209971_1000010 Ga0209971_100001029 134
382 3300027682 Ga0209971_1014366 Ga0209971_10143662 134
383 3300027695 Ga0209966_1000255 Ga0209966_100025514 134
384 3300027717 Ga0209998_10000131 Ga0209998_1000013126 134
385 3300027876 Ga0209974_10011978 Ga0209974_100119783 134
386 3300027876 Ga0209974_10090727 Ga0209974_100907271 134
387 3300028380 Ga0268265_10003910 Ga0268265_100039107 134
388 3300028380 Ga0268265_10103562 Ga0268265_101035623 134
389 3300028380 Ga0268265_10645417 Ga0268265_106454172 134
390 3300028381 Ga0268264_10030130 Ga0268264_100301304 134
391 3300028381 Ga0268264_10057388 Ga0268264_100573885 134
392 3300028381 Ga0268264_10373112 Ga0268264_103731123 134
393 3300028381 Ga0268264_11031500 Ga0268264_110315002 134
394 3300031911 Ga0307412_10256423 Ga0307412_102564231 134
395 3300034817 Ga0373948_0049804 Ga0373948_0049804_92_502 134
396 3300035090 Ga0373949_0013924 Ga0373949_0013924_286_690 134
397 3300035090 Ga0373949_0015575 Ga0373949_0015575_546_956 134
398 3300035091 Ga0373951_0008441 Ga0373951_0008441_1237_1641 134
399 3300035092 Ga0373952_0008087 Ga0373952_0008087_1178_1582 134
400 3300035114 Ga0373939_0065523 Ga0373939_0065523_256_660 134
401 3300035121 Ga0373960_0088943 Ga0373960_0088943_182_586 134
402 3300035241 Ga0373961_0013978 Ga0373961_0013978_749_1153 134
403 3300035242 Ga0373962_0191583 Ga0373962_0191583_264_668 134
404 3300035691 Ga0373931_0100911 Ga0373931_0100911_655_1059 134
405 3300036401 Ga0373937_1537906 Ga0373937_1537906_12_431 134
406 3300037312 Ga0395899_0530276 Ga0395899_0530276_93_497 134
407 3300038698 Ga0242419_007769 Ga0242419_007769_105_509 134
408 3300039437 Ga0436365_1038217 Ga0436365_1038217_20_424 134
409 3300041501 Ga0451845_0815444 Ga0451845_0815444_126_530 134
410 3300042005 Ga0439448_0003629 Ga0439448_0003629_2104_2508 134
411 3300042005 Ga0439448_0007395 Ga0439448_0007395_2215_2619 134
412 3300042011 Ga0439454_054371 Ga0439454_054371_18_422 134
413 3300042016 Ga0439463_034283 Ga0439463_034283_478_882 134
414 3300042157 Ga0439458_0006751 Ga0439458_0006751_614_1018 134
415 3300042157 Ga0439458_0014062 Ga0439458_0014062_149_553 134
416 3300042157 Ga0439458_0163144 Ga0439458_0163144_13_417 134
417 3300042439 Ga0439464_0017027 Ga0439464_0017027_1135_1539 134
418 3300042461 Ga0439460_0000656 Ga0439460_0000656_3107_3511 134
419 3300042461 Ga0439460_0200733 Ga0439460_0200733_64_468 134
420 3300042876 Ga0451577_0003247 Ga0451577_0003247_9747_10151 134
421 3300042876 Ga0451577_0009390 Ga0451577_0009390_279_683 134
422 3300042876 Ga0451577_0044898 Ga0451577_0044898_2137_2541 134
423 3300044673 Ga0453683_0011056 Ga0453683_0011056_5384_5788 134
424 3300044673 Ga0453683_0022003 Ga0453683_0022003_1301_1705 134
425 3300044712 Ga0453684_0199755 Ga0453684_0199755_1052_1456 134
426 3300044712 Ga0453684_0357088 Ga0453684_0357088_626_1030 134
427 3300045051 Ga0451576_0014386 Ga0451576_0014386_8022_8426 134
428 3300045051 Ga0451576_0020073 Ga0451576_0020073_2187_2591 134
429 3300045051 Ga0451576_0093517 Ga0451576_0093517_1688_2098 134
430 3300045051 Ga0451576_0192138 Ga0451576_0192138_1196_1600 134
431 3300045051 Ga0451576_0372843 Ga0451576_0372843_893_1297 134
432 3300046454 Ga0495592_0275108 Ga0495592_0275108_591_995 134
433 3300046462 Ga0495651_0037217 Ga0495651_0037217_907_1311 134
434 3300046472 Ga0495580_0106354 Ga0495580_0106354_188_592 134
435 3300046472 Ga0495580_0416772 Ga0495580_0416772_406_816 134
436 3300046491 Ga0495584_0237315 Ga0495584_0237315_438_845 134
437 3300046516 Ga0495628_0145056 Ga0495628_0145056_391_795 134
438 3300046683 Ga0495658_0382657 Ga0495658_0382657_113_517 134
439 3300047322 Ga0495680_0253393 Ga0495680_0253393_95_499 134
440 3300048905 Ga0496102_0120610 Ga0496102_0120610_1139_1543 134
441 3300048906 Ga0496103_0125572 Ga0496103_0125572_800_1204 134
442 3300048907 Ga0496104_0240883 Ga0496104_0240883_150_554 134
443 3300048907 Ga0496104_0389654 Ga0496104_0389654_402_806 134
444 3300048911 Ga0496108_0341688 Ga0496108_0341688_529_933 134
445 3300048912 Ga0496109_0330170 Ga0496109_0330170_378_782 134
446 3300048913 Ga0496110_0105058 Ga0496110_0105058_918_1322 134
447 3300048915 Ga0496112_0259028 Ga0496112_0259028_135_539 134
448 3300048916 Ga0496113_0230130 Ga0496113_0230130_182_586 134
449 3300048924 Ga0496121_0239401 Ga0496121_0239401_538_942 134
450 3300049568 Ga0501031_0025568 Ga0501031_0025568_3390_3794 134
451 3300049570 Ga0501033_0168364 Ga0501033_0168364_288_692 134
452 3300049572 Ga0501036_0180149 Ga0501036_0180149_1219_1623 134
453 3300049572 Ga0501036_0305736 Ga0501036_0305736_368_775 134
454 3300049572 Ga0501036_1231675 Ga0501036_1231675_85_489 134
455 3300049573 Ga0501037_0032414 Ga0501037_0032414_331_735 134
456 3300049573 Ga0501037_0053145 Ga0501037_0053145_400_804 134
457 3300049574 Ga0501038_0017563 Ga0501038_0017563_2874_3278 134
458 3300049576 Ga0501040_0036168 Ga0501040_0036168_2040_2444 134
459 3300049576 Ga0501040_0043429 Ga0501040_0043429_128_535 134
460 3300049577 Ga0501041_0365065 Ga0501041_0365065_239_643 134
461 3300049578 Ga0501042_0080804 Ga0501042_0080804_707_1114 134
462 3300049580 Ga0501046_0012826 Ga0501046_0012826_6517_6921 134
463 3300049580 Ga0501046_0195152 Ga0501046_0195152_64_468 134
464 3300049581 Ga0501047_1083825 Ga0501047_1083825_11_415 134
465 3300049584 Ga0501068_0013113 Ga0501068_0013113_3903_4307 134
466 3300049585 Ga0501069_0058078 Ga0501069_0058078_1494_1898 134
467 3300049586 Ga0501070_1079479 Ga0501070_1079479_104_508 134
468 3300049586 Ga0501070_1388773 Ga0501070_1388773_22_426 134
469 3300049587 Ga0501071_0027014 Ga0501071_0027014_234_638 134
470 3300049588 Ga0501072_0096302 Ga0501072_0096302_1499_1906 134
471 3300049590 Ga0501074_0258165 Ga0501074_0258165_162_569 134
472 3300049590 Ga0501074_0279054 Ga0501074_0279054_516_920 134
473 3300049591 Ga0501075_0005476 Ga0501075_0005476_8150_8554 134
474 3300049591 Ga0501075_0030602 Ga0501075_0030602_264_668 134
475 3300049591 Ga0501075_0042762 Ga0501075_0042762_1316_1723 134
476 3300049591 Ga0501075_0118040 Ga0501075_0118040_746_1150 134
477 3300049592 Ga0501076_0020633 Ga0501076_0020633_357_761 134
478 3300049593 Ga0501077_0013053 Ga0501077_0013053_2098_2505 134
479 3300049593 Ga0501077_0247044 Ga0501077_0247044_473_877 134
480 3300049741 Ga0501079_0009197 Ga0501079_0009197_6967_7371 134
481 3300049741 Ga0501079_0066696 Ga0501079_0066696_933_1340 134
482 3300049741 Ga0501079_0203906 Ga0501079_0203906_419_823 134
483 3300049741 Ga0501079_0306306 Ga0501079_0306306_298_702 134
484 3300049742 Ga0501080_0623023 Ga0501080_0623023_53_460 134
485 3300049822 Ga0501035_0016960 Ga0501035_0016960_6100_6504 134
486 3300049824 Ga0501045_0008137 Ga0501045_0008137_6221_6625 134
487 3300049824 Ga0501045_0410569 Ga0501045_0410569_365_769 134
488 3300050507 nmdc:mga05p37_273740_c1 nmdc:mga05p37_273740_c1_755_1159 134
489 3300050507 nmdc:mga05p37_680441_c1 nmdc:mga05p37_680441_c1_582_986 134
490 3300050507 nmdc:mga05p37_98011_c1 nmdc:mga05p37_98011_c1_2249_2656 134
491 3300050507 nmdc:mga05p37_99530_c1 nmdc:mga05p37_99530_c1_1937_2344 134
492 3300050508 nmdc:mga09592_149218_c1 nmdc:mga09592_149218_c1_758_1165 134
493 3300050508 nmdc:mga09592_88802_c1 nmdc:mga09592_88802_c1_186_590 134
494 3300050509 nmdc:mga0qj67_4345_c1 nmdc:mga0qj67_4345_c1_8709_9116 134
495 3300050509 nmdc:mga0qj67_964082_c1 nmdc:mga0qj67_964082_c1_34_438 134
496 3300050510 nmdc:mga06r32_430972_c1 nmdc:mga06r32_430972_c1_189_593 134
497 3300050510 nmdc:mga06r32_498544_c1 nmdc:mga06r32_498544_c1_464_868 134
498 3300050510 nmdc:mga06r32_703_c1 nmdc:mga06r32_703_c1_14853_15260 134
499 3300050512 nmdc:mga0n895_179144_c1 nmdc:mga0n895_179144_c1_472_876 134
500 3300050512 nmdc:mga0n895_668_c1 nmdc:mga0n895_668_c1_11158_11562 134
501 3300050513 nmdc:mga0rr50_20722_c1 nmdc:mga0rr50_20722_c1_1354_1758 134
502 3300050513 nmdc:mga0rr50_2913_c1 nmdc:mga0rr50_2913_c1_5202_5606 134
503 3300050514 nmdc:mga08x19_1014015_c1 nmdc:mga08x19_1014015_c1_130_534 134
504 3300050514 nmdc:mga08x19_104417_c1 nmdc:mga08x19_104417_c1_911_1315 134
505 3300050515 nmdc:mga0a205_155086_c1 nmdc:mga0a205_155086_c1_1460_1864 134
506 3300050515 nmdc:mga0a205_63894_c1 nmdc:mga0a205_63894_c1_1428_1832 134
507 3300053077 Ga0495601_0000762 Ga0495601_0000762_13924_14328 134
508 3300053085 Ga0495619_0147497 Ga0495619_0147497_769_1173 134
509 3300054114 Ga0501084_0007539 Ga0501084_0007539_3627_4034 134
510 3300054114 Ga0501084_0017956 Ga0501084_0017956_5310_5714 134
511 3300054114 Ga0501084_0465829 Ga0501084_0465829_40_444 134
512 3300060353 Ga0501082_0362076 Ga0501082_0362076_590_994 134
513 3300061734 Ga0530510_0427310 Ga0530510_0427310_26_451 134
514 3300005339 Ga0070660_100251598 Ga0070660_1002515982 135
515 3300005341 Ga0070691_10402884 Ga0070691_104028841 135
516 3300005356 Ga0070674_100009683 Ga0070674_1000096835 135
517 3300005406 Ga0070703_10000082 Ga0070703_1000008220 135
518 3300005440 Ga0070705_100057718 Ga0070705_1000577183 135
519 3300005441 Ga0070700_100200567 Ga0070700_1002005672 135
520 3300005445 Ga0070708_100000583 Ga0070708_10000058319 135
521 3300005467 Ga0070706_100000283 Ga0070706_1000002832 135
522 3300005467 Ga0070706_100180124 Ga0070706_1001801243 135
523 3300005468 Ga0070707_100009176 Ga0070707_1000091762 135
524 3300005471 Ga0070698_100045170 Ga0070698_1000451705 135
525 3300005471 Ga0070698_100531121 Ga0070698_1005311212 135
526 3300005518 Ga0070699_100576939 Ga0070699_1005769392 135
527 3300005536 Ga0070697_100057701 Ga0070697_1000577014 135
528 3300005536 Ga0070697_101236456 Ga0070697_1012364562 135
529 3300005545 Ga0070695_100369162 Ga0070695_1003691622 135
530 3300005546 Ga0070696_100053630 Ga0070696_1000536302 135
531 3300005718 Ga0068866_10009087 Ga0068866_100090874 135
532 3300005719 Ga0068861_100717266 Ga0068861_1007172662 135
533 3300005843 Ga0068860_100807077 Ga0068860_1008070772 135
534 3300005844 Ga0068862_100907800 Ga0068862_1009078002 135
535 3300006173 Ga0070716_101385537 Ga0070716_1013855371 135
536 3300006846 Ga0075430_100016571 Ga0075430_1000165712 135
537 3300006847 Ga0075431_100563872 Ga0075431_1005638722 135
538 3300006881 Ga0068865_100130243 Ga0068865_1001302432 135
539 3300007076 Ga0075435_100003548 Ga0075435_1000035486 135
540 3300009094 Ga0111539_10106643 Ga0111539_101066432 135
541 3300009094 Ga0111539_12097470 Ga0111539_120974702 135
542 3300009098 Ga0105245_10094169 Ga0105245_100941692 135
543 3300009098 Ga0105245_11741846 Ga0105245_117418462 135
544 3300009148 Ga0105243_10013620 Ga0105243_100136204 135
545 3300009176 Ga0105242_10026733 Ga0105242_100267332 135
546 3300009553 Ga0105249_12575724 Ga0105249_125757242 135
547 3300010375 Ga0105239_10305422 Ga0105239_103054223 135
548 3300011119 Ga0105246_10449335 Ga0105246_104493352 135
549 3300013306 Ga0163162_10093658 Ga0163162_100936582 135
550 3300014326 Ga0157380_10867307 Ga0157380_108673072 135
551 3300014326 Ga0157380_12487862 Ga0157380_124878621 135
552 3300025885 Ga0207653_10000045 Ga0207653_1000004594 135
553 3300025899 Ga0207642_10084475 Ga0207642_100844752 135
554 3300025910 Ga0207684_10000058 Ga0207684_1000005825 135
555 3300025922 Ga0207646_10008859 Ga0207646_100088596 135
556 3300025922 Ga0207646_10112763 Ga0207646_101127633 135
557 3300025927 Ga0207687_10089735 Ga0207687_100897353 135
558 3300025927 Ga0207687_10103469 Ga0207687_101034692 135
559 3300025927 Ga0207687_10997216 Ga0207687_109972162 135
560 3300025934 Ga0207686_10025017 Ga0207686_100250174 135
561 3300025935 Ga0207709_10027194 Ga0207709_100271942 135
562 3300025937 Ga0207669_10406942 Ga0207669_104069422 135
563 3300025938 Ga0207704_10174569 Ga0207704_101745691 135
564 3300025942 Ga0207689_10720620 Ga0207689_107206202 135
565 3300025945 Ga0207679_11484122 Ga0207679_114841222 135
566 3300025981 Ga0207640_10430247 Ga0207640_104302472 135
567 3300026023 Ga0207677_10106326 Ga0207677_101063262 135
568 3300026075 Ga0207708_10332147 Ga0207708_103321472 135
569 3300026075 Ga0207708_10981637 Ga0207708_109816371 135
570 3300026089 Ga0207648_10870627 Ga0207648_108706271 135
571 3300026118 Ga0207675_100353683 Ga0207675_1003536832 135
572 3300026121 Ga0207683_10309953 Ga0207683_103099531 135
573 3300027907 Ga0207428_10393401 Ga0207428_103934012 135
574 3300028380 Ga0268265_10837138 Ga0268265_108371382 135
575 3300032002 Ga0307416_100176682 Ga0307416_1001766822 135
576 3300035086 Ga0373934_0043704 Ga0373934_0043704_189_596 135
577 3300035111 Ga0373923_0063776 Ga0373923_0063776_764_1171 135
578 3300035119 Ga0373956_0009666 Ga0373956_0009666_1915_2322 135
579 3300035172 Ga0373955_0024400 Ga0373955_0024400_1764_2171 135
580 3300035410 Ga0373924_0057007 Ga0373924_0057007_1124_1531 135
581 3300035692 Ga0373935_0764871 Ga0373935_0764871_295_702 135
582 3300035695 Ga0373927_0177129 Ga0373927_0177129_44_451 135
583 3300035695 Ga0373927_0743036 Ga0373927_0743036_123_533 135
584 3300035725 Ga0373947_0191145 Ga0373947_0191145_411_818 135
585 3300035725 Ga0373947_0953908 Ga0373947_0953908_78_488 135
586 3300036401 Ga0373937_0026867 Ga0373937_0026867_1135_1542 135
587 3300036401 Ga0373937_1953352 Ga0373937_1953352_69_476 135
588 3300037068 Ga0373925_0875889 Ga0373925_0875889_203_610 135
589 3300037471 Ga0395905_1102576 Ga0395905_1102576_116_529 135
590 3300039437 Ga0436365_0065915 Ga0436365_0065915_824_1246 135
591 3300039437 Ga0436365_0159496 Ga0436365_0159496_13716_14135 135
592 3300039437 Ga0436365_0798370 Ga0436365_0798370_580_1002 135
593 3300039453 Ga0436362_0639565 Ga0436362_0639565_256_678 135
594 3300039453 Ga0436362_1060922 Ga0436362_1060922_75_497 135
595 3300045049 Ga0466959_0067718 Ga0466959_0067718_284_697 135
596 3300046455 Ga0495603_0004360 Ga0495603_0004360_6037_6444 135
597 3300046472 Ga0495580_0425687 Ga0495580_0425687_315_725 135
598 3300046472 Ga0495580_0528159 Ga0495580_0528159_231_638 135
599 3300046476 Ga0495662_0431744 Ga0495662_0431744_138_548 135
600 3300046500 Ga0495596_0187756 Ga0495596_0187756_203_616 135
601 3300046525 Ga0495663_0084865 Ga0495663_0084865_463_870 135
602 3300046528 Ga0495642_0163843 Ga0495642_0163843_475_882 135
603 3300046538 Ga0495609_0040345 Ga0495609_0040345_723_1130 135
604 3300046615 Ga0495656_0401558 Ga0495656_0401558_107_517 135
605 3300046664 Ga0495659_0058969 Ga0495659_0058969_987_1394 135
606 3300046674 Ga0495588_0044320 Ga0495588_0044320_1173_1583 135
607 3300046683 Ga0495658_0449008 Ga0495658_0449008_401_808 135
608 3300046689 Ga0495613_0453497 Ga0495613_0453497_315_722 135
609 3300047321 Ga0495676_0029660 Ga0495676_0029660_1850_2260 135
610 3300047673 Ga0495593_0450376 Ga0495593_0450376_185_595 135
611 3300048091 Ga0495626_0350011 Ga0495626_0350011_131_538 135
612 3300048903 Ga0496100_0009320 Ga0496100_0009320_2184_2591 135
613 3300048904 Ga0496101_0033968 Ga0496101_0033968_1036_1443 135
614 3300048905 Ga0496102_0322978 Ga0496102_0322978_1026_1433 135
615 3300048906 Ga0496103_1052771 Ga0496103_1052771_43_450 135
616 3300048909 Ga0496106_0005863 Ga0496106_0005863_6225_6632 135
617 3300048910 Ga0496107_0056043 Ga0496107_0056043_1941_2348 135
618 3300048912 Ga0496109_1810577 Ga0496109_1810577_26_442 135
619 3300048913 Ga0496110_0274048 Ga0496110_0274048_383_790 135
620 3300048917 Ga0496114_1635590 Ga0496114_1635590_40_453 135
621 3300048918 Ga0496115_1058152 Ga0496115_1058152_37_444 135
622 3300049568 Ga0501031_0013951 Ga0501031_0013951_464_871 135
623 3300049568 Ga0501031_0709142 Ga0501031_0709142_201_608 135
624 3300049569 Ga0501032_0329505 Ga0501032_0329505_148_555 135
625 3300049569 Ga0501032_0693990 Ga0501032_0693990_54_461 135
626 3300049570 Ga0501033_0073110 Ga0501033_0073110_842_1249 135
627 3300049571 Ga0501034_0003490 Ga0501034_0003490_4872_5288 135
628 3300049572 Ga0501036_0007145 Ga0501036_0007145_4627_5034 135
629 3300049572 Ga0501036_0716310 Ga0501036_0716310_309_716 135
630 3300049574 Ga0501038_0021842 Ga0501038_0021842_4439_4846 135
631 3300049575 Ga0501039_0007616 Ga0501039_0007616_1527_1934 135
632 3300049575 Ga0501039_0020587 Ga0501039_0020587_1302_1709 135
633 3300049575 Ga0501039_0397720 Ga0501039_0397720_245_652 135
634 3300049576 Ga0501040_0000885 Ga0501040_0000885_13050_13457 135
635 3300049576 Ga0501040_0010600 Ga0501040_0010600_4861_5268 135
636 3300049576 Ga0501040_0357348 Ga0501040_0357348_332_739 135
637 3300049577 Ga0501041_0012864 Ga0501041_0012864_188_595 135
638 3300049577 Ga0501041_0187160 Ga0501041_0187160_202_609 135
639 3300049578 Ga0501042_0007869 Ga0501042_0007869_1386_1793 135
640 3300049578 Ga0501042_0017392 Ga0501042_0017392_4353_4760 135
641 3300049578 Ga0501042_0114812 Ga0501042_0114812_174_581 135
642 3300049579 Ga0501043_0079293 Ga0501043_0079293_1783_2190 135
643 3300049580 Ga0501046_0131160 Ga0501046_0131160_1130_1537 135
644 3300049581 Ga0501047_0439684 Ga0501047_0439684_16_423 135
645 3300049582 Ga0501048_0007737 Ga0501048_0007737_3546_3953 135
646 3300049583 Ga0501067_0338877 Ga0501067_0338877_128_535 135
647 3300049584 Ga0501068_0034399 Ga0501068_0034399_1473_1880 135
648 3300049584 Ga0501068_0037885 Ga0501068_0037885_1653_2060 135
649 3300049586 Ga0501070_0122104 Ga0501070_0122104_1674_2081 135
650 3300049587 Ga0501071_0011839 Ga0501071_0011839_1826_2233 135
651 3300049587 Ga0501071_0062016 Ga0501071_0062016_307_714 135
652 3300049588 Ga0501072_0005345 Ga0501072_0005345_5800_6207 135
653 3300049590 Ga0501074_0011455 Ga0501074_0011455_205_612 135
654 3300049590 Ga0501074_0019507 Ga0501074_0019507_3146_3553 135
655 3300049590 Ga0501074_0200388 Ga0501074_0200388_970_1377 135
656 3300049590 Ga0501074_0244486 Ga0501074_0244486_81_488 135
657 3300049591 Ga0501075_0003166 Ga0501075_0003166_4444_4851 135
658 3300049591 Ga0501075_0049635 Ga0501075_0049635_2105_2512 135
659 3300049591 Ga0501075_0345191 Ga0501075_0345191_630_1037 135
660 3300049592 Ga0501076_0014869 Ga0501076_0014869_1527_1934 135
661 3300049593 Ga0501077_0005709 Ga0501077_0005709_3104_3511 135
662 3300049593 Ga0501077_0027984 Ga0501077_0027984_143_550 135
663 3300049593 Ga0501077_0186555 Ga0501077_0186555_263_670 135
664 3300049741 Ga0501079_0009731 Ga0501079_0009731_1689_2096 135
665 3300049741 Ga0501079_0210680 Ga0501079_0210680_908_1315 135
666 3300049743 Ga0501081_0002929 Ga0501081_0002929_6641_7048 135
667 3300049743 Ga0501081_0009042 Ga0501081_0009042_3381_3788 135
668 3300049743 Ga0501081_0288431 Ga0501081_0288431_240_647 135
669 3300049743 Ga0501081_0339687 Ga0501081_0339687_458_865 135
670 3300049744 Ga0501083_0038291 Ga0501083_0038291_2108_2515 135
671 3300049822 Ga0501035_0126569 Ga0501035_0126569_1137_1544 135
672 3300049823 Ga0501044_0209536 Ga0501044_0209536_656_1063 135
673 3300049824 Ga0501045_0008966 Ga0501045_0008966_208_615 135
674 3300049824 Ga0501045_0009528 Ga0501045_0009528_3232_3639 135
675 3300049824 Ga0501045_0632829 Ga0501045_0632829_158_565 135
676 3300050509 nmdc:mga0qj67_12234_c1 nmdc:mga0qj67_12234_c1_3924_4331 135
677 3300050510 nmdc:mga06r32_803524_c1 nmdc:mga06r32_803524_c1_197_604 135
678 3300050511 nmdc:mga08y16_16924_c1 nmdc:mga08y16_16924_c1_4429_4836 135
679 3300050512 nmdc:mga0n895_1499482_c1 nmdc:mga0n895_1499482_c1_190_597 135
680 3300050513 nmdc:mga0rr50_36476_c1 nmdc:mga0rr50_36476_c1_2390_2797 135
681 3300050514 nmdc:mga08x19_342440_c1 nmdc:mga08x19_342440_c1_202_609 135
682 3300053083 Ga0495655_0172144 Ga0495655_0172144_55_462 135
683 3300053083 Ga0495655_0269400 Ga0495655_0269400_135_548 135
684 3300053103 Ga0500555_029926 Ga0500555_029926_271_678 135
685 3300053153 Ga0500616_0068560 Ga0500616_0068560_629_1051 135
686 3300054114 Ga0501084_0003271 Ga0501084_0003271_6390_6797 135
687 3300054114 Ga0501084_0021951 Ga0501084_0021951_3662_4069 135
688 3300054114 Ga0501084_0422315 Ga0501084_0422315_350_757 135
689 3300054114 Ga0501084_1725565 Ga0501084_1725565_48_458 135
690 3300060353 Ga0501082_0082580 Ga0501082_0082580_832_1239 135
691 3300060353 Ga0501082_0213485 Ga0501082_0213485_902_1309 135
692 3300060353 Ga0501082_0676467 Ga0501082_0676467_399_806 135
693 3300060353 Ga0501082_0766326 Ga0501082_0766326_153_569 135
694 3300061734 Ga0530510_0008059 Ga0530510_0008059_4376_4783 135
695 3300061734 Ga0530510_0172641 Ga0530510_0172641_187_594 135
696 3300061734 Ga0530510_0309684 Ga0530510_0309684_419_826 135
697 3300061734 Ga0530510_1139024 Ga0530510_1139024_179_586 135
698 3300005343 Ga0070687_100117754 Ga0070687_1001177541 136
699 3300005343 Ga0070687_100154021 Ga0070687_1001540212 136
700 3300005435 Ga0070714_101350923 Ga0070714_1013509231 136
701 3300005518 Ga0070699_100276075 Ga0070699_1002760752 136
702 3300005518 Ga0070699_101441603 Ga0070699_1014416032 136
703 3300005535 Ga0070684_102130774 Ga0070684_1021307741 136
704 3300005536 Ga0070697_101152304 Ga0070697_1011523042 136
705 3300005544 Ga0070686_101791548 Ga0070686_1017915481 136
706 3300005841 Ga0068863_101183513 Ga0068863_1011835131 136
707 3300005937 Ga0081455_10003792 Ga0081455_100037928 136
708 3300006163 Ga0070715_10930975 Ga0070715_109309751 136
709 3300006844 Ga0075428_100511804 Ga0075428_1005118042 136
710 3300006852 Ga0075433_10211345 Ga0075433_102113451 136
711 3300006871 Ga0075434_100452403 Ga0075434_1004524032 136
712 3300009098 Ga0105245_11957739 Ga0105245_119577392 136
713 3300014326 Ga0157380_10885020 Ga0157380_108850201 136
714 3300021384 Ga0213876_10061746 Ga0213876_100617461 136
715 3300021388 Ga0213875_10339567 Ga0213875_103395672 136
716 3300025910 Ga0207684_11150406 Ga0207684_111504062 136
717 3300025931 Ga0207644_10007383 Ga0207644_100073837 136
718 3300025936 Ga0207670_10056231 Ga0207670_100562312 136
719 3300025961 Ga0207712_10326470 Ga0207712_103264701 136
720 3300026088 Ga0207641_11486583 Ga0207641_114865832 136
721 3300028381 Ga0268264_11090185 Ga0268264_110901851 136
722 3300031727 Ga0316576_10085343 Ga0316576_100853432 136
723 3300032126 Ga0307415_100312714 Ga0307415_1003127142 136
724 3300035724 Ga0373933_0099958 Ga0373933_0099958_810_1223 136
725 3300039437 Ga0436365_1188467 Ga0436365_1188467_3319_3741 136
726 3300044673 Ga0453683_0299343 Ga0453683_0299343_417_830 136
727 3300048917 Ga0496114_0193498 Ga0496114_0193498_898_1308 136
728 3300049583 Ga0501067_0538702 Ga0501067_0538702_190_615 136
729 3300049593 Ga0501077_0051345 Ga0501077_0051345_416_829 136
730 3300050507 nmdc:mga05p37_1563043_c1 nmdc:mga05p37_1563043_c1_10_420 136
731 3300053146 Ga0500588_0023315 Ga0500588_0023315_171_584 136
732 3300005295 Ga0065707_10457094 Ga0065707_104570941 137
733 3300005336 Ga0070680_100373061 Ga0070680_1003730611 137
734 3300005444 Ga0070694_100617933 Ga0070694_1006179332 137
735 3300006028 Ga0070717_10176569 Ga0070717_101765692 137
736 3300025906 Ga0207699_10000078 Ga0207699_1000007847 137
737 3300035119 Ga0373956_0376109 Ga0373956_0376109_52_471 137
738 3300035724 Ga0373933_0037611 Ga0373933_0037611_2180_2599 137
739 3300039447 Ga0436361_0972566 Ga0436361_0972566_98_517 137
740 3300041512 Ga0451853_3803030 Ga0451853_3803030_148_561 137
741 3300049575 Ga0501039_0010519 Ga0501039_0010519_4829_5245 137
742 3300006880 Ga0075429_100305698 Ga0075429_1003056983 138
743 3300028577 Ga0265318_10102767 Ga0265318_101027672 138
744 3300031711 Ga0265314_10211614 Ga0265314_102116142 138
745 3300045051 Ga0451576_2229617 Ga0451576_2229617_108_524 138
746 3300048907 Ga0496104_0139756 Ga0496104_0139756_54_473 138
747 3300005347 Ga0070668_100481021 Ga0070668_1004810212 139
748 3300005471 Ga0070698_100125706 Ga0070698_1001257063 139
749 3300005518 Ga0070699_101586919 Ga0070699_1015869191 139
750 3300005719 Ga0068861_100003765 Ga0068861_1000037653 139
751 3300009101 Ga0105247_10004607 Ga0105247_100046077 139
752 3300009147 Ga0114129_11097435 Ga0114129_110974352 139
753 3300009553 Ga0105249_10032330 Ga0105249_100323303 139
754 3300014326 Ga0157380_10470460 Ga0157380_104704602 139
755 3300025900 Ga0207710_10002166 Ga0207710_100021667 139
756 3300026118 Ga0207675_100007470 Ga0207675_1000074709 139
757 3300031616 Ga0307508_10136445 Ga0307508_101364453 139
758 3300031903 Ga0307407_10005376 Ga0307407_100053766 139
759 3300031995 Ga0307409_100570645 Ga0307409_1005706452 139
760 3300032002 Ga0307416_101048583 Ga0307416_1010485831 139
761 3300032005 Ga0307411_10695716 Ga0307411_106957161 139
762 3300032126 Ga0307415_100073836 Ga0307415_1000738362 139
763 3300042876 Ga0451577_0222053 Ga0451577_0222053_177_596 139
764 3300042876 Ga0451577_0293457 Ga0451577_0293457_500_922 139
765 3300042876 Ga0451577_0908790 Ga0451577_0908790_78_497 139
766 3300042876 Ga0451577_1162853 Ga0451577_1162853_175_597 139
767 3300044673 Ga0453683_0022838 Ga0453683_0022838_3347_3769 139
768 3300044673 Ga0453683_0190765 Ga0453683_0190765_709_1131 139
769 3300044712 Ga0453684_0001130 Ga0453684_0001130_61545_61967 139
770 3300044712 Ga0453684_0035005 Ga0453684_0035005_2128_2550 139
771 3300044712 Ga0453684_0132775 Ga0453684_0132775_2117_2539 139
772 3300044712 Ga0453684_1893686 Ga0453684_1893686_80_502 139
773 3300049570 Ga0501033_0322376 Ga0501033_0322376_288_710 139
774 3300049572 Ga0501036_0705688 Ga0501036_0705688_47_469 139
775 3300049575 Ga0501039_0192267 Ga0501039_0192267_1091_1513 139
776 3300049577 Ga0501041_0158836 Ga0501041_0158836_535_957 139
777 3300049590 Ga0501074_0480048 Ga0501074_0480048_414_836 139
778 3300050507 nmdc:mga05p37_26584_c1 nmdc:mga05p37_26584_c1_2635_3126 139
779 3300050507 nmdc:mga05p37_272902_c1 nmdc:mga05p37_272902_c1_1138_1629 139
780 3300050508 nmdc:mga09592_671355_c1 nmdc:mga09592_671355_c1_65_487 139
781 3300054114 Ga0501084_0794106 Ga0501084_0794106_132_554 139
782 3300009147 Ga0114129_10882586 Ga0114129_108825862 140
783 3300026116 Ga0207674_12092395 Ga0207674_120923951 140
784 3300050507 nmdc:mga05p37_812233_c1 nmdc:mga05p37_812233_c1_243_740 140
785 3300003320 rootH2_10046080 rootH2_100460805 141
786 3300005438 Ga0070701_10445794 Ga0070701_104457941 141
787 3300021384 Ga0213876_10001046 Ga0213876_1000104613 141
788 3300025910 Ga0207684_10029482 Ga0207684_100294823 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02310

B12-binding

B12 binding domain

11

128

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bic-assembly3.cif.gz_B crystal structure of human methylmalonyl-coa mutase 0.9634 12 134
3bic-assembly1.cif.gz_A crystal structure of human methylmalonyl-coa mutase 0.9632 12 134
8dyl-assembly1.cif.gz_B crystal structure of human methylmalonyl-coa mutase bound to aquocobalamin 0.963 12 134
2xiq-assembly1.cif.gz_A crystal structure of human methylmalonyl-coa mutase in complex with adenosylcobalamin and malonyl-coa 0.9591 11 134
4r3u-assembly1.cif.gz_C crystal structure of 2-hydroxyisobutyryl-coa mutase 0.9477 7 133
ID Description Score Start End Superfamily
af_A4I2L1_581_723_3.40.50.280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.9647 12 133 3.40.50.280
3bicB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.9634 12 134 3.40.50.280
4r3uD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.9572 10 133 3.40.50.280
4r3uD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.9145 10 133 3.40.50.280
4jgiA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.8766 9 133 3.40.50.280
ID Description Score Start End GO Terms
AF-A0A512CZW4-F1-model_v4 Methylmalonyl-CoA mutase 0.9811 10 138 GO:0016853
GO:0031419
GO:0046872
AF-A0A7W0FPV3-F1-model_v4 Cobalamin B12-binding domain-containing protein 0.9808 10 133 GO:0016853
GO:0031419
GO:0046872
AF-A0A6J7NVJ9-F1-model_v4 Unannotated protein 0.9808 10 133 GO:0016853
GO:0031419
GO:0046872
AF-A0A538P5B2-F1-model_v4 B12-binding domain-containing protein 0.9807 25 133 GO:0004494
GO:0031419
GO:0046872
AF-A0A521KGE8-F1-model_v4 Cobalamin B12-binding domain-containing protein 0.9805 10 133 GO:0016853
GO:0031419
GO:0046872

Feature Viewer

pLDDT pTM Quality
92.27 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map