F480892

General Info

Members Datasets Scaffolds Average Seq Length
789 348 1576 320

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100032406|Ga0070670_1000324062
Length 350
Sequence LLKSVSVGCRVRGTNASLVMELRLALVASARICALAVVGCAASITVAVAGEYPDRPIRIVTPFPAGSATDIVARPIAAKLSEKWSQPVVVDNRSGAGGTISAEIVAKSPPDGHTLLIGATGPNTVNPALIKSMPYDSVRAFAPVTILATNNLLLTVPLSLPVTSVKELIELAHSKPGHLRYGSSGIGAMPHLAGELFKAMARVDIVHVPYKGSPQYVVDLLSGRIDMVIGAAGPVLPHVKVGRLRLLAVSAAARDPALPNVPTMGEEGVPGYEVIGWYGLLAPAGTPAAVIKKLHAEVARILAQPDLKAIYVSGGLEAIASSSPAEFGALIQTDRDKWAKVIKAANIRIE

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
123 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
185 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
191 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
192 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
193 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
194 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
195 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
196 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
197 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
198 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
199 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
200 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
205 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
206 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
211 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
212 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
213 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
214 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
215 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
216 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
217 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
218 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
220 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
222 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
223 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
224 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
225 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
226 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
227 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
228 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
229 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
231 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
233 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
234 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
237 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
238 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
239 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
240 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
241 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
242 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
243 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
246 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
247 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
248 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
249 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
250 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
254 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
255 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
256 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
257 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
260 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
261 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
262 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
263 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
264 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
265 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
266 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
267 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
268 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
269 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
270 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
271 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
272 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
273 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
274 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
275 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
276 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
277 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
278 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
279 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
285 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
286 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
287 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
288 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
297 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
298 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
299 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
300 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
301 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
302 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
303 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
304 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
305 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
306 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
307 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
308 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
309 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
310 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
311 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
312 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
313 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
314 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
315 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
316 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
317 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
318 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
319 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
320 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
321 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
322 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
323 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
324 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
325 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
326 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
327 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
328 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
329 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
330 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
331 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
332 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
333 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
334 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
335 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
336 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
337 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
338 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
339 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
340 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
341 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
342 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
343 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
344 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
345 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
346 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
347 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
348 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.21
Nodule 0.25
Rhizoplane 1.27
Rhizosphere 90.37
Stem 0
Stem Tuber 0
Unclassified 4.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100032406 3300005331 Bacteria 4501
2 JGI25151J46595_10000357 3300003187 Bacteria 48666
3 JGI25406J46586_10000411 3300003203 Bacteria 19666
4 JGI25406J46586_10000578 3300003203 Bacteria 17301
5 JGI25406J46586_10023210 3300003203 Bacteria 2455
6 Ga0065707_10007750 3300005295 Bacteria 2772
7 Ga0065707_10099781 3300005295 Bacteria 2980
8 Ga0070676_10010104 3300005328 Bacteria 5113
9 Ga0070676_10097306 3300005328 Bacteria 1812
10 Ga0070676_10150288 3300005328 Bacteria 1490
11 Ga0070683_100097888 3300005329 Unclassified 2760
12 Ga0070683_100345256 3300005329 Bacteria 1417
13 Ga0070690_100000086 3300005330 Bacteria 45886
14 Ga0070690_100067358 3300005330 Bacteria 2319
15 Ga0070670_100000905 3300005331 Bacteria 23328
16 Ga0070670_100008368 3300005331 Bacteria 8818
17 Ga0070670_100012773 3300005331 Bacteria 7188
18 Ga0070670_100073110 3300005331 Bacteria 2945
19 Ga0070670_100104872 3300005331 Bacteria 2435
20 Ga0070670_100124554 3300005331 Bacteria 2224
21 Ga0070677_10023809 3300005333 Bacteria 2270
22 Ga0068869_100000108 3300005334 Bacteria 39249
23 Ga0068869_100000300 3300005334 Bacteria 26332
24 Ga0070666_10030011 3300005335 Bacteria 3579
25 Ga0070666_10067238 3300005335 Bacteria 2433
26 Ga0070666_10137393 3300005335 Bacteria 1701
27 Ga0070680_100000924 3300005336 Bacteria 20811
28 Ga0070680_100128788 3300005336 Unclassified 2116
29 Ga0070680_100185147 3300005336 Bacteria 1754
30 Ga0070682_100008092 3300005337 Bacteria 5925
31 Ga0068868_100000831 3300005338 Bacteria 20934
32 Ga0068868_100015385 3300005338 Bacteria 5656
33 Ga0068868_100024524 3300005338 Bacteria 4578
34 Ga0068868_100026975 3300005338 Bacteria 4380
35 Ga0068868_100099691 3300005338 Bacteria 2350
36 Ga0070660_100002282 3300005339 Bacteria 13169
37 Ga0070689_100000462 3300005340 Bacteria 24051
38 Ga0070689_100026295 3300005340 Bacteria 4381
39 Ga0070691_10006020 3300005341 Bacteria 5537
40 Ga0070687_100000162 3300005343 Bacteria 23106
41 Ga0070687_100027356 3300005343 Bacteria 2754
42 Ga0070661_100001225 3300005344 Bacteria 18043
43 Ga0070661_100007402 3300005344 Bacteria 7565
44 Ga0070661_100139461 3300005344 Bacteria 1826
45 Ga0070692_10000148 3300005345 Bacteria 17249
46 Ga0070692_10010339 3300005345 Bacteria 4241
47 Ga0070692_10160751 3300005345 Bacteria 1287
48 Ga0070668_100018088 3300005347 Bacteria 5287
49 Ga0070668_100156676 3300005347 Bacteria 1845
50 Ga0070669_100000955 3300005353 Bacteria 21098
51 Ga0070669_100005424 3300005353 Bacteria 9201
52 Ga0070669_100052743 3300005353 Bacteria 2976
53 Ga0070669_100175440 3300005353 Bacteria 1673
54 Ga0070675_100017779 3300005354 Bacteria 5655
55 Ga0070675_100062857 3300005354 Bacteria 3068
56 Ga0070675_100070047 3300005354 Bacteria 2906
57 Ga0070675_100075636 3300005354 Unclassified 2799
58 Ga0070675_100084009 3300005354 Bacteria 2659
59 Ga0070675_100105045 3300005354 Bacteria 2383
60 Ga0070675_100376824 3300005354 Bacteria 1262
61 Ga0070671_100018236 3300005355 Bacteria 5699
62 Ga0070671_100019897 3300005355 Bacteria 5469
63 Ga0070671_100045164 3300005355 Bacteria 3662
64 Ga0070671_100047502 3300005355 Bacteria 3570
65 Ga0070671_100067544 3300005355 Bacteria 2981
66 Ga0070671_100070229 3300005355 Bacteria 2921
67 Ga0070671_100170415 3300005355 Bacteria 1841
68 Ga0070671_100273257 3300005355 Bacteria 1436
69 Ga0070674_100029937 3300005356 Bacteria 3594
70 Ga0070674_100044482 3300005356 Bacteria 3027
71 Ga0070674_100072307 3300005356 Bacteria 2442
72 Ga0070674_100090739 3300005356 Bacteria 2204
73 Ga0070674_100137416 3300005356 Bacteria 1830
74 Ga0070673_100003613 3300005364 Bacteria 9676
75 Ga0070673_100009797 3300005364 Bacteria 6452
76 Ga0070673_100055419 3300005364 Bacteria 3123
77 Ga0070673_100201353 3300005364 Bacteria 1715
78 Ga0070673_100348701 3300005364 Bacteria 1313
79 Ga0070673_100456985 3300005364 Bacteria 1149
80 Ga0070688_100123904 3300005365 Bacteria 1735
81 Ga0070659_100012167 3300005366 Bacteria 6377
82 Ga0070667_100011016 3300005367 Bacteria 7479
83 Ga0070667_100077696 3300005367 Bacteria 2835
84 Ga0070703_10068460 3300005406 Bacteria 1180
85 Ga0070714_100000658 3300005435 Bacteria 24519
86 Ga0070701_10044612 3300005438 Bacteria 2271
87 Ga0070701_10098525 3300005438 Bacteria 1615
88 Ga0070705_100000115 3300005440 Bacteria 45886
89 Ga0070705_100011462 3300005440 Bacteria 4472
90 Ga0070705_100039214 3300005440 Bacteria 2686
91 Ga0070705_100095844 3300005440 Bacteria 1861
92 Ga0070700_100006809 3300005441 Bacteria 6130
93 Ga0070700_100063322 3300005441 Unclassified 2339
94 Ga0070700_100130647 3300005441 Bacteria 1694
95 Ga0070700_100264350 3300005441 Bacteria 1240
96 Ga0070694_100000066 3300005444 Bacteria 49292
97 Ga0070694_100022245 3300005444 Bacteria 4060
98 Ga0070694_100024681 3300005444 Bacteria 3882
99 Ga0070694_100267015 3300005444 Bacteria 1300
100 Ga0070663_100063662 3300005455 Unclassified 2664
101 Ga0070678_100030402 3300005456 Bacteria 3712
102 Ga0070678_100083493 3300005456 Bacteria 2428
103 Ga0070662_100024676 3300005457 Bacteria 4145
104 Ga0070662_100125411 3300005457 Bacteria 1973
105 Ga0070662_100126149 3300005457 Bacteria 1968
106 Ga0070681_10002294 3300005458 Bacteria 17494
107 Ga0070681_10011752 3300005458 Bacteria 8676
108 Ga0070681_10127806 3300005458 Bacteria 2474
109 Ga0068867_100000169 3300005459 Bacteria 42652
110 Ga0068867_100003016 3300005459 Bacteria 11868
111 Ga0068867_100018825 3300005459 Bacteria 4912
112 Ga0068867_100032523 3300005459 Bacteria 3773
113 Ga0070685_10240281 3300005466 Bacteria 1195
114 Ga0070706_100026513 3300005467 Bacteria 5331
115 Ga0070706_100074081 3300005467 Bacteria 3152
116 Ga0070706_100206594 3300005467 Bacteria 1834
117 Ga0070706_100464988 3300005467 Bacteria 1177
118 Ga0070707_100074831 3300005468 Bacteria 3266
119 Ga0070707_100214972 3300005468 Bacteria 1873
120 Ga0070707_100216250 3300005468 Bacteria 1867
121 Ga0070707_100415301 3300005468 Bacteria 1306
122 Ga0070698_100001748 3300005471 Bacteria 24226
123 Ga0070698_100242599 3300005471 Bacteria 1735
124 Ga0070699_100004971 3300005518 Bacteria 11723
125 Ga0070699_100017541 3300005518 Bacteria 6146
126 Ga0070679_100026350 3300005530 Bacteria 5711
127 Ga0070679_100174259 3300005530 Bacteria 2123
128 Ga0070679_100234786 3300005530 Unclassified 1793
129 Ga0070684_100241166 3300005535 Bacteria 1651
130 Ga0070697_100103548 3300005536 Bacteria 2366
131 Ga0070697_100109665 3300005536 Bacteria 2299
132 Ga0070697_100292103 3300005536 Bacteria 1400
133 Ga0068853_100007575 3300005539 Bacteria 8693
134 Ga0070672_100008546 3300005543 Bacteria 7013
135 Ga0070672_100243556 3300005543 Bacteria 1513
136 Ga0070672_100331648 3300005543 Bacteria 1294
137 Ga0070672_100413425 3300005543 Bacteria 1158
138 Ga0070686_100000167 3300005544 Bacteria 45886
139 Ga0070695_100000164 3300005545 Bacteria 31583
140 Ga0070695_100000823 3300005545 Bacteria 16733
141 Ga0070695_100010327 3300005545 Bacteria 5573
142 Ga0070695_100043767 3300005545 Bacteria 2848
143 Ga0070695_100058224 3300005545 Bacteria 2498
144 Ga0070695_100066947 3300005545 Bacteria 2342
145 Ga0070696_100000143 3300005546 Bacteria 39364
146 Ga0070693_100000043 3300005547 Bacteria 48919
147 Ga0070693_100015898 3300005547 Bacteria 3884
148 Ga0070665_100422648 3300005548 Bacteria 1341
149 Ga0070704_100000027 3300005549 Bacteria 47731
150 Ga0070704_100029906 3300005549 Bacteria 3643
151 Ga0070704_100042619 3300005549 Bacteria 3141
152 Ga0068855_100004508 3300005563 Bacteria 17013
153 Ga0068855_100013852 3300005563 Bacteria 9722
154 Ga0068855_100161237 3300005563 Bacteria 2545
155 Ga0070664_100001083 3300005564 Bacteria 21461
156 Ga0070664_100031096 3300005564 Bacteria 4457
157 Ga0070664_100103945 3300005564 Bacteria 2473
158 Ga0070664_100147483 3300005564 Bacteria 2076
159 Ga0068857_100001559 3300005577 Bacteria 18382
160 Ga0068857_100012448 3300005577 Bacteria 7407
161 Ga0068857_100458249 3300005577 Bacteria 1193
162 Ga0068854_100002357 3300005578 Bacteria 11645
163 Ga0068854_100123906 3300005578 Bacteria 1966
164 Ga0068856_100004951 3300005614 Bacteria 13186
165 Ga0068856_100013231 3300005614 Bacteria 7991
166 Ga0068856_100412222 3300005614 Bacteria 1371
167 Ga0070702_100000078 3300005615 Bacteria 28197
168 Ga0070702_100033247 3300005615 Bacteria 2834
169 Ga0068852_100021637 3300005616 Bacteria 5140
170 Ga0068852_100028851 3300005616 Bacteria 4547
171 Ga0068852_100064358 3300005616 Bacteria 3196
172 Ga0068852_100118997 3300005616 Bacteria 2414
173 Ga0068859_100000217 3300005617 Bacteria 56968
174 Ga0068859_100004853 3300005617 Bacteria 13683
175 Ga0068859_100043808 3300005617 Bacteria 4498
176 Ga0068859_100113322 3300005617 Bacteria 2775
177 Ga0068859_100116329 3300005617 Bacteria 2738
178 Ga0068859_100630366 3300005617 Bacteria 1164
179 Ga0068864_100002326 3300005618 Bacteria 15724
180 Ga0068864_100021470 3300005618 Bacteria 5410
181 Ga0068864_100041718 3300005618 Bacteria 3924
182 Ga0068864_100131904 3300005618 Bacteria 2245
183 Ga0068864_100224220 3300005618 Unclassified 1735
184 Ga0068866_10000332 3300005718 Bacteria 22291
185 Ga0068861_100000189 3300005719 Bacteria 32839
186 Ga0068861_100000382 3300005719 Bacteria 25541
187 Ga0068861_100011311 3300005719 Bacteria 6197
188 Ga0068861_100133908 3300005719 Bacteria 2014
189 Ga0068851_10046447 3300005834 Unclassified 2196
190 Ga0068851_10055313 3300005834 Bacteria 2022
191 Ga0068870_10017157 3300005840 Bacteria 3475
192 Ga0068870_10061975 3300005840 Bacteria 2012
193 Ga0068870_10200174 3300005840 Bacteria 1210
194 Ga0068863_100000555 3300005841 Bacteria 37962
195 Ga0068863_100169845 3300005841 Unclassified 2091
196 Ga0068863_100420115 3300005841 Bacteria 1310
197 Ga0068863_100537975 3300005841 Bacteria 1153
198 Ga0068858_100000286 3300005842 Bacteria 54596
199 Ga0068858_100002390 3300005842 Bacteria 18994
200 Ga0068858_100087948 3300005842 Bacteria 2890
201 Ga0068860_100000770 3300005843 Bacteria 36109
202 Ga0068860_100002920 3300005843 Bacteria 17695
203 Ga0068860_100174990 3300005843 Bacteria 2074
204 Ga0068862_100000639 3300005844 Bacteria 36261
205 Ga0068862_100001764 3300005844 Bacteria 19564
206 Ga0068862_100061937 3300005844 Bacteria 3216
207 Ga0081455_10010920 3300005937 Bacteria 9160
208 Ga0081455_10019742 3300005937 Bacteria 6366
209 Ga0081540_1005105 3300005983 Bacteria 9847
210 Ga0081540_1009697 3300005983 Bacteria 6611
211 Ga0081540_1010378 3300005983 Bacteria 6315
212 Ga0081539_10000003 3300005985 Bacteria 594833
213 Ga0081539_10000365 3300005985 Bacteria 99063
214 Ga0081539_10000540 3300005985 Bacteria 78243
215 Ga0075368_10002140 3300006042 Bacteria 6379
216 Ga0075363_100024583 3300006048 Bacteria 3064
217 Ga0075363_100144066 3300006048 Bacteria 1343
218 Ga0075362_10000865 3300006177 Bacteria 9145
219 Ga0075362_10036240 3300006177 Bacteria 2157
220 Ga0075367_10162856 3300006178 Bacteria 1387
221 Ga0075369_10000105 3300006186 Bacteria 22481
222 Ga0075369_10014503 3300006186 Bacteria 3148
223 Ga0075369_10020107 3300006186 Bacteria 2732
224 Ga0075369_10030331 3300006186 Bacteria 2276
225 Ga0075366_10029063 3300006195 Bacteria 3246
226 Ga0097621_100000283 3300006237 Bacteria 34080
227 Ga0097621_100003177 3300006237 Bacteria 11288
228 Ga0097621_100064371 3300006237 Bacteria 3015
229 Ga0097621_100135165 3300006237 Bacteria 2102
230 Ga0097621_100167108 3300006237 Bacteria 1894
231 Ga0068871_100000460 3300006358 Bacteria 27930
232 Ga0068871_100025097 3300006358 Bacteria 4632
233 Ga0068871_100042157 3300006358 Unclassified 3662
234 Ga0068871_100106225 3300006358 Bacteria 2356
235 Ga0075428_100000502 3300006844 Bacteria 39707
236 Ga0075428_100005493 3300006844 Bacteria 14093
237 Ga0075428_100107656 3300006844 Bacteria 3038
238 Ga0075428_100370346 3300006844 Bacteria 1536
239 Ga0075428_100572650 3300006844 Unclassified 1207
240 Ga0075430_100001376 3300006846 Bacteria 19735
241 Ga0075430_100097771 3300006846 Bacteria 2453
242 Ga0075430_100224000 3300006846 Bacteria 1560
243 Ga0075431_100004692 3300006847 Bacteria 13428
244 Ga0075431_100005443 3300006847 Bacteria 12579
245 Ga0075431_100202530 3300006847 Bacteria 2030
246 Ga0075433_10000830 3300006852 Bacteria 21606
247 Ga0075433_10038268 3300006852 Bacteria 4142
248 Ga0075433_10194774 3300006852 Bacteria 1803
249 Ga0075434_100000302 3300006871 Bacteria 34971
250 Ga0075434_100009634 3300006871 Bacteria 9024
251 Ga0075434_100016137 3300006871 Bacteria 7177
252 Ga0075429_100000146 3300006880 Bacteria 43486
253 Ga0075429_100003986 3300006880 Bacteria 12635
254 Ga0075429_100028009 3300006880 Bacteria 4890
255 Ga0075429_100478708 3300006880 Bacteria 1091
256 Ga0068865_100000043 3300006881 Bacteria 70962
257 Ga0068865_100030355 3300006881 Bacteria 3595
258 Ga0068865_100282152 3300006881 Bacteria 1323
259 Ga0075436_100000235 3300006914 Bacteria 34727
260 Ga0075436_100000386 3300006914 Bacteria 28270
261 Ga0075436_100002175 3300006914 Bacteria 13510
262 Ga0075436_100004325 3300006914 Bacteria 9747
263 Ga0075436_100019769 3300006914 Bacteria 4618
264 Ga0075436_100132102 3300006914 Bacteria 1751
265 Ga0075436_100186618 3300006914 Bacteria 1467
266 Ga0097620_100000217 3300006931 Bacteria 56968
267 Ga0097620_100004853 3300006931 Bacteria 13683
268 Ga0097620_100043807 3300006931 Bacteria 4498
269 Ga0097620_100113324 3300006931 Bacteria 2775
270 Ga0097620_100116329 3300006931 Bacteria 2738
271 Ga0097620_100630353 3300006931 Bacteria 1164
272 Ga0075435_100013336 3300007076 Bacteria 6110
273 Ga0099794_10090726 3300007265 Bacteria 1516
274 Ga0099794_10112870 3300007265 Bacteria 1363
275 Ga0105240_10004413 3300009093 Bacteria 21457
276 Ga0111539_10027842 3300009094 Bacteria 6901
277 Ga0111539_10030251 3300009094 Bacteria 6585
278 Ga0111539_10087782 3300009094 Bacteria 3654
279 Ga0111539_10151814 3300009094 Bacteria 2711
280 Ga0111539_10165290 3300009094 Bacteria 2588
281 Ga0111539_10200975 3300009094 Bacteria 2324
282 Ga0111539_10471477 3300009094 Bacteria 1462
283 Ga0105245_10000271 3300009098 Bacteria 49162
284 Ga0105245_10009332 3300009098 Bacteria 8556
285 Ga0105245_10082910 3300009098 Bacteria 2934
286 Ga0105245_10106986 3300009098 Bacteria 2596
287 Ga0105245_10163040 3300009098 Bacteria 2117
288 Ga0105245_10201095 3300009098 Bacteria 1913
289 Ga0105247_10033691 3300009101 Bacteria 3117
290 Ga0114129_10025565 3300009147 Bacteria 8366
291 Ga0114129_10032533 3300009147 Bacteria 7370
292 Ga0114129_10034619 3300009147 Bacteria 7134
293 Ga0105243_10001687 3300009148 Bacteria 19030
294 Ga0105243_10003977 3300009148 Bacteria 11787
295 Ga0105243_10249660 3300009148 Bacteria 1583
296 Ga0105243_10459916 3300009148 Bacteria 1196
297 Ga0105242_10001134 3300009176 Bacteria 20983
298 Ga0105242_10068908 3300009176 Bacteria 2928
299 Ga0105242_10084962 3300009176 Bacteria 2653
300 Ga0105242_10122235 3300009176 Unclassified 2236
301 Ga0105242_10394764 3300009176 Bacteria 1289
302 Ga0105248_10027598 3300009177 Bacteria 6322
303 Ga0105248_10287645 3300009177 Bacteria 1851
304 Ga0105248_10669312 3300009177 Bacteria 1171
305 Ga0105238_10000170 3300009551 Bacteria 70811
306 Ga0105238_10297444 3300009551 Bacteria 1597
307 Ga0105249_10009628 3300009553 Bacteria 8466
308 Ga0105249_10034854 3300009553 Bacteria 4562
309 Ga0105249_10043872 3300009553 Bacteria 4067
310 Ga0105249_10117657 3300009553 Bacteria 2521
311 Ga0105249_10212432 3300009553 Bacteria 1899
312 Ga0105239_10076109 3300010375 Bacteria 3691
313 Ga0105246_10016145 3300011119 Bacteria 4725
314 Ga0157373_10005694 3300013100 Bacteria 9339
315 Ga0157369_10001613 3300013105 Bacteria 27597
316 Ga0157374_10093579 3300013296 Bacteria 2870
317 Ga0157374_10142972 3300013296 Bacteria 2323
318 Ga0157374_10296363 3300013296 Unclassified 1599
319 Ga0157374_10418092 3300013296 Bacteria 1339
320 Ga0157378_10000140 3300013297 Bacteria 67335
321 Ga0157378_10063347 3300013297 Bacteria 3304
322 Ga0157378_10080997 3300013297 Bacteria 2934
323 Ga0157378_10081084 3300013297 Bacteria 2932
324 Ga0157378_10114378 3300013297 Unclassified 2478
325 Ga0157378_10219957 3300013297 Bacteria 1805
326 Ga0163162_10066222 3300013306 Bacteria 3661
327 Ga0163162_10106175 3300013306 Unclassified 2903
328 Ga0163162_10112073 3300013306 Bacteria 2826
329 Ga0157375_10014511 3300013308 Bacteria 7029
330 Ga0157375_10028199 3300013308 Bacteria 5259
331 Ga0157375_10353297 3300013308 Bacteria 1636
332 Ga0163163_10013771 3300014325 Bacteria 7414
333 Ga0157380_10000720 3300014326 Bacteria 20644
334 Ga0157380_10022212 3300014326 Bacteria 4772
335 Ga0157380_10235328 3300014326 Bacteria 1648
336 Ga0182008_10051694 3300014497 Bacteria 2038
337 Ga0182008_10095908 3300014497 Unclassified 1464
338 Ga0157377_10007067 3300014745 Bacteria 5393
339 Ga0157377_10185799 3300014745 Bacteria 1310
340 Ga0157377_10300497 3300014745 Bacteria 1059
341 Ga0157379_10000045 3300014968 Bacteria 75128
342 Ga0157379_10046527 3300014968 Bacteria 3869
343 Ga0157376_10001035 3300014969 Bacteria 18219
344 Ga0157376_10038070 3300014969 Bacteria 3911
345 Ga0157376_10044937 3300014969 Bacteria 3634
346 Ga0157376_10100693 3300014969 Bacteria 2524
347 Ga0157376_10286737 3300014969 Bacteria 1553
348 Ga0182006_1062271 3300015261 Bacteria 1404
349 Ga0163161_10070037 3300017792 Bacteria 2565
350 Ga0163161_10123657 3300017792 Bacteria 1946
351 Ga0163161_10156313 3300017792 Bacteria 1736
352 Ga0163161_10389909 3300017792 Bacteria 1115
353 Ga0209677_100943 3300025253 Bacteria 14198
354 Ga0209233_1009166 3300025261 Bacteria 3024
355 Ga0209455_1005285 3300025272 Bacteria 4026
356 Ga0209025_1000003 3300025294 Bacteria 1366495
357 Ga0207697_10014097 3300025315 Bacteria 3326
358 Ga0207656_10077862 3300025321 Bacteria 1485
359 Ga0207682_10003044 3300025893 Bacteria 7361
360 Ga0207682_10019434 3300025893 Bacteria 2659
361 Ga0207682_10021095 3300025893 Bacteria 2562
362 Ga0207642_10048522 3300025899 Unclassified 1904
363 Ga0207688_10001598 3300025901 Bacteria 11958
364 Ga0207688_10007741 3300025901 Bacteria 5852
365 Ga0207688_10009524 3300025901 Bacteria 5288
366 Ga0207688_10026617 3300025901 Bacteria 3181
367 Ga0207680_10068092 3300025903 Bacteria 2195
368 Ga0207680_10083192 3300025903 Bacteria 2016
369 Ga0207645_10009616 3300025907 Bacteria 6679
370 Ga0207645_10009705 3300025907 Bacteria 6650
371 Ga0207645_10046974 3300025907 Bacteria 2757
372 Ga0207645_10048032 3300025907 Bacteria 2725
373 Ga0207645_10215405 3300025907 Bacteria 1265
374 Ga0207643_10004462 3300025908 Bacteria 7522
375 Ga0207643_10017908 3300025908 Unclassified 3879
376 Ga0207643_10147175 3300025908 Bacteria 1410
377 Ga0207684_10119545 3300025910 Bacteria 2258
378 Ga0207684_10160099 3300025910 Bacteria 1938
379 Ga0207707_10008049 3300025912 Bacteria 9157
380 Ga0207707_10047300 3300025912 Bacteria 3746
381 Ga0207695_10042889 3300025913 Bacteria 4826
382 Ga0207695_10073653 3300025913 Bacteria 3479
383 Ga0207671_10019920 3300025914 Bacteria 5118
384 Ga0207660_10000496 3300025917 Bacteria 26222
385 Ga0207660_10163056 3300025917 Bacteria 1721
386 Ga0207662_10000024 3300025918 Bacteria 70677
387 Ga0207662_10002409 3300025918 Bacteria 9381
388 Ga0207662_10006024 3300025918 Bacteria 6518
389 Ga0207662_10010278 3300025918 Bacteria 5164
390 Ga0207662_10039562 3300025918 Bacteria 2767
391 Ga0207662_10185171 3300025918 Bacteria 1341
392 Ga0207662_10232986 3300025918 Bacteria 1203
393 Ga0207657_10006325 3300025919 Bacteria 12305
394 Ga0207649_10011768 3300025920 Bacteria 4837
395 Ga0207649_10018871 3300025920 Bacteria 3933
396 Ga0207649_10033097 3300025920 Bacteria 3086
397 Ga0207652_10090327 3300025921 Bacteria 2691
398 Ga0207652_10166006 3300025921 Unclassified 1980
399 Ga0207646_10066142 3300025922 Bacteria 3227
400 Ga0207646_10199166 3300025922 Bacteria 1809
401 Ga0207646_10377010 3300025922 Bacteria 1281
402 Ga0207681_10000501 3300025923 Bacteria 27289
403 Ga0207681_10006749 3300025923 Bacteria 7044
404 Ga0207681_10078209 3300025923 Bacteria 2327
405 Ga0207681_10083578 3300025923 Unclassified 2260
406 Ga0207694_10006233 3300025924 Bacteria 9111
407 Ga0207650_10003987 3300025925 Bacteria 10102
408 Ga0207650_10020564 3300025925 Bacteria 4656
409 Ga0207650_10042396 3300025925 Unclassified 3339
410 Ga0207659_10004954 3300025926 Bacteria 8071
411 Ga0207659_10023850 3300025926 Bacteria 4090
412 Ga0207659_10085772 3300025926 Bacteria 2340
413 Ga0207659_10131686 3300025926 Bacteria 1931
414 Ga0207659_10237052 3300025926 Bacteria 1474
415 Ga0207687_10000191 3300025927 Bacteria 41173
416 Ga0207687_10107267 3300025927 Bacteria 2066
417 Ga0207664_10422547 3300025929 Bacteria 1187
418 Ga0207644_10019834 3300025931 Unclassified 4564
419 Ga0207644_10022490 3300025931 Bacteria 4308
420 Ga0207644_10069687 3300025931 Bacteria 2568
421 Ga0207644_10199066 3300025931 Bacteria 1579
422 Ga0207690_10018309 3300025932 Bacteria 4295
423 Ga0207706_10018011 3300025933 Bacteria 6354
424 Ga0207706_10044203 3300025933 Unclassified 3949
425 Ga0207706_10084067 3300025933 Bacteria 2798
426 Ga0207706_10090710 3300025933 Bacteria 2687
427 Ga0207686_10002315 3300025934 Bacteria 10427
428 Ga0207686_10095939 3300025934 Unclassified 1969
429 Ga0207709_10001103 3300025935 Bacteria 19800
430 Ga0207709_10001994 3300025935 Bacteria 13253
431 Ga0207709_10073457 3300025935 Bacteria 2179
432 Ga0207670_10017782 3300025936 Bacteria 4306
433 Ga0207670_10190326 3300025936 Bacteria 1552
434 Ga0207669_10009358 3300025937 Unclassified 4660
435 Ga0207669_10029419 3300025937 Bacteria 3038
436 Ga0207669_10178389 3300025937 Bacteria 1520
437 Ga0207704_10004153 3300025938 Bacteria 6604
438 Ga0207704_10004522 3300025938 Bacteria 6359
439 Ga0207704_10027179 3300025938 Bacteria 3152
440 Ga0207665_10032998 3300025939 Bacteria 3430
441 Ga0207691_10002261 3300025940 Bacteria 18855
442 Ga0207691_10005585 3300025940 Bacteria 12151
443 Ga0207691_10043305 3300025940 Bacteria 4149
444 Ga0207691_10119987 3300025940 Bacteria 2332
445 Ga0207691_10235379 3300025940 Bacteria 1585
446 Ga0207711_10064654 3300025941 Bacteria 3160
447 Ga0207689_10000030 3300025942 Bacteria 97584
448 Ga0207689_10000162 3300025942 Bacteria 57621
449 Ga0207689_10006465 3300025942 Bacteria 10357
450 Ga0207689_10008582 3300025942 Bacteria 8904
451 Ga0207689_10063943 3300025942 Bacteria 3027
452 Ga0207661_10313246 3300025944 Unclassified 1409
453 Ga0207679_10033901 3300025945 Unclassified 3597
454 Ga0207679_10124623 3300025945 Unclassified 2057
455 Ga0207679_10269561 3300025945 Bacteria 1455
456 Ga0207667_10011259 3300025949 Bacteria 10405
457 Ga0207667_10143889 3300025949 Bacteria 2455
458 Ga0207651_10005807 3300025960 Bacteria 6376
459 Ga0207651_10014046 3300025960 Unclassified 4610
460 Ga0207651_10048285 3300025960 Unclassified 2876
461 Ga0207651_10079973 3300025960 Bacteria 2350
462 Ga0207712_10002217 3300025961 Bacteria 12662
463 Ga0207712_10028712 3300025961 Bacteria 3723
464 Ga0207640_10004586 3300025981 Bacteria 7493
465 Ga0207640_10011243 3300025981 Bacteria 5063
466 Ga0207640_10421515 3300025981 Bacteria 1092
467 Ga0207658_10005347 3300025986 Bacteria 8827
468 Ga0207658_10087357 3300025986 Bacteria 2408
469 Ga0207658_10510850 3300025986 Bacteria 1071
470 Ga0207677_10014283 3300026023 Bacteria 4632
471 Ga0207677_10033688 3300026023 Bacteria 3308
472 Ga0207677_10164373 3300026023 Bacteria 1728
473 Ga0207677_10238195 3300026023 Bacteria 1470
474 Ga0207703_10000143 3300026035 Bacteria 84508
475 Ga0207703_10000871 3300026035 Bacteria 29621
476 Ga0207703_10081442 3300026035 Bacteria 2698
477 Ga0207708_10000890 3300026075 Bacteria 22460
478 Ga0207708_10001270 3300026075 Bacteria 19007
479 Ga0207708_10004613 3300026075 Bacteria 10141
480 Ga0207708_10012934 3300026075 Bacteria 6223
481 Ga0207708_10030470 3300026075 Bacteria 4090
482 Ga0207708_10316878 3300026075 Bacteria 1272
483 Ga0207702_10004341 3300026078 Bacteria 12647
484 Ga0207702_10143004 3300026078 Bacteria 2167
485 Ga0207641_10057258 3300026088 Unclassified 3314
486 Ga0207641_10080262 3300026088 Bacteria 2830
487 Ga0207641_10285187 3300026088 Unclassified 1555
488 Ga0207648_10000147 3300026089 Bacteria 70420
489 Ga0207648_10001747 3300026089 Bacteria 23789
490 Ga0207648_10009037 3300026089 Bacteria 9585
491 Ga0207648_10021914 3300026089 Bacteria 5739
492 Ga0207648_10031746 3300026089 Bacteria 4668
493 Ga0207676_10018969 3300026095 Bacteria 5010
494 Ga0207676_10082500 3300026095 Bacteria 2615
495 Ga0207676_10094693 3300026095 Bacteria 2461
496 Ga0207676_10175515 3300026095 Unclassified 1871
497 Ga0207674_10000087 3300026116 Bacteria 100668
498 Ga0207674_10057820 3300026116 Bacteria 3931
499 Ga0207674_10100062 3300026116 Bacteria 2881
500 Ga0207674_10160539 3300026116 Bacteria 2202
501 Ga0207674_10425313 3300026116 Bacteria 1283
502 Ga0207675_100000104 3300026118 Bacteria 67261
503 Ga0207675_100002235 3300026118 Bacteria 19244
504 Ga0207675_100002568 3300026118 Bacteria 17984
505 Ga0207675_100013954 3300026118 Bacteria 7490
506 Ga0207675_100037279 3300026118 Bacteria 4536
507 Ga0207683_10001658 3300026121 Bacteria 19925
508 Ga0207683_10003538 3300026121 Bacteria 13623
509 Ga0207683_10019000 3300026121 Bacteria 5864
510 Ga0207683_10019643 3300026121 Bacteria 5774
511 Ga0207683_10035297 3300026121 Bacteria 4348
512 Ga0207683_10068894 3300026121 Bacteria 3124
513 Ga0207683_10253495 3300026121 Bacteria 1606
514 Ga0207698_10007203 3300026142 Bacteria 6970
515 Ga0207698_10007803 3300026142 Bacteria 6727
516 Ga0207698_10200105 3300026142 Bacteria 1788
517 Ga0209967_1007519 3300027364 Bacteria 1491
518 Ga0210000_1002184 3300027462 Bacteria 2775
519 Ga0209995_1001965 3300027471 Bacteria 3218
520 Ga0209971_1003062 3300027682 Bacteria 3990
521 Ga0209971_1030819 3300027682 Bacteria 1285
522 Ga0209966_1003381 3300027695 Bacteria 2682
523 Ga0209813_10005381 3300027866 Bacteria 3104
524 Ga0209974_10009308 3300027876 Bacteria 3334
525 Ga0209974_10029722 3300027876 Bacteria 1811
526 Ga0207428_10001497 3300027907 Bacteria 24423
527 Ga0207428_10028609 3300027907 Bacteria 4629
528 Ga0207428_10191473 3300027907 Bacteria 1542
529 Ga0268266_10084572 3300028379 Bacteria 2771
530 Ga0268266_10098258 3300028379 Bacteria 2576
531 Ga0268265_10000585 3300028380 Bacteria 36765
532 Ga0268265_10003236 3300028380 Bacteria 11829
533 Ga0268264_10000502 3300028381 Bacteria 50745
534 Ga0268264_10000841 3300028381 Bacteria 32855
535 Ga0268264_10032247 3300028381 Bacteria 4297
536 Ga0268264_10085927 3300028381 Bacteria 2701
537 Ga0265318_10006938 3300028577 Bacteria 5160
538 Ga0265318_10008411 3300028577 Bacteria 4597
539 Ga0265318_10018978 3300028577 Bacteria 2796
540 Ga0307517_10000176 3300028786 Bacteria 105402
541 Ga0307511_10000406 3300030521 Bacteria 45893
542 Ga0265330_10002871 3300031235 Bacteria 9210
543 Ga0265330_10010064 3300031235 Bacteria 4470
544 Ga0265330_10037577 3300031235 Bacteria 2155
545 Ga0265330_10054849 3300031235 Bacteria 1741
546 Ga0265330_10071491 3300031235 Bacteria 1501
547 Ga0265332_10001715 3300031238 Bacteria 11936
548 Ga0265332_10003617 3300031238 Bacteria 7406
549 Ga0265332_10011002 3300031238 Bacteria 4020
550 Ga0265328_10003814 3300031239 Bacteria 6626
551 Ga0265328_10004977 3300031239 Bacteria 5726
552 Ga0265328_10016185 3300031239 Bacteria 2905
553 Ga0265320_10033090 3300031240 Bacteria 2642
554 Ga0265320_10051209 3300031240 Bacteria 2005
555 Ga0265340_10045959 3300031247 Bacteria 2131
556 Ga0265339_10005071 3300031249 Bacteria 8846
557 Ga0265339_10023849 3300031249 Bacteria 3533
558 Ga0265331_10000950 3300031250 Bacteria 23049
559 Ga0265331_10001580 3300031250 Bacteria 16660
560 Ga0265331_10018071 3300031250 Bacteria 3663
561 Ga0265331_10046595 3300031250 Bacteria 2089
562 Ga0265327_10049877 3300031251 Bacteria 2193
563 Ga0265316_10090817 3300031344 Bacteria 2330
564 Ga0265316_10107320 3300031344 Bacteria 2117
565 Ga0265316_10252496 3300031344 Bacteria 1294
566 Ga0307408_100176701 3300031548 Bacteria 1709
567 Ga0265314_10000944 3300031711 Bacteria 34198
568 Ga0265314_10002120 3300031711 Bacteria 20822
569 Ga0265314_10025076 3300031711 Bacteria 4506
570 Ga0265314_10147586 3300031711 Unclassified 1446
571 Ga0265342_10043345 3300031712 Bacteria 2715
572 Ga0265342_10112531 3300031712 Bacteria 1539
573 Ga0307516_10016176 3300031730 Bacteria 7815
574 Ga0307405_10084006 3300031731 Bacteria 2089
575 Ga0307412_10007382 3300031911 Bacteria 6234
576 Ga0307412_10068533 3300031911 Bacteria 2413
577 Ga0307409_100129160 3300031995 Bacteria 2156
578 Ga0307416_100338574 3300032002 Bacteria 1516
579 Ga0307411_10108586 3300032005 Bacteria 1980
580 Ga0307415_100045311 3300032126 Bacteria 2948
581 Ga0307507_10035743 3300033179 Bacteria 5096
582 Ga0316215_1005883 3300033544 Bacteria 1186
583 Ga0373926_0006819 3300035083 Bacteria 3796
584 Ga0373926_0015987 3300035083 Bacteria 2563
585 Ga0373940_0002720 3300035088 Bacteria 3493
586 Ga0373944_0001070 3300035089 Bacteria 6781
587 Ga0373951_0002482 3300035091 Bacteria 4646
588 Ga0373923_0002741 3300035111 Bacteria 5498
589 Ga0373923_0049245 3300035111 Bacteria 1762
590 Ga0373932_0006989 3300035112 Bacteria 2681
591 Ga0373936_0001313 3300035113 Bacteria 9002
592 Ga0373939_0008099 3300035114 Bacteria 2570
593 Ga0373941_0077807 3300035115 Bacteria 1114
594 Ga0373953_0039086 3300035117 Bacteria 1879
595 Ga0373943_0007686 3300035170 Bacteria 4842
596 Ga0373943_0014860 3300035170 Bacteria 3532
597 Ga0373946_0012979 3300035171 Bacteria 3125
598 Ga0373955_0044677 3300035172 Bacteria 2388
599 Ga0373955_0192420 3300035172 Bacteria 1213
600 Ga0373942_0015844 3300035207 Bacteria 1842
601 Ga0373961_0004221 3300035241 Bacteria 3488
602 Ga0373961_0036378 3300035241 Bacteria 1402
603 Ga0373924_0012721 3300035410 Bacteria 3148
604 Ga0373924_0087059 3300035410 Bacteria 1333
605 Ga0373931_0000648 3300035691 Bacteria 14369
606 Ga0373931_0003825 3300035691 Bacteria 6802
607 Ga0373931_0115054 3300035691 Bacteria 1531
608 Ga0373931_0135850 3300035691 Bacteria 1420
609 Ga0373931_0212671 3300035691 Bacteria 1160
610 Ga0373931_0284429 3300035691 Bacteria 1016
611 Ga0373935_0009070 3300035692 Bacteria 5952
612 Ga0373935_0056270 3300035692 Bacteria 2507
613 Ga0373935_0089751 3300035692 Bacteria 2010
614 Ga0373927_0006578 3300035695 Bacteria 7915
615 Ga0373927_0020169 3300035695 Bacteria 4370
616 Ga0373927_0153916 3300035695 Bacteria 1505
617 Ga0373933_0024557 3300035724 Bacteria 3450
618 Ga0373933_0107678 3300035724 Bacteria 1735
619 Ga0373937_0371638 3300036401 Bacteria 1355
620 Ga0373925_0070882 3300037068 Bacteria 2635
621 Ga0436364_0665986 3300037853 Bacteria 1229
622 Ga0436361_0949329 3300039447 Bacteria 3083
623 Ga0439453_0005926 3300041408 Bacteria 1883
624 Ga0451807_2429854 3300041486 Bacteria 961
625 Ga0451853_0755636 3300041512 Bacteria 1532
626 Ga0439441_000557 3300042001 Bacteria 4136
627 Ga0439443_001685 3300042003 Bacteria 2504
628 Ga0439444_0000089 3300042437 Bacteria 7031
629 Ga0451577_0199510 3300042876 Bacteria 1806
630 Ga0466969_0032003 3300044656 Bacteria 2675
631 Ga0466966_0058217 3300044684 Bacteria 2443
632 Ga0466964_0094264 3300044706 Bacteria 1308
633 Ga0451576_0002895 3300045051 Bacteria 24483
634 Ga0451576_0007504 3300045051 Bacteria 13014
635 Ga0451576_0183606 3300045051 Bacteria 2184
636 Ga0451576_0604389 3300045051 Bacteria 1153
637 Ga0495592_0177283 3300046454 Bacteria 1455
638 Ga0495603_0039546 3300046455 Bacteria 2825
639 Ga0495603_0250910 3300046455 Bacteria 1019
640 Ga0495653_0190808 3300046463 Bacteria 1398
641 Ga0495580_0003547 3300046472 Bacteria 13255
642 Ga0495580_0018667 3300046472 Bacteria 5161
643 Ga0495580_0029141 3300046472 Bacteria 4007
644 Ga0495605_0035312 3300046474 Unclassified 2527
645 Ga0495639_0015974 3300046475 Bacteria 3256
646 Ga0495639_0089454 3300046475 Bacteria 1443
647 Ga0495664_0034175 3300046477 Bacteria 2990
648 Ga0495664_0044120 3300046477 Bacteria 2642
649 Ga0495594_0097190 3300046499 Bacteria 1655
650 Ga0495594_0190994 3300046499 Bacteria 1167
651 Ga0495608_0039081 3300046511 Bacteria 3182
652 Ga0495630_0087685 3300046517 Bacteria 2350
653 Ga0495666_0009438 3300046526 Bacteria 4879
654 Ga0495642_0123703 3300046528 Bacteria 1111
655 Ga0495665_0017723 3300046531 Bacteria 3829
656 Ga0495640_0203627 3300046533 Bacteria 1253
657 Ga0495586_0008118 3300046535 Bacteria 5598
658 Ga0495586_0045476 3300046535 Bacteria 2365
659 Ga0495586_0070212 3300046535 Bacteria 1912
660 Ga0495587_0125342 3300046536 Bacteria 1470
661 Ga0495598_0033552 3300046537 Bacteria 1458
662 Ga0495621_0042398 3300046539 Bacteria 1602
663 Ga0495645_0149345 3300046543 Bacteria 1625
664 Ga0495634_0036574 3300046642 Bacteria 3357
665 Ga0495634_0181220 3300046642 Bacteria 1318
666 Ga0495659_0076218 3300046664 Bacteria 1265
667 Ga0495647_0001109 3300046681 Bacteria 8223
668 Ga0495658_0008854 3300046683 Bacteria 5003
669 Ga0495658_0067017 3300046683 Unclassified 2075
670 Ga0495658_0108327 3300046683 Bacteria 1667
671 Ga0495658_0218196 3300046683 Bacteria 1193
672 Ga0495669_0047570 3300046684 Bacteria 1916
673 Ga0495624_0012563 3300046690 Bacteria 5783
674 Ga0495672_0092299 3300047320 Bacteria 1660
675 Ga0495676_0028397 3300047321 Bacteria 4777
676 Ga0495680_0208838 3300047322 Bacteria 1398
677 Ga0495684_0038679 3300047471 Bacteria 3657
678 Ga0495684_0142252 3300047471 Bacteria 1798
679 Ga0496100_0419093 3300048903 Bacteria 1022
680 Ga0496106_0169016 3300048909 Bacteria 1732
681 Ga0496106_0243555 3300048909 Bacteria 1437
682 Ga0496108_0066177 3300048911 Bacteria 3047
683 Ga0496108_0076946 3300048911 Bacteria 2821
684 Ga0496108_0269046 3300048911 Bacteria 1483
685 Ga0496109_0582129 3300048912 Bacteria 1055
686 Ga0496110_0054162 3300048913 Bacteria 3528
687 Ga0496114_0034560 3300048917 Bacteria 4172
688 Ga0496117_0034853 3300048920 Bacteria 3786
689 Ga0496118_0008904 3300048921 Bacteria 10255
690 Ga0496119_0159128 3300048922 Bacteria 1203
691 Ga0496121_0029453 3300048924 Bacteria 5075
692 Ga0496121_0081021 3300048924 Bacteria 2571
693 Ga0496125_0160174 3300048928 Bacteria 1530
694 Ga0501034_0010412 3300049571 Bacteria 9692
695 Ga0501034_0015436 3300049571 Bacteria 7850
696 Ga0501036_0162752 3300049572 Bacteria 1881
697 Ga0501037_0209708 3300049573 Bacteria 1374
698 Ga0501040_0054002 3300049576 Bacteria 2754
699 Ga0501043_0086051 3300049579 Bacteria 2470
700 Ga0501046_0020732 3300049580 Bacteria 5432
701 Ga0501048_0136320 3300049582 Bacteria 1735
702 Ga0501067_0125063 3300049583 Bacteria 1431
703 Ga0501071_0034584 3300049587 Bacteria 3598
704 Ga0501071_0162031 3300049587 Unclassified 1672
705 Ga0501075_0004582 3300049591 Bacteria 9370
706 Ga0501076_0128653 3300049592 Unclassified 2053
707 Ga0501076_0194979 3300049592 Bacteria 1653
708 Ga0501077_0006482 3300049593 Bacteria 7185
709 Ga0501079_0150616 3300049741 Bacteria 1813
710 Ga0501080_0046986 3300049742 Bacteria 4019
711 Ga0501081_0051215 3300049743 Bacteria 2847
712 Ga0501081_0235216 3300049743 Unclassified 1335
713 Ga0501045_0072853 3300049824 Bacteria 2529
714 nmdc:mga03683_465_c1 3300050489 Bacteria 11702
715 nmdc:mga03n38_2017_c1 3300050490 Bacteria 6112
716 nmdc:mga00v17_17429_c1 3300050491 Bacteria 4067
717 nmdc:mga0yw44_103938_c1 3300050492 Bacteria 1812
718 nmdc:mga0yw44_129678_c1 3300050492 Bacteria 1631
719 nmdc:mga06z11_16393_c1 3300050494 Bacteria 3337
720 nmdc:mga06z11_32502_c1 3300050494 Bacteria 2545
721 nmdc:mga04h51_1861_c1 3300050495 Bacteria 4931
722 nmdc:mga07m45_44603_c1 3300050496 Bacteria 1093
723 nmdc:mga07m45_7149_c1 3300050496 Bacteria 5686
724 nmdc:mga05p37_1105_c1 3300050507 Bacteria 30994
725 nmdc:mga05p37_588_c1 3300050507 Bacteria 40012
726 nmdc:mga09592_10327_c1 3300050508 Bacteria 7596
727 nmdc:mga09592_116_c1 3300050508 Bacteria 50381
728 nmdc:mga09592_144964_c1 3300050508 Bacteria 2047
729 nmdc:mga09592_148_c1 3300050508 Bacteria 47706
730 nmdc:mga0qj67_194826_c1 3300050509 Bacteria 1647
731 nmdc:mga0qj67_254125_c1 3300050509 Bacteria 1426
732 nmdc:mga0qj67_28505_c1 3300050509 Bacteria 4334
733 nmdc:mga0qj67_84419_c1 3300050509 Bacteria 2547
734 nmdc:mga0qj67_9213_c1 3300050509 Bacteria 7335
735 nmdc:mga06r32_3824_c1 3300050510 Bacteria 13483
736 nmdc:mga06r32_53244_c1 3300050510 Bacteria 3877
737 nmdc:mga08y16_2516_c1 3300050511 Bacteria 18835
738 nmdc:mga08y16_27016_c1 3300050511 Bacteria 6049
739 nmdc:mga08y16_2868_c1 3300050511 Bacteria 17735
740 nmdc:mga08y16_367676_c1 3300050511 Bacteria 1476
741 nmdc:mga08y16_73996_c1 3300050511 Bacteria 3549
742 nmdc:mga0n895_119294_c1 3300050512 Bacteria 2659
743 nmdc:mga0n895_137092_c1 3300050512 Bacteria 2474
744 nmdc:mga0n895_289370_c1 3300050512 Bacteria 1661
745 nmdc:mga0n895_38902_c1 3300050512 Bacteria 4611
746 nmdc:mga0n895_8012_c1 3300050512 Bacteria 9115
747 nmdc:mga0rr50_223426_c1 3300050513 Bacteria 1556
748 nmdc:mga0rr50_914_c1 3300050513 Bacteria 15979
749 nmdc:mga08x19_10127_c1 3300050514 Bacteria 5655
750 nmdc:mga08x19_157043_c1 3300050514 Bacteria 1543
751 nmdc:mga08x19_1704_c1 3300050514 Bacteria 13531
752 nmdc:mga08x19_172657_c1 3300050514 Bacteria 1473
753 nmdc:mga08x19_1736_c1 3300050514 Bacteria 13425
754 nmdc:mga08x19_21031_c1 3300050514 Bacteria 4025
755 nmdc:mga08x19_2271_c1 3300050514 Bacteria 11696
756 nmdc:mga08x19_314048_c1 3300050514 Bacteria 1090
757 nmdc:mga0a205_145680_c2 3300050515 Bacteria 1949
758 nmdc:mga0a205_187_c1 3300050515 Bacteria 42758
759 nmdc:mga0a205_8299_c1 3300050515 Bacteria 9445
760 nmdc:mga0sz30_1320_c1 3300050516 Bacteria 8817
761 nmdc:mga0sz30_29028_c1 3300050516 Bacteria 2278
762 Ga0500635_0067675 3300053080 Bacteria 1260
763 Ga0500646_0014874 3300053090 Bacteria 2022
764 Ga0500647_0032726 3300053091 Bacteria 2478
765 Ga0500583_0026855 3300053092 Bacteria 2478
766 Ga0500651_0042141 3300053093 Bacteria 2876
767 Ga0500566_0002691 3300053094 Bacteria 10590
768 Ga0500641_0005691 3300053096 Bacteria 4413
769 Ga0500572_000826 3300053111 Bacteria 9761
770 Ga0500608_024851 3300053122 Bacteria 2800
771 Ga0500614_000593 3300053123 Bacteria 9245
772 Ga0500559_0017158 3300053136 Bacteria 3056
773 Ga0500568_0001478 3300053139 Bacteria 15055
774 Ga0500603_000871 3300053150 Bacteria 7198
775 Ga0500604_0001808 3300053151 Bacteria 5968
776 Ga0500630_013830 3300053159 Bacteria 3973
777 Ga0500639_015947 3300053163 Bacteria 3957
778 Ga0500636_0136003 3300053177 Bacteria 1365
779 Ga0500637_0091649 3300053178 Bacteria 1761
780 Ga0500596_004009 3300053735 Bacteria 2740
781 Ga0500601_002418 3300053737 Bacteria 2007
782 Ga0501084_0273722 3300054114 Bacteria 1425
783 Ga0501082_0027120 3300060353 Bacteria 4934
784 Ga0466962_0018747 3300061719 Bacteria 3327
785 2513887923 2513237141 Bacteria 8496279
786 2922388448 2922386360 Bacteria 7017218
787 2928086740 2928084124 Bacteria 7159212
788 2945986602 2945984333 Bacteria 7358892
789 Ga0070670_100032406
790 JGI25151J46595_10000357
791 JGI25406J46586_10000411
792 JGI25406J46586_10000578
793 JGI25406J46586_10023210
794 Ga0065707_10007750
795 Ga0065707_10099781
796 Ga0070676_10010104
797 Ga0070676_10097306
798 Ga0070676_10150288
799 Ga0070683_100097888
800 Ga0070683_100345256
801 Ga0070690_100000086
802 Ga0070690_100067358
803 Ga0070670_100000905
804 Ga0070670_100008368
805 Ga0070670_100012773
806 Ga0070670_100073110
807 Ga0070670_100104872
808 Ga0070670_100124554
809 Ga0070677_10023809
810 Ga0068869_100000108
811 Ga0068869_100000300
812 Ga0070666_10030011
813 Ga0070666_10067238
814 Ga0070666_10137393
815 Ga0070680_100000924
816 Ga0070680_100128788
817 Ga0070680_100185147
818 Ga0070682_100008092
819 Ga0068868_100000831
820 Ga0068868_100015385
821 Ga0068868_100024524
822 Ga0068868_100026975
823 Ga0068868_100099691
824 Ga0070660_100002282
825 Ga0070689_100000462
826 Ga0070689_100026295
827 Ga0070691_10006020
828 Ga0070687_100000162
829 Ga0070687_100027356
830 Ga0070661_100001225
831 Ga0070661_100007402
832 Ga0070661_100139461
833 Ga0070692_10000148
834 Ga0070692_10010339
835 Ga0070692_10160751
836 Ga0070668_100018088
837 Ga0070668_100156676
838 Ga0070669_100000955
839 Ga0070669_100005424
840 Ga0070669_100052743
841 Ga0070669_100175440
842 Ga0070675_100017779
843 Ga0070675_100062857
844 Ga0070675_100070047
845 Ga0070675_100075636
846 Ga0070675_100084009
847 Ga0070675_100105045
848 Ga0070675_100376824
849 Ga0070671_100018236
850 Ga0070671_100019897
851 Ga0070671_100045164
852 Ga0070671_100047502
853 Ga0070671_100067544
854 Ga0070671_100070229
855 Ga0070671_100170415
856 Ga0070671_100273257
857 Ga0070674_100029937
858 Ga0070674_100044482
859 Ga0070674_100072307
860 Ga0070674_100090739
861 Ga0070674_100137416
862 Ga0070673_100003613
863 Ga0070673_100009797
864 Ga0070673_100055419
865 Ga0070673_100201353
866 Ga0070673_100348701
867 Ga0070673_100456985
868 Ga0070688_100123904
869 Ga0070659_100012167
870 Ga0070667_100011016
871 Ga0070667_100077696
872 Ga0070703_10068460
873 Ga0070714_100000658
874 Ga0070701_10044612
875 Ga0070701_10098525
876 Ga0070705_100000115
877 Ga0070705_100011462
878 Ga0070705_100039214
879 Ga0070705_100095844
880 Ga0070700_100006809
881 Ga0070700_100063322
882 Ga0070700_100130647
883 Ga0070700_100264350
884 Ga0070694_100000066
885 Ga0070694_100022245
886 Ga0070694_100024681
887 Ga0070694_100267015
888 Ga0070663_100063662
889 Ga0070678_100030402
890 Ga0070678_100083493
891 Ga0070662_100024676
892 Ga0070662_100125411
893 Ga0070662_100126149
894 Ga0070681_10002294
895 Ga0070681_10011752
896 Ga0070681_10127806
897 Ga0068867_100000169
898 Ga0068867_100003016
899 Ga0068867_100018825
900 Ga0068867_100032523
901 Ga0070685_10240281
902 Ga0070706_100026513
903 Ga0070706_100074081
904 Ga0070706_100206594
905 Ga0070706_100464988
906 Ga0070707_100074831
907 Ga0070707_100214972
908 Ga0070707_100216250
909 Ga0070707_100415301
910 Ga0070698_100001748
911 Ga0070698_100242599
912 Ga0070699_100004971
913 Ga0070699_100017541
914 Ga0070679_100026350
915 Ga0070679_100174259
916 Ga0070679_100234786
917 Ga0070684_100241166
918 Ga0070697_100103548
919 Ga0070697_100109665
920 Ga0070697_100292103
921 Ga0068853_100007575
922 Ga0070672_100008546
923 Ga0070672_100243556
924 Ga0070672_100331648
925 Ga0070672_100413425
926 Ga0070686_100000167
927 Ga0070695_100000164
928 Ga0070695_100000823
929 Ga0070695_100010327
930 Ga0070695_100043767
931 Ga0070695_100058224
932 Ga0070695_100066947
933 Ga0070696_100000143
934 Ga0070693_100000043
935 Ga0070693_100015898
936 Ga0070665_100422648
937 Ga0070704_100000027
938 Ga0070704_100029906
939 Ga0070704_100042619
940 Ga0068855_100004508
941 Ga0068855_100013852
942 Ga0068855_100161237
943 Ga0070664_100001083
944 Ga0070664_100031096
945 Ga0070664_100103945
946 Ga0070664_100147483
947 Ga0068857_100001559
948 Ga0068857_100012448
949 Ga0068857_100458249
950 Ga0068854_100002357
951 Ga0068854_100123906
952 Ga0068856_100004951
953 Ga0068856_100013231
954 Ga0068856_100412222
955 Ga0070702_100000078
956 Ga0070702_100033247
957 Ga0068852_100021637
958 Ga0068852_100028851
959 Ga0068852_100064358
960 Ga0068852_100118997
961 Ga0068859_100000217
962 Ga0068859_100004853
963 Ga0068859_100043808
964 Ga0068859_100113322
965 Ga0068859_100116329
966 Ga0068859_100630366
967 Ga0068864_100002326
968 Ga0068864_100021470
969 Ga0068864_100041718
970 Ga0068864_100131904
971 Ga0068864_100224220
972 Ga0068866_10000332
973 Ga0068861_100000189
974 Ga0068861_100000382
975 Ga0068861_100011311
976 Ga0068861_100133908
977 Ga0068851_10046447
978 Ga0068851_10055313
979 Ga0068870_10017157
980 Ga0068870_10061975
981 Ga0068870_10200174
982 Ga0068863_100000555
983 Ga0068863_100169845
984 Ga0068863_100420115
985 Ga0068863_100537975
986 Ga0068858_100000286
987 Ga0068858_100002390
988 Ga0068858_100087948
989 Ga0068860_100000770
990 Ga0068860_100002920
991 Ga0068860_100174990
992 Ga0068862_100000639
993 Ga0068862_100001764
994 Ga0068862_100061937
995 Ga0081455_10010920
996 Ga0081455_10019742
997 Ga0081540_1005105
998 Ga0081540_1009697
999 Ga0081540_1010378
1000 Ga0081539_10000003
1001 Ga0081539_10000365
1002 Ga0081539_10000540
1003 Ga0075368_10002140
1004 Ga0075363_100024583
1005 Ga0075363_100144066
1006 Ga0075362_10000865
1007 Ga0075362_10036240
1008 Ga0075367_10162856
1009 Ga0075369_10000105
1010 Ga0075369_10014503
1011 Ga0075369_10020107
1012 Ga0075369_10030331
1013 Ga0075366_10029063
1014 Ga0097621_100000283
1015 Ga0097621_100003177
1016 Ga0097621_100064371
1017 Ga0097621_100135165
1018 Ga0097621_100167108
1019 Ga0068871_100000460
1020 Ga0068871_100025097
1021 Ga0068871_100042157
1022 Ga0068871_100106225
1023 Ga0075428_100000502
1024 Ga0075428_100005493
1025 Ga0075428_100107656
1026 Ga0075428_100370346
1027 Ga0075428_100572650
1028 Ga0075430_100001376
1029 Ga0075430_100097771
1030 Ga0075430_100224000
1031 Ga0075431_100004692
1032 Ga0075431_100005443
1033 Ga0075431_100202530
1034 Ga0075433_10000830
1035 Ga0075433_10038268
1036 Ga0075433_10194774
1037 Ga0075434_100000302
1038 Ga0075434_100009634
1039 Ga0075434_100016137
1040 Ga0075429_100000146
1041 Ga0075429_100003986
1042 Ga0075429_100028009
1043 Ga0075429_100478708
1044 Ga0068865_100000043
1045 Ga0068865_100030355
1046 Ga0068865_100282152
1047 Ga0075436_100000235
1048 Ga0075436_100000386
1049 Ga0075436_100002175
1050 Ga0075436_100004325
1051 Ga0075436_100019769
1052 Ga0075436_100132102
1053 Ga0075436_100186618
1054 Ga0097620_100000217
1055 Ga0097620_100004853
1056 Ga0097620_100043807
1057 Ga0097620_100113324
1058 Ga0097620_100116329
1059 Ga0097620_100630353
1060 Ga0075435_100013336
1061 Ga0099794_10090726
1062 Ga0099794_10112870
1063 Ga0105240_10004413
1064 Ga0111539_10027842
1065 Ga0111539_10030251
1066 Ga0111539_10087782
1067 Ga0111539_10151814
1068 Ga0111539_10165290
1069 Ga0111539_10200975
1070 Ga0111539_10471477
1071 Ga0105245_10000271
1072 Ga0105245_10009332
1073 Ga0105245_10082910
1074 Ga0105245_10106986
1075 Ga0105245_10163040
1076 Ga0105245_10201095
1077 Ga0105247_10033691
1078 Ga0114129_10025565
1079 Ga0114129_10032533
1080 Ga0114129_10034619
1081 Ga0105243_10001687
1082 Ga0105243_10003977
1083 Ga0105243_10249660
1084 Ga0105243_10459916
1085 Ga0105242_10001134
1086 Ga0105242_10068908
1087 Ga0105242_10084962
1088 Ga0105242_10122235
1089 Ga0105242_10394764
1090 Ga0105248_10027598
1091 Ga0105248_10287645
1092 Ga0105248_10669312
1093 Ga0105238_10000170
1094 Ga0105238_10297444
1095 Ga0105249_10009628
1096 Ga0105249_10034854
1097 Ga0105249_10043872
1098 Ga0105249_10117657
1099 Ga0105249_10212432
1100 Ga0105239_10076109
1101 Ga0105246_10016145
1102 Ga0157373_10005694
1103 Ga0157369_10001613
1104 Ga0157374_10093579
1105 Ga0157374_10142972
1106 Ga0157374_10296363
1107 Ga0157374_10418092
1108 Ga0157378_10000140
1109 Ga0157378_10063347
1110 Ga0157378_10080997
1111 Ga0157378_10081084
1112 Ga0157378_10114378
1113 Ga0157378_10219957
1114 Ga0163162_10066222
1115 Ga0163162_10106175
1116 Ga0163162_10112073
1117 Ga0157375_10014511
1118 Ga0157375_10028199
1119 Ga0157375_10353297
1120 Ga0163163_10013771
1121 Ga0157380_10000720
1122 Ga0157380_10022212
1123 Ga0157380_10235328
1124 Ga0182008_10051694
1125 Ga0182008_10095908
1126 Ga0157377_10007067
1127 Ga0157377_10185799
1128 Ga0157377_10300497
1129 Ga0157379_10000045
1130 Ga0157379_10046527
1131 Ga0157376_10001035
1132 Ga0157376_10038070
1133 Ga0157376_10044937
1134 Ga0157376_10100693
1135 Ga0157376_10286737
1136 Ga0182006_1062271
1137 Ga0163161_10070037
1138 Ga0163161_10123657
1139 Ga0163161_10156313
1140 Ga0163161_10389909
1141 Ga0209677_100943
1142 Ga0209233_1009166
1143 Ga0209455_1005285
1144 Ga0209025_1000003
1145 Ga0207697_10014097
1146 Ga0207656_10077862
1147 Ga0207682_10003044
1148 Ga0207682_10019434
1149 Ga0207682_10021095
1150 Ga0207642_10048522
1151 Ga0207688_10001598
1152 Ga0207688_10007741
1153 Ga0207688_10009524
1154 Ga0207688_10026617
1155 Ga0207680_10068092
1156 Ga0207680_10083192
1157 Ga0207645_10009616
1158 Ga0207645_10009705
1159 Ga0207645_10046974
1160 Ga0207645_10048032
1161 Ga0207645_10215405
1162 Ga0207643_10004462
1163 Ga0207643_10017908
1164 Ga0207643_10147175
1165 Ga0207684_10119545
1166 Ga0207684_10160099
1167 Ga0207707_10008049
1168 Ga0207707_10047300
1169 Ga0207695_10042889
1170 Ga0207695_10073653
1171 Ga0207671_10019920
1172 Ga0207660_10000496
1173 Ga0207660_10163056
1174 Ga0207662_10000024
1175 Ga0207662_10002409
1176 Ga0207662_10006024
1177 Ga0207662_10010278
1178 Ga0207662_10039562
1179 Ga0207662_10185171
1180 Ga0207662_10232986
1181 Ga0207657_10006325
1182 Ga0207649_10011768
1183 Ga0207649_10018871
1184 Ga0207649_10033097
1185 Ga0207652_10090327
1186 Ga0207652_10166006
1187 Ga0207646_10066142
1188 Ga0207646_10199166
1189 Ga0207646_10377010
1190 Ga0207681_10000501
1191 Ga0207681_10006749
1192 Ga0207681_10078209
1193 Ga0207681_10083578
1194 Ga0207694_10006233
1195 Ga0207650_10003987
1196 Ga0207650_10020564
1197 Ga0207650_10042396
1198 Ga0207659_10004954
1199 Ga0207659_10023850
1200 Ga0207659_10085772
1201 Ga0207659_10131686
1202 Ga0207659_10237052
1203 Ga0207687_10000191
1204 Ga0207687_10107267
1205 Ga0207664_10422547
1206 Ga0207644_10019834
1207 Ga0207644_10022490
1208 Ga0207644_10069687
1209 Ga0207644_10199066
1210 Ga0207690_10018309
1211 Ga0207706_10018011
1212 Ga0207706_10044203
1213 Ga0207706_10084067
1214 Ga0207706_10090710
1215 Ga0207686_10002315
1216 Ga0207686_10095939
1217 Ga0207709_10001103
1218 Ga0207709_10001994
1219 Ga0207709_10073457
1220 Ga0207670_10017782
1221 Ga0207670_10190326
1222 Ga0207669_10009358
1223 Ga0207669_10029419
1224 Ga0207669_10178389
1225 Ga0207704_10004153
1226 Ga0207704_10004522
1227 Ga0207704_10027179
1228 Ga0207665_10032998
1229 Ga0207691_10002261
1230 Ga0207691_10005585
1231 Ga0207691_10043305
1232 Ga0207691_10119987
1233 Ga0207691_10235379
1234 Ga0207711_10064654
1235 Ga0207689_10000030
1236 Ga0207689_10000162
1237 Ga0207689_10006465
1238 Ga0207689_10008582
1239 Ga0207689_10063943
1240 Ga0207661_10313246
1241 Ga0207679_10033901
1242 Ga0207679_10124623
1243 Ga0207679_10269561
1244 Ga0207667_10011259
1245 Ga0207667_10143889
1246 Ga0207651_10005807
1247 Ga0207651_10014046
1248 Ga0207651_10048285
1249 Ga0207651_10079973
1250 Ga0207712_10002217
1251 Ga0207712_10028712
1252 Ga0207640_10004586
1253 Ga0207640_10011243
1254 Ga0207640_10421515
1255 Ga0207658_10005347
1256 Ga0207658_10087357
1257 Ga0207658_10510850
1258 Ga0207677_10014283
1259 Ga0207677_10033688
1260 Ga0207677_10164373
1261 Ga0207677_10238195
1262 Ga0207703_10000143
1263 Ga0207703_10000871
1264 Ga0207703_10081442
1265 Ga0207708_10000890
1266 Ga0207708_10001270
1267 Ga0207708_10004613
1268 Ga0207708_10012934
1269 Ga0207708_10030470
1270 Ga0207708_10316878
1271 Ga0207702_10004341
1272 Ga0207702_10143004
1273 Ga0207641_10057258
1274 Ga0207641_10080262
1275 Ga0207641_10285187
1276 Ga0207648_10000147
1277 Ga0207648_10001747
1278 Ga0207648_10009037
1279 Ga0207648_10021914
1280 Ga0207648_10031746
1281 Ga0207676_10018969
1282 Ga0207676_10082500
1283 Ga0207676_10094693
1284 Ga0207676_10175515
1285 Ga0207674_10000087
1286 Ga0207674_10057820
1287 Ga0207674_10100062
1288 Ga0207674_10160539
1289 Ga0207674_10425313
1290 Ga0207675_100000104
1291 Ga0207675_100002235
1292 Ga0207675_100002568
1293 Ga0207675_100013954
1294 Ga0207675_100037279
1295 Ga0207683_10001658
1296 Ga0207683_10003538
1297 Ga0207683_10019000
1298 Ga0207683_10019643
1299 Ga0207683_10035297
1300 Ga0207683_10068894
1301 Ga0207683_10253495
1302 Ga0207698_10007203
1303 Ga0207698_10007803
1304 Ga0207698_10200105
1305 Ga0209967_1007519
1306 Ga0210000_1002184
1307 Ga0209995_1001965
1308 Ga0209971_1003062
1309 Ga0209971_1030819
1310 Ga0209966_1003381
1311 Ga0209813_10005381
1312 Ga0209974_10009308
1313 Ga0209974_10029722
1314 Ga0207428_10001497
1315 Ga0207428_10028609
1316 Ga0207428_10191473
1317 Ga0268266_10084572
1318 Ga0268266_10098258
1319 Ga0268265_10000585
1320 Ga0268265_10003236
1321 Ga0268264_10000502
1322 Ga0268264_10000841
1323 Ga0268264_10032247
1324 Ga0268264_10085927
1325 Ga0265318_10006938
1326 Ga0265318_10008411
1327 Ga0265318_10018978
1328 Ga0307517_10000176
1329 Ga0307511_10000406
1330 Ga0265330_10002871
1331 Ga0265330_10010064
1332 Ga0265330_10037577
1333 Ga0265330_10054849
1334 Ga0265330_10071491
1335 Ga0265332_10001715
1336 Ga0265332_10003617
1337 Ga0265332_10011002
1338 Ga0265328_10003814
1339 Ga0265328_10004977
1340 Ga0265328_10016185
1341 Ga0265320_10033090
1342 Ga0265320_10051209
1343 Ga0265340_10045959
1344 Ga0265339_10005071
1345 Ga0265339_10023849
1346 Ga0265331_10000950
1347 Ga0265331_10001580
1348 Ga0265331_10018071
1349 Ga0265331_10046595
1350 Ga0265327_10049877
1351 Ga0265316_10090817
1352 Ga0265316_10107320
1353 Ga0265316_10252496
1354 Ga0307408_100176701
1355 Ga0265314_10000944
1356 Ga0265314_10002120
1357 Ga0265314_10025076
1358 Ga0265314_10147586
1359 Ga0265342_10043345
1360 Ga0265342_10112531
1361 Ga0307516_10016176
1362 Ga0307405_10084006
1363 Ga0307412_10007382
1364 Ga0307412_10068533
1365 Ga0307409_100129160
1366 Ga0307416_100338574
1367 Ga0307411_10108586
1368 Ga0307415_100045311
1369 Ga0307507_10035743
1370 Ga0316215_1005883
1371 Ga0373926_0006819
1372 Ga0373926_0015987
1373 Ga0373940_0002720
1374 Ga0373944_0001070
1375 Ga0373951_0002482
1376 Ga0373923_0002741
1377 Ga0373923_0049245
1378 Ga0373932_0006989
1379 Ga0373936_0001313
1380 Ga0373939_0008099
1381 Ga0373941_0077807
1382 Ga0373953_0039086
1383 Ga0373943_0007686
1384 Ga0373943_0014860
1385 Ga0373946_0012979
1386 Ga0373955_0044677
1387 Ga0373955_0192420
1388 Ga0373942_0015844
1389 Ga0373961_0004221
1390 Ga0373961_0036378
1391 Ga0373924_0012721
1392 Ga0373924_0087059
1393 Ga0373931_0000648
1394 Ga0373931_0003825
1395 Ga0373931_0115054
1396 Ga0373931_0135850
1397 Ga0373931_0212671
1398 Ga0373931_0284429
1399 Ga0373935_0009070
1400 Ga0373935_0056270
1401 Ga0373935_0089751
1402 Ga0373927_0006578
1403 Ga0373927_0020169
1404 Ga0373927_0153916
1405 Ga0373933_0024557
1406 Ga0373933_0107678
1407 Ga0373937_0371638
1408 Ga0373925_0070882
1409 Ga0436364_0665986
1410 Ga0436361_0949329
1411 Ga0439453_0005926
1412 Ga0451807_2429854
1413 Ga0451853_0755636
1414 Ga0439441_000557
1415 Ga0439443_001685
1416 Ga0439444_0000089
1417 Ga0451577_0199510
1418 Ga0466969_0032003
1419 Ga0466966_0058217
1420 Ga0466964_0094264
1421 Ga0451576_0002895
1422 Ga0451576_0007504
1423 Ga0451576_0183606
1424 Ga0451576_0604389
1425 Ga0495592_0177283
1426 Ga0495603_0039546
1427 Ga0495603_0250910
1428 Ga0495653_0190808
1429 Ga0495580_0003547
1430 Ga0495580_0018667
1431 Ga0495580_0029141
1432 Ga0495605_0035312
1433 Ga0495639_0015974
1434 Ga0495639_0089454
1435 Ga0495664_0034175
1436 Ga0495664_0044120
1437 Ga0495594_0097190
1438 Ga0495594_0190994
1439 Ga0495608_0039081
1440 Ga0495630_0087685
1441 Ga0495666_0009438
1442 Ga0495642_0123703
1443 Ga0495665_0017723
1444 Ga0495640_0203627
1445 Ga0495586_0008118
1446 Ga0495586_0045476
1447 Ga0495586_0070212
1448 Ga0495587_0125342
1449 Ga0495598_0033552
1450 Ga0495621_0042398
1451 Ga0495645_0149345
1452 Ga0495634_0036574
1453 Ga0495634_0181220
1454 Ga0495659_0076218
1455 Ga0495647_0001109
1456 Ga0495658_0008854
1457 Ga0495658_0067017
1458 Ga0495658_0108327
1459 Ga0495658_0218196
1460 Ga0495669_0047570
1461 Ga0495624_0012563
1462 Ga0495672_0092299
1463 Ga0495676_0028397
1464 Ga0495680_0208838
1465 Ga0495684_0038679
1466 Ga0495684_0142252
1467 Ga0496100_0419093
1468 Ga0496106_0169016
1469 Ga0496106_0243555
1470 Ga0496108_0066177
1471 Ga0496108_0076946
1472 Ga0496108_0269046
1473 Ga0496109_0582129
1474 Ga0496110_0054162
1475 Ga0496114_0034560
1476 Ga0496117_0034853
1477 Ga0496118_0008904
1478 Ga0496119_0159128
1479 Ga0496121_0029453
1480 Ga0496121_0081021
1481 Ga0496125_0160174
1482 Ga0501034_0010412
1483 Ga0501034_0015436
1484 Ga0501036_0162752
1485 Ga0501037_0209708
1486 Ga0501040_0054002
1487 Ga0501043_0086051
1488 Ga0501046_0020732
1489 Ga0501048_0136320
1490 Ga0501067_0125063
1491 Ga0501071_0034584
1492 Ga0501071_0162031
1493 Ga0501075_0004582
1494 Ga0501076_0128653
1495 Ga0501076_0194979
1496 Ga0501077_0006482
1497 Ga0501079_0150616
1498 Ga0501080_0046986
1499 Ga0501081_0051215
1500 Ga0501081_0235216
1501 Ga0501045_0072853
1502 nmdc:mga03683_465_c1
1503 nmdc:mga03n38_2017_c1
1504 nmdc:mga00v17_17429_c1
1505 nmdc:mga0yw44_103938_c1
1506 nmdc:mga0yw44_129678_c1
1507 nmdc:mga06z11_16393_c1
1508 nmdc:mga06z11_32502_c1
1509 nmdc:mga04h51_1861_c1
1510 nmdc:mga07m45_44603_c1
1511 nmdc:mga07m45_7149_c1
1512 nmdc:mga05p37_1105_c1
1513 nmdc:mga05p37_588_c1
1514 nmdc:mga09592_10327_c1
1515 nmdc:mga09592_116_c1
1516 nmdc:mga09592_144964_c1
1517 nmdc:mga09592_148_c1
1518 nmdc:mga0qj67_194826_c1
1519 nmdc:mga0qj67_254125_c1
1520 nmdc:mga0qj67_28505_c1
1521 nmdc:mga0qj67_84419_c1
1522 nmdc:mga0qj67_9213_c1
1523 nmdc:mga06r32_3824_c1
1524 nmdc:mga06r32_53244_c1
1525 nmdc:mga08y16_2516_c1
1526 nmdc:mga08y16_27016_c1
1527 nmdc:mga08y16_2868_c1
1528 nmdc:mga08y16_367676_c1
1529 nmdc:mga08y16_73996_c1
1530 nmdc:mga0n895_119294_c1
1531 nmdc:mga0n895_137092_c1
1532 nmdc:mga0n895_289370_c1
1533 nmdc:mga0n895_38902_c1
1534 nmdc:mga0n895_8012_c1
1535 nmdc:mga0rr50_223426_c1
1536 nmdc:mga0rr50_914_c1
1537 nmdc:mga08x19_10127_c1
1538 nmdc:mga08x19_157043_c1
1539 nmdc:mga08x19_1704_c1
1540 nmdc:mga08x19_172657_c1
1541 nmdc:mga08x19_1736_c1
1542 nmdc:mga08x19_21031_c1
1543 nmdc:mga08x19_2271_c1
1544 nmdc:mga08x19_314048_c1
1545 nmdc:mga0a205_145680_c2
1546 nmdc:mga0a205_187_c1
1547 nmdc:mga0a205_8299_c1
1548 nmdc:mga0sz30_1320_c1
1549 nmdc:mga0sz30_29028_c1
1550 Ga0500635_0067675
1551 Ga0500646_0014874
1552 Ga0500647_0032726
1553 Ga0500583_0026855
1554 Ga0500651_0042141
1555 Ga0500566_0002691
1556 Ga0500641_0005691
1557 Ga0500572_000826
1558 Ga0500608_024851
1559 Ga0500614_000593
1560 Ga0500559_0017158
1561 Ga0500568_0001478
1562 Ga0500603_000871
1563 Ga0500604_0001808
1564 Ga0500630_013830
1565 Ga0500639_015947
1566 Ga0500636_0136003
1567 Ga0500637_0091649
1568 Ga0500596_004009
1569 Ga0500601_002418
1570 Ga0501084_0273722
1571 Ga0501082_0027120
1572 Ga0466962_0018747
1573 2513887923
1574 2922388448
1575 2928086740
1576 2945986602

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

72

347

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.9624 31 321
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9623 28 325
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9591 27 325
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9591 28 325
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9559 27 325
ID Description Score Start End Superfamily
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9292 26 325 3.40.190.150
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9256 127 245 3.40.190.10
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9249 27 325 3.40.190.150
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9239 26 325 3.40.190.150
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9217 127 250 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4Q7VFW8-F1-model_v4 Tripartite-type tricarboxylate transporter receptor subunit TctC 0.983 27 318
AF-A0A315DNU9-F1-model_v4 LacI family transcriptional regulator 0.9827 27 325
AF-A0A536SS29-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9821 35 325
AF-A0A4Q3GQ29-F1-model_v4 deleted 0.9817 27 323
AF-A0A1W1Z5P6-F1-model_v4 Tripartite-type tricarboxylate transporter, receptor component TctC 0.9817 27 325

Map