F480901
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 789 | 330 | 1578 | 253 |
Family's Representative Sequence
| Representative Sequence | 3300013102|Ga0157371_10009448|Ga0157371_100094482 |
| Length | 282 |
| Sequence | VGGKRRPEDQAGADVSAPEVRPAAAQTTNMTTVAKAVAWRSIHNFLTNPAFLVPALVFPLFFFVSFAGGLSAIENVPGFDFPTGYTAFQFVFVLLQSAAFGGVFTGFGIARDFETGFARRYLLAASNRSGIVAGYAIAALIRAFVTWTVLTTVALVAGMNIGGSGGEIVALYALAILVNVAATMWSAGVAMRVRSIQGGPLMQFPTFLILFLAPVYVPLTLLSGWIHAVASINPVTALLEAGRGFISGDPTVVVLAFAIAFALPLIFALWARSGLRRAEAAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 62 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 98 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 99 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 157 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 158 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 159 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 160 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 161 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 162 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 164 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 165 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 167 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 168 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 169 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 170 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 171 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 172 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 173 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 174 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 176 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 177 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 179 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 180 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 181 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 182 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 183 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 184 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 185 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 186 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 187 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 188 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 189 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 190 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 191 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 192 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 256 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 257 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 258 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 259 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 260 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 261 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 264 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 265 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 266 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 267 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 268 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 269 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 270 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 271 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 272 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 273 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 274 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 275 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 276 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 277 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 278 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 324 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 325 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 326 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 327 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 330 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.75 |
| Metatranscriptomes | 0.25 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.63 |
| Nodule | 0 |
| Rhizoplane | 12.55 |
| Rhizosphere | 83.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157371_10009448 | 3300013102 | Bacteria | 7674 |
| 2 | Ga0070658_10040957 | 3300005327 | Bacteria | 3737 |
| 3 | Ga0070658_10144314 | 3300005327 | Bacteria | 1990 |
| 4 | Ga0070683_100000793 | 3300005329 | Bacteria | 23313 |
| 5 | Ga0070683_100001714 | 3300005329 | Bacteria | 17052 |
| 6 | Ga0070683_100013143 | 3300005329 | Bacteria | 7208 |
| 7 | Ga0070683_100043303 | 3300005329 | Bacteria | 4149 |
| 8 | Ga0070683_100108431 | 3300005329 | Bacteria | 2619 |
| 9 | Ga0070670_100044615 | 3300005331 | Bacteria | 3812 |
| 10 | Ga0070677_10000003 | 3300005333 | Bacteria | 81204 |
| 11 | Ga0068869_100342532 | 3300005334 | Bacteria | 1217 |
| 12 | Ga0070666_10003293 | 3300005335 | Bacteria | 9802 |
| 13 | Ga0070666_10085528 | 3300005335 | Bacteria | 2160 |
| 14 | Ga0070680_100065864 | 3300005336 | Bacteria | 2969 |
| 15 | Ga0070680_100220226 | 3300005336 | Bacteria | 1602 |
| 16 | Ga0070682_100000080 | 3300005337 | Bacteria | 85683 |
| 17 | Ga0070682_100000102 | 3300005337 | Bacteria | 76457 |
| 18 | Ga0070682_100172182 | 3300005337 | Bacteria | 1505 |
| 19 | Ga0070682_100255499 | 3300005337 | Bacteria | 1265 |
| 20 | Ga0068868_100000095 | 3300005338 | Bacteria | 54537 |
| 21 | Ga0070660_100078256 | 3300005339 | Bacteria | 2593 |
| 22 | Ga0070689_100072593 | 3300005340 | Bacteria | 2690 |
| 23 | Ga0070689_100505377 | 3300005340 | Unclassified | 1036 |
| 24 | Ga0070691_10000054 | 3300005341 | Bacteria | 32149 |
| 25 | Ga0070691_10008984 | 3300005341 | Bacteria | 4572 |
| 26 | Ga0070661_100000005 | 3300005344 | Bacteria | 220455 |
| 27 | Ga0070668_100008119 | 3300005347 | Bacteria | 7797 |
| 28 | Ga0070668_100148348 | 3300005347 | Bacteria | 1895 |
| 29 | Ga0070675_100000058 | 3300005354 | Bacteria | 66874 |
| 30 | Ga0070674_100000003 | 3300005356 | Bacteria | 258221 |
| 31 | Ga0070674_100000020 | 3300005356 | Bacteria | 88217 |
| 32 | Ga0070674_100023772 | 3300005356 | Bacteria | 3971 |
| 33 | Ga0070673_100013844 | 3300005364 | Bacteria | 5598 |
| 34 | Ga0070688_100000333 | 3300005365 | Bacteria | 24059 |
| 35 | Ga0070688_100002793 | 3300005365 | Bacteria | 8872 |
| 36 | Ga0070688_100396145 | 3300005365 | Bacteria | 1021 |
| 37 | Ga0070688_100486515 | 3300005365 | Bacteria | 928 |
| 38 | Ga0070667_100007958 | 3300005367 | Bacteria | 8790 |
| 39 | Ga0070667_100223189 | 3300005367 | Unclassified | 1678 |
| 40 | Ga0070714_100000243 | 3300005435 | Bacteria | 42598 |
| 41 | Ga0070714_100199562 | 3300005435 | Bacteria | 1829 |
| 42 | Ga0070713_100000138 | 3300005436 | Bacteria | 48026 |
| 43 | Ga0070713_100015507 | 3300005436 | Bacteria | 5702 |
| 44 | Ga0070713_100374734 | 3300005436 | Bacteria | 1325 |
| 45 | Ga0070710_10017787 | 3300005437 | Bacteria | 3646 |
| 46 | Ga0070710_10164320 | 3300005437 | Bacteria | 1379 |
| 47 | Ga0070710_10245347 | 3300005437 | Bacteria | 1149 |
| 48 | Ga0070711_100008345 | 3300005439 | Bacteria | 6342 |
| 49 | Ga0070711_100043089 | 3300005439 | Bacteria | 3055 |
| 50 | Ga0070711_100252527 | 3300005439 | Bacteria | 1384 |
| 51 | Ga0070694_100034592 | 3300005444 | Bacteria | 3333 |
| 52 | Ga0070708_100025820 | 3300005445 | Bacteria | 5023 |
| 53 | Ga0070663_100085873 | 3300005455 | Bacteria | 2323 |
| 54 | Ga0070678_100004162 | 3300005456 | Bacteria | 8159 |
| 55 | Ga0070662_100000363 | 3300005457 | Bacteria | 27116 |
| 56 | Ga0070681_10005901 | 3300005458 | Bacteria | 11857 |
| 57 | Ga0070681_10034745 | 3300005458 | Bacteria | 5062 |
| 58 | Ga0070681_10040325 | 3300005458 | Bacteria | 4678 |
| 59 | Ga0070681_10084225 | 3300005458 | Bacteria | 3132 |
| 60 | Ga0068867_100000179 | 3300005459 | Bacteria | 41694 |
| 61 | Ga0070685_10000293 | 3300005466 | Bacteria | 31562 |
| 62 | Ga0070706_100099695 | 3300005467 | Bacteria | 2699 |
| 63 | Ga0070698_100008430 | 3300005471 | Bacteria | 11141 |
| 64 | Ga0070699_100691064 | 3300005518 | Unclassified | 932 |
| 65 | Ga0070679_100000537 | 3300005530 | Bacteria | 32232 |
| 66 | Ga0070679_100048185 | 3300005530 | Bacteria | 4246 |
| 67 | Ga0070679_100126520 | 3300005530 | Bacteria | 2538 |
| 68 | Ga0070684_100003511 | 3300005535 | Bacteria | 11778 |
| 69 | Ga0070684_100163543 | 3300005535 | Bacteria | 2020 |
| 70 | Ga0070684_100223350 | 3300005535 | Unclassified | 1719 |
| 71 | Ga0070684_100424822 | 3300005535 | Bacteria | 1227 |
| 72 | Ga0070697_100114251 | 3300005536 | Bacteria | 2253 |
| 73 | Ga0068853_100002080 | 3300005539 | Bacteria | 14840 |
| 74 | Ga0068853_100483223 | 3300005539 | Bacteria | 1168 |
| 75 | Ga0070672_100000004 | 3300005543 | Bacteria | 129970 |
| 76 | Ga0070696_100084495 | 3300005546 | Bacteria | 2252 |
| 77 | Ga0070696_100577520 | 3300005546 | Bacteria | 904 |
| 78 | Ga0070693_100000833 | 3300005547 | Bacteria | 13687 |
| 79 | Ga0070693_100016010 | 3300005547 | Bacteria | 3874 |
| 80 | Ga0070693_100146483 | 3300005547 | Unclassified | 1492 |
| 81 | Ga0070665_100000159 | 3300005548 | Bacteria | 122613 |
| 82 | Ga0070665_100002822 | 3300005548 | Bacteria | 18813 |
| 83 | Ga0070665_100219516 | 3300005548 | Unclassified | 1901 |
| 84 | Ga0070665_100579522 | 3300005548 | Bacteria | 1135 |
| 85 | Ga0070665_100685624 | 3300005548 | Bacteria | 1038 |
| 86 | Ga0070665_100765282 | 3300005548 | Unclassified | 979 |
| 87 | Ga0068855_100060814 | 3300005563 | Bacteria | 4415 |
| 88 | Ga0068854_100006423 | 3300005578 | Bacteria | 7476 |
| 89 | Ga0068854_100012863 | 3300005578 | Bacteria | 5482 |
| 90 | Ga0068854_100324349 | 3300005578 | Bacteria | 1253 |
| 91 | Ga0068854_100327648 | 3300005578 | Bacteria | 1247 |
| 92 | Ga0068854_100589319 | 3300005578 | Unclassified | 948 |
| 93 | Ga0068856_100018421 | 3300005614 | Bacteria | 6768 |
| 94 | Ga0068856_100023907 | 3300005614 | Bacteria | 5944 |
| 95 | Ga0068856_100074113 | 3300005614 | Bacteria | 3370 |
| 96 | Ga0068856_100074564 | 3300005614 | Bacteria | 3360 |
| 97 | Ga0068856_100395026 | 3300005614 | Bacteria | 1402 |
| 98 | Ga0068852_100000012 | 3300005616 | Bacteria | 140734 |
| 99 | Ga0068859_100808532 | 3300005617 | Unclassified | 1025 |
| 100 | Ga0068864_100026224 | 3300005618 | Bacteria | 4914 |
| 101 | Ga0068866_10000002 | 3300005718 | Bacteria | 394090 |
| 102 | Ga0068866_10000019 | 3300005718 | Bacteria | 64778 |
| 103 | Ga0068851_10002153 | 3300005834 | Bacteria | 8660 |
| 104 | Ga0068870_10066166 | 3300005840 | Bacteria | 1957 |
| 105 | Ga0068863_100000032 | 3300005841 | Bacteria | 172402 |
| 106 | Ga0068858_100000049 | 3300005842 | Bacteria | 122693 |
| 107 | Ga0068858_100006307 | 3300005842 | Bacteria | 11549 |
| 108 | Ga0068858_100049480 | 3300005842 | Bacteria | 3893 |
| 109 | Ga0068858_100239891 | 3300005842 | Bacteria | 1720 |
| 110 | Ga0068862_100002825 | 3300005844 | Bacteria | 15226 |
| 111 | Ga0081455_10009498 | 3300005937 | Bacteria | 9996 |
| 112 | Ga0081538_10081463 | 3300005981 | Bacteria | 1721 |
| 113 | Ga0081540_1000006 | 3300005983 | Bacteria | 208724 |
| 114 | Ga0081539_10000473 | 3300005985 | Bacteria | 85174 |
| 115 | Ga0081539_10002242 | 3300005985 | Bacteria | 28126 |
| 116 | Ga0081539_10119888 | 3300005985 | Bacteria | 1309 |
| 117 | Ga0070717_10075881 | 3300006028 | Unclassified | 2812 |
| 118 | Ga0075363_100299345 | 3300006048 | Bacteria | 933 |
| 119 | Ga0070715_10000012 | 3300006163 | Bacteria | 173731 |
| 120 | Ga0070715_10064513 | 3300006163 | Bacteria | 1618 |
| 121 | Ga0070715_10103001 | 3300006163 | Bacteria | 1335 |
| 122 | Ga0070715_10228858 | 3300006163 | Bacteria | 960 |
| 123 | Ga0070716_100146589 | 3300006173 | Bacteria | 1513 |
| 124 | Ga0070712_100000777 | 3300006175 | Bacteria | 18846 |
| 125 | Ga0070712_100100853 | 3300006175 | Bacteria | 2134 |
| 126 | Ga0070712_100404597 | 3300006175 | Bacteria | 1128 |
| 127 | Ga0075428_100021945 | 3300006844 | Bacteria | 7071 |
| 128 | Ga0075430_100027536 | 3300006846 | Bacteria | 4828 |
| 129 | Ga0075431_100036575 | 3300006847 | Bacteria | 5057 |
| 130 | Ga0075431_100065779 | 3300006847 | Bacteria | 3743 |
| 131 | Ga0075433_10027284 | 3300006852 | Bacteria | 4841 |
| 132 | Ga0075433_10037865 | 3300006852 | Bacteria | 4162 |
| 133 | Ga0075433_10075025 | 3300006852 | Bacteria | 2976 |
| 134 | Ga0075433_10243789 | 3300006852 | Bacteria | 1595 |
| 135 | Ga0075434_100007144 | 3300006871 | Bacteria | 10320 |
| 136 | Ga0075434_100191835 | 3300006871 | Bacteria | 2064 |
| 137 | Ga0075434_100370372 | 3300006871 | Unclassified | 1453 |
| 138 | Ga0075436_100043703 | 3300006914 | Bacteria | 3089 |
| 139 | Ga0075436_100047633 | 3300006914 | Bacteria | 2956 |
| 140 | Ga0075436_100219177 | 3300006914 | Bacteria | 1350 |
| 141 | Ga0075436_100448620 | 3300006914 | Bacteria | 939 |
| 142 | Ga0097620_100808453 | 3300006931 | Unclassified | 1025 |
| 143 | Ga0075435_100007136 | 3300007076 | Bacteria | 7939 |
| 144 | Ga0075435_100037060 | 3300007076 | Bacteria | 3881 |
| 145 | Ga0075435_100171504 | 3300007076 | Bacteria | 1830 |
| 146 | Ga0075435_100447733 | 3300007076 | Bacteria | 1113 |
| 147 | Ga0111539_10057025 | 3300009094 | Bacteria | 4640 |
| 148 | Ga0111539_10242677 | 3300009094 | Bacteria | 2097 |
| 149 | Ga0111539_10331616 | 3300009094 | Bacteria | 1771 |
| 150 | Ga0105245_10000056 | 3300009098 | Bacteria | 124109 |
| 151 | Ga0105245_10000290 | 3300009098 | Bacteria | 47991 |
| 152 | Ga0105245_10001677 | 3300009098 | Bacteria | 20157 |
| 153 | Ga0105245_10003691 | 3300009098 | Bacteria | 13667 |
| 154 | Ga0105245_10359013 | 3300009098 | Bacteria | 1446 |
| 155 | Ga0105247_10000202 | 3300009101 | Bacteria | 58345 |
| 156 | Ga0105247_10109935 | 3300009101 | Bacteria | 1773 |
| 157 | Ga0105247_10272342 | 3300009101 | Bacteria | 1165 |
| 158 | Ga0105247_10409945 | 3300009101 | Unclassified | 968 |
| 159 | Ga0114129_10001119 | 3300009147 | Bacteria | 35383 |
| 160 | Ga0114129_10013663 | 3300009147 | Bacteria | 11570 |
| 161 | Ga0114129_10029165 | 3300009147 | Bacteria | 7817 |
| 162 | Ga0114129_10467965 | 3300009147 | Unclassified | 1651 |
| 163 | Ga0105243_10285969 | 3300009148 | Bacteria | 1488 |
| 164 | Ga0105243_10345353 | 3300009148 | Bacteria | 1365 |
| 165 | Ga0105241_10081860 | 3300009174 | Bacteria | 2530 |
| 166 | Ga0105241_10189587 | 3300009174 | Bacteria | 1711 |
| 167 | Ga0105242_10016975 | 3300009176 | Bacteria | 5667 |
| 168 | Ga0105242_10051900 | 3300009176 | Bacteria | 3344 |
| 169 | Ga0105242_10068974 | 3300009176 | Bacteria | 2927 |
| 170 | Ga0105248_10000032 | 3300009177 | Bacteria | 201114 |
| 171 | Ga0105238_10670934 | 3300009551 | Bacteria | 1048 |
| 172 | Ga0105249_10000073 | 3300009553 | Bacteria | 145660 |
| 173 | Ga0105249_10020406 | 3300009553 | Bacteria | 5925 |
| 174 | Ga0157370_10005853 | 3300013104 | Bacteria | 13734 |
| 175 | Ga0157370_10007615 | 3300013104 | Bacteria | 11762 |
| 176 | Ga0157369_10000099 | 3300013105 | Bacteria | 120032 |
| 177 | Ga0157369_10068684 | 3300013105 | Bacteria | 3807 |
| 178 | Ga0157374_10571808 | 3300013296 | Bacteria | 1139 |
| 179 | Ga0157378_10010497 | 3300013297 | Bacteria | 8091 |
| 180 | Ga0157378_10016775 | 3300013297 | Bacteria | 6418 |
| 181 | Ga0157378_10074162 | 3300013297 | Bacteria | 3061 |
| 182 | Ga0157378_10461332 | 3300013297 | Bacteria | 1262 |
| 183 | Ga0163162_10081431 | 3300013306 | Bacteria | 3308 |
| 184 | Ga0157372_10365990 | 3300013307 | Bacteria | 1680 |
| 185 | Ga0157375_10000707 | 3300013308 | Bacteria | 29426 |
| 186 | Ga0157375_10539542 | 3300013308 | Bacteria | 1329 |
| 187 | Ga0163163_10119806 | 3300014325 | Bacteria | 2665 |
| 188 | Ga0157380_10000219 | 3300014326 | Bacteria | 34156 |
| 189 | Ga0157380_10003655 | 3300014326 | Bacteria | 10579 |
| 190 | Ga0157380_10052162 | 3300014326 | Bacteria | 3237 |
| 191 | Ga0157379_10040899 | 3300014968 | Bacteria | 4138 |
| 192 | Ga0157379_10346924 | 3300014968 | Bacteria | 1358 |
| 193 | Ga0157376_10121124 | 3300014969 | Bacteria | 2319 |
| 194 | Ga0157376_10643395 | 3300014969 | Bacteria | 1060 |
| 195 | Ga0157376_10767140 | 3300014969 | Unclassified | 975 |
| 196 | Ga0163161_10000058 | 3300017792 | Bacteria | 114035 |
| 197 | Ga0163161_10014924 | 3300017792 | Bacteria | 5411 |
| 198 | Ga0206356_10933897 | 3300020070 | Unclassified | 1875 |
| 199 | Ga0206353_11051550 | 3300020082 | Bacteria | 1498 |
| 200 | Ga0213876_10098728 | 3300021384 | Unclassified | 1548 |
| 201 | Ga0213875_10000468 | 3300021388 | Bacteria | 34648 |
| 202 | Ga0207656_10032149 | 3300025321 | Bacteria | 2178 |
| 203 | Ga0207682_10000052 | 3300025893 | Bacteria | 49191 |
| 204 | Ga0207692_10040358 | 3300025898 | Bacteria | 2303 |
| 205 | Ga0207692_10052115 | 3300025898 | Unclassified | 2078 |
| 206 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 207 | Ga0207642_10000003 | 3300025899 | Bacteria | 650651 |
| 208 | Ga0207642_10000004 | 3300025899 | Bacteria | 407822 |
| 209 | Ga0207642_10000017 | 3300025899 | Bacteria | 64774 |
| 210 | Ga0207710_10000369 | 3300025900 | Bacteria | 31539 |
| 211 | Ga0207680_10002430 | 3300025903 | Bacteria | 8684 |
| 212 | Ga0207680_10166999 | 3300025903 | Bacteria | 1480 |
| 213 | Ga0207685_10112614 | 3300025905 | Bacteria | 1182 |
| 214 | Ga0207705_10049419 | 3300025909 | Bacteria | 3027 |
| 215 | Ga0207705_10094717 | 3300025909 | Bacteria | 2190 |
| 216 | Ga0207654_10079660 | 3300025911 | Bacteria | 1968 |
| 217 | Ga0207654_10121817 | 3300025911 | Bacteria | 1639 |
| 218 | Ga0207707_10092802 | 3300025912 | Bacteria | 2637 |
| 219 | Ga0207707_10122363 | 3300025912 | Bacteria | 2275 |
| 220 | Ga0207695_10560577 | 3300025913 | Bacteria | 1024 |
| 221 | Ga0207693_10008860 | 3300025915 | Bacteria | 8219 |
| 222 | Ga0207693_10043531 | 3300025915 | Bacteria | 3532 |
| 223 | Ga0207693_10053039 | 3300025915 | Bacteria | 3181 |
| 224 | Ga0207693_10093503 | 3300025915 | Bacteria | 2357 |
| 225 | Ga0207693_10245339 | 3300025915 | Bacteria | 1406 |
| 226 | Ga0207663_10031736 | 3300025916 | Bacteria | 3130 |
| 227 | Ga0207663_10099496 | 3300025916 | Bacteria | 1949 |
| 228 | Ga0207660_10067787 | 3300025917 | Bacteria | 2586 |
| 229 | Ga0207660_10123298 | 3300025917 | Bacteria | 1965 |
| 230 | Ga0207660_10311908 | 3300025917 | Bacteria | 1254 |
| 231 | Ga0207657_10082913 | 3300025919 | Bacteria | 2690 |
| 232 | Ga0207649_10000005 | 3300025920 | Bacteria | 356179 |
| 233 | Ga0207652_10000631 | 3300025921 | Bacteria | 34868 |
| 234 | Ga0207646_10060981 | 3300025922 | Bacteria | 3367 |
| 235 | Ga0207646_10315543 | 3300025922 | Bacteria | 1412 |
| 236 | Ga0207650_10025386 | 3300025925 | Bacteria | 4221 |
| 237 | Ga0207659_10000020 | 3300025926 | Bacteria | 151552 |
| 238 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 239 | Ga0207687_10000012 | 3300025927 | Bacteria | 370729 |
| 240 | Ga0207687_10000646 | 3300025927 | Bacteria | 23464 |
| 241 | Ga0207687_10000970 | 3300025927 | Bacteria | 19492 |
| 242 | Ga0207687_10084136 | 3300025927 | Bacteria | 2305 |
| 243 | Ga0207700_10000008 | 3300025928 | Bacteria | 341717 |
| 244 | Ga0207700_10000016 | 3300025928 | Bacteria | 202434 |
| 245 | Ga0207700_10086661 | 3300025928 | Bacteria | 2461 |
| 246 | Ga0207700_10207811 | 3300025928 | Unclassified | 1653 |
| 247 | Ga0207700_10397504 | 3300025928 | Bacteria | 1207 |
| 248 | Ga0207664_10000013 | 3300025929 | Bacteria | 260716 |
| 249 | Ga0207664_10110118 | 3300025929 | Bacteria | 2289 |
| 250 | Ga0207664_10154503 | 3300025929 | Bacteria | 1952 |
| 251 | Ga0207644_10123003 | 3300025931 | Bacteria | 1978 |
| 252 | Ga0207690_10008415 | 3300025932 | Bacteria | 6126 |
| 253 | Ga0207706_10000006 | 3300025933 | Bacteria | 216994 |
| 254 | Ga0207686_10006424 | 3300025934 | Bacteria | 6327 |
| 255 | Ga0207686_10024357 | 3300025934 | Bacteria | 3507 |
| 256 | Ga0207670_10259273 | 3300025936 | Unclassified | 1347 |
| 257 | Ga0207669_10000016 | 3300025937 | Bacteria | 124532 |
| 258 | Ga0207669_10000036 | 3300025937 | Bacteria | 78568 |
| 259 | Ga0207665_10020351 | 3300025939 | Bacteria | 4359 |
| 260 | Ga0207665_10182274 | 3300025939 | Bacteria | 1521 |
| 261 | Ga0207691_10000020 | 3300025940 | Bacteria | 133465 |
| 262 | Ga0207711_10000020 | 3300025941 | Bacteria | 363325 |
| 263 | Ga0207689_10264829 | 3300025942 | Bacteria | 1422 |
| 264 | Ga0207661_10001238 | 3300025944 | Bacteria | 17056 |
| 265 | Ga0207661_10001949 | 3300025944 | Bacteria | 14185 |
| 266 | Ga0207661_10008416 | 3300025944 | Bacteria | 7373 |
| 267 | Ga0207661_10030009 | 3300025944 | Bacteria | 4182 |
| 268 | Ga0207661_10062095 | 3300025944 | Bacteria | 3022 |
| 269 | Ga0207679_10025975 | 3300025945 | Bacteria | 4034 |
| 270 | Ga0207667_10611451 | 3300025949 | Unclassified | 1098 |
| 271 | Ga0207651_10008445 | 3300025960 | Bacteria | 5563 |
| 272 | Ga0207651_10041883 | 3300025960 | Bacteria | 3044 |
| 273 | Ga0207712_10000003 | 3300025961 | Bacteria | 615314 |
| 274 | Ga0207712_10235415 | 3300025961 | Bacteria | 1472 |
| 275 | Ga0207712_10331831 | 3300025961 | Bacteria | 1258 |
| 276 | Ga0207668_10044746 | 3300025972 | Bacteria | 3014 |
| 277 | Ga0207640_10000285 | 3300025981 | Bacteria | 33957 |
| 278 | Ga0207640_10002518 | 3300025981 | Bacteria | 9823 |
| 279 | Ga0207640_10168323 | 3300025981 | Bacteria | 1630 |
| 280 | Ga0207677_10001435 | 3300026023 | Bacteria | 12669 |
| 281 | Ga0207703_10000053 | 3300026035 | Bacteria | 143924 |
| 282 | Ga0207703_10000067 | 3300026035 | Bacteria | 125623 |
| 283 | Ga0207703_10073601 | 3300026035 | Bacteria | 2827 |
| 284 | Ga0207703_10109546 | 3300026035 | Bacteria | 2354 |
| 285 | Ga0207639_10001671 | 3300026041 | Bacteria | 14960 |
| 286 | Ga0207678_10063204 | 3300026067 | Bacteria | 3181 |
| 287 | Ga0207708_10514108 | 3300026075 | Bacteria | 1005 |
| 288 | Ga0207702_10000016 | 3300026078 | Bacteria | 226633 |
| 289 | Ga0207702_10003815 | 3300026078 | Bacteria | 13603 |
| 290 | Ga0207702_10060671 | 3300026078 | Bacteria | 3224 |
| 291 | Ga0207702_10192541 | 3300026078 | Bacteria | 1885 |
| 292 | Ga0207641_10000071 | 3300026088 | Bacteria | 151812 |
| 293 | Ga0207641_10008529 | 3300026088 | Bacteria | 8466 |
| 294 | Ga0207648_10000228 | 3300026089 | Bacteria | 60032 |
| 295 | Ga0207676_10194051 | 3300026095 | Bacteria | 1789 |
| 296 | Ga0207674_10275630 | 3300026116 | Bacteria | 1630 |
| 297 | Ga0207683_10006404 | 3300026121 | Bacteria | 10083 |
| 298 | Ga0207683_10297110 | 3300026121 | Bacteria | 1477 |
| 299 | Ga0207698_10000012 | 3300026142 | Bacteria | 260061 |
| 300 | Ga0207428_10076863 | 3300027907 | Bacteria | 2614 |
| 301 | Ga0207428_10181623 | 3300027907 | Bacteria | 1589 |
| 302 | Ga0268266_10000023 | 3300028379 | Bacteria | 501899 |
| 303 | Ga0268266_10000553 | 3300028379 | Bacteria | 52199 |
| 304 | Ga0268266_10002681 | 3300028379 | Bacteria | 18711 |
| 305 | Ga0268266_10513070 | 3300028379 | Unclassified | 1145 |
| 306 | Ga0268265_10011815 | 3300028380 | Bacteria | 5903 |
| 307 | Ga0268264_10007216 | 3300028381 | Bacteria | 9306 |
| 308 | Ga0265338_10058061 | 3300028800 | Bacteria | 3419 |
| 309 | Ga0307406_10536645 | 3300031901 | Unclassified | 955 |
| 310 | Ga0307415_100000648 | 3300032126 | Bacteria | 15309 |
| 311 | Ga0373926_0071554 | 3300035083 | Bacteria | 1275 |
| 312 | Ga0373944_0016363 | 3300035089 | Bacteria | 2090 |
| 313 | Ga0373945_0004604 | 3300035116 | Bacteria | 4390 |
| 314 | Ga0373943_0000090 | 3300035170 | Bacteria | 33196 |
| 315 | Ga0373943_0007558 | 3300035170 | Bacteria | 4881 |
| 316 | Ga0373946_0007850 | 3300035171 | Bacteria | 3916 |
| 317 | Ga0373946_0013315 | 3300035171 | Bacteria | 3091 |
| 318 | Ga0373927_0074898 | 3300035695 | Bacteria | 2192 |
| 319 | Ga0373947_0000266 | 3300035725 | Bacteria | 29609 |
| 320 | Ga0373947_0001538 | 3300035725 | Bacteria | 14146 |
| 321 | Ga0373925_0001866 | 3300037068 | Bacteria | 17533 |
| 322 | Ga0373925_0215933 | 3300037068 | Bacteria | 1529 |
| 323 | Ga0395899_0001477 | 3300037312 | Bacteria | 20007 |
| 324 | Ga0395899_0107394 | 3300037312 | Bacteria | 2009 |
| 325 | Ga0395900_0014343 | 3300037418 | Bacteria | 8091 |
| 326 | Ga0395900_0186535 | 3300037418 | Unclassified | 2105 |
| 327 | Ga0395900_0252312 | 3300037418 | Bacteria | 1765 |
| 328 | Ga0395898_0019644 | 3300037466 | Bacteria | 6872 |
| 329 | Ga0395898_0036814 | 3300037466 | Bacteria | 4856 |
| 330 | Ga0395905_0020023 | 3300037471 | Bacteria | 6339 |
| 331 | Ga0395905_0025788 | 3300037471 | Bacteria | 5542 |
| 332 | Ga0395905_0186330 | 3300037471 | Bacteria | 1948 |
| 333 | Ga0436364_0309695 | 3300037853 | Bacteria | 1589 |
| 334 | Ga0436364_1031907 | 3300037853 | Bacteria | 102112 |
| 335 | Ga0436364_1133006 | 3300037853 | Bacteria | 892 |
| 336 | Ga0395901_0000856 | 3300038443 | Bacteria | 33489 |
| 337 | Ga0395901_0011639 | 3300038443 | Bacteria | 8909 |
| 338 | Ga0395901_0024834 | 3300038443 | Bacteria | 6151 |
| 339 | Ga0395901_0153898 | 3300038443 | Unclassified | 2415 |
| 340 | Ga0436365_0328253 | 3300039437 | Unclassified | 1843 |
| 341 | Ga0436365_0329149 | 3300039437 | Bacteria | 12480 |
| 342 | Ga0436362_0533856 | 3300039453 | Unclassified | 1238 |
| 343 | Ga0451789_0027790 | 3300041443 | Bacteria | 2341 |
| 344 | Ga0451791_1163314 | 3300041451 | Bacteria | 1404 |
| 345 | Ga0451793_0300818 | 3300041452 | Bacteria | 2035 |
| 346 | Ga0451807_2280868 | 3300041486 | Bacteria | 2010 |
| 347 | Ga0451853_0384465 | 3300041512 | Bacteria | 6514 |
| 348 | Ga0451853_1991254 | 3300041512 | Unclassified | 1239 |
| 349 | Ga0451853_2081083 | 3300041512 | Bacteria | 1700 |
| 350 | Ga0439431_0025850 | 3300041997 | Bacteria | 1436 |
| 351 | Ga0439433_0006334 | 3300041999 | Bacteria | 2547 |
| 352 | Ga0439462_0004636 | 3300042015 | Bacteria | 3362 |
| 353 | Ga0439446_0000927 | 3300042156 | Bacteria | 6339 |
| 354 | Ga0466966_0208199 | 3300044684 | Unclassified | 1182 |
| 355 | Ga0466961_0338983 | 3300044693 | Bacteria | 916 |
| 356 | Ga0466961_0350564 | 3300044693 | Bacteria | 898 |
| 357 | Ga0466963_0000070 | 3300044694 | Bacteria | 35676 |
| 358 | Ga0466963_0079187 | 3300044694 | Bacteria | 2223 |
| 359 | Ga0466963_0207075 | 3300044694 | Unclassified | 1372 |
| 360 | Ga0466964_0174965 | 3300044706 | Bacteria | 1014 |
| 361 | Ga0466957_0003681 | 3300044842 | Bacteria | 8460 |
| 362 | Ga0466960_0226618 | 3300044901 | Bacteria | 1030 |
| 363 | Ga0466959_0252775 | 3300045049 | Bacteria | 1215 |
| 364 | Ga0466958_0112295 | 3300045836 | Bacteria | 1701 |
| 365 | Ga0466967_0000046 | 3300045976 | Bacteria | 43911 |
| 366 | Ga0466967_0261967 | 3300045976 | Bacteria | 1654 |
| 367 | Ga0466967_0738415 | 3300045976 | Bacteria | 976 |
| 368 | Ga0495592_0000621 | 3300046454 | Bacteria | 24971 |
| 369 | Ga0495592_0164449 | 3300046454 | Unclassified | 1524 |
| 370 | Ga0495592_0213460 | 3300046454 | Bacteria | 1295 |
| 371 | Ga0495603_0001473 | 3300046455 | Bacteria | 13710 |
| 372 | Ga0495603_0003021 | 3300046455 | Bacteria | 9967 |
| 373 | Ga0495603_0077607 | 3300046455 | Bacteria | 1948 |
| 374 | Ga0495629_0002088 | 3300046459 | Bacteria | 15500 |
| 375 | Ga0495629_0005520 | 3300046459 | Bacteria | 9437 |
| 376 | Ga0495629_0007647 | 3300046459 | Bacteria | 7957 |
| 377 | Ga0495629_0019746 | 3300046459 | Bacteria | 4810 |
| 378 | Ga0495629_0088279 | 3300046459 | Bacteria | 2163 |
| 379 | Ga0495629_0129808 | 3300046459 | Bacteria | 1755 |
| 380 | Ga0495638_0009398 | 3300046460 | Bacteria | 6872 |
| 381 | Ga0495641_0003321 | 3300046461 | Bacteria | 12113 |
| 382 | Ga0495641_0005538 | 3300046461 | Bacteria | 8483 |
| 383 | Ga0495641_0015104 | 3300046461 | Bacteria | 4144 |
| 384 | Ga0495641_0082409 | 3300046461 | Bacteria | 1440 |
| 385 | Ga0495651_0004887 | 3300046462 | Bacteria | 10251 |
| 386 | Ga0495651_0024849 | 3300046462 | Bacteria | 4661 |
| 387 | Ga0495651_0192164 | 3300046462 | Bacteria | 1436 |
| 388 | Ga0495653_0010741 | 3300046463 | Bacteria | 7498 |
| 389 | Ga0495653_0032140 | 3300046463 | Bacteria | 4170 |
| 390 | Ga0495653_0099929 | 3300046463 | Bacteria | 2104 |
| 391 | Ga0495580_0022051 | 3300046472 | Bacteria | 4693 |
| 392 | Ga0495582_0000005 | 3300046473 | Bacteria | 156170 |
| 393 | Ga0495582_0000801 | 3300046473 | Bacteria | 17458 |
| 394 | Ga0495582_0037719 | 3300046473 | Bacteria | 2658 |
| 395 | Ga0495582_0113618 | 3300046473 | Bacteria | 1522 |
| 396 | Ga0495582_0116493 | 3300046473 | Bacteria | 1503 |
| 397 | Ga0495639_0002081 | 3300046475 | Bacteria | 8857 |
| 398 | Ga0495639_0058412 | 3300046475 | Bacteria | 1764 |
| 399 | Ga0495639_0138624 | 3300046475 | Bacteria | 1168 |
| 400 | Ga0495662_0000022 | 3300046476 | Bacteria | 54342 |
| 401 | Ga0495662_0000984 | 3300046476 | Bacteria | 13942 |
| 402 | Ga0495664_0000012 | 3300046477 | Bacteria | 226118 |
| 403 | Ga0495664_0052360 | 3300046477 | Bacteria | 2425 |
| 404 | Ga0495584_0163949 | 3300046491 | Bacteria | 1130 |
| 405 | Ga0495584_0225562 | 3300046491 | Bacteria | 952 |
| 406 | Ga0495594_0000013 | 3300046499 | Bacteria | 103201 |
| 407 | Ga0495594_0000157 | 3300046499 | Bacteria | 32522 |
| 408 | Ga0495594_0027397 | 3300046499 | Bacteria | 3071 |
| 409 | Ga0495606_0000211 | 3300046507 | Bacteria | 103386 |
| 410 | Ga0495608_0000031 | 3300046511 | Bacteria | 145255 |
| 411 | Ga0495608_0000406 | 3300046511 | Bacteria | 30178 |
| 412 | Ga0495608_0010782 | 3300046511 | Bacteria | 6370 |
| 413 | Ga0495608_0019149 | 3300046511 | Bacteria | 4717 |
| 414 | Ga0495608_0107463 | 3300046511 | Bacteria | 1795 |
| 415 | Ga0495608_0265658 | 3300046511 | Unclassified | 1067 |
| 416 | Ga0495618_0000068 | 3300046514 | Bacteria | 74614 |
| 417 | Ga0495620_0000315 | 3300046515 | Bacteria | 34463 |
| 418 | Ga0495628_0000323 | 3300046516 | Bacteria | 43212 |
| 419 | Ga0495628_0036648 | 3300046516 | Bacteria | 3935 |
| 420 | Ga0495628_0039578 | 3300046516 | Bacteria | 3770 |
| 421 | Ga0495628_0069964 | 3300046516 | Bacteria | 2736 |
| 422 | Ga0495628_0073094 | 3300046516 | Bacteria | 2672 |
| 423 | Ga0495628_0172280 | 3300046516 | Bacteria | 1641 |
| 424 | Ga0495628_0188052 | 3300046516 | Bacteria | 1560 |
| 425 | Ga0495628_0247640 | 3300046516 | Bacteria | 1331 |
| 426 | Ga0495630_0000018 | 3300046517 | Bacteria | 186064 |
| 427 | Ga0495630_0005899 | 3300046517 | Bacteria | 8659 |
| 428 | Ga0495630_0020993 | 3300046517 | Bacteria | 4821 |
| 429 | Ga0495630_0064242 | 3300046517 | Bacteria | 2757 |
| 430 | Ga0495630_0318177 | 3300046517 | Bacteria | 1189 |
| 431 | Ga0495644_0000954 | 3300046523 | Bacteria | 11954 |
| 432 | Ga0495666_0016257 | 3300046526 | Bacteria | 3706 |
| 433 | Ga0495666_0047579 | 3300046526 | Bacteria | 2066 |
| 434 | Ga0495652_0000003 | 3300046529 | Bacteria | 597094 |
| 435 | Ga0495652_0147980 | 3300046529 | Bacteria | 1838 |
| 436 | Ga0495652_0168788 | 3300046529 | Bacteria | 1691 |
| 437 | Ga0495652_0317936 | 3300046529 | Bacteria | 1126 |
| 438 | Ga0495665_0000215 | 3300046531 | Bacteria | 29257 |
| 439 | Ga0495640_0001520 | 3300046533 | Bacteria | 18268 |
| 440 | Ga0495640_0047817 | 3300046533 | Bacteria | 2959 |
| 441 | Ga0495640_0114688 | 3300046533 | Bacteria | 1756 |
| 442 | Ga0495640_0121419 | 3300046533 | Bacteria | 1698 |
| 443 | Ga0495586_0000527 | 3300046535 | Bacteria | 22292 |
| 444 | Ga0495586_0031050 | 3300046535 | Bacteria | 2860 |
| 445 | Ga0495587_0001970 | 3300046536 | Bacteria | 13697 |
| 446 | Ga0495587_0054503 | 3300046536 | Bacteria | 2356 |
| 447 | Ga0495587_0208484 | 3300046536 | Bacteria | 1104 |
| 448 | Ga0495587_0265446 | 3300046536 | Bacteria | 964 |
| 449 | Ga0495621_0002083 | 3300046539 | Bacteria | 5297 |
| 450 | Ga0495645_0061651 | 3300046543 | Bacteria | 2717 |
| 451 | Ga0495645_0205758 | 3300046543 | Bacteria | 1332 |
| 452 | Ga0495622_0000014 | 3300046557 | Bacteria | 182142 |
| 453 | Ga0495667_0004189 | 3300046559 | Bacteria | 9713 |
| 454 | Ga0495667_0064213 | 3300046559 | Bacteria | 2401 |
| 455 | Ga0495667_0082143 | 3300046559 | Bacteria | 2094 |
| 456 | Ga0495656_0078619 | 3300046615 | Bacteria | 1483 |
| 457 | Ga0495668_0031957 | 3300046616 | Bacteria | 2964 |
| 458 | Ga0495634_0000024 | 3300046642 | Bacteria | 116230 |
| 459 | Ga0495634_0026899 | 3300046642 | Bacteria | 4010 |
| 460 | Ga0495625_0000029 | 3300046660 | Bacteria | 244646 |
| 461 | Ga0495625_0257297 | 3300046660 | Unclassified | 1131 |
| 462 | Ga0495635_0000009 | 3300046663 | Bacteria | 259024 |
| 463 | Ga0495635_0037192 | 3300046663 | Bacteria | 3370 |
| 464 | Ga0495635_0076575 | 3300046663 | Bacteria | 2292 |
| 465 | Ga0495588_0000198 | 3300046674 | Bacteria | 60956 |
| 466 | Ga0495588_0010582 | 3300046674 | Bacteria | 4296 |
| 467 | Ga0495588_0020730 | 3300046674 | Bacteria | 3235 |
| 468 | Ga0495657_0000024 | 3300046675 | Bacteria | 145255 |
| 469 | Ga0495657_0004915 | 3300046675 | Bacteria | 10635 |
| 470 | Ga0495657_0079758 | 3300046675 | Bacteria | 2119 |
| 471 | Ga0495657_0181127 | 3300046675 | Unclassified | 1293 |
| 472 | Ga0495657_0213593 | 3300046675 | Unclassified | 1172 |
| 473 | Ga0495599_0031412 | 3300046678 | Bacteria | 3333 |
| 474 | Ga0495599_0193580 | 3300046678 | Bacteria | 1250 |
| 475 | Ga0495623_0109015 | 3300046679 | Unclassified | 1680 |
| 476 | Ga0495646_0021230 | 3300046680 | Bacteria | 4105 |
| 477 | Ga0495647_0000037 | 3300046681 | Bacteria | 42482 |
| 478 | Ga0495647_0000293 | 3300046681 | Bacteria | 13969 |
| 479 | Ga0495647_0002559 | 3300046681 | Bacteria | 5763 |
| 480 | Ga0495647_0004495 | 3300046681 | Bacteria | 4534 |
| 481 | Ga0495647_0026359 | 3300046681 | Bacteria | 2129 |
| 482 | Ga0495658_0000019 | 3300046683 | Bacteria | 91606 |
| 483 | Ga0495658_0001056 | 3300046683 | Bacteria | 14543 |
| 484 | Ga0495658_0002471 | 3300046683 | Bacteria | 9310 |
| 485 | Ga0495658_0228514 | 3300046683 | Bacteria | 1166 |
| 486 | Ga0495669_0000562 | 3300046684 | Bacteria | 16446 |
| 487 | Ga0495613_0000249 | 3300046689 | Bacteria | 50975 |
| 488 | Ga0495613_0000309 | 3300046689 | Bacteria | 44163 |
| 489 | Ga0495613_0003963 | 3300046689 | Bacteria | 11089 |
| 490 | Ga0495613_0057044 | 3300046689 | Bacteria | 2867 |
| 491 | Ga0495613_0318942 | 3300046689 | Bacteria | 1073 |
| 492 | Ga0495624_0000028 | 3300046690 | Bacteria | 93474 |
| 493 | Ga0495624_0012694 | 3300046690 | Bacteria | 5754 |
| 494 | Ga0495624_0066552 | 3300046690 | Bacteria | 2249 |
| 495 | Ga0495670_0017148 | 3300046691 | Bacteria | 3563 |
| 496 | Ga0495670_0122393 | 3300046691 | Bacteria | 1352 |
| 497 | Ga0495649_0015920 | 3300046694 | Bacteria | 4271 |
| 498 | Ga0495600_0003314 | 3300046809 | Bacteria | 9451 |
| 499 | Ga0495600_0010047 | 3300046809 | Bacteria | 5867 |
| 500 | Ga0495600_0041968 | 3300046809 | Bacteria | 2982 |
| 501 | Ga0495600_0043498 | 3300046809 | Bacteria | 2929 |
| 502 | Ga0495581_0038723 | 3300047315 | Bacteria | 2759 |
| 503 | Ga0495581_0069066 | 3300047315 | Bacteria | 2043 |
| 504 | Ga0495581_0222299 | 3300047315 | Bacteria | 1104 |
| 505 | Ga0495604_0000056 | 3300047317 | Bacteria | 100110 |
| 506 | Ga0495604_0000190 | 3300047317 | Bacteria | 55090 |
| 507 | Ga0495604_0003466 | 3300047317 | Bacteria | 12570 |
| 508 | Ga0495604_0006459 | 3300047317 | Bacteria | 9300 |
| 509 | Ga0495604_0049521 | 3300047317 | Bacteria | 3264 |
| 510 | Ga0495604_0087982 | 3300047317 | Bacteria | 2312 |
| 511 | Ga0495674_0000042 | 3300047319 | Bacteria | 94820 |
| 512 | Ga0495674_0007533 | 3300047319 | Bacteria | 10396 |
| 513 | Ga0495674_0034205 | 3300047319 | Bacteria | 4596 |
| 514 | Ga0495674_0124032 | 3300047319 | Bacteria | 2180 |
| 515 | Ga0495674_0137328 | 3300047319 | Bacteria | 2056 |
| 516 | Ga0495676_0000646 | 3300047321 | Bacteria | 28924 |
| 517 | Ga0495676_0001001 | 3300047321 | Bacteria | 23792 |
| 518 | Ga0495676_0005236 | 3300047321 | Bacteria | 11864 |
| 519 | Ga0495676_0014558 | 3300047321 | Bacteria | 7037 |
| 520 | Ga0495676_0038393 | 3300047321 | Bacteria | 3977 |
| 521 | Ga0495676_0138941 | 3300047321 | Bacteria | 1743 |
| 522 | Ga0495680_0000023 | 3300047322 | Bacteria | 116444 |
| 523 | Ga0495680_0000421 | 3300047322 | Bacteria | 47432 |
| 524 | Ga0495680_0003583 | 3300047322 | Bacteria | 15204 |
| 525 | Ga0495680_0005597 | 3300047322 | Bacteria | 11781 |
| 526 | Ga0495680_0013355 | 3300047322 | Bacteria | 7170 |
| 527 | Ga0495680_0061884 | 3300047322 | Bacteria | 2878 |
| 528 | Ga0495675_0000209 | 3300047444 | Bacteria | 42691 |
| 529 | Ga0495685_019250 | 3300047447 | Bacteria | 2345 |
| 530 | Ga0495673_0029664 | 3300047469 | Bacteria | 2579 |
| 531 | Ga0495684_0006596 | 3300047471 | Bacteria | 9002 |
| 532 | Ga0495684_0010019 | 3300047471 | Bacteria | 7327 |
| 533 | Ga0495593_0001317 | 3300047673 | Bacteria | 14550 |
| 534 | Ga0495593_0053085 | 3300047673 | Bacteria | 2140 |
| 535 | Ga0495602_0000228 | 3300048088 | Bacteria | 52649 |
| 536 | Ga0495602_0169060 | 3300048088 | Bacteria | 1698 |
| 537 | Ga0495602_0178666 | 3300048088 | Unclassified | 1640 |
| 538 | Ga0495614_0004961 | 3300048089 | Bacteria | 6006 |
| 539 | Ga0496100_0000038 | 3300048903 | Bacteria | 94110 |
| 540 | Ga0496100_0000116 | 3300048903 | Bacteria | 45781 |
| 541 | Ga0496100_0010105 | 3300048903 | Bacteria | 5332 |
| 542 | Ga0496100_0041580 | 3300048903 | Bacteria | 2931 |
| 543 | Ga0496100_0161150 | 3300048903 | Bacteria | 1608 |
| 544 | Ga0496101_0000003 | 3300048904 | Bacteria | 406565 |
| 545 | Ga0496101_0000010 | 3300048904 | Bacteria | 281990 |
| 546 | Ga0496101_0008537 | 3300048904 | Bacteria | 6696 |
| 547 | Ga0496101_0008544 | 3300048904 | Bacteria | 6691 |
| 548 | Ga0496101_0346868 | 3300048904 | Bacteria | 1166 |
| 549 | Ga0496102_0000027 | 3300048905 | Bacteria | 225466 |
| 550 | Ga0496102_0027850 | 3300048905 | Bacteria | 5047 |
| 551 | Ga0496102_0051948 | 3300048905 | Bacteria | 3734 |
| 552 | Ga0496102_0058954 | 3300048905 | Bacteria | 3509 |
| 553 | Ga0496102_0077064 | 3300048905 | Bacteria | 3068 |
| 554 | Ga0496102_0130941 | 3300048905 | Bacteria | 2348 |
| 555 | Ga0496102_0136102 | 3300048905 | Bacteria | 2302 |
| 556 | Ga0496102_0177626 | 3300048905 | Unclassified | 2005 |
| 557 | Ga0496103_0000155 | 3300048906 | Bacteria | 72091 |
| 558 | Ga0496103_0021878 | 3300048906 | Bacteria | 3848 |
| 559 | Ga0496103_0036541 | 3300048906 | Bacteria | 3008 |
| 560 | Ga0496103_0129794 | 3300048906 | Unclassified | 1609 |
| 561 | Ga0496103_0205169 | 3300048906 | Bacteria | 1268 |
| 562 | Ga0496103_0252865 | 3300048906 | Bacteria | 1134 |
| 563 | Ga0496104_0000002 | 3300048907 | Bacteria | 686017 |
| 564 | Ga0496104_0000003 | 3300048907 | Bacteria | 669219 |
| 565 | Ga0496104_0000576 | 3300048907 | Bacteria | 31360 |
| 566 | Ga0496104_0001562 | 3300048907 | Bacteria | 19718 |
| 567 | Ga0496104_0007540 | 3300048907 | Bacteria | 9621 |
| 568 | Ga0496104_0017150 | 3300048907 | Bacteria | 6588 |
| 569 | Ga0496104_0020399 | 3300048907 | Bacteria | 6074 |
| 570 | Ga0496104_0061986 | 3300048907 | Bacteria | 3545 |
| 571 | Ga0496104_0310719 | 3300048907 | Bacteria | 1489 |
| 572 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 573 | Ga0496105_0000008 | 3300048908 | Bacteria | 335652 |
| 574 | Ga0496105_0000313 | 3300048908 | Bacteria | 31795 |
| 575 | Ga0496105_0001400 | 3300048908 | Bacteria | 16942 |
| 576 | Ga0496105_0008480 | 3300048908 | Bacteria | 7986 |
| 577 | Ga0496105_0009052 | 3300048908 | Bacteria | 7768 |
| 578 | Ga0496106_0000013 | 3300048909 | Bacteria | 202263 |
| 579 | Ga0496106_0000018 | 3300048909 | Bacteria | 175028 |
| 580 | Ga0496106_0000177 | 3300048909 | Bacteria | 45808 |
| 581 | Ga0496106_0011021 | 3300048909 | Bacteria | 6683 |
| 582 | Ga0496106_0062443 | 3300048909 | Bacteria | 2828 |
| 583 | Ga0496107_0000032 | 3300048910 | Bacteria | 99848 |
| 584 | Ga0496107_0000081 | 3300048910 | Bacteria | 45824 |
| 585 | Ga0496107_0120084 | 3300048910 | Bacteria | 1936 |
| 586 | Ga0496107_0378038 | 3300048910 | Unclassified | 1054 |
| 587 | Ga0496108_0000002 | 3300048911 | Bacteria | 700890 |
| 588 | Ga0496108_0000045 | 3300048911 | Bacteria | 137416 |
| 589 | Ga0496108_0000631 | 3300048911 | Bacteria | 27478 |
| 590 | Ga0496108_0008008 | 3300048911 | Bacteria | 8574 |
| 591 | Ga0496108_0017482 | 3300048911 | Bacteria | 5867 |
| 592 | Ga0496108_0112187 | 3300048911 | Bacteria | 2332 |
| 593 | Ga0496109_0000001 | 3300048912 | Bacteria | 700852 |
| 594 | Ga0496109_0000028 | 3300048912 | Bacteria | 168138 |
| 595 | Ga0496109_0000032 | 3300048912 | Bacteria | 162984 |
| 596 | Ga0496109_0000085 | 3300048912 | Bacteria | 95437 |
| 597 | Ga0496109_0001462 | 3300048912 | Bacteria | 19603 |
| 598 | Ga0496109_0001613 | 3300048912 | Bacteria | 18839 |
| 599 | Ga0496109_0125780 | 3300048912 | Bacteria | 2390 |
| 600 | Ga0496109_0228633 | 3300048912 | Bacteria | 1750 |
| 601 | Ga0496109_0302392 | 3300048912 | Bacteria | 1508 |
| 602 | Ga0496109_0327012 | 3300048912 | Bacteria | 1447 |
| 603 | Ga0496110_0000033 | 3300048913 | Bacteria | 65539 |
| 604 | Ga0496110_0001879 | 3300048913 | Bacteria | 15501 |
| 605 | Ga0496110_0017994 | 3300048913 | Bacteria | 5919 |
| 606 | Ga0496110_0024705 | 3300048913 | Bacteria | 5124 |
| 607 | Ga0496110_0126042 | 3300048913 | Bacteria | 2310 |
| 608 | Ga0496110_0129358 | 3300048913 | Bacteria | 2279 |
| 609 | Ga0496111_0000560 | 3300048914 | Bacteria | 19358 |
| 610 | Ga0496111_0001844 | 3300048914 | Bacteria | 12488 |
| 611 | Ga0496111_0005648 | 3300048914 | Bacteria | 8051 |
| 612 | Ga0496111_0125039 | 3300048914 | Bacteria | 1901 |
| 613 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 614 | Ga0496112_0001813 | 3300048915 | Bacteria | 16810 |
| 615 | Ga0496112_0016767 | 3300048915 | Bacteria | 6870 |
| 616 | Ga0496112_0017217 | 3300048915 | Bacteria | 6785 |
| 617 | Ga0496112_0026222 | 3300048915 | Bacteria | 5605 |
| 618 | Ga0496112_0051598 | 3300048915 | Bacteria | 4034 |
| 619 | Ga0496113_0000007 | 3300048916 | Bacteria | 95884 |
| 620 | Ga0496113_0000240 | 3300048916 | Bacteria | 25763 |
| 621 | Ga0496113_0002837 | 3300048916 | Bacteria | 10193 |
| 622 | Ga0496113_0024435 | 3300048916 | Bacteria | 4295 |
| 623 | Ga0496113_0161716 | 3300048916 | Unclassified | 1770 |
| 624 | Ga0496113_0290973 | 3300048916 | Bacteria | 1307 |
| 625 | Ga0496114_0009484 | 3300048917 | Bacteria | 7727 |
| 626 | Ga0496114_0009498 | 3300048917 | Bacteria | 7719 |
| 627 | Ga0496114_0490237 | 3300048917 | Bacteria | 1087 |
| 628 | Ga0496114_0587247 | 3300048917 | Unclassified | 983 |
| 629 | Ga0496115_0000020 | 3300048918 | Bacteria | 171995 |
| 630 | Ga0496115_0005222 | 3300048918 | Bacteria | 9440 |
| 631 | Ga0496115_0006918 | 3300048918 | Bacteria | 8332 |
| 632 | Ga0496115_0008785 | 3300048918 | Bacteria | 7489 |
| 633 | Ga0496115_0105769 | 3300048918 | Bacteria | 2310 |
| 634 | Ga0496116_0000780 | 3300048919 | Bacteria | 40473 |
| 635 | Ga0496117_0015033 | 3300048920 | Bacteria | 6631 |
| 636 | Ga0496118_0000174 | 3300048921 | Bacteria | 115950 |
| 637 | Ga0496118_0088493 | 3300048921 | Bacteria | 2142 |
| 638 | Ga0496119_0004215 | 3300048922 | Bacteria | 14439 |
| 639 | Ga0496119_0021993 | 3300048922 | Bacteria | 4585 |
| 640 | Ga0496119_0026047 | 3300048922 | Bacteria | 4066 |
| 641 | Ga0496120_0053857 | 3300048923 | Bacteria | 2284 |
| 642 | Ga0496121_0005891 | 3300048924 | Bacteria | 15512 |
| 643 | Ga0496121_0016585 | 3300048924 | Bacteria | 7593 |
| 644 | Ga0496121_0082402 | 3300048924 | Unclassified | 2543 |
| 645 | Ga0496121_0086517 | 3300048924 | Bacteria | 2463 |
| 646 | Ga0496124_0115152 | 3300048927 | Bacteria | 2158 |
| 647 | Ga0496124_0116434 | 3300048927 | Bacteria | 2143 |
| 648 | Ga0496125_0013994 | 3300048928 | Bacteria | 7845 |
| 649 | Ga0496125_0289604 | 3300048928 | Unclassified | 1009 |
| 650 | Ga0496126_0029904 | 3300048929 | Bacteria | 5170 |
| 651 | Ga0496126_0099256 | 3300048929 | Bacteria | 2550 |
| 652 | Ga0501031_0000445 | 3300049568 | Bacteria | 23857 |
| 653 | Ga0501031_0065331 | 3300049568 | Bacteria | 2370 |
| 654 | Ga0501032_0000876 | 3300049569 | Bacteria | 24428 |
| 655 | Ga0501033_0000294 | 3300049570 | Bacteria | 47989 |
| 656 | Ga0501034_0065214 | 3300049571 | Bacteria | 3654 |
| 657 | Ga0501036_0005562 | 3300049572 | Bacteria | 10223 |
| 658 | Ga0501036_0135273 | 3300049572 | Bacteria | 2080 |
| 659 | Ga0501037_0000378 | 3300049573 | Bacteria | 37014 |
| 660 | Ga0501037_0005716 | 3300049573 | Bacteria | 9075 |
| 661 | Ga0501038_0000087 | 3300049574 | Bacteria | 78741 |
| 662 | Ga0501039_0001020 | 3300049575 | Bacteria | 20404 |
| 663 | Ga0501039_0003991 | 3300049575 | Bacteria | 11095 |
| 664 | Ga0501039_0107426 | 3300049575 | Bacteria | 2180 |
| 665 | Ga0501040_0000007 | 3300049576 | Bacteria | 90368 |
| 666 | Ga0501040_0000954 | 3300049576 | Bacteria | 18260 |
| 667 | Ga0501040_0017844 | 3300049576 | Bacteria | 4711 |
| 668 | Ga0501040_0058110 | 3300049576 | Bacteria | 2656 |
| 669 | Ga0501040_0710312 | 3300049576 | Bacteria | 727 |
| 670 | Ga0501041_0000005 | 3300049577 | Bacteria | 75426 |
| 671 | Ga0501041_0001093 | 3300049577 | Bacteria | 14842 |
| 672 | Ga0501041_0040749 | 3300049577 | Bacteria | 2820 |
| 673 | Ga0501042_0003216 | 3300049578 | Bacteria | 10205 |
| 674 | Ga0501042_0003964 | 3300049578 | Bacteria | 9370 |
| 675 | Ga0501043_0000998 | 3300049579 | Bacteria | 24892 |
| 676 | Ga0501043_0093174 | 3300049579 | Bacteria | 2368 |
| 677 | Ga0501043_0371369 | 3300049579 | Bacteria | 1084 |
| 678 | Ga0501046_0001278 | 3300049580 | Bacteria | 24362 |
| 679 | Ga0501046_0028136 | 3300049580 | Bacteria | 4580 |
| 680 | Ga0501046_0053780 | 3300049580 | Bacteria | 3169 |
| 681 | Ga0501047_0000592 | 3300049581 | Bacteria | 38584 |
| 682 | Ga0501047_0009620 | 3300049581 | Bacteria | 9141 |
| 683 | Ga0501048_0000018 | 3300049582 | Bacteria | 72234 |
| 684 | Ga0501048_0001926 | 3300049582 | Bacteria | 15771 |
| 685 | Ga0501048_0071099 | 3300049582 | Bacteria | 2457 |
| 686 | Ga0501048_0184813 | 3300049582 | Bacteria | 1477 |
| 687 | Ga0501067_0009559 | 3300049583 | Bacteria | 5372 |
| 688 | Ga0501068_0000134 | 3300049584 | Bacteria | 33588 |
| 689 | Ga0501068_0011873 | 3300049584 | Bacteria | 4924 |
| 690 | Ga0501068_0018498 | 3300049584 | Bacteria | 4035 |
| 691 | Ga0501069_0000426 | 3300049585 | Bacteria | 19142 |
| 692 | Ga0501069_0077986 | 3300049585 | Bacteria | 1863 |
| 693 | Ga0501070_0004569 | 3300049586 | Bacteria | 11863 |
| 694 | Ga0501070_0005855 | 3300049586 | Bacteria | 10483 |
| 695 | Ga0501070_0009281 | 3300049586 | Bacteria | 8320 |
| 696 | Ga0501071_0000005 | 3300049587 | Bacteria | 78747 |
| 697 | Ga0501071_0001995 | 3300049587 | Bacteria | 12192 |
| 698 | Ga0501071_0014797 | 3300049587 | Bacteria | 5343 |
| 699 | Ga0501072_0000269 | 3300049588 | Bacteria | 37902 |
| 700 | Ga0501072_0004831 | 3300049588 | Bacteria | 10263 |
| 701 | Ga0501072_0092159 | 3300049588 | Bacteria | 2406 |
| 702 | Ga0501072_0152356 | 3300049588 | Bacteria | 1843 |
| 703 | Ga0501073_0001327 | 3300049589 | Bacteria | 18226 |
| 704 | Ga0501073_0033451 | 3300049589 | Bacteria | 3660 |
| 705 | Ga0501073_0178046 | 3300049589 | Unclassified | 1472 |
| 706 | Ga0501074_0001138 | 3300049590 | Bacteria | 17415 |
| 707 | Ga0501074_0044985 | 3300049590 | Bacteria | 3194 |
| 708 | Ga0501074_0075006 | 3300049590 | Bacteria | 2428 |
| 709 | Ga0501074_0261410 | 3300049590 | Bacteria | 1230 |
| 710 | Ga0501075_0000009 | 3300049591 | Bacteria | 97052 |
| 711 | Ga0501075_0000193 | 3300049591 | Bacteria | 31987 |
| 712 | Ga0501075_0099979 | 3300049591 | Bacteria | 2203 |
| 713 | Ga0501075_0114929 | 3300049591 | Bacteria | 2046 |
| 714 | Ga0501076_0000028 | 3300049592 | Bacteria | 76828 |
| 715 | Ga0501076_0001292 | 3300049592 | Bacteria | 16692 |
| 716 | Ga0501076_0090419 | 3300049592 | Bacteria | 2462 |
| 717 | Ga0501076_0187905 | 3300049592 | Bacteria | 1686 |
| 718 | Ga0501077_0000006 | 3300049593 | Bacteria | 119936 |
| 719 | Ga0501077_0001176 | 3300049593 | Bacteria | 15828 |
| 720 | Ga0501077_0112680 | 3300049593 | Bacteria | 1724 |
| 721 | Ga0501079_0000881 | 3300049741 | Bacteria | 20585 |
| 722 | Ga0501079_0025921 | 3300049741 | Bacteria | 4497 |
| 723 | Ga0501079_0171082 | 3300049741 | Bacteria | 1694 |
| 724 | Ga0501079_0255159 | 3300049741 | Bacteria | 1371 |
| 725 | Ga0501080_0000626 | 3300049742 | Bacteria | 28026 |
| 726 | Ga0501080_0032292 | 3300049742 | Bacteria | 4881 |
| 727 | Ga0501081_0000003 | 3300049743 | Bacteria | 97558 |
| 728 | Ga0501081_0000159 | 3300049743 | Bacteria | 31036 |
| 729 | Ga0501081_0145654 | 3300049743 | Bacteria | 1699 |
| 730 | Ga0501083_0001673 | 3300049744 | Bacteria | 15132 |
| 731 | Ga0501083_0008047 | 3300049744 | Bacteria | 7457 |
| 732 | Ga0501083_0021756 | 3300049744 | Bacteria | 4454 |
| 733 | Ga0501083_0372292 | 3300049744 | Bacteria | 929 |
| 734 | Ga0501035_0000175 | 3300049822 | Bacteria | 78747 |
| 735 | Ga0501044_0006303 | 3300049823 | Bacteria | 13113 |
| 736 | Ga0501044_0065287 | 3300049823 | Bacteria | 3712 |
| 737 | Ga0501045_0000009 | 3300049824 | Bacteria | 75255 |
| 738 | Ga0501045_0002161 | 3300049824 | Bacteria | 13314 |
| 739 | Ga0501045_0075570 | 3300049824 | Bacteria | 2481 |
| 740 | Ga0501045_0653959 | 3300049824 | Bacteria | 777 |
| 741 | nmdc:mga05p37_62567_c1 | 3300050507 | Bacteria | 4580 |
| 742 | nmdc:mga05p37_8447_c1 | 3300050507 | Bacteria | 12180 |
| 743 | nmdc:mga06r32_504525_c1 | 3300050510 | Unclassified | 1186 |
| 744 | nmdc:mga08y16_287973_c1 | 3300050511 | Bacteria | 1694 |
| 745 | nmdc:mga08y16_55458_c1 | 3300050511 | Bacteria | 4141 |
| 746 | nmdc:mga08y16_567673_c1 | 3300050511 | Bacteria | 1147 |
| 747 | nmdc:mga0n895_108290_c1 | 3300050512 | Bacteria | 2793 |
| 748 | nmdc:mga0n895_468709_c1 | 3300050512 | Bacteria | 1271 |
| 749 | nmdc:mga0n895_599926_c1 | 3300050512 | Bacteria | 1104 |
| 750 | nmdc:mga0rr50_148702_c1 | 3300050513 | Bacteria | 1891 |
| 751 | nmdc:mga0rr50_372931_c1 | 3300050513 | Unclassified | 1203 |
| 752 | nmdc:mga0rr50_76361_c1 | 3300050513 | Bacteria | 2572 |
| 753 | nmdc:mga08x19_198354_c1 | 3300050514 | Bacteria | 1375 |
| 754 | nmdc:mga08x19_383629_c1 | 3300050514 | Bacteria | 984 |
| 755 | nmdc:mga0a205_193953_c1 | 3300050515 | Bacteria | 1923 |
| 756 | nmdc:mga0a205_54850_c1 | 3300050515 | Bacteria | 2996 |
| 757 | nmdc:mga0a205_65733_c1 | 3300050515 | Bacteria | 3505 |
| 758 | Ga0495601_0000086 | 3300053077 | Bacteria | 50421 |
| 759 | Ga0495601_0000097 | 3300053077 | Bacteria | 48380 |
| 760 | Ga0495601_0003248 | 3300053077 | Bacteria | 9287 |
| 761 | Ga0495601_0008176 | 3300053077 | Bacteria | 6169 |
| 762 | Ga0495601_0059411 | 3300053077 | Bacteria | 2424 |
| 763 | Ga0495601_0139304 | 3300053077 | Bacteria | 1582 |
| 764 | Ga0495612_0005844 | 3300053078 | Bacteria | 5082 |
| 765 | Ga0495655_0001313 | 3300053083 | Bacteria | 3825 |
| 766 | Ga0495595_0000014 | 3300053084 | Bacteria | 145255 |
| 767 | Ga0495595_0000109 | 3300053084 | Bacteria | 37617 |
| 768 | Ga0495595_0006454 | 3300053084 | Bacteria | 4785 |
| 769 | Ga0495619_0000022 | 3300053085 | Bacteria | 184144 |
| 770 | Ga0495619_0000024 | 3300053085 | Bacteria | 180821 |
| 771 | Ga0495619_0000319 | 3300053085 | Bacteria | 33678 |
| 772 | Ga0495619_0004791 | 3300053085 | Bacteria | 8599 |
| 773 | Ga0495619_0069309 | 3300053085 | Bacteria | 2357 |
| 774 | Ga0495619_0309197 | 3300053085 | Bacteria | 1095 |
| 775 | Ga0500566_0005120 | 3300053094 | Bacteria | 7815 |
| 776 | Ga0500641_0002398 | 3300053096 | Bacteria | 6646 |
| 777 | Ga0500595_039603 | 3300053119 | Bacteria | 1524 |
| 778 | Ga0500614_004265 | 3300053123 | Bacteria | 3034 |
| 779 | Ga0501084_0001358 | 3300054114 | Bacteria | 19353 |
| 780 | Ga0501084_0005874 | 3300054114 | Bacteria | 10101 |
| 781 | Ga0501084_0065108 | 3300054114 | Bacteria | 3049 |
| 782 | Ga0501084_0396990 | 3300054114 | Bacteria | 1165 |
| 783 | Ga0501082_0000063 | 3300060353 | Bacteria | 76891 |
| 784 | Ga0501082_0001009 | 3300060353 | Bacteria | 24886 |
| 785 | Ga0501082_0237725 | 3300060353 | Bacteria | 1585 |
| 786 | Ga0466962_0049559 | 3300061719 | Bacteria | 2007 |
| 787 | Ga0530510_0000014 | 3300061734 | Bacteria | 106661 |
| 788 | Ga0530510_0001148 | 3300061734 | Bacteria | 17568 |
| 789 | Ga0530510_0079218 | 3300061734 | Bacteria | 2389 |
| 790 | Ga0157371_10009448 | |||
| 791 | Ga0070658_10040957 | |||
| 792 | Ga0070658_10144314 | |||
| 793 | Ga0070683_100000793 | |||
| 794 | Ga0070683_100001714 | |||
| 795 | Ga0070683_100013143 | |||
| 796 | Ga0070683_100043303 | |||
| 797 | Ga0070683_100108431 | |||
| 798 | Ga0070670_100044615 | |||
| 799 | Ga0070677_10000003 | |||
| 800 | Ga0068869_100342532 | |||
| 801 | Ga0070666_10003293 | |||
| 802 | Ga0070666_10085528 | |||
| 803 | Ga0070680_100065864 | |||
| 804 | Ga0070680_100220226 | |||
| 805 | Ga0070682_100000080 | |||
| 806 | Ga0070682_100000102 | |||
| 807 | Ga0070682_100172182 | |||
| 808 | Ga0070682_100255499 | |||
| 809 | Ga0068868_100000095 | |||
| 810 | Ga0070660_100078256 | |||
| 811 | Ga0070689_100072593 | |||
| 812 | Ga0070689_100505377 | |||
| 813 | Ga0070691_10000054 | |||
| 814 | Ga0070691_10008984 | |||
| 815 | Ga0070661_100000005 | |||
| 816 | Ga0070668_100008119 | |||
| 817 | Ga0070668_100148348 | |||
| 818 | Ga0070675_100000058 | |||
| 819 | Ga0070674_100000003 | |||
| 820 | Ga0070674_100000020 | |||
| 821 | Ga0070674_100023772 | |||
| 822 | Ga0070673_100013844 | |||
| 823 | Ga0070688_100000333 | |||
| 824 | Ga0070688_100002793 | |||
| 825 | Ga0070688_100396145 | |||
| 826 | Ga0070688_100486515 | |||
| 827 | Ga0070667_100007958 | |||
| 828 | Ga0070667_100223189 | |||
| 829 | Ga0070714_100000243 | |||
| 830 | Ga0070714_100199562 | |||
| 831 | Ga0070713_100000138 | |||
| 832 | Ga0070713_100015507 | |||
| 833 | Ga0070713_100374734 | |||
| 834 | Ga0070710_10017787 | |||
| 835 | Ga0070710_10164320 | |||
| 836 | Ga0070710_10245347 | |||
| 837 | Ga0070711_100008345 | |||
| 838 | Ga0070711_100043089 | |||
| 839 | Ga0070711_100252527 | |||
| 840 | Ga0070694_100034592 | |||
| 841 | Ga0070708_100025820 | |||
| 842 | Ga0070663_100085873 | |||
| 843 | Ga0070678_100004162 | |||
| 844 | Ga0070662_100000363 | |||
| 845 | Ga0070681_10005901 | |||
| 846 | Ga0070681_10034745 | |||
| 847 | Ga0070681_10040325 | |||
| 848 | Ga0070681_10084225 | |||
| 849 | Ga0068867_100000179 | |||
| 850 | Ga0070685_10000293 | |||
| 851 | Ga0070706_100099695 | |||
| 852 | Ga0070698_100008430 | |||
| 853 | Ga0070699_100691064 | |||
| 854 | Ga0070679_100000537 | |||
| 855 | Ga0070679_100048185 | |||
| 856 | Ga0070679_100126520 | |||
| 857 | Ga0070684_100003511 | |||
| 858 | Ga0070684_100163543 | |||
| 859 | Ga0070684_100223350 | |||
| 860 | Ga0070684_100424822 | |||
| 861 | Ga0070697_100114251 | |||
| 862 | Ga0068853_100002080 | |||
| 863 | Ga0068853_100483223 | |||
| 864 | Ga0070672_100000004 | |||
| 865 | Ga0070696_100084495 | |||
| 866 | Ga0070696_100577520 | |||
| 867 | Ga0070693_100000833 | |||
| 868 | Ga0070693_100016010 | |||
| 869 | Ga0070693_100146483 | |||
| 870 | Ga0070665_100000159 | |||
| 871 | Ga0070665_100002822 | |||
| 872 | Ga0070665_100219516 | |||
| 873 | Ga0070665_100579522 | |||
| 874 | Ga0070665_100685624 | |||
| 875 | Ga0070665_100765282 | |||
| 876 | Ga0068855_100060814 | |||
| 877 | Ga0068854_100006423 | |||
| 878 | Ga0068854_100012863 | |||
| 879 | Ga0068854_100324349 | |||
| 880 | Ga0068854_100327648 | |||
| 881 | Ga0068854_100589319 | |||
| 882 | Ga0068856_100018421 | |||
| 883 | Ga0068856_100023907 | |||
| 884 | Ga0068856_100074113 | |||
| 885 | Ga0068856_100074564 | |||
| 886 | Ga0068856_100395026 | |||
| 887 | Ga0068852_100000012 | |||
| 888 | Ga0068859_100808532 | |||
| 889 | Ga0068864_100026224 | |||
| 890 | Ga0068866_10000002 | |||
| 891 | Ga0068866_10000019 | |||
| 892 | Ga0068851_10002153 | |||
| 893 | Ga0068870_10066166 | |||
| 894 | Ga0068863_100000032 | |||
| 895 | Ga0068858_100000049 | |||
| 896 | Ga0068858_100006307 | |||
| 897 | Ga0068858_100049480 | |||
| 898 | Ga0068858_100239891 | |||
| 899 | Ga0068862_100002825 | |||
| 900 | Ga0081455_10009498 | |||
| 901 | Ga0081538_10081463 | |||
| 902 | Ga0081540_1000006 | |||
| 903 | Ga0081539_10000473 | |||
| 904 | Ga0081539_10002242 | |||
| 905 | Ga0081539_10119888 | |||
| 906 | Ga0070717_10075881 | |||
| 907 | Ga0075363_100299345 | |||
| 908 | Ga0070715_10000012 | |||
| 909 | Ga0070715_10064513 | |||
| 910 | Ga0070715_10103001 | |||
| 911 | Ga0070715_10228858 | |||
| 912 | Ga0070716_100146589 | |||
| 913 | Ga0070712_100000777 | |||
| 914 | Ga0070712_100100853 | |||
| 915 | Ga0070712_100404597 | |||
| 916 | Ga0075428_100021945 | |||
| 917 | Ga0075430_100027536 | |||
| 918 | Ga0075431_100036575 | |||
| 919 | Ga0075431_100065779 | |||
| 920 | Ga0075433_10027284 | |||
| 921 | Ga0075433_10037865 | |||
| 922 | Ga0075433_10075025 | |||
| 923 | Ga0075433_10243789 | |||
| 924 | Ga0075434_100007144 | |||
| 925 | Ga0075434_100191835 | |||
| 926 | Ga0075434_100370372 | |||
| 927 | Ga0075436_100043703 | |||
| 928 | Ga0075436_100047633 | |||
| 929 | Ga0075436_100219177 | |||
| 930 | Ga0075436_100448620 | |||
| 931 | Ga0097620_100808453 | |||
| 932 | Ga0075435_100007136 | |||
| 933 | Ga0075435_100037060 | |||
| 934 | Ga0075435_100171504 | |||
| 935 | Ga0075435_100447733 | |||
| 936 | Ga0111539_10057025 | |||
| 937 | Ga0111539_10242677 | |||
| 938 | Ga0111539_10331616 | |||
| 939 | Ga0105245_10000056 | |||
| 940 | Ga0105245_10000290 | |||
| 941 | Ga0105245_10001677 | |||
| 942 | Ga0105245_10003691 | |||
| 943 | Ga0105245_10359013 | |||
| 944 | Ga0105247_10000202 | |||
| 945 | Ga0105247_10109935 | |||
| 946 | Ga0105247_10272342 | |||
| 947 | Ga0105247_10409945 | |||
| 948 | Ga0114129_10001119 | |||
| 949 | Ga0114129_10013663 | |||
| 950 | Ga0114129_10029165 | |||
| 951 | Ga0114129_10467965 | |||
| 952 | Ga0105243_10285969 | |||
| 953 | Ga0105243_10345353 | |||
| 954 | Ga0105241_10081860 | |||
| 955 | Ga0105241_10189587 | |||
| 956 | Ga0105242_10016975 | |||
| 957 | Ga0105242_10051900 | |||
| 958 | Ga0105242_10068974 | |||
| 959 | Ga0105248_10000032 | |||
| 960 | Ga0105238_10670934 | |||
| 961 | Ga0105249_10000073 | |||
| 962 | Ga0105249_10020406 | |||
| 963 | Ga0157370_10005853 | |||
| 964 | Ga0157370_10007615 | |||
| 965 | Ga0157369_10000099 | |||
| 966 | Ga0157369_10068684 | |||
| 967 | Ga0157374_10571808 | |||
| 968 | Ga0157378_10010497 | |||
| 969 | Ga0157378_10016775 | |||
| 970 | Ga0157378_10074162 | |||
| 971 | Ga0157378_10461332 | |||
| 972 | Ga0163162_10081431 | |||
| 973 | Ga0157372_10365990 | |||
| 974 | Ga0157375_10000707 | |||
| 975 | Ga0157375_10539542 | |||
| 976 | Ga0163163_10119806 | |||
| 977 | Ga0157380_10000219 | |||
| 978 | Ga0157380_10003655 | |||
| 979 | Ga0157380_10052162 | |||
| 980 | Ga0157379_10040899 | |||
| 981 | Ga0157379_10346924 | |||
| 982 | Ga0157376_10121124 | |||
| 983 | Ga0157376_10643395 | |||
| 984 | Ga0157376_10767140 | |||
| 985 | Ga0163161_10000058 | |||
| 986 | Ga0163161_10014924 | |||
| 987 | Ga0206356_10933897 | |||
| 988 | Ga0206353_11051550 | |||
| 989 | Ga0213876_10098728 | |||
| 990 | Ga0213875_10000468 | |||
| 991 | Ga0207656_10032149 | |||
| 992 | Ga0207682_10000052 | |||
| 993 | Ga0207692_10040358 | |||
| 994 | Ga0207692_10052115 | |||
| 995 | Ga0207642_10000001 | |||
| 996 | Ga0207642_10000003 | |||
| 997 | Ga0207642_10000004 | |||
| 998 | Ga0207642_10000017 | |||
| 999 | Ga0207710_10000369 | |||
| 1000 | Ga0207680_10002430 | |||
| 1001 | Ga0207680_10166999 | |||
| 1002 | Ga0207685_10112614 | |||
| 1003 | Ga0207705_10049419 | |||
| 1004 | Ga0207705_10094717 | |||
| 1005 | Ga0207654_10079660 | |||
| 1006 | Ga0207654_10121817 | |||
| 1007 | Ga0207707_10092802 | |||
| 1008 | Ga0207707_10122363 | |||
| 1009 | Ga0207695_10560577 | |||
| 1010 | Ga0207693_10008860 | |||
| 1011 | Ga0207693_10043531 | |||
| 1012 | Ga0207693_10053039 | |||
| 1013 | Ga0207693_10093503 | |||
| 1014 | Ga0207693_10245339 | |||
| 1015 | Ga0207663_10031736 | |||
| 1016 | Ga0207663_10099496 | |||
| 1017 | Ga0207660_10067787 | |||
| 1018 | Ga0207660_10123298 | |||
| 1019 | Ga0207660_10311908 | |||
| 1020 | Ga0207657_10082913 | |||
| 1021 | Ga0207649_10000005 | |||
| 1022 | Ga0207652_10000631 | |||
| 1023 | Ga0207646_10060981 | |||
| 1024 | Ga0207646_10315543 | |||
| 1025 | Ga0207650_10025386 | |||
| 1026 | Ga0207659_10000020 | |||
| 1027 | Ga0207687_10000007 | |||
| 1028 | Ga0207687_10000012 | |||
| 1029 | Ga0207687_10000646 | |||
| 1030 | Ga0207687_10000970 | |||
| 1031 | Ga0207687_10084136 | |||
| 1032 | Ga0207700_10000008 | |||
| 1033 | Ga0207700_10000016 | |||
| 1034 | Ga0207700_10086661 | |||
| 1035 | Ga0207700_10207811 | |||
| 1036 | Ga0207700_10397504 | |||
| 1037 | Ga0207664_10000013 | |||
| 1038 | Ga0207664_10110118 | |||
| 1039 | Ga0207664_10154503 | |||
| 1040 | Ga0207644_10123003 | |||
| 1041 | Ga0207690_10008415 | |||
| 1042 | Ga0207706_10000006 | |||
| 1043 | Ga0207686_10006424 | |||
| 1044 | Ga0207686_10024357 | |||
| 1045 | Ga0207670_10259273 | |||
| 1046 | Ga0207669_10000016 | |||
| 1047 | Ga0207669_10000036 | |||
| 1048 | Ga0207665_10020351 | |||
| 1049 | Ga0207665_10182274 | |||
| 1050 | Ga0207691_10000020 | |||
| 1051 | Ga0207711_10000020 | |||
| 1052 | Ga0207689_10264829 | |||
| 1053 | Ga0207661_10001238 | |||
| 1054 | Ga0207661_10001949 | |||
| 1055 | Ga0207661_10008416 | |||
| 1056 | Ga0207661_10030009 | |||
| 1057 | Ga0207661_10062095 | |||
| 1058 | Ga0207679_10025975 | |||
| 1059 | Ga0207667_10611451 | |||
| 1060 | Ga0207651_10008445 | |||
| 1061 | Ga0207651_10041883 | |||
| 1062 | Ga0207712_10000003 | |||
| 1063 | Ga0207712_10235415 | |||
| 1064 | Ga0207712_10331831 | |||
| 1065 | Ga0207668_10044746 | |||
| 1066 | Ga0207640_10000285 | |||
| 1067 | Ga0207640_10002518 | |||
| 1068 | Ga0207640_10168323 | |||
| 1069 | Ga0207677_10001435 | |||
| 1070 | Ga0207703_10000053 | |||
| 1071 | Ga0207703_10000067 | |||
| 1072 | Ga0207703_10073601 | |||
| 1073 | Ga0207703_10109546 | |||
| 1074 | Ga0207639_10001671 | |||
| 1075 | Ga0207678_10063204 | |||
| 1076 | Ga0207708_10514108 | |||
| 1077 | Ga0207702_10000016 | |||
| 1078 | Ga0207702_10003815 | |||
| 1079 | Ga0207702_10060671 | |||
| 1080 | Ga0207702_10192541 | |||
| 1081 | Ga0207641_10000071 | |||
| 1082 | Ga0207641_10008529 | |||
| 1083 | Ga0207648_10000228 | |||
| 1084 | Ga0207676_10194051 | |||
| 1085 | Ga0207674_10275630 | |||
| 1086 | Ga0207683_10006404 | |||
| 1087 | Ga0207683_10297110 | |||
| 1088 | Ga0207698_10000012 | |||
| 1089 | Ga0207428_10076863 | |||
| 1090 | Ga0207428_10181623 | |||
| 1091 | Ga0268266_10000023 | |||
| 1092 | Ga0268266_10000553 | |||
| 1093 | Ga0268266_10002681 | |||
| 1094 | Ga0268266_10513070 | |||
| 1095 | Ga0268265_10011815 | |||
| 1096 | Ga0268264_10007216 | |||
| 1097 | Ga0265338_10058061 | |||
| 1098 | Ga0307406_10536645 | |||
| 1099 | Ga0307415_100000648 | |||
| 1100 | Ga0373926_0071554 | |||
| 1101 | Ga0373944_0016363 | |||
| 1102 | Ga0373945_0004604 | |||
| 1103 | Ga0373943_0000090 | |||
| 1104 | Ga0373943_0007558 | |||
| 1105 | Ga0373946_0007850 | |||
| 1106 | Ga0373946_0013315 | |||
| 1107 | Ga0373927_0074898 | |||
| 1108 | Ga0373947_0000266 | |||
| 1109 | Ga0373947_0001538 | |||
| 1110 | Ga0373925_0001866 | |||
| 1111 | Ga0373925_0215933 | |||
| 1112 | Ga0395899_0001477 | |||
| 1113 | Ga0395899_0107394 | |||
| 1114 | Ga0395900_0014343 | |||
| 1115 | Ga0395900_0186535 | |||
| 1116 | Ga0395900_0252312 | |||
| 1117 | Ga0395898_0019644 | |||
| 1118 | Ga0395898_0036814 | |||
| 1119 | Ga0395905_0020023 | |||
| 1120 | Ga0395905_0025788 | |||
| 1121 | Ga0395905_0186330 | |||
| 1122 | Ga0436364_0309695 | |||
| 1123 | Ga0436364_1031907 | |||
| 1124 | Ga0436364_1133006 | |||
| 1125 | Ga0395901_0000856 | |||
| 1126 | Ga0395901_0011639 | |||
| 1127 | Ga0395901_0024834 | |||
| 1128 | Ga0395901_0153898 | |||
| 1129 | Ga0436365_0328253 | |||
| 1130 | Ga0436365_0329149 | |||
| 1131 | Ga0436362_0533856 | |||
| 1132 | Ga0451789_0027790 | |||
| 1133 | Ga0451791_1163314 | |||
| 1134 | Ga0451793_0300818 | |||
| 1135 | Ga0451807_2280868 | |||
| 1136 | Ga0451853_0384465 | |||
| 1137 | Ga0451853_1991254 | |||
| 1138 | Ga0451853_2081083 | |||
| 1139 | Ga0439431_0025850 | |||
| 1140 | Ga0439433_0006334 | |||
| 1141 | Ga0439462_0004636 | |||
| 1142 | Ga0439446_0000927 | |||
| 1143 | Ga0466966_0208199 | |||
| 1144 | Ga0466961_0338983 | |||
| 1145 | Ga0466961_0350564 | |||
| 1146 | Ga0466963_0000070 | |||
| 1147 | Ga0466963_0079187 | |||
| 1148 | Ga0466963_0207075 | |||
| 1149 | Ga0466964_0174965 | |||
| 1150 | Ga0466957_0003681 | |||
| 1151 | Ga0466960_0226618 | |||
| 1152 | Ga0466959_0252775 | |||
| 1153 | Ga0466958_0112295 | |||
| 1154 | Ga0466967_0000046 | |||
| 1155 | Ga0466967_0261967 | |||
| 1156 | Ga0466967_0738415 | |||
| 1157 | Ga0495592_0000621 | |||
| 1158 | Ga0495592_0164449 | |||
| 1159 | Ga0495592_0213460 | |||
| 1160 | Ga0495603_0001473 | |||
| 1161 | Ga0495603_0003021 | |||
| 1162 | Ga0495603_0077607 | |||
| 1163 | Ga0495629_0002088 | |||
| 1164 | Ga0495629_0005520 | |||
| 1165 | Ga0495629_0007647 | |||
| 1166 | Ga0495629_0019746 | |||
| 1167 | Ga0495629_0088279 | |||
| 1168 | Ga0495629_0129808 | |||
| 1169 | Ga0495638_0009398 | |||
| 1170 | Ga0495641_0003321 | |||
| 1171 | Ga0495641_0005538 | |||
| 1172 | Ga0495641_0015104 | |||
| 1173 | Ga0495641_0082409 | |||
| 1174 | Ga0495651_0004887 | |||
| 1175 | Ga0495651_0024849 | |||
| 1176 | Ga0495651_0192164 | |||
| 1177 | Ga0495653_0010741 | |||
| 1178 | Ga0495653_0032140 | |||
| 1179 | Ga0495653_0099929 | |||
| 1180 | Ga0495580_0022051 | |||
| 1181 | Ga0495582_0000005 | |||
| 1182 | Ga0495582_0000801 | |||
| 1183 | Ga0495582_0037719 | |||
| 1184 | Ga0495582_0113618 | |||
| 1185 | Ga0495582_0116493 | |||
| 1186 | Ga0495639_0002081 | |||
| 1187 | Ga0495639_0058412 | |||
| 1188 | Ga0495639_0138624 | |||
| 1189 | Ga0495662_0000022 | |||
| 1190 | Ga0495662_0000984 | |||
| 1191 | Ga0495664_0000012 | |||
| 1192 | Ga0495664_0052360 | |||
| 1193 | Ga0495584_0163949 | |||
| 1194 | Ga0495584_0225562 | |||
| 1195 | Ga0495594_0000013 | |||
| 1196 | Ga0495594_0000157 | |||
| 1197 | Ga0495594_0027397 | |||
| 1198 | Ga0495606_0000211 | |||
| 1199 | Ga0495608_0000031 | |||
| 1200 | Ga0495608_0000406 | |||
| 1201 | Ga0495608_0010782 | |||
| 1202 | Ga0495608_0019149 | |||
| 1203 | Ga0495608_0107463 | |||
| 1204 | Ga0495608_0265658 | |||
| 1205 | Ga0495618_0000068 | |||
| 1206 | Ga0495620_0000315 | |||
| 1207 | Ga0495628_0000323 | |||
| 1208 | Ga0495628_0036648 | |||
| 1209 | Ga0495628_0039578 | |||
| 1210 | Ga0495628_0069964 | |||
| 1211 | Ga0495628_0073094 | |||
| 1212 | Ga0495628_0172280 | |||
| 1213 | Ga0495628_0188052 | |||
| 1214 | Ga0495628_0247640 | |||
| 1215 | Ga0495630_0000018 | |||
| 1216 | Ga0495630_0005899 | |||
| 1217 | Ga0495630_0020993 | |||
| 1218 | Ga0495630_0064242 | |||
| 1219 | Ga0495630_0318177 | |||
| 1220 | Ga0495644_0000954 | |||
| 1221 | Ga0495666_0016257 | |||
| 1222 | Ga0495666_0047579 | |||
| 1223 | Ga0495652_0000003 | |||
| 1224 | Ga0495652_0147980 | |||
| 1225 | Ga0495652_0168788 | |||
| 1226 | Ga0495652_0317936 | |||
| 1227 | Ga0495665_0000215 | |||
| 1228 | Ga0495640_0001520 | |||
| 1229 | Ga0495640_0047817 | |||
| 1230 | Ga0495640_0114688 | |||
| 1231 | Ga0495640_0121419 | |||
| 1232 | Ga0495586_0000527 | |||
| 1233 | Ga0495586_0031050 | |||
| 1234 | Ga0495587_0001970 | |||
| 1235 | Ga0495587_0054503 | |||
| 1236 | Ga0495587_0208484 | |||
| 1237 | Ga0495587_0265446 | |||
| 1238 | Ga0495621_0002083 | |||
| 1239 | Ga0495645_0061651 | |||
| 1240 | Ga0495645_0205758 | |||
| 1241 | Ga0495622_0000014 | |||
| 1242 | Ga0495667_0004189 | |||
| 1243 | Ga0495667_0064213 | |||
| 1244 | Ga0495667_0082143 | |||
| 1245 | Ga0495656_0078619 | |||
| 1246 | Ga0495668_0031957 | |||
| 1247 | Ga0495634_0000024 | |||
| 1248 | Ga0495634_0026899 | |||
| 1249 | Ga0495625_0000029 | |||
| 1250 | Ga0495625_0257297 | |||
| 1251 | Ga0495635_0000009 | |||
| 1252 | Ga0495635_0037192 | |||
| 1253 | Ga0495635_0076575 | |||
| 1254 | Ga0495588_0000198 | |||
| 1255 | Ga0495588_0010582 | |||
| 1256 | Ga0495588_0020730 | |||
| 1257 | Ga0495657_0000024 | |||
| 1258 | Ga0495657_0004915 | |||
| 1259 | Ga0495657_0079758 | |||
| 1260 | Ga0495657_0181127 | |||
| 1261 | Ga0495657_0213593 | |||
| 1262 | Ga0495599_0031412 | |||
| 1263 | Ga0495599_0193580 | |||
| 1264 | Ga0495623_0109015 | |||
| 1265 | Ga0495646_0021230 | |||
| 1266 | Ga0495647_0000037 | |||
| 1267 | Ga0495647_0000293 | |||
| 1268 | Ga0495647_0002559 | |||
| 1269 | Ga0495647_0004495 | |||
| 1270 | Ga0495647_0026359 | |||
| 1271 | Ga0495658_0000019 | |||
| 1272 | Ga0495658_0001056 | |||
| 1273 | Ga0495658_0002471 | |||
| 1274 | Ga0495658_0228514 | |||
| 1275 | Ga0495669_0000562 | |||
| 1276 | Ga0495613_0000249 | |||
| 1277 | Ga0495613_0000309 | |||
| 1278 | Ga0495613_0003963 | |||
| 1279 | Ga0495613_0057044 | |||
| 1280 | Ga0495613_0318942 | |||
| 1281 | Ga0495624_0000028 | |||
| 1282 | Ga0495624_0012694 | |||
| 1283 | Ga0495624_0066552 | |||
| 1284 | Ga0495670_0017148 | |||
| 1285 | Ga0495670_0122393 | |||
| 1286 | Ga0495649_0015920 | |||
| 1287 | Ga0495600_0003314 | |||
| 1288 | Ga0495600_0010047 | |||
| 1289 | Ga0495600_0041968 | |||
| 1290 | Ga0495600_0043498 | |||
| 1291 | Ga0495581_0038723 | |||
| 1292 | Ga0495581_0069066 | |||
| 1293 | Ga0495581_0222299 | |||
| 1294 | Ga0495604_0000056 | |||
| 1295 | Ga0495604_0000190 | |||
| 1296 | Ga0495604_0003466 | |||
| 1297 | Ga0495604_0006459 | |||
| 1298 | Ga0495604_0049521 | |||
| 1299 | Ga0495604_0087982 | |||
| 1300 | Ga0495674_0000042 | |||
| 1301 | Ga0495674_0007533 | |||
| 1302 | Ga0495674_0034205 | |||
| 1303 | Ga0495674_0124032 | |||
| 1304 | Ga0495674_0137328 | |||
| 1305 | Ga0495676_0000646 | |||
| 1306 | Ga0495676_0001001 | |||
| 1307 | Ga0495676_0005236 | |||
| 1308 | Ga0495676_0014558 | |||
| 1309 | Ga0495676_0038393 | |||
| 1310 | Ga0495676_0138941 | |||
| 1311 | Ga0495680_0000023 | |||
| 1312 | Ga0495680_0000421 | |||
| 1313 | Ga0495680_0003583 | |||
| 1314 | Ga0495680_0005597 | |||
| 1315 | Ga0495680_0013355 | |||
| 1316 | Ga0495680_0061884 | |||
| 1317 | Ga0495675_0000209 | |||
| 1318 | Ga0495685_019250 | |||
| 1319 | Ga0495673_0029664 | |||
| 1320 | Ga0495684_0006596 | |||
| 1321 | Ga0495684_0010019 | |||
| 1322 | Ga0495593_0001317 | |||
| 1323 | Ga0495593_0053085 | |||
| 1324 | Ga0495602_0000228 | |||
| 1325 | Ga0495602_0169060 | |||
| 1326 | Ga0495602_0178666 | |||
| 1327 | Ga0495614_0004961 | |||
| 1328 | Ga0496100_0000038 | |||
| 1329 | Ga0496100_0000116 | |||
| 1330 | Ga0496100_0010105 | |||
| 1331 | Ga0496100_0041580 | |||
| 1332 | Ga0496100_0161150 | |||
| 1333 | Ga0496101_0000003 | |||
| 1334 | Ga0496101_0000010 | |||
| 1335 | Ga0496101_0008537 | |||
| 1336 | Ga0496101_0008544 | |||
| 1337 | Ga0496101_0346868 | |||
| 1338 | Ga0496102_0000027 | |||
| 1339 | Ga0496102_0027850 | |||
| 1340 | Ga0496102_0051948 | |||
| 1341 | Ga0496102_0058954 | |||
| 1342 | Ga0496102_0077064 | |||
| 1343 | Ga0496102_0130941 | |||
| 1344 | Ga0496102_0136102 | |||
| 1345 | Ga0496102_0177626 | |||
| 1346 | Ga0496103_0000155 | |||
| 1347 | Ga0496103_0021878 | |||
| 1348 | Ga0496103_0036541 | |||
| 1349 | Ga0496103_0129794 | |||
| 1350 | Ga0496103_0205169 | |||
| 1351 | Ga0496103_0252865 | |||
| 1352 | Ga0496104_0000002 | |||
| 1353 | Ga0496104_0000003 | |||
| 1354 | Ga0496104_0000576 | |||
| 1355 | Ga0496104_0001562 | |||
| 1356 | Ga0496104_0007540 | |||
| 1357 | Ga0496104_0017150 | |||
| 1358 | Ga0496104_0020399 | |||
| 1359 | Ga0496104_0061986 | |||
| 1360 | Ga0496104_0310719 | |||
| 1361 | Ga0496105_0000001 | |||
| 1362 | Ga0496105_0000008 | |||
| 1363 | Ga0496105_0000313 | |||
| 1364 | Ga0496105_0001400 | |||
| 1365 | Ga0496105_0008480 | |||
| 1366 | Ga0496105_0009052 | |||
| 1367 | Ga0496106_0000013 | |||
| 1368 | Ga0496106_0000018 | |||
| 1369 | Ga0496106_0000177 | |||
| 1370 | Ga0496106_0011021 | |||
| 1371 | Ga0496106_0062443 | |||
| 1372 | Ga0496107_0000032 | |||
| 1373 | Ga0496107_0000081 | |||
| 1374 | Ga0496107_0120084 | |||
| 1375 | Ga0496107_0378038 | |||
| 1376 | Ga0496108_0000002 | |||
| 1377 | Ga0496108_0000045 | |||
| 1378 | Ga0496108_0000631 | |||
| 1379 | Ga0496108_0008008 | |||
| 1380 | Ga0496108_0017482 | |||
| 1381 | Ga0496108_0112187 | |||
| 1382 | Ga0496109_0000001 | |||
| 1383 | Ga0496109_0000028 | |||
| 1384 | Ga0496109_0000032 | |||
| 1385 | Ga0496109_0000085 | |||
| 1386 | Ga0496109_0001462 | |||
| 1387 | Ga0496109_0001613 | |||
| 1388 | Ga0496109_0125780 | |||
| 1389 | Ga0496109_0228633 | |||
| 1390 | Ga0496109_0302392 | |||
| 1391 | Ga0496109_0327012 | |||
| 1392 | Ga0496110_0000033 | |||
| 1393 | Ga0496110_0001879 | |||
| 1394 | Ga0496110_0017994 | |||
| 1395 | Ga0496110_0024705 | |||
| 1396 | Ga0496110_0126042 | |||
| 1397 | Ga0496110_0129358 | |||
| 1398 | Ga0496111_0000560 | |||
| 1399 | Ga0496111_0001844 | |||
| 1400 | Ga0496111_0005648 | |||
| 1401 | Ga0496111_0125039 | |||
| 1402 | Ga0496112_0000002 | |||
| 1403 | Ga0496112_0001813 | |||
| 1404 | Ga0496112_0016767 | |||
| 1405 | Ga0496112_0017217 | |||
| 1406 | Ga0496112_0026222 | |||
| 1407 | Ga0496112_0051598 | |||
| 1408 | Ga0496113_0000007 | |||
| 1409 | Ga0496113_0000240 | |||
| 1410 | Ga0496113_0002837 | |||
| 1411 | Ga0496113_0024435 | |||
| 1412 | Ga0496113_0161716 | |||
| 1413 | Ga0496113_0290973 | |||
| 1414 | Ga0496114_0009484 | |||
| 1415 | Ga0496114_0009498 | |||
| 1416 | Ga0496114_0490237 | |||
| 1417 | Ga0496114_0587247 | |||
| 1418 | Ga0496115_0000020 | |||
| 1419 | Ga0496115_0005222 | |||
| 1420 | Ga0496115_0006918 | |||
| 1421 | Ga0496115_0008785 | |||
| 1422 | Ga0496115_0105769 | |||
| 1423 | Ga0496116_0000780 | |||
| 1424 | Ga0496117_0015033 | |||
| 1425 | Ga0496118_0000174 | |||
| 1426 | Ga0496118_0088493 | |||
| 1427 | Ga0496119_0004215 | |||
| 1428 | Ga0496119_0021993 | |||
| 1429 | Ga0496119_0026047 | |||
| 1430 | Ga0496120_0053857 | |||
| 1431 | Ga0496121_0005891 | |||
| 1432 | Ga0496121_0016585 | |||
| 1433 | Ga0496121_0082402 | |||
| 1434 | Ga0496121_0086517 | |||
| 1435 | Ga0496124_0115152 | |||
| 1436 | Ga0496124_0116434 | |||
| 1437 | Ga0496125_0013994 | |||
| 1438 | Ga0496125_0289604 | |||
| 1439 | Ga0496126_0029904 | |||
| 1440 | Ga0496126_0099256 | |||
| 1441 | Ga0501031_0000445 | |||
| 1442 | Ga0501031_0065331 | |||
| 1443 | Ga0501032_0000876 | |||
| 1444 | Ga0501033_0000294 | |||
| 1445 | Ga0501034_0065214 | |||
| 1446 | Ga0501036_0005562 | |||
| 1447 | Ga0501036_0135273 | |||
| 1448 | Ga0501037_0000378 | |||
| 1449 | Ga0501037_0005716 | |||
| 1450 | Ga0501038_0000087 | |||
| 1451 | Ga0501039_0001020 | |||
| 1452 | Ga0501039_0003991 | |||
| 1453 | Ga0501039_0107426 | |||
| 1454 | Ga0501040_0000007 | |||
| 1455 | Ga0501040_0000954 | |||
| 1456 | Ga0501040_0017844 | |||
| 1457 | Ga0501040_0058110 | |||
| 1458 | Ga0501040_0710312 | |||
| 1459 | Ga0501041_0000005 | |||
| 1460 | Ga0501041_0001093 | |||
| 1461 | Ga0501041_0040749 | |||
| 1462 | Ga0501042_0003216 | |||
| 1463 | Ga0501042_0003964 | |||
| 1464 | Ga0501043_0000998 | |||
| 1465 | Ga0501043_0093174 | |||
| 1466 | Ga0501043_0371369 | |||
| 1467 | Ga0501046_0001278 | |||
| 1468 | Ga0501046_0028136 | |||
| 1469 | Ga0501046_0053780 | |||
| 1470 | Ga0501047_0000592 | |||
| 1471 | Ga0501047_0009620 | |||
| 1472 | Ga0501048_0000018 | |||
| 1473 | Ga0501048_0001926 | |||
| 1474 | Ga0501048_0071099 | |||
| 1475 | Ga0501048_0184813 | |||
| 1476 | Ga0501067_0009559 | |||
| 1477 | Ga0501068_0000134 | |||
| 1478 | Ga0501068_0011873 | |||
| 1479 | Ga0501068_0018498 | |||
| 1480 | Ga0501069_0000426 | |||
| 1481 | Ga0501069_0077986 | |||
| 1482 | Ga0501070_0004569 | |||
| 1483 | Ga0501070_0005855 | |||
| 1484 | Ga0501070_0009281 | |||
| 1485 | Ga0501071_0000005 | |||
| 1486 | Ga0501071_0001995 | |||
| 1487 | Ga0501071_0014797 | |||
| 1488 | Ga0501072_0000269 | |||
| 1489 | Ga0501072_0004831 | |||
| 1490 | Ga0501072_0092159 | |||
| 1491 | Ga0501072_0152356 | |||
| 1492 | Ga0501073_0001327 | |||
| 1493 | Ga0501073_0033451 | |||
| 1494 | Ga0501073_0178046 | |||
| 1495 | Ga0501074_0001138 | |||
| 1496 | Ga0501074_0044985 | |||
| 1497 | Ga0501074_0075006 | |||
| 1498 | Ga0501074_0261410 | |||
| 1499 | Ga0501075_0000009 | |||
| 1500 | Ga0501075_0000193 | |||
| 1501 | Ga0501075_0099979 | |||
| 1502 | Ga0501075_0114929 | |||
| 1503 | Ga0501076_0000028 | |||
| 1504 | Ga0501076_0001292 | |||
| 1505 | Ga0501076_0090419 | |||
| 1506 | Ga0501076_0187905 | |||
| 1507 | Ga0501077_0000006 | |||
| 1508 | Ga0501077_0001176 | |||
| 1509 | Ga0501077_0112680 | |||
| 1510 | Ga0501079_0000881 | |||
| 1511 | Ga0501079_0025921 | |||
| 1512 | Ga0501079_0171082 | |||
| 1513 | Ga0501079_0255159 | |||
| 1514 | Ga0501080_0000626 | |||
| 1515 | Ga0501080_0032292 | |||
| 1516 | Ga0501081_0000003 | |||
| 1517 | Ga0501081_0000159 | |||
| 1518 | Ga0501081_0145654 | |||
| 1519 | Ga0501083_0001673 | |||
| 1520 | Ga0501083_0008047 | |||
| 1521 | Ga0501083_0021756 | |||
| 1522 | Ga0501083_0372292 | |||
| 1523 | Ga0501035_0000175 | |||
| 1524 | Ga0501044_0006303 | |||
| 1525 | Ga0501044_0065287 | |||
| 1526 | Ga0501045_0000009 | |||
| 1527 | Ga0501045_0002161 | |||
| 1528 | Ga0501045_0075570 | |||
| 1529 | Ga0501045_0653959 | |||
| 1530 | nmdc:mga05p37_62567_c1 | |||
| 1531 | nmdc:mga05p37_8447_c1 | |||
| 1532 | nmdc:mga06r32_504525_c1 | |||
| 1533 | nmdc:mga08y16_287973_c1 | |||
| 1534 | nmdc:mga08y16_55458_c1 | |||
| 1535 | nmdc:mga08y16_567673_c1 | |||
| 1536 | nmdc:mga0n895_108290_c1 | |||
| 1537 | nmdc:mga0n895_468709_c1 | |||
| 1538 | nmdc:mga0n895_599926_c1 | |||
| 1539 | nmdc:mga0rr50_148702_c1 | |||
| 1540 | nmdc:mga0rr50_372931_c1 | |||
| 1541 | nmdc:mga0rr50_76361_c1 | |||
| 1542 | nmdc:mga08x19_198354_c1 | |||
| 1543 | nmdc:mga08x19_383629_c1 | |||
| 1544 | nmdc:mga0a205_193953_c1 | |||
| 1545 | nmdc:mga0a205_54850_c1 | |||
| 1546 | nmdc:mga0a205_65733_c1 | |||
| 1547 | Ga0495601_0000086 | |||
| 1548 | Ga0495601_0000097 | |||
| 1549 | Ga0495601_0003248 | |||
| 1550 | Ga0495601_0008176 | |||
| 1551 | Ga0495601_0059411 | |||
| 1552 | Ga0495601_0139304 | |||
| 1553 | Ga0495612_0005844 | |||
| 1554 | Ga0495655_0001313 | |||
| 1555 | Ga0495595_0000014 | |||
| 1556 | Ga0495595_0000109 | |||
| 1557 | Ga0495595_0006454 | |||
| 1558 | Ga0495619_0000022 | |||
| 1559 | Ga0495619_0000024 | |||
| 1560 | Ga0495619_0000319 | |||
| 1561 | Ga0495619_0004791 | |||
| 1562 | Ga0495619_0069309 | |||
| 1563 | Ga0495619_0309197 | |||
| 1564 | Ga0500566_0005120 | |||
| 1565 | Ga0500641_0002398 | |||
| 1566 | Ga0500595_039603 | |||
| 1567 | Ga0500614_004265 | |||
| 1568 | Ga0501084_0001358 | |||
| 1569 | Ga0501084_0005874 | |||
| 1570 | Ga0501084_0065108 | |||
| 1571 | Ga0501084_0396990 | |||
| 1572 | Ga0501082_0000063 | |||
| 1573 | Ga0501082_0001009 | |||
| 1574 | Ga0501082_0237725 | |||
| 1575 | Ga0466962_0049559 | |||
| 1576 | Ga0530510_0000014 | |||
| 1577 | Ga0530510_0001148 | |||
| 1578 | Ga0530510_0079218 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5njg-assembly1.cif.gz_B | structure of an abc transporter: part of the structure that could be built de novo | 0.6988 | 3 | 253 |
| 6hbu-assembly1.cif.gz_A | cryo-em structure of the abcg2 e211q mutant bound to atp and magnesium | 0.6944 | 4 | 246 |
| 5njg-assembly1.cif.gz_B | structure of an abc transporter: part of the structure that could be built de novo | 0.6924 | 3 | 253 |
| 8p8j-assembly1.cif.gz_B | structure of 5d3-fab and nanobody(nb96)-bound abcg2 | 0.6863 | 4 | 246 |
| 5nj3-assembly1.cif.gz_A | structure of an abc transporter: complete structure | 0.682 | 3 | 253 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VMM9_322_706_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.7962 | 48 | 244 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.778 | 34 | 246 | 3.40.1710.10 |
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.7569 | 31 | 246 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.6626 | 34 | 246 | 3.40.1710.10 |
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.6534 | 31 | 246 | 3.40.1710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538ENL9-F1-model_v4 | ABC-2 type transporter transmembrane domain-containing protein | 0.9911 | 2 | 253 |
GO:0043190
GO:0140359 |
| AF-A0A538CUW8-F1-model_v4 | ABC-2 type transporter transmembrane domain-containing protein | 0.9872 | 2 | 253 |
GO:0016020
GO:0140359 |
| AF-A0A7V9D1C1-F1-model_v4 | ABC transporter permease | 0.9871 | 2 | 253 |
GO:0043190
GO:0140359 |
| AF-A0A538CAD6-F1-model_v4 | ABC transporter permease | 0.9847 | 2 | 253 |
GO:0016020
GO:0140359 |
| AF-A0A7K0RK29-F1-model_v4 | ABC-2 type transporter transmembrane domain-containing protein | 0.9834 | 2 | 252 |
GO:0043190
GO:0140359 |