F480925

General Info

Members Datasets Scaffolds Average Seq Length
789 277 789 231

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_169793_c1|nmdc:mga0qj67_169793_c1_893_1681
Length 262
Sequence LAEPSTSLGPGPSTSPGGPRSKTPLPAAPHGVAVAEHAHHPRLQHHFYSMEQQLEASILGMWIFLVTEIMFFGGLFMAYLVYRTMYPQAWLDGSAALDVPLGALNTAVLICSSLTMVLSVRAAQVGSRRGQIVNLILTILFGTTFLVVKYFEYAAKFEHHLIPGPHFSVHYLEELGRTGADPFSTQLFFSLYFIMTGIHAAHMVVGIGLMSVILLMAWRGRFTPDYYGPIEVSGLYWHFVDIVWIFLFPLLYLLGLHGGHGA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
190 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
191 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
192 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
193 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
201 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
202 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
203 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
204 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
205 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
206 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
219 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
220 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
221 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
222 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
223 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
224 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
225 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
226 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
227 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
230 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
235 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
238 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
247 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
248 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
249 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
253 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
254 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
257 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
258 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
259 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
260 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
261 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
270 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
271 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
272 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
273 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
274 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.79
Nodule 0
Rhizoplane 0.38
Rhizosphere 96.32
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_122425 2162886007 Bacteria 846
2 JGI24746J21847_1005306 3300001977 Bacteria 2014
3 JGI25406J46586_10025285 3300003203 Bacteria 2307
4 Ga0065704_10022647 3300005289 Bacteria 1485
5 Ga0065704_10073597 3300005289 Bacteria 6976
6 Ga0065704_10076056 3300005289 Bacteria 5272
7 Ga0065704_10113394 3300005289 Bacteria 1913
8 Ga0065704_10153920 3300005289 Bacteria 1405
9 Ga0065712_10000219 3300005290 Bacteria 22736
10 Ga0065712_10002625 3300005290 Bacteria 5351
11 Ga0065712_10016166 3300005290 Bacteria 2544
12 Ga0065712_10118747 3300005290 Bacteria 1702
13 Ga0065715_10090744 3300005293 Bacteria 6526
14 Ga0065715_10096482 3300005293 Bacteria 3871
15 Ga0065715_10097033 3300005293 Bacteria 3773
16 Ga0065715_10179547 3300005293 Bacteria 1486
17 Ga0065715_10218196 3300005293 Bacteria 1283
18 Ga0065707_10001683 3300005295 Bacteria 5818
19 Ga0065707_10034238 3300005295 Bacteria 1256
20 Ga0065707_10090215 3300005295 Bacteria 4184
21 Ga0065707_10099283 3300005295 Bacteria 3019
22 Ga0065707_10099626 3300005295 Bacteria 2931
23 Ga0065707_10232790 3300005295 Bacteria 1183
24 Ga0065707_10256441 3300005295 Bacteria 1110
25 Ga0065707_10284019 3300005295 Bacteria 1041
26 Ga0070676_10002802 3300005328 Bacteria 9009
27 Ga0070676_10016273 3300005328 Bacteria 4110
28 Ga0070676_10290456 3300005328 Bacteria 1105
29 Ga0070683_100000002 3300005329 Bacteria 427530
30 Ga0070683_100279457 3300005329 Bacteria 1588
31 Ga0070683_100829850 3300005329 Bacteria 886
32 Ga0070690_100031524 3300005330 Bacteria 3303
33 Ga0070690_100151542 3300005330 Bacteria 1582
34 Ga0070690_100177126 3300005330 Bacteria 1471
35 Ga0070670_100001515 3300005331 Bacteria 18706
36 Ga0070670_100071576 3300005331 Bacteria 2977
37 Ga0070670_100166949 3300005331 Bacteria 1909
38 Ga0070670_100500072 3300005331 Bacteria 1081
39 Ga0070677_10001401 3300005333 Bacteria 7688
40 Ga0070677_10059944 3300005333 Bacteria 1566
41 Ga0070677_10063929 3300005333 Bacteria 1527
42 Ga0070677_10166575 3300005333 Bacteria 1038
43 Ga0068869_100011805 3300005334 Bacteria 5746
44 Ga0068869_100078766 3300005334 Bacteria 2455
45 Ga0068869_100224091 3300005334 Bacteria 1491
46 Ga0068869_100238904 3300005334 Bacteria 1447
47 Ga0068869_100407333 3300005334 Bacteria 1120
48 Ga0070666_10004032 3300005335 Bacteria 8913
49 Ga0070666_10063210 3300005335 Bacteria 2509
50 Ga0070680_100643545 3300005336 Bacteria 911
51 Ga0070682_100353829 3300005337 Bacteria 1096
52 Ga0068868_100557053 3300005338 Bacteria 1011
53 Ga0068868_100763363 3300005338 Bacteria 870
54 Ga0070689_100002830 3300005340 Bacteria 11412
55 Ga0070689_100018135 3300005340 Bacteria 5181
56 Ga0070689_100035664 3300005340 Bacteria 3801
57 Ga0070689_100042217 3300005340 Bacteria 3501
58 Ga0070689_100100654 3300005340 Bacteria 2287
59 Ga0070689_100114284 3300005340 Bacteria 2150
60 Ga0070689_100268935 3300005340 Bacteria 1411
61 Ga0070687_100014988 3300005343 Bacteria 3495
62 Ga0070687_100023099 3300005343 Bacteria 2951
63 Ga0070687_100206374 3300005343 Bacteria 1194
64 Ga0070661_100031836 3300005344 Bacteria 3815
65 Ga0070692_10201882 3300005345 Bacteria 1165
66 Ga0070692_10251610 3300005345 Unclassified 1058
67 Ga0070668_100060823 3300005347 Bacteria 2926
68 Ga0070668_100127988 3300005347 Bacteria 2036
69 Ga0070668_100137844 3300005347 Bacteria 1964
70 Ga0070668_100267499 3300005347 Bacteria 1424
71 Ga0070668_100445241 3300005347 Bacteria 1113
72 Ga0070669_100001921 3300005353 Bacteria 15002
73 Ga0070669_100002059 3300005353 Bacteria 14549
74 Ga0070669_100005541 3300005353 Bacteria 9116
75 Ga0070669_100154516 3300005353 Bacteria 1778
76 Ga0070675_100002457 3300005354 Bacteria 13856
77 Ga0070675_100002479 3300005354 Bacteria 13810
78 Ga0070675_100075497 3300005354 Bacteria 2802
79 Ga0070675_100087517 3300005354 Bacteria 2605
80 Ga0070675_100110037 3300005354 Bacteria 2329
81 Ga0070675_100128284 3300005354 Bacteria 2159
82 Ga0070675_100134579 3300005354 Bacteria 2109
83 Ga0070675_100188634 3300005354 Bacteria 1785
84 Ga0070675_100241503 3300005354 Bacteria 1578
85 Ga0070671_100004964 3300005355 Bacteria 10589
86 Ga0070671_100008105 3300005355 Bacteria 8413
87 Ga0070671_100074506 3300005355 Bacteria 2836
88 Ga0070674_100100131 3300005356 Bacteria 2109
89 Ga0070674_100136853 3300005356 Bacteria 1833
90 Ga0070674_100492769 3300005356 Bacteria 1019
91 Ga0070673_100000726 3300005364 Bacteria 18223
92 Ga0070673_100001253 3300005364 Bacteria 14749
93 Ga0070673_100006498 3300005364 Bacteria 7602
94 Ga0070673_100022334 3300005364 Bacteria 4603
95 Ga0070673_100164217 3300005364 Bacteria 1890
96 Ga0070673_100202599 3300005364 Bacteria 1709
97 Ga0070673_100207321 3300005364 Bacteria 1691
98 Ga0070673_100207555 3300005364 Bacteria 1690
99 Ga0070673_100233756 3300005364 Bacteria 1595
100 Ga0070673_100521474 3300005364 Bacteria 1077
101 Ga0070688_100000591 3300005365 Bacteria 18259
102 Ga0070688_100013523 3300005365 Bacteria 4606
103 Ga0070688_100015084 3300005365 Bacteria 4386
104 Ga0070688_100045520 3300005365 Bacteria 2712
105 Ga0070688_100088356 3300005365 Bacteria 2021
106 Ga0070688_100254058 3300005365 Bacteria 1253
107 Ga0070659_100002627 3300005366 Bacteria 12778
108 Ga0070659_100233369 3300005366 Bacteria 1521
109 Ga0070659_100266754 3300005366 Bacteria 1421
110 Ga0070659_100568797 3300005366 Bacteria 972
111 Ga0070667_100071360 3300005367 Bacteria 2958
112 Ga0070703_10032020 3300005406 Bacteria 1594
113 Ga0070714_100179072 3300005435 Unclassified 1928
114 Ga0070701_10044551 3300005438 Bacteria 2273
115 Ga0070705_100038972 3300005440 Bacteria 2693
116 Ga0070705_100040131 3300005440 Unclassified 2660
117 Ga0070705_100161038 3300005440 Bacteria 1500
118 Ga0070705_100379780 3300005440 Bacteria 1039
119 Ga0070700_100050889 3300005441 Bacteria 2577
120 Ga0070700_100193164 3300005441 Bacteria 1425
121 Ga0070700_100349594 3300005441 Bacteria 1095
122 Ga0070694_100012339 3300005444 Bacteria 5308
123 Ga0070694_100013920 3300005444 Bacteria 5030
124 Ga0070694_100074129 3300005444 Bacteria 2352
125 Ga0070694_100179232 3300005444 Bacteria 1566
126 Ga0070708_100008725 3300005445 Bacteria 8146
127 Ga0070663_100314193 3300005455 Bacteria 1258
128 Ga0070678_100045389 3300005456 Bacteria 3144
129 Ga0070678_100183990 3300005456 Bacteria 1713
130 Ga0070678_100292017 3300005456 Bacteria 1382
131 Ga0070662_100008143 3300005457 Bacteria 6829
132 Ga0070662_100066280 3300005457 Bacteria 2649
133 Ga0070662_100345232 3300005457 Bacteria 1218
134 Ga0070662_100489548 3300005457 Bacteria 1025
135 Ga0070662_100550188 3300005457 Unclassified 967
136 Ga0070681_10000273 3300005458 Bacteria 41372
137 Ga0070681_10002209 3300005458 Bacteria 17745
138 Ga0070681_10348588 3300005458 Bacteria 1391
139 Ga0068867_100035716 3300005459 Bacteria 3606
140 Ga0068867_100188593 3300005459 Bacteria 1644
141 Ga0068867_100225054 3300005459 Bacteria 1513
142 Ga0070685_10030778 3300005466 Bacteria 2994
143 Ga0070685_10039236 3300005466 Bacteria 2689
144 Ga0070685_10049081 3300005466 Bacteria 2433
145 Ga0070685_10061739 3300005466 Bacteria 2196
146 Ga0070706_100000017 3300005467 Bacteria 172828
147 Ga0070706_100041728 3300005467 Bacteria 4236
148 Ga0070706_100105195 3300005467 Bacteria 2626
149 Ga0070706_100166559 3300005467 Bacteria 2058
150 Ga0070707_100000983 3300005468 Bacteria 28206
151 Ga0070707_100178936 3300005468 Bacteria 2067
152 Ga0070698_100007095 3300005471 Bacteria 12136
153 Ga0070698_100063792 3300005471 Bacteria 3714
154 Ga0070698_100090695 3300005471 Bacteria 3039
155 Ga0070699_100003587 3300005518 Bacteria 13725
156 Ga0070699_100151262 3300005518 Unclassified 2053
157 Ga0070699_100262197 3300005518 Bacteria 1546
158 Ga0070699_100373913 3300005518 Bacteria 1286
159 Ga0070679_100000737 3300005530 Bacteria 28290
160 Ga0070679_100466879 3300005530 Bacteria 1207
161 Ga0070697_100111953 3300005536 Bacteria 2276
162 Ga0070697_100282478 3300005536 Bacteria 1424
163 Ga0070697_100401816 3300005536 Bacteria 1189
164 Ga0068853_100004645 3300005539 Bacteria 10650
165 Ga0068853_100197466 3300005539 Unclassified 1830
166 Ga0070672_100000166 3300005543 Bacteria 36328
167 Ga0070672_100020617 3300005543 Bacteria 4811
168 Ga0070672_100166295 3300005543 Bacteria 1832
169 Ga0070672_100325214 3300005543 Bacteria 1307
170 Ga0070672_100468492 3300005543 Bacteria 1087
171 Ga0070686_100029433 3300005544 Bacteria 3342
172 Ga0070686_100112288 3300005544 Bacteria 1859
173 Ga0070686_100129779 3300005544 Bacteria 1741
174 Ga0070686_100600625 3300005544 Bacteria 867
175 Ga0070695_100099652 3300005545 Bacteria 1955
176 Ga0070696_100015437 3300005546 Bacteria 5129
177 Ga0070696_100017102 3300005546 Bacteria 4895
178 Ga0070696_100054966 3300005546 Unclassified 2776
179 Ga0070696_100292281 3300005546 Bacteria 1245
180 Ga0070693_100295660 3300005547 Viruses 1090
181 Ga0070665_100000281 3300005548 Bacteria 83503
182 Ga0070665_100153067 3300005548 Bacteria 2308
183 Ga0070665_100462654 3300005548 Bacteria 1279
184 Ga0070665_100514964 3300005548 Bacteria 1208
185 Ga0070704_100010948 3300005549 Bacteria 5532
186 Ga0070704_100017442 3300005549 Bacteria 4564
187 Ga0070704_100044235 3300005549 Bacteria 3093
188 Ga0070704_100260858 3300005549 Bacteria 1427
189 Ga0068855_100183077 3300005563 Bacteria 2367
190 Ga0070664_100010524 3300005564 Bacteria 7497
191 Ga0070664_100033946 3300005564 Bacteria 4277
192 Ga0070664_100093533 3300005564 Bacteria 2605
193 Ga0068857_100105733 3300005577 Bacteria 2527
194 Ga0068857_100125098 3300005577 Bacteria 2316
195 Ga0068854_100070373 3300005578 Bacteria 2557
196 Ga0068856_100010662 3300005614 Bacteria 8929
197 Ga0068856_100525033 3300005614 Bacteria 1205
198 Ga0070702_100184481 3300005615 Bacteria 1368
199 Ga0068852_100320017 3300005616 Bacteria 1506
200 Ga0068852_100409185 3300005616 Unclassified 1336
201 Ga0068859_100006608 3300005617 Bacteria 11775
202 Ga0068859_100007844 3300005617 Bacteria 10834
203 Ga0068859_100015089 3300005617 Bacteria 7756
204 Ga0068859_100037931 3300005617 Bacteria 4835
205 Ga0068859_100081330 3300005617 Bacteria 3282
206 Ga0068859_100134300 3300005617 Bacteria 2546
207 Ga0068859_100455762 3300005617 Unclassified 1375
208 Ga0068864_100002881 3300005618 Bacteria 14212
209 Ga0068864_100016493 3300005618 Bacteria 6148
210 Ga0068864_100054305 3300005618 Unclassified 3457
211 Ga0068864_100073380 3300005618 Bacteria 2983
212 Ga0068864_100203925 3300005618 Bacteria 1818
213 Ga0068864_100371229 3300005618 Bacteria 1354
214 Ga0068864_100476115 3300005618 Bacteria 1198
215 Ga0068864_100582003 3300005618 Unclassified 1085
216 Ga0068866_10177249 3300005718 Bacteria 1256
217 Ga0068861_100001191 3300005719 Bacteria 16176
218 Ga0068851_10151960 3300005834 Bacteria 1266
219 Ga0068870_10001143 3300005840 Bacteria 10612
220 Ga0068870_10032943 3300005840 Bacteria 2640
221 Ga0068870_10036479 3300005840 Bacteria 2529
222 Ga0068863_100054815 3300005841 Bacteria 3777
223 Ga0068863_100119373 3300005841 Bacteria 2514
224 Ga0068863_100598458 3300005841 Bacteria 1091
225 Ga0068858_100021713 3300005842 Bacteria 5998
226 Ga0068858_100035013 3300005842 Unclassified 4658
227 Ga0068858_100036842 3300005842 Unclassified 4535
228 Ga0068858_100077467 3300005842 Bacteria 3089
229 Ga0068858_100174715 3300005842 Bacteria 2026
230 Ga0068858_100989899 3300005842 Bacteria 824
231 Ga0068860_100116460 3300005843 Bacteria 2557
232 Ga0068860_100194224 3300005843 Bacteria 1965
233 Ga0068860_100225107 3300005843 Bacteria 1822
234 Ga0068862_100002024 3300005844 Bacteria 18363
235 Ga0068862_100019276 3300005844 Bacteria 5691
236 Ga0068862_100148510 3300005844 Bacteria 2085
237 Ga0068862_100232554 3300005844 Bacteria 1673
238 Ga0081539_10001769 3300005985 Bacteria 34433
239 Ga0075368_10004669 3300006042 Bacteria 4659
240 Ga0075364_10319670 3300006051 Bacteria 1057
241 Ga0075367_10008309 3300006178 Bacteria 5376
242 Ga0075367_10029494 3300006178 Bacteria 3138
243 Ga0075367_10162981 3300006178 Bacteria 1387
244 Ga0075366_10002715 3300006195 Bacteria 9138
245 Ga0075366_10054578 3300006195 Bacteria 2373
246 Ga0075366_10219322 3300006195 Bacteria 1159
247 Ga0097621_100065937 3300006237 Bacteria 2981
248 Ga0097621_100073884 3300006237 Bacteria 2823
249 Ga0075370_10033120 3300006353 Bacteria 2892
250 Ga0068871_100102965 3300006358 Bacteria 2393
251 Ga0068871_100144118 3300006358 Bacteria 2027
252 Ga0068871_100737756 3300006358 Bacteria 904
253 Ga0075428_100024015 3300006844 Bacteria 6747
254 Ga0075428_100069048 3300006844 Bacteria 3865
255 Ga0075428_100102438 3300006844 Bacteria 3121
256 Ga0075428_100110669 3300006844 Bacteria 2992
257 Ga0075428_100278782 3300006844 Bacteria 1799
258 Ga0075428_100307863 3300006844 Bacteria 1703
259 Ga0075430_100034887 3300006846 Bacteria 4271
260 Ga0075430_100040830 3300006846 Bacteria 3926
261 Ga0075430_100064842 3300006846 Bacteria 3069
262 Ga0075430_100105973 3300006846 Bacteria 2346
263 Ga0075430_100110091 3300006846 Bacteria 2297
264 Ga0075430_100153334 3300006846 Bacteria 1918
265 Ga0075431_100015539 3300006847 Bacteria 7714
266 Ga0075431_100054172 3300006847 Bacteria 4136
267 Ga0075431_100062799 3300006847 Bacteria 3833
268 Ga0075431_100101664 3300006847 Bacteria 2966
269 Ga0075431_100196629 3300006847 Bacteria 2064
270 Ga0075431_100268034 3300006847 Bacteria 1731
271 Ga0075431_100302394 3300006847 Bacteria 1616
272 Ga0075431_100448728 3300006847 Bacteria 1286
273 Ga0075431_100501857 3300006847 Bacteria 1204
274 Ga0075433_10000236 3300006852 Bacteria 31700
275 Ga0075433_10008532 3300006852 Bacteria 8173
276 Ga0075433_10009913 3300006852 Bacteria 7637
277 Ga0075433_10018529 3300006852 Bacteria 5789
278 Ga0075433_10019163 3300006852 Bacteria 5694
279 Ga0075433_10159247 3300006852 Bacteria 2009
280 Ga0075433_10245982 3300006852 Bacteria 1587
281 Ga0075433_10323417 3300006852 Bacteria 1364
282 Ga0075434_100001337 3300006871 Bacteria 20658
283 Ga0075434_100007557 3300006871 Bacteria 10068
284 Ga0075434_100060618 3300006871 Bacteria 3763
285 Ga0075434_100086968 3300006871 Bacteria 3126
286 Ga0075434_100092464 3300006871 Bacteria 3027
287 Ga0075434_100363791 3300006871 Unclassified 1467
288 Ga0075434_100837596 3300006871 Bacteria 935
289 Ga0075429_100072025 3300006880 Bacteria 3010
290 Ga0075429_100073085 3300006880 Bacteria 2986
291 Ga0075429_100153766 3300006880 Bacteria 2014
292 Ga0075429_100392938 3300006880 Bacteria 1214
293 Ga0068865_100098147 3300006881 Bacteria 2140
294 Ga0068865_100126489 3300006881 Bacteria 1908
295 Ga0068865_100144722 3300006881 Bacteria 1796
296 Ga0068865_100201836 3300006881 Unclassified 1544
297 Ga0068865_100236005 3300006881 Bacteria 1437
298 Ga0075436_100000743 3300006914 Bacteria 21632
299 Ga0075436_100075227 3300006914 Bacteria 2338
300 Ga0075436_100242378 3300006914 Bacteria 1282
301 Ga0097620_100006608 3300006931 Bacteria 11775
302 Ga0097620_100007844 3300006931 Bacteria 10834
303 Ga0097620_100015088 3300006931 Bacteria 7756
304 Ga0097620_100037929 3300006931 Bacteria 4835
305 Ga0097620_100081330 3300006931 Bacteria 3282
306 Ga0097620_100134289 3300006931 Bacteria 2546
307 Ga0097620_100455728 3300006931 Unclassified 1375
308 Ga0075435_100001882 3300007076 Bacteria 13650
309 Ga0075435_100048142 3300007076 Bacteria 3424
310 Ga0075435_100217397 3300007076 Bacteria 1622
311 Ga0075435_100256365 3300007076 Bacteria 1490
312 Ga0075435_100590887 3300007076 Unclassified 962
313 Ga0105240_10013257 3300009093 Bacteria 11336
314 Ga0105240_10203959 3300009093 Bacteria 2316
315 Ga0111539_10002317 3300009094 Bacteria 25338
316 Ga0111539_10005574 3300009094 Bacteria 16275
317 Ga0111539_10011387 3300009094 Bacteria 11166
318 Ga0111539_10023771 3300009094 Bacteria 7530
319 Ga0111539_10028207 3300009094 Bacteria 6851
320 Ga0111539_10079531 3300009094 Unclassified 3856
321 Ga0111539_10089798 3300009094 Bacteria 3611
322 Ga0111539_10311777 3300009094 Bacteria 1831
323 Ga0111539_10397429 3300009094 Bacteria 1605
324 Ga0111539_10413225 3300009094 Bacteria 1571
325 Ga0111539_10443772 3300009094 Bacteria 1511
326 Ga0105247_10051255 3300009101 Bacteria 2541
327 Ga0105247_10248973 3300009101 Bacteria 1214
328 Ga0114129_10024805 3300009147 Bacteria 8501
329 Ga0114129_10049203 3300009147 Bacteria 5924
330 Ga0114129_10055343 3300009147 Bacteria 5560
331 Ga0114129_10109572 3300009147 Bacteria 3811
332 Ga0114129_10274606 3300009147 Bacteria 2254
333 Ga0114129_10475000 3300009147 Bacteria 1637
334 Ga0114129_10524507 3300009147 Unclassified 1544
335 Ga0114129_10663454 3300009147 Bacteria 1345
336 Ga0114129_11499248 3300009147 Bacteria 829
337 Ga0114129_11920224 3300009147 Bacteria 717
338 Ga0105242_10451036 3300009176 Bacteria 1212
339 Ga0105242_10643737 3300009176 Bacteria 1030
340 Ga0105248_10053476 3300009177 Bacteria 4531
341 Ga0105248_10087961 3300009177 Bacteria 3497
342 Ga0105248_10185633 3300009177 Bacteria 2343
343 Ga0105248_10230990 3300009177 Bacteria 2083
344 Ga0105248_11346235 3300009177 Bacteria 808
345 Ga0105237_10001605 3300009545 Bacteria 29357
346 Ga0105237_10104408 3300009545 Unclassified 2825
347 Ga0105237_10105838 3300009545 Bacteria 2804
348 Ga0105237_10384704 3300009545 Bacteria 1408
349 Ga0105238_11104259 3300009551 Bacteria 816
350 Ga0105249_10003004 3300009553 Bacteria 14549
351 Ga0105249_10004273 3300009553 Bacteria 12348
352 Ga0105249_10046251 3300009553 Bacteria 3960
353 Ga0105249_10046440 3300009553 Bacteria 3952
354 Ga0105249_10757433 3300009553 Bacteria 1033
355 Ga0105239_10018785 3300010375 Bacteria 7638
356 Ga0105239_10725689 3300010375 Bacteria 1137
357 Ga0105239_10871401 3300010375 Bacteria 1033
358 Ga0105246_10061211 3300011119 Bacteria 2618
359 Ga0105246_10275146 3300011119 Bacteria 1348
360 Ga0157371_10515618 3300013102 Bacteria 884
361 Ga0157370_10409549 3300013104 Unclassified 1248
362 Ga0157369_10013391 3300013105 Bacteria 9276
363 Ga0157369_10024559 3300013105 Bacteria 6701
364 Ga0157369_10459050 3300013105 Bacteria 1319
365 Ga0157374_10019423 3300013296 Bacteria 6014
366 Ga0157374_10279585 3300013296 Bacteria 1648
367 Ga0157378_10008418 3300013297 Bacteria 8985
368 Ga0157378_10104249 3300013297 Bacteria 2592
369 Ga0157378_10298078 3300013297 Bacteria 1559
370 Ga0157378_10402419 3300013297 Bacteria 1349
371 Ga0163162_10000539 3300013306 Bacteria 34986
372 Ga0163162_10004052 3300013306 Bacteria 14058
373 Ga0163162_10037891 3300013306 Unclassified 4812
374 Ga0163162_10072367 3300013306 Bacteria 3502
375 Ga0163162_10088850 3300013306 Bacteria 3170
376 Ga0163162_10447279 3300013306 Unclassified 1424
377 Ga0163162_10697308 3300013306 Bacteria 1137
378 Ga0157372_10010413 3300013307 Bacteria 9886
379 Ga0157372_10074395 3300013307 Unclassified 3831
380 Ga0157372_10346239 3300013307 Bacteria 1731
381 Ga0157372_10369262 3300013307 Bacteria 1672
382 Ga0157375_10005816 3300013308 Bacteria 10732
383 Ga0157375_10018153 3300013308 Bacteria 6375
384 Ga0157375_10111777 3300013308 Bacteria 2831
385 Ga0157375_10153586 3300013308 Bacteria 2439
386 Ga0157375_10190919 3300013308 Bacteria 2203
387 Ga0157375_10230020 3300013308 Bacteria 2013
388 Ga0157375_10316157 3300013308 Bacteria 1726
389 Ga0157375_10966423 3300013308 Bacteria 993
390 Ga0163163_10006853 3300014325 Bacteria 10001
391 Ga0163163_10036436 3300014325 Bacteria 4779
392 Ga0163163_10079861 3300014325 Bacteria 3270
393 Ga0163163_10308778 3300014325 Bacteria 1634
394 Ga0163163_10449160 3300014325 Bacteria 1349
395 Ga0157380_10023425 3300014326 Bacteria 4657
396 Ga0157380_10027968 3300014326 Bacteria 4295
397 Ga0157380_10057833 3300014326 Bacteria 3089
398 Ga0157380_10090655 3300014326 Bacteria 2522
399 Ga0157380_10238880 3300014326 Bacteria 1637
400 Ga0157380_10363076 3300014326 Bacteria 1359
401 Ga0157377_10009324 3300014745 Bacteria 4808
402 Ga0157377_10040283 3300014745 Bacteria 2586
403 Ga0157377_10073747 3300014745 Bacteria 1979
404 Ga0157377_10078250 3300014745 Bacteria 1927
405 Ga0157377_10312198 3300014745 Bacteria 1042
406 Ga0157377_10327289 3300014745 Bacteria 1020
407 Ga0157379_10100973 3300014968 Bacteria 2589
408 Ga0157376_10385473 3300014969 Bacteria 1351
409 Ga0213872_10039578 3300021361 Bacteria 2151
410 Ga0207697_10008066 3300025315 Bacteria 4647
411 Ga0207697_10008492 3300025315 Bacteria 4490
412 Ga0207697_10047928 3300025315 Bacteria 1762
413 Ga0207653_10001629 3300025885 Bacteria 7226
414 Ga0207653_10059183 3300025885 Bacteria 1289
415 Ga0207682_10019563 3300025893 Bacteria 2651
416 Ga0207692_10239798 3300025898 Unclassified 1082
417 Ga0207710_10015587 3300025900 Bacteria 3214
418 Ga0207710_10208532 3300025900 Bacteria 967
419 Ga0207688_10005700 3300025901 Bacteria 6772
420 Ga0207688_10017187 3300025901 Bacteria 3930
421 Ga0207688_10035547 3300025901 Bacteria 2761
422 Ga0207680_10005415 3300025903 Bacteria 6098
423 Ga0207680_10043210 3300025903 Bacteria 2641
424 Ga0207647_10062073 3300025904 Bacteria 2277
425 Ga0207645_10010688 3300025907 Bacteria 6296
426 Ga0207645_10014924 3300025907 Bacteria 5181
427 Ga0207645_10214207 3300025907 Bacteria 1269
428 Ga0207643_10018772 3300025908 Bacteria 3787
429 Ga0207643_10037381 3300025908 Bacteria 2724
430 Ga0207643_10072081 3300025908 Bacteria 1989
431 Ga0207643_10073932 3300025908 Bacteria 1965
432 Ga0207684_10000079 3300025910 Bacteria 179842
433 Ga0207684_10031952 3300025910 Bacteria 4478
434 Ga0207684_10299002 3300025910 Bacteria 1388
435 Ga0207684_10634132 3300025910 Bacteria 911
436 Ga0207707_10021834 3300025912 Bacteria 5594
437 Ga0207707_10071114 3300025912 Bacteria 3031
438 Ga0207695_10171597 3300025913 Bacteria 2094
439 Ga0207695_10404193 3300025913 Viruses 1250
440 Ga0207671_10003525 3300025914 Bacteria 15516
441 Ga0207671_10037683 3300025914 Bacteria 3585
442 Ga0207671_10363500 3300025914 Bacteria 1149
443 Ga0207671_10419078 3300025914 Viruses 1065
444 Ga0207693_10198463 3300025915 Unclassified 1578
445 Ga0207662_10011883 3300025918 Bacteria 4840
446 Ga0207662_10048458 3300025918 Bacteria 2517
447 Ga0207662_10053633 3300025918 Bacteria 2402
448 Ga0207662_10128657 3300025918 Unclassified 1594
449 Ga0207662_10179089 3300025918 Bacteria 1363
450 Ga0207662_10237987 3300025918 Bacteria 1191
451 Ga0207657_10168407 3300025919 Bacteria 1776
452 Ga0207657_10302770 3300025919 Bacteria 1266
453 Ga0207649_10114337 3300025920 Bacteria 1809
454 Ga0207652_10061700 3300025921 Bacteria 3238
455 Ga0207646_10000282 3300025922 Bacteria 69731
456 Ga0207646_10547734 3300025922 Unclassified 1040
457 Ga0207681_10000879 3300025923 Bacteria 19782
458 Ga0207681_10042241 3300025923 Bacteria 3044
459 Ga0207681_10063967 3300025923 Bacteria 2538
460 Ga0207681_10072204 3300025923 Bacteria 2410
461 Ga0207681_10133032 3300025923 Bacteria 1841
462 Ga0207681_10348693 3300025923 Bacteria 1185
463 Ga0207650_10006493 3300025925 Bacteria 7972
464 Ga0207650_10011443 3300025925 Bacteria 6108
465 Ga0207659_10000585 3300025926 Bacteria 21814
466 Ga0207659_10003424 3300025926 Bacteria 9509
467 Ga0207659_10004901 3300025926 Bacteria 8108
468 Ga0207659_10012610 3300025926 Bacteria 5386
469 Ga0207659_10016074 3300025926 Bacteria 4865
470 Ga0207659_10064693 3300025926 Bacteria 2648
471 Ga0207659_10151964 3300025926 Bacteria 1809
472 Ga0207659_10314667 3300025926 Bacteria 1290
473 Ga0207664_10168483 3300025929 Bacteria 1873
474 Ga0207664_10185652 3300025929 Bacteria 1787
475 Ga0207644_10000824 3300025931 Bacteria 19722
476 Ga0207644_10006210 3300025931 Bacteria 7791
477 Ga0207690_10116306 3300025932 Bacteria 1934
478 Ga0207690_10224889 3300025932 Bacteria 1438
479 Ga0207690_10474734 3300025932 Bacteria 1009
480 Ga0207690_10555578 3300025932 Bacteria 934
481 Ga0207690_10629971 3300025932 Bacteria 877
482 Ga0207706_10009814 3300025933 Bacteria 8783
483 Ga0207706_10010833 3300025933 Bacteria 8318
484 Ga0207706_10298043 3300025933 Bacteria 1405
485 Ga0207706_10343687 3300025933 Bacteria 1298
486 Ga0207706_10482778 3300025933 Bacteria 1071
487 Ga0207706_10577395 3300025933 Unclassified 967
488 Ga0207709_10028359 3300025935 Bacteria 3236
489 Ga0207670_10004139 3300025936 Bacteria 7770
490 Ga0207670_10180598 3300025936 Bacteria 1589
491 Ga0207670_10211309 3300025936 Bacteria 1480
492 Ga0207670_10267520 3300025936 Bacteria 1327
493 Ga0207669_10000860 3300025937 Bacteria 12929
494 Ga0207704_10076399 3300025938 Bacteria 2146
495 Ga0207704_10382764 3300025938 Bacteria 1105
496 Ga0207704_10457730 3300025938 Bacteria 1020
497 Ga0207691_10000888 3300025940 Bacteria 29662
498 Ga0207691_10008155 3300025940 Bacteria 10055
499 Ga0207691_10037214 3300025940 Bacteria 4507
500 Ga0207691_10057461 3300025940 Bacteria 3541
501 Ga0207691_10154162 3300025940 Bacteria 2019
502 Ga0207691_10342784 3300025940 Bacteria 1279
503 Ga0207711_10078119 3300025941 Bacteria 2886
504 Ga0207711_10097151 3300025941 Bacteria 2601
505 Ga0207711_10420960 3300025941 Bacteria 1242
506 Ga0207689_10002833 3300025942 Bacteria 16002
507 Ga0207689_10143814 3300025942 Bacteria 1965
508 Ga0207689_10149738 3300025942 Unclassified 1924
509 Ga0207689_10212385 3300025942 Bacteria 1599
510 Ga0207661_10000003 3300025944 Bacteria 611941
511 Ga0207679_10001069 3300025945 Bacteria 17433
512 Ga0207679_10024700 3300025945 Bacteria 4123
513 Ga0207679_10034122 3300025945 Bacteria 3587
514 Ga0207679_10070632 3300025945 Bacteria 2631
515 Ga0207679_10294193 3300025945 Bacteria 1397
516 Ga0207651_10001222 3300025960 Bacteria 11527
517 Ga0207651_10015033 3300025960 Bacteria 4486
518 Ga0207651_10019400 3300025960 Bacteria 4074
519 Ga0207651_10190568 3300025960 Bacteria 1635
520 Ga0207651_10205324 3300025960 Bacteria 1582
521 Ga0207651_10229305 3300025960 Bacteria 1506
522 Ga0207651_10349705 3300025960 Bacteria 1244
523 Ga0207651_10469640 3300025960 Bacteria 1082
524 Ga0207712_10002060 3300025961 Bacteria 13198
525 Ga0207712_10020570 3300025961 Bacteria 4324
526 Ga0207712_10399925 3300025961 Bacteria 1154
527 Ga0207668_10355300 3300025972 Bacteria 1226
528 Ga0207668_10471405 3300025972 Bacteria 1075
529 Ga0207668_10549295 3300025972 Bacteria 1000
530 Ga0207640_10038408 3300025981 Unclassified 3021
531 Ga0207640_10073182 3300025981 Bacteria 2315
532 Ga0207640_10268744 3300025981 Bacteria 1333
533 Ga0207658_10035999 3300025986 Bacteria 3548
534 Ga0207658_10506125 3300025986 Bacteria 1076
535 Ga0207703_10015655 3300026035 Bacteria 5914
536 Ga0207703_10025335 3300026035 Unclassified 4666
537 Ga0207703_10367669 3300026035 Bacteria 1328
538 Ga0207708_10064512 3300026075 Bacteria 2798
539 Ga0207708_10080753 3300026075 Bacteria 2499
540 Ga0207708_10240498 3300026075 Bacteria 1456
541 Ga0207702_10014773 3300026078 Bacteria 6477
542 Ga0207702_10443319 3300026078 Bacteria 1259
543 Ga0207641_10048370 3300026088 Bacteria 3589
544 Ga0207641_10126926 3300026088 Bacteria 2285
545 Ga0207641_10188868 3300026088 Bacteria 1892
546 Ga0207641_10309634 3300026088 Bacteria 1494
547 Ga0207648_10011476 3300026089 Bacteria 8341
548 Ga0207648_10023955 3300026089 Bacteria 5457
549 Ga0207648_10077160 3300026089 Bacteria 2904
550 Ga0207648_10172522 3300026089 Bacteria 1912
551 Ga0207676_10005286 3300026095 Bacteria 9143
552 Ga0207676_10030545 3300026095 Bacteria 4045
553 Ga0207676_10031246 3300026095 Bacteria 4004
554 Ga0207676_10184794 3300026095 Bacteria 1828
555 Ga0207676_10188194 3300026095 Bacteria 1814
556 Ga0207676_10424127 3300026095 Bacteria 1248
557 Ga0207674_10000079 3300026116 Bacteria 102085
558 Ga0207674_10427178 3300026116 Bacteria 1280
559 Ga0207675_100001985 3300026118 Bacteria 20408
560 Ga0207675_100180796 3300026118 Bacteria 2019
561 Ga0207675_100584795 3300026118 Bacteria 1118
562 Ga0207675_100969071 3300026118 Bacteria 868
563 Ga0207683_10094437 3300026121 Bacteria 2665
564 Ga0207683_10230999 3300026121 Bacteria 1687
565 Ga0207683_10255606 3300026121 Bacteria 1599
566 Ga0207683_10303232 3300026121 Bacteria 1461
567 Ga0207698_10206406 3300026142 Bacteria 1764
568 Ga0207698_10375646 3300026142 Bacteria 1351
569 Ga0207698_11086780 3300026142 Unclassified 812
570 Ga0209968_1035156 3300027526 Bacteria 845
571 Ga0209971_1016111 3300027682 Bacteria 1772
572 Ga0209974_10031852 3300027876 Bacteria 1747
573 Ga0209974_10064369 3300027876 Bacteria 1244
574 Ga0207428_10001048 3300027907 Bacteria 30412
575 Ga0207428_10001642 3300027907 Bacteria 23263
576 Ga0207428_10006724 3300027907 Bacteria 10556
577 Ga0207428_10008918 3300027907 Bacteria 9035
578 Ga0207428_10117929 3300027907 Bacteria 2037
579 Ga0207428_10170016 3300027907 Bacteria 1651
580 Ga0207428_10180609 3300027907 Bacteria 1594
581 Ga0207428_10202726 3300027907 Bacteria 1492
582 Ga0207428_10241546 3300027907 Bacteria 1349
583 Ga0268266_10000161 3300028379 Bacteria 125387
584 Ga0268266_10223248 3300028379 Bacteria 1733
585 Ga0268265_10000135 3300028380 Bacteria 93986
586 Ga0268265_10008392 3300028380 Bacteria 6976
587 Ga0268265_10063517 3300028380 Bacteria 2841
588 Ga0268265_10134071 3300028380 Bacteria 2063
589 Ga0268265_10211904 3300028380 Bacteria 1689
590 Ga0268265_10539278 3300028380 Bacteria 1106
591 Ga0268264_10009058 3300028381 Bacteria 8259
592 Ga0268264_10145929 3300028381 Unclassified 2116
593 Ga0268264_10147190 3300028381 Bacteria 2108
594 Ga0268264_10188758 3300028381 Bacteria 1877
595 Ga0268264_10575924 3300028381 Bacteria 1107
596 Ga0268264_10679563 3300028381 Bacteria 1021
597 Ga0265338_10000029 3300028800 Bacteria 271824
598 Ga0265760_10000038 3300031090 Bacteria 42230
599 Ga0265331_10088025 3300031250 Bacteria 1438
600 Ga0307408_100054721 3300031548 Bacteria 2886
601 Ga0307408_100146495 3300031548 Bacteria 1859
602 Ga0265314_10035447 3300031711 Bacteria 3637
603 Ga0307405_10000588 3300031731 Bacteria 13937
604 Ga0307413_10009332 3300031824 Bacteria 4691
605 Ga0307413_10224684 3300031824 Bacteria 1374
606 Ga0307410_10004093 3300031852 Bacteria 7467
607 Ga0307407_10121615 3300031903 Bacteria 1656
608 Ga0307409_100012205 3300031995 Bacteria 5464
609 Ga0307416_100001585 3300032002 Bacteria 12480
610 Ga0307416_100018839 3300032002 Bacteria 4877
611 Ga0307416_100400576 3300032002 Bacteria 1410
612 Ga0307416_100674023 3300032002 Bacteria 1121
613 Ga0307411_10001285 3300032005 Bacteria 10069
614 Ga0307411_10061901 3300032005 Bacteria 2494
615 Ga0307411_10256221 3300032005 Bacteria 1379
616 Ga0307415_100001811 3300032126 Bacteria 10464
617 Ga0307415_100071602 3300032126 Bacteria 2439
618 Ga0373958_0042837 3300034819 Bacteria 931
619 Ga0373949_0009446 3300035090 Bacteria 2137
620 Ga0373951_0034204 3300035091 Bacteria 1206
621 Ga0373939_0021159 3300035114 Bacteria 1777
622 Ga0373939_0078368 3300035114 Bacteria 1092
623 Ga0373961_0000297 3300035241 Bacteria 22207
624 Ga0373937_0091916 3300036401 Unclassified 2812
625 Ga0395900_0414868 3300037418 Bacteria 1308
626 Ga0395898_0015655 3300037466 Bacteria 7772
627 Ga0395901_0462618 3300038443 Bacteria 1296
628 Ga0242420_009417 3300038996 Bacteria 1601
629 Ga0436365_1053164 3300039437 Unclassified 1024
630 Ga0436361_0156101 3300039447 Bacteria 21426
631 Ga0439448_0027297 3300042005 Bacteria 1798
632 Ga0450891_016591 3300042129 Bacteria 704
633 Ga0439458_0001621 3300042157 Bacteria 5620
634 Ga0439435_0009902 3300042436 Bacteria 2249
635 Ga0439435_0013999 3300042436 Bacteria 1975
636 Ga0439459_0045375 3300042438 Bacteria 948
637 Ga0450916_001806 3300042530 Bacteria 2188
638 Ga0451577_0006065 3300042876 Bacteria 12155
639 Ga0451577_0073780 3300042876 Bacteria 3044
640 Ga0451577_0757099 3300042876 Bacteria 878
641 Ga0453683_0023191 3300044673 Bacteria 3956
642 Ga0453683_0193404 3300044673 Bacteria 1291
643 Ga0466963_0052559 3300044694 Bacteria 2704
644 Ga0466963_0256185 3300044694 Bacteria 1228
645 Ga0453684_0007016 3300044712 Bacteria 21048
646 Ga0453684_0211404 3300044712 Bacteria 2254
647 Ga0466957_0034189 3300044842 Bacteria 3050
648 Ga0466959_0453710 3300045049 Bacteria 869
649 Ga0451576_0006728 3300045051 Bacteria 14003
650 Ga0451576_0015927 3300045051 Bacteria 8311
651 Ga0451576_0112797 3300045051 Bacteria 2830
652 Ga0451576_0360104 3300045051 Bacteria 1523
653 Ga0451576_0381213 3300045051 Bacteria 1478
654 Ga0466958_0104906 3300045836 Bacteria 1761
655 Ga0466967_0020441 3300045976 Bacteria 5352
656 Ga0495603_0007369 3300046455 Bacteria 6617
657 Ga0495638_0004257 3300046460 Bacteria 10891
658 Ga0495662_0237579 3300046476 Bacteria 898
659 Ga0495584_0006176 3300046491 Bacteria 6298
660 Ga0495585_0130195 3300046492 Bacteria 1325
661 Ga0495594_0067571 3300046499 Bacteria 1984
662 Ga0495642_0010266 3300046528 Bacteria 3586
663 Ga0495642_0145168 3300046528 Bacteria 1025
664 Ga0495598_0106180 3300046537 Bacteria 935
665 Ga0495609_0044028 3300046538 Bacteria 2003
666 Ga0495609_0175589 3300046538 Bacteria 903
667 Ga0495621_0006040 3300046539 Bacteria 3516
668 Ga0495621_0007839 3300046539 Bacteria 3175
669 Ga0495621_0066946 3300046539 Bacteria 1315
670 Ga0495621_0069244 3300046539 Bacteria 1296
671 Ga0495621_0094989 3300046539 Bacteria 1128
672 Ga0495656_0008786 3300046615 Bacteria 3620
673 Ga0495659_0080928 3300046664 Bacteria 1232
674 Ga0495659_0084266 3300046664 Bacteria 1211
675 Ga0495669_0088025 3300046684 Bacteria 1431
676 Ga0495670_0011807 3300046691 Bacteria 4300
677 Ga0495636_0024829 3300047318 Bacteria 2432
678 Ga0496103_0028216 3300048906 Bacteria 3405
679 Ga0496106_0184013 3300048909 Unclassified 1659
680 Ga0496109_0172228 3300048912 Bacteria 2031
681 Ga0496116_0043856 3300048919 Bacteria 3043
682 Ga0496117_0098185 3300048920 Bacteria 1863
683 Ga0496126_0079201 3300048929 Bacteria 2909
684 Ga0501298_042395 3300049521 Bacteria 925
685 Ga0501040_0089114 3300049576 Bacteria 2143
686 Ga0501042_0655782 3300049578 Bacteria 763
687 Ga0501048_0051528 3300049582 Bacteria 2930
688 Ga0501068_0088698 3300049584 Bacteria 1906
689 Ga0501071_0024452 3300049587 Bacteria 4227
690 Ga0501071_0516628 3300049587 Bacteria 916
691 Ga0501072_0284710 3300049588 Bacteria 1314
692 Ga0501072_0311615 3300049588 Bacteria 1251
693 Ga0501074_0450960 3300049590 Bacteria 912
694 Ga0501075_0021253 3300049591 Bacteria 4730
695 Ga0501075_0289361 3300049591 Bacteria 1248
696 Ga0501075_0529504 3300049591 Bacteria 899
697 Ga0501075_0567548 3300049591 Bacteria 866
698 Ga0501227_006404 3300049665 Bacteria 2531
699 Ga0501240_022566 3300049673 Bacteria 959
700 Ga0501259_012414 3300049688 Bacteria 1421
701 Ga0501229_015824 3300049706 Bacteria 980
702 Ga0501079_0066374 3300049741 Bacteria 2784
703 Ga0501080_0212080 3300049742 Bacteria 1775
704 Ga0501081_0190749 3300049743 Bacteria 1484
705 Ga0501081_0284202 3300049743 Bacteria 1212
706 Ga0501083_0001386 3300049744 Bacteria 16465
707 Ga0501271_010394 3300049768 Unclassified 982
708 Ga0501045_0041432 3300049824 Bacteria 3351
709 Ga0501045_0309578 3300049824 Bacteria 1175
710 Ga0501212_008037 3300049851 Bacteria 1458
711 nmdc:mga00v17_119854_c1 3300050491 Bacteria 1674
712 nmdc:mga0k408_32071_c1 3300050493 Bacteria 3002
713 nmdc:mga0k408_74420_c1 3300050493 Bacteria 1984
714 nmdc:mga0k408_8831_c1 3300050493 Bacteria 5422
715 nmdc:mga06z11_144809_c1 3300050494 Bacteria 1346
716 nmdc:mga06z11_79006_c1 3300050494 Bacteria 1760
717 nmdc:mga04h51_16446_c1 3300050495 Bacteria 2147
718 nmdc:mga07m45_3177_c1 3300050496 Bacteria 7886
719 nmdc:mga05p37_1_c1 3300050507 Bacteria 177088
720 nmdc:mga05p37_251236_c1 3300050507 Bacteria 2121
721 nmdc:mga05p37_40487_c1 3300050507 Bacteria 5723
722 nmdc:mga05p37_58869_c1 3300050507 Bacteria 4731
723 nmdc:mga09592_102390_c1 3300050508 Bacteria 2453
724 nmdc:mga09592_126612_c1 3300050508 Bacteria 2196
725 nmdc:mga09592_301948_c1 3300050508 Bacteria 1388
726 nmdc:mga09592_412521_c1 3300050508 Unclassified 1167
727 nmdc:mga09592_74053_c1 3300050508 Bacteria 2894
728 nmdc:mga09592_77774_c1 3300050508 Bacteria 2823
729 nmdc:mga0qj67_106354_c1 3300050509 Bacteria 2264
730 nmdc:mga0qj67_169793_c1 3300050509 Bacteria 1771
731 nmdc:mga0qj67_191946_c1 3300050509 Bacteria 1660
732 nmdc:mga0qj67_77166_c1 3300050509 Bacteria 2665
733 nmdc:mga0qj67_84948_c1 3300050509 Bacteria 2538
734 nmdc:mga06r32_117341_c1 3300050510 Bacteria 2623
735 nmdc:mga06r32_229568_c1 3300050510 Bacteria 1844
736 nmdc:mga06r32_395742_c1 3300050510 Bacteria 1364
737 nmdc:mga06r32_569058_c1 3300050510 Bacteria 1106
738 nmdc:mga06r32_663245_c1 3300050510 Bacteria 1011
739 nmdc:mga06r32_725078_c1 3300050510 Bacteria 959
740 nmdc:mga06r32_92361_c1 3300050510 Bacteria 2959
741 nmdc:mga08y16_153419_c1 3300050511 Unclassified 2394
742 nmdc:mga08y16_16314_c1 3300050511 Bacteria 7808
743 nmdc:mga08y16_20018_c1 3300050511 Bacteria 7059
744 nmdc:mga08y16_209702_c1 3300050511 Bacteria 2018
745 nmdc:mga08y16_294613_c1 3300050511 Bacteria 1673
746 nmdc:mga08y16_327926_c1 3300050511 Bacteria 1575
747 nmdc:mga08y16_3811_c1 3300050511 Bacteria 15684
748 nmdc:mga08y16_4121_c1 3300050511 Bacteria 15166
749 nmdc:mga08y16_557302_c1 3300050511 Bacteria 1159
750 nmdc:mga0n895_136419_c1 3300050512 Bacteria 2480
751 nmdc:mga0n895_13720_c1 3300050512 Bacteria 7326
752 nmdc:mga0n895_163473_c1 3300050512 Bacteria 2258
753 nmdc:mga0n895_23710_c1 3300050512 Bacteria 5771
754 nmdc:mga0n895_25567_c1 3300050512 Bacteria 5580
755 nmdc:mga0n895_45375_c1 3300050512 Bacteria 4289
756 nmdc:mga0n895_47058_c1 3300050512 Bacteria 4216
757 nmdc:mga0n895_56795_c1 3300050512 Bacteria 3857
758 nmdc:mga0rr50_129821_c1 3300050513 Bacteria 2016
759 nmdc:mga0rr50_192620_c1 3300050513 Bacteria 1672
760 nmdc:mga0rr50_211847_c1 3300050513 Bacteria 1596
761 nmdc:mga0rr50_267349_c1 3300050513 Bacteria 1424
762 nmdc:mga0rr50_330706_c1 3300050513 Unclassified 1279
763 nmdc:mga0rr50_392986_c1 3300050513 Bacteria 1171
764 nmdc:mga0rr50_5018_c1 3300050513 Bacteria 7841
765 nmdc:mga08x19_1968_c1 3300050514 Bacteria 12567
766 nmdc:mga08x19_39410_c1 3300050514 Bacteria 3003
767 nmdc:mga08x19_44398_c1 3300050514 Bacteria 2838
768 nmdc:mga0a205_114150_c1 3300050515 Bacteria 2600
769 nmdc:mga0a205_150089_c1 3300050515 Unclassified 2231
770 nmdc:mga0a205_1555_c1 3300050515 Bacteria 19642
771 nmdc:mga0a205_161954_c1 3300050515 Bacteria 2133
772 nmdc:mga0a205_19009_c1 3300050515 Bacteria 6473
773 nmdc:mga0a205_293_c2 3300050515 Bacteria 34916
774 nmdc:mga0a205_306359_c1 3300050515 Bacteria 1461
775 nmdc:mga0a205_42186_c1 3300050515 Bacteria 4395
776 nmdc:mga0a205_509108_c1 3300050515 Bacteria 1061
777 nmdc:mga0a205_7840_c2 3300050515 Bacteria 2036
778 nmdc:mga0a205_857408_c1 3300050515 Bacteria 755
779 Ga0500555_001047 3300053103 Bacteria 9328
780 Ga0500616_0000829 3300053153 Bacteria 34893
781 Ga0500616_0001144 3300053153 Bacteria 27218
782 Ga0500611_002917 3300053727 Bacteria 2120
783 Ga0500645_002423 3300053730 Bacteria 8342
784 Ga0501084_0198139 3300054114 Bacteria 1694
785 Ga0501084_0294563 3300054114 Bacteria 1370
786 Ga0590071_001172 3300059421 Bacteria 7088
787 Ga0590071_005369 3300059421 Bacteria 3084
788 Ga0501082_0082565 3300060353 Bacteria 2773
789 Ga0501082_0359596 3300060353 Bacteria 1270

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0757099 Ga0451577_0757099_38_610 182
2 3300048919 Ga0496116_0043856 Ga0496116_0043856_2392_2964 183
3 3300009101 Ga0105247_10051255 Ga0105247_100512553 189
4 3300050510 nmdc:mga06r32_725078_c1 nmdc:mga06r32_725078_c1_352_933 192
5 3300050513 nmdc:mga0rr50_392986_c1 nmdc:mga0rr50_392986_c1_38_649 198
6 3300042129 Ga0450891_016591 Ga0450891_016591_67_687 199
7 3300044694 Ga0466963_0256185 Ga0466963_0256185_228_845 199
8 3300045976 Ga0466967_0020441 Ga0466967_0020441_3159_3776 199
9 3300035114 Ga0373939_0078368 Ga0373939_0078368_21_674 200
10 3300006846 Ga0075430_100064842 Ga0075430_1000648422 201
11 3300006847 Ga0075431_100268034 Ga0075431_1002680342 201
12 3300013105 Ga0157369_10024559 Ga0157369_100245592 201
13 3300025929 Ga0207664_10168483 Ga0207664_101684833 201
14 3300005290 Ga0065712_10118747 Ga0065712_101187473 202
15 3300005293 Ga0065715_10090744 Ga0065715_100907446 202
16 3300005328 Ga0070676_10290456 Ga0070676_102904562 202
17 3300005334 Ga0068869_100078766 Ga0068869_1000787662 202
18 3300005354 Ga0070675_100087517 Ga0070675_1000875173 202
19 3300005355 Ga0070671_100074506 Ga0070671_1000745062 202
20 3300005444 Ga0070694_100179232 Ga0070694_1001792323 202
21 3300005457 Ga0070662_100066280 Ga0070662_1000662802 202
22 3300005546 Ga0070696_100054966 Ga0070696_1000549663 202
23 3300009553 Ga0105249_10046440 Ga0105249_100464402 202
24 3300005366 Ga0070659_100002627 Ga0070659_1000026279 203
25 3300005445 Ga0070708_100008725 Ga0070708_1000087252 203
26 3300005458 Ga0070681_10002209 Ga0070681_1000220914 203
27 3300005467 Ga0070706_100041728 Ga0070706_1000417282 203
28 3300005468 Ga0070707_100000983 Ga0070707_10000098322 203
29 3300005471 Ga0070698_100090695 Ga0070698_1000906954 203
30 3300005530 Ga0070679_100000737 Ga0070679_1000007374 203
31 3300005536 Ga0070697_100282478 Ga0070697_1002824782 203
32 3300014326 Ga0157380_10027968 Ga0157380_100279684 203
33 3300025910 Ga0207684_10634132 Ga0207684_106341322 203
34 3300025922 Ga0207646_10000282 Ga0207646_1000028255 203
35 3300031090 Ga0265760_10000038 Ga0265760_100000383 203
36 3300050511 nmdc:mga08y16_153419_c1 nmdc:mga08y16_153419_c1_66_746 203
37 3300050511 nmdc:mga08y16_557302_c1 nmdc:mga08y16_557302_c1_255_974 203
38 3300005518 Ga0070699_100262197 Ga0070699_1002621972 204
39 3300006844 Ga0075428_100024015 Ga0075428_1000240155 204
40 3300006846 Ga0075430_100040830 Ga0075430_1000408303 204
41 3300009147 Ga0114129_10109572 Ga0114129_101095722 204
42 3300044673 Ga0453683_0023191 Ga0453683_0023191_967_1620 204
43 3300044712 Ga0453684_0007016 Ga0453684_0007016_20349_21002 204
44 3300045051 Ga0451576_0006728 Ga0451576_0006728_11556_12209 204
45 3300049578 Ga0501042_0655782 Ga0501042_0655782_52_693 204
46 3300050508 nmdc:mga09592_126612_c1 nmdc:mga09592_126612_c1_1056_1697 204
47 3300053153 Ga0500616_0001144 Ga0500616_0001144_6748_7443 204
48 3300005841 Ga0068863_100054815 Ga0068863_1000548152 206
49 3300009551 Ga0105238_11104259 Ga0105238_111042592 206
50 3300021361 Ga0213872_10039578 Ga0213872_100395783 206
51 3300026088 Ga0207641_10188868 Ga0207641_101888682 206
52 3300039447 Ga0436361_0156101 Ga0436361_0156101_10376_11020 206
53 3300060353 Ga0501082_0359596 Ga0501082_0359596_36_782 206
54 3300005329 Ga0070683_100000002 Ga0070683_100000002364 207
55 3300005364 Ga0070673_100022334 Ga0070673_1000223342 207
56 3300005435 Ga0070714_100179072 Ga0070714_1001790722 207
57 3300013105 Ga0157369_10013391 Ga0157369_100133919 207
58 3300013105 Ga0157369_10459050 Ga0157369_104590503 207
59 3300025960 Ga0207651_10019400 Ga0207651_100194003 207
60 3300049591 Ga0501075_0529504 Ga0501075_0529504_131_880 207
61 3300005329 Ga0070683_100279457 Ga0070683_1002794572 208
62 3300010375 Ga0105239_10725689 Ga0105239_107256891 208
63 3300013307 Ga0157372_10010413 Ga0157372_100104134 208
64 3300028800 Ga0265338_10000029 Ga0265338_1000002952 208
65 3300031250 Ga0265331_10088025 Ga0265331_100880251 208
66 3300005355 Ga0070671_100008105 Ga0070671_1000081053 209
67 3300025931 Ga0207644_10006210 Ga0207644_100062103 209
68 3300042876 Ga0451577_0073780 Ga0451577_0073780_1899_2555 209
69 3300044712 Ga0453684_0211404 Ga0453684_0211404_817_1473 209
70 3300048920 Ga0496117_0098185 Ga0496117_0098185_738_1400 209
71 3300048929 Ga0496126_0079201 Ga0496126_0079201_1711_2373 209
72 3300005440 Ga0070705_100161038 Ga0070705_1001610382 210
73 3300013308 Ga0157375_10316157 Ga0157375_103161571 210
74 3300049591 Ga0501075_0289361 Ga0501075_0289361_450_1166 210
75 3300049744 Ga0501083_0001386 Ga0501083_0001386_6200_6919 210
76 3300049824 Ga0501045_0309578 Ga0501045_0309578_101_817 210
77 3300054114 Ga0501084_0294563 Ga0501084_0294563_552_1268 210
78 3300060353 Ga0501082_0082565 Ga0501082_0082565_630_1346 210
79 3300005459 Ga0068867_100188593 Ga0068867_1001885932 211
80 3300009176 Ga0105242_10451036 Ga0105242_104510362 211
81 3300026089 Ga0207648_10023955 Ga0207648_100239555 211
82 3300027526 Ga0209968_1035156 Ga0209968_10351561 211
83 3300035241 Ga0373961_0000297 Ga0373961_0000297_11558_12250 211
84 3300050510 nmdc:mga06r32_229568_c1 nmdc:mga06r32_229568_c1_406_1122 211
85 3300005331 Ga0070670_100001515 Ga0070670_1000015153 212
86 3300005336 Ga0070680_100643545 Ga0070680_1006435452 212
87 3300005337 Ga0070682_100353829 Ga0070682_1003538292 212
88 3300005340 Ga0070689_100035664 Ga0070689_1000356643 212
89 3300006881 Ga0068865_100236005 Ga0068865_1002360052 212
90 3300006914 Ga0075436_100000743 Ga0075436_10000074313 212
91 3300006914 Ga0075436_100075227 Ga0075436_1000752271 212
92 3300006914 Ga0075436_100242378 Ga0075436_1002423782 212
93 3300007076 Ga0075435_100590887 Ga0075435_1005908872 212
94 3300013104 Ga0157370_10409549 Ga0157370_104095492 212
95 3300013308 Ga0157375_10966423 Ga0157375_109664231 212
96 3300025898 Ga0207692_10239798 Ga0207692_102397982 212
97 3300025915 Ga0207693_10198463 Ga0207693_101984632 212
98 3300025925 Ga0207650_10011443 Ga0207650_100114436 212
99 3300025929 Ga0207664_10185652 Ga0207664_101856522 212
100 3300025938 Ga0207704_10457730 Ga0207704_104577302 212
101 3300026088 Ga0207641_10309634 Ga0207641_103096342 212
102 3300028381 Ga0268264_10679563 Ga0268264_106795632 212
103 3300050513 nmdc:mga0rr50_330706_c1 nmdc:mga0rr50_330706_c1_166_834 212
104 3300050514 nmdc:mga08x19_1968_c1 nmdc:mga08x19_1968_c1_5971_6639 212
105 3300050514 nmdc:mga08x19_39410_c1 nmdc:mga08x19_39410_c1_920_1588 212
106 3300050514 nmdc:mga08x19_44398_c1 nmdc:mga08x19_44398_c1_669_1337 212
107 3300005353 Ga0070669_100005541 Ga0070669_1000055414 213
108 3300005364 Ga0070673_100207321 Ga0070673_1002073212 213
109 3300005364 Ga0070673_100207555 Ga0070673_1002075552 213
110 3300005545 Ga0070695_100099652 Ga0070695_1000996521 213
111 3300005563 Ga0068855_100183077 Ga0068855_1001830774 213
112 3300005618 Ga0068864_100476115 Ga0068864_1004761151 213
113 3300006881 Ga0068865_100126489 Ga0068865_1001264893 213
114 3300009094 Ga0111539_10079531 Ga0111539_100795315 213
115 3300009147 Ga0114129_10049203 Ga0114129_100492031 213
116 3300009177 Ga0105248_11346235 Ga0105248_113462352 213
117 3300009553 Ga0105249_10046251 Ga0105249_100462514 213
118 3300013297 Ga0157378_10104249 Ga0157378_101042492 213
119 3300013297 Ga0157378_10402419 Ga0157378_104024192 213
120 3300013306 Ga0163162_10447279 Ga0163162_104472792 213
121 3300014969 Ga0157376_10385473 Ga0157376_103854732 213
122 3300025923 Ga0207681_10000879 Ga0207681_100008795 213
123 3300025944 Ga0207661_10000003 Ga0207661_10000003358 213
124 3300025960 Ga0207651_10190568 Ga0207651_101905682 213
125 3300026035 Ga0207703_10367669 Ga0207703_103676692 213
126 3300026095 Ga0207676_10424127 Ga0207676_104241272 213
127 3300028380 Ga0268265_10539278 Ga0268265_105392781 213
128 3300031824 Ga0307413_10224684 Ga0307413_102246842 213
129 3300031903 Ga0307407_10121615 Ga0307407_101216152 213
130 3300032002 Ga0307416_100018839 Ga0307416_1000188393 213
131 3300032126 Ga0307415_100071602 Ga0307415_1000716023 213
132 3300039437 Ga0436365_1053164 Ga0436365_1053164_100_807 213
133 3300044673 Ga0453683_0193404 Ga0453683_0193404_96_770 213
134 3300049587 Ga0501071_0516628 Ga0501071_0516628_91_789 213
135 3300050493 nmdc:mga0k408_8831_c1 nmdc:mga0k408_8831_c1_4128_4826 213
136 3300050495 nmdc:mga04h51_16446_c1 nmdc:mga04h51_16446_c1_976_1674 213
137 3300050515 nmdc:mga0a205_509108_c1 nmdc:mga0a205_509108_c1_172_858 213
138 3300053730 Ga0500645_002423 Ga0500645_002423_4063_4740 213
139 3300005356 Ga0070674_100100131 Ga0070674_1001001312 214
140 3300009094 Ga0111539_10089798 Ga0111539_100897981 214
141 3300009147 Ga0114129_10475000 Ga0114129_104750001 214
142 3300028381 Ga0268264_10575924 Ga0268264_105759241 214
143 3300044694 Ga0466963_0052559 Ga0466963_0052559_24_704 214
144 3300044842 Ga0466957_0034189 Ga0466957_0034189_700_1380 214
145 3300045049 Ga0466959_0453710 Ga0466959_0453710_136_816 214
146 3300045836 Ga0466958_0104906 Ga0466958_0104906_863_1543 214
147 3300046476 Ga0495662_0237579 Ga0495662_0237579_15_716 214
148 3300046528 Ga0495642_0145168 Ga0495642_0145168_227_919 214
149 3300046538 Ga0495609_0175589 Ga0495609_0175589_151_843 214
150 3300046539 Ga0495621_0007839 Ga0495621_0007839_2051_2743 214
151 3300046684 Ga0495669_0088025 Ga0495669_0088025_256_948 214
152 3300046691 Ga0495670_0011807 Ga0495670_0011807_3191_3883 214
153 3300050493 nmdc:mga0k408_74420_c1 nmdc:mga0k408_74420_c1_381_1076 214
154 3300005365 Ga0070688_100254058 Ga0070688_1002540582 215
155 3300005466 Ga0070685_10049081 Ga0070685_100490812 215
156 3300005467 Ga0070706_100105195 Ga0070706_1001051954 215
157 3300005546 Ga0070696_100292281 Ga0070696_1002922812 215
158 3300005548 Ga0070665_100000281 Ga0070665_10000028140 215
159 3300006847 Ga0075431_100302394 Ga0075431_1003023942 215
160 3300013308 Ga0157375_10230020 Ga0157375_102300202 215
161 3300025910 Ga0207684_10031952 Ga0207684_100319522 215
162 3300026121 Ga0207683_10094437 Ga0207683_100944372 215
163 3300027907 Ga0207428_10180609 Ga0207428_101806093 215
164 3300028379 Ga0268266_10000161 Ga0268266_1000016120 215
165 3300031711 Ga0265314_10035447 Ga0265314_100354473 215
166 3300042876 Ga0451577_0006065 Ga0451577_0006065_500_1156 215
167 3300005333 Ga0070677_10166575 Ga0070677_101665752 216
168 3300005338 Ga0068868_100557053 Ga0068868_1005570532 216
169 3300005842 Ga0068858_100989899 Ga0068858_1009898991 216
170 3300006844 Ga0075428_100278782 Ga0075428_1002787822 216
171 3300006844 Ga0075428_100307863 Ga0075428_1003078633 216
172 3300006846 Ga0075430_100110091 Ga0075430_1001100913 216
173 3300006847 Ga0075431_100015539 Ga0075431_1000155393 216
174 3300009093 Ga0105240_10013257 Ga0105240_100132572 216
175 3300009177 Ga0105248_10230990 Ga0105248_102309903 216
176 3300009545 Ga0105237_10384704 Ga0105237_103847042 216
177 3300009553 Ga0105249_10757433 Ga0105249_107574332 216
178 3300010375 Ga0105239_10018785 Ga0105239_100187858 216
179 3300025913 Ga0207695_10171597 Ga0207695_101715972 216
180 3300025914 Ga0207671_10363500 Ga0207671_103635002 216
181 3300025919 Ga0207657_10168407 Ga0207657_101684072 216
182 3300025923 Ga0207681_10348693 Ga0207681_103486932 216
183 3300025941 Ga0207711_10097151 Ga0207711_100971514 216
184 3300027876 Ga0209974_10064369 Ga0209974_100643692 216
185 3300038443 Ga0395901_0462618 Ga0395901_0462618_92_838 216
186 3300049584 Ga0501068_0088698 Ga0501068_0088698_249_944 216
187 3300050509 nmdc:mga0qj67_84948_c1 nmdc:mga0qj67_84948_c1_1077_1775 216
188 3300050515 nmdc:mga0a205_161954_c1 nmdc:mga0a205_161954_c1_961_1716 216
189 3300005289 Ga0065704_10113394 Ga0065704_101133943 217
190 3300005295 Ga0065707_10256441 Ga0065707_102564412 217
191 3300005295 Ga0065707_10284019 Ga0065707_102840192 217
192 3300005329 Ga0070683_100829850 Ga0070683_1008298502 217
193 3300005330 Ga0070690_100177126 Ga0070690_1001771262 217
194 3300005331 Ga0070670_100166949 Ga0070670_1001669493 217
195 3300005334 Ga0068869_100238904 Ga0068869_1002389042 217
196 3300005340 Ga0070689_100042217 Ga0070689_1000422174 217
197 3300005343 Ga0070687_100023099 Ga0070687_1000230993 217
198 3300005347 Ga0070668_100060823 Ga0070668_1000608233 217
199 3300005353 Ga0070669_100002059 Ga0070669_1000020598 217
200 3300005354 Ga0070675_100110037 Ga0070675_1001100372 217
201 3300005365 Ga0070688_100013523 Ga0070688_1000135234 217
202 3300005366 Ga0070659_100568797 Ga0070659_1005687971 217
203 3300005406 Ga0070703_10032020 Ga0070703_100320203 217
204 3300005440 Ga0070705_100379780 Ga0070705_1003797801 217
205 3300005444 Ga0070694_100012339 Ga0070694_1000123392 217
206 3300005457 Ga0070662_100345232 Ga0070662_1003452321 217
207 3300005458 Ga0070681_10348588 Ga0070681_103485882 217
208 3300005459 Ga0068867_100035716 Ga0068867_1000357163 217
209 3300005466 Ga0070685_10061739 Ga0070685_100617393 217
210 3300005530 Ga0070679_100466879 Ga0070679_1004668792 217
211 3300005543 Ga0070672_100020617 Ga0070672_1000206173 217
212 3300005544 Ga0070686_100112288 Ga0070686_1001122882 217
213 3300005544 Ga0070686_100129779 Ga0070686_1001297793 217
214 3300005546 Ga0070696_100015437 Ga0070696_1000154373 217
215 3300005549 Ga0070704_100017442 Ga0070704_1000174422 217
216 3300005549 Ga0070704_100044235 Ga0070704_1000442352 217
217 3300005577 Ga0068857_100125098 Ga0068857_1001250983 217
218 3300005614 Ga0068856_100525033 Ga0068856_1005250332 217
219 3300005617 Ga0068859_100006608 Ga0068859_10000660810 217
220 3300005618 Ga0068864_100073380 Ga0068864_1000733802 217
221 3300005719 Ga0068861_100001191 Ga0068861_10000119110 217
222 3300005840 Ga0068870_10001143 Ga0068870_100011431 217
223 3300005842 Ga0068858_100077467 Ga0068858_1000774672 217
224 3300005844 Ga0068862_100019276 Ga0068862_1000192765 217
225 3300006358 Ga0068871_100102965 Ga0068871_1001029652 217
226 3300006358 Ga0068871_100737756 Ga0068871_1007377562 217
227 3300006844 Ga0075428_100069048 Ga0075428_1000690483 217
228 3300006846 Ga0075430_100034887 Ga0075430_1000348873 217
229 3300006931 Ga0097620_100006608 Ga0097620_1000066081 217
230 3300009093 Ga0105240_10203959 Ga0105240_102039592 217
231 3300009094 Ga0111539_10005574 Ga0111539_1000557410 217
232 3300009094 Ga0111539_10311777 Ga0111539_103117773 217
233 3300009094 Ga0111539_10413225 Ga0111539_104132252 217
234 3300009101 Ga0105247_10248973 Ga0105247_102489732 217
235 3300009147 Ga0114129_10055343 Ga0114129_100553435 217
236 3300009176 Ga0105242_10643737 Ga0105242_106437372 217
237 3300009177 Ga0105248_10185633 Ga0105248_101856332 217
238 3300009553 Ga0105249_10004273 Ga0105249_100042736 217
239 3300010375 Ga0105239_10871401 Ga0105239_108714012 217
240 3300013297 Ga0157378_10298078 Ga0157378_102980782 217
241 3300013306 Ga0163162_10088850 Ga0163162_100888502 217
242 3300014326 Ga0157380_10363076 Ga0157380_103630763 217
243 3300025315 Ga0207697_10047928 Ga0207697_100479282 217
244 3300025885 Ga0207653_10059183 Ga0207653_100591831 217
245 3300025900 Ga0207710_10208532 Ga0207710_102085322 217
246 3300025901 Ga0207688_10005700 Ga0207688_100057003 217
247 3300025904 Ga0207647_10062073 Ga0207647_100620732 217
248 3300025907 Ga0207645_10214207 Ga0207645_102142072 217
249 3300025908 Ga0207643_10073932 Ga0207643_100739321 217
250 3300025912 Ga0207707_10021834 Ga0207707_100218346 217
251 3300025914 Ga0207671_10037683 Ga0207671_100376835 217
252 3300025923 Ga0207681_10063967 Ga0207681_100639672 217
253 3300025925 Ga0207650_10006493 Ga0207650_100064936 217
254 3300025932 Ga0207690_10555578 Ga0207690_105555781 217
255 3300025933 Ga0207706_10298043 Ga0207706_102980432 217
256 3300025935 Ga0207709_10028359 Ga0207709_100283592 217
257 3300025936 Ga0207670_10267520 Ga0207670_102675202 217
258 3300025940 Ga0207691_10008155 Ga0207691_100081559 217
259 3300025941 Ga0207711_10420960 Ga0207711_104209602 217
260 3300025960 Ga0207651_10349705 Ga0207651_103497052 217
261 3300025961 Ga0207712_10002060 Ga0207712_100020607 217
262 3300025981 Ga0207640_10073182 Ga0207640_100731823 217
263 3300026078 Ga0207702_10443319 Ga0207702_104433192 217
264 3300026089 Ga0207648_10011476 Ga0207648_100114766 217
265 3300026118 Ga0207675_100001985 Ga0207675_10000198511 217
266 3300026121 Ga0207683_10230999 Ga0207683_102309992 217
267 3300026142 Ga0207698_11086780 Ga0207698_110867801 217
268 3300027907 Ga0207428_10001642 Ga0207428_1000164218 217
269 3300027907 Ga0207428_10202726 Ga0207428_102027263 217
270 3300027907 Ga0207428_10241546 Ga0207428_102415462 217
271 3300028380 Ga0268265_10000135 Ga0268265_100001356 217
272 3300032002 Ga0307416_100674023 Ga0307416_1006740231 217
273 3300035114 Ga0373939_0021159 Ga0373939_0021159_201_893 217
274 3300049576 Ga0501040_0089114 Ga0501040_0089114_1245_1946 217
275 3300049582 Ga0501048_0051528 Ga0501048_0051528_1809_2510 217
276 3300049587 Ga0501071_0024452 Ga0501071_0024452_2474_3175 217
277 3300049588 Ga0501072_0284710 Ga0501072_0284710_374_1075 217
278 3300049590 Ga0501074_0450960 Ga0501074_0450960_168_869 217
279 3300049591 Ga0501075_0021253 Ga0501075_0021253_3234_3935 217
280 3300049741 Ga0501079_0066374 Ga0501079_0066374_1716_2417 217
281 3300049742 Ga0501080_0212080 Ga0501080_0212080_949_1650 217
282 3300049743 Ga0501081_0190749 Ga0501081_0190749_477_1178 217
283 3300049824 Ga0501045_0041432 Ga0501045_0041432_885_1586 217
284 3300050507 nmdc:mga05p37_40487_c1 nmdc:mga05p37_40487_c1_435_1136 217
285 3300050508 nmdc:mga09592_301948_c1 nmdc:mga09592_301948_c1_338_1036 217
286 3300050509 nmdc:mga0qj67_77166_c1 nmdc:mga0qj67_77166_c1_562_1263 217
287 3300050511 nmdc:mga08y16_16314_c1 nmdc:mga08y16_16314_c1_1603_2295 217
288 3300050511 nmdc:mga08y16_20018_c1 nmdc:mga08y16_20018_c1_5765_6466 217
289 3300050511 nmdc:mga08y16_327926_c1 nmdc:mga08y16_327926_c1_677_1366 217
290 3300054114 Ga0501084_0198139 Ga0501084_0198139_421_1122 217
291 3300059421 Ga0590071_005369 Ga0590071_005369_2257_3057 217
292 3300006042 Ga0075368_10004669 Ga0075368_100046696 218
293 3300006178 Ga0075367_10008309 Ga0075367_100083094 218
294 3300006195 Ga0075366_10002715 Ga0075366_100027152 218
295 3300009545 Ga0105237_10105838 Ga0105237_101058382 218
296 3300025986 Ga0207658_10506125 Ga0207658_105061252 218
297 3300032002 Ga0307416_100400576 Ga0307416_1004005762 218
298 3300034819 Ga0373958_0042837 Ga0373958_0042837_95_796 218
299 3300042530 Ga0450916_001806 Ga0450916_001806_1162_1863 218
300 3300046539 Ga0495621_0094989 Ga0495621_0094989_287_988 218
301 3300050491 nmdc:mga00v17_119854_c1 nmdc:mga00v17_119854_c1_392_1066 218
302 3300005290 Ga0065712_10002625 Ga0065712_100026253 219
303 3300005293 Ga0065715_10179547 Ga0065715_101795472 219
304 3300005338 Ga0068868_100763363 Ga0068868_1007633632 219
305 3300005340 Ga0070689_100268935 Ga0070689_1002689352 219
306 3300005354 Ga0070675_100128284 Ga0070675_1001282842 219
307 3300005364 Ga0070673_100006498 Ga0070673_1000064984 219
308 3300005364 Ga0070673_100521474 Ga0070673_1005214742 219
309 3300005467 Ga0070706_100000017 Ga0070706_1000000174 219
310 3300005543 Ga0070672_100325214 Ga0070672_1003252142 219
311 3300005548 Ga0070665_100514964 Ga0070665_1005149642 219
312 3300013308 Ga0157375_10190919 Ga0157375_101909192 219
313 3300014326 Ga0157380_10090655 Ga0157380_100906553 219
314 3300025910 Ga0207684_10000079 Ga0207684_1000007987 219
315 3300025923 Ga0207681_10072204 Ga0207681_100722043 219
316 3300025926 Ga0207659_10151964 Ga0207659_101519642 219
317 3300025936 Ga0207670_10211309 Ga0207670_102113092 219
318 3300025940 Ga0207691_10154162 Ga0207691_101541622 219
319 3300025960 Ga0207651_10015033 Ga0207651_100150333 219
320 3300037466 Ga0395898_0015655 Ga0395898_0015655_1014_1754 219
321 3300042005 Ga0439448_0027297 Ga0439448_0027297_241_978 219
322 3300042157 Ga0439458_0001621 Ga0439458_0001621_2604_3341 219
323 3300042436 Ga0439435_0009902 Ga0439435_0009902_1421_2158 219
324 3300042438 Ga0439459_0045375 Ga0439459_0045375_180_917 219
325 3300053103 Ga0500555_001047 Ga0500555_001047_1777_2451 219
326 3300005289 Ga0065704_10022647 Ga0065704_100226471 220
327 3300005295 Ga0065707_10099626 Ga0065707_100996264 220
328 3300005334 Ga0068869_100224091 Ga0068869_1002240912 220
329 3300005354 Ga0070675_100188634 Ga0070675_1001886341 220
330 3300005355 Ga0070671_100004964 Ga0070671_1000049648 220
331 3300005456 Ga0070678_100183990 Ga0070678_1001839902 220
332 3300005547 Ga0070693_100295660 Ga0070693_1002956602 220
333 3300005564 Ga0070664_100093533 Ga0070664_1000935332 220
334 3300005578 Ga0068854_100070373 Ga0068854_1000703733 220
335 3300005614 Ga0068856_100010662 Ga0068856_1000106629 220
336 3300005616 Ga0068852_100320017 Ga0068852_1003200172 220
337 3300005617 Ga0068859_100081330 Ga0068859_1000813302 220
338 3300005617 Ga0068859_100455762 Ga0068859_1004557621 220
339 3300005618 Ga0068864_100002881 Ga0068864_1000028816 220
340 3300005718 Ga0068866_10177249 Ga0068866_101772492 220
341 3300005840 Ga0068870_10036479 Ga0068870_100364793 220
342 3300005841 Ga0068863_100119373 Ga0068863_1001193732 220
343 3300005842 Ga0068858_100035013 Ga0068858_1000350136 220
344 3300005843 Ga0068860_100194224 Ga0068860_1001942242 220
345 3300005844 Ga0068862_100148510 Ga0068862_1001485102 220
346 3300006237 Ga0097621_100073884 Ga0097621_1000738843 220
347 3300006847 Ga0075431_100054172 Ga0075431_1000541722 220
348 3300006852 Ga0075433_10008532 Ga0075433_100085325 220
349 3300006852 Ga0075433_10018529 Ga0075433_100185294 220
350 3300006852 Ga0075433_10019163 Ga0075433_100191635 220
351 3300006852 Ga0075433_10245982 Ga0075433_102459822 220
352 3300006871 Ga0075434_100092464 Ga0075434_1000924642 220
353 3300006871 Ga0075434_100363791 Ga0075434_1003637911 220
354 3300006880 Ga0075429_100153766 Ga0075429_1001537662 220
355 3300006881 Ga0068865_100144722 Ga0068865_1001447222 220
356 3300006931 Ga0097620_100081330 Ga0097620_1000813304 220
357 3300006931 Ga0097620_100455728 Ga0097620_1004557281 220
358 3300007076 Ga0075435_100256365 Ga0075435_1002563652 220
359 3300009147 Ga0114129_10024805 Ga0114129_100248054 220
360 3300009177 Ga0105248_10053476 Ga0105248_100534763 220
361 3300009177 Ga0105248_10087961 Ga0105248_100879614 220
362 3300009545 Ga0105237_10104408 Ga0105237_101044084 220
363 3300013296 Ga0157374_10019423 Ga0157374_100194234 220
364 3300013297 Ga0157378_10008418 Ga0157378_100084183 220
365 3300013306 Ga0163162_10000539 Ga0163162_100005398 220
366 3300013307 Ga0157372_10074395 Ga0157372_100743955 220
367 3300013308 Ga0157375_10111777 Ga0157375_101117773 220
368 3300014325 Ga0163163_10006853 Ga0163163_100068534 220
369 3300014745 Ga0157377_10078250 Ga0157377_100782502 220
370 3300025908 Ga0207643_10018772 Ga0207643_100187722 220
371 3300025913 Ga0207695_10404193 Ga0207695_104041932 220
372 3300025914 Ga0207671_10419078 Ga0207671_104190782 220
373 3300025926 Ga0207659_10064693 Ga0207659_100646932 220
374 3300025931 Ga0207644_10000824 Ga0207644_1000082412 220
375 3300025933 Ga0207706_10482778 Ga0207706_104827782 220
376 3300025938 Ga0207704_10076399 Ga0207704_100763992 220
377 3300025941 Ga0207711_10078119 Ga0207711_100781192 220
378 3300025942 Ga0207689_10149738 Ga0207689_101497382 220
379 3300025942 Ga0207689_10212385 Ga0207689_102123852 220
380 3300025945 Ga0207679_10070632 Ga0207679_100706322 220
381 3300025981 Ga0207640_10038408 Ga0207640_100384082 220
382 3300026035 Ga0207703_10025335 Ga0207703_100253351 220
383 3300026078 Ga0207702_10014773 Ga0207702_100147736 220
384 3300026088 Ga0207641_10126926 Ga0207641_101269263 220
385 3300026095 Ga0207676_10005286 Ga0207676_100052866 220
386 3300026121 Ga0207683_10303232 Ga0207683_103032322 220
387 3300026142 Ga0207698_10375646 Ga0207698_103756462 220
388 3300028380 Ga0268265_10134071 Ga0268265_101340712 220
389 3300036401 Ga0373937_0091916 Ga0373937_0091916_1723_2463 220
390 3300037418 Ga0395900_0414868 Ga0395900_0414868_479_1219 220
391 3300038996 Ga0242420_009417 Ga0242420_009417_136_876 220
392 3300048906 Ga0496103_0028216 Ga0496103_0028216_2513_3253 220
393 3300048909 Ga0496106_0184013 Ga0496106_0184013_779_1519 220
394 3300050494 nmdc:mga06z11_79006_c1 nmdc:mga06z11_79006_c1_13_693 220
395 3300050507 nmdc:mga05p37_58869_c1 nmdc:mga05p37_58869_c1_875_1615 220
396 3300050508 nmdc:mga09592_412521_c1 nmdc:mga09592_412521_c1_410_1153 220
397 3300050510 nmdc:mga06r32_569058_c1 nmdc:mga06r32_569058_c1_202_954 220
398 3300050512 nmdc:mga0n895_23710_c1 nmdc:mga0n895_23710_c1_4553_5293 220
399 3300050513 nmdc:mga0rr50_129821_c1 nmdc:mga0rr50_129821_c1_1147_1887 220
400 3300050513 nmdc:mga0rr50_211847_c1 nmdc:mga0rr50_211847_c1_24_764 220
401 3300050515 nmdc:mga0a205_114150_c1 nmdc:mga0a205_114150_c1_848_1588 220
402 3300050515 nmdc:mga0a205_150089_c1 nmdc:mga0a205_150089_c1_1184_1930 220
403 3300050515 nmdc:mga0a205_19009_c1 nmdc:mga0a205_19009_c1_2853_3593 220
404 3300053153 Ga0500616_0000829 Ga0500616_0000829_3505_4182 220
405 3300005343 Ga0070687_100014988 Ga0070687_1000149882 221
406 3300005345 Ga0070692_10251610 Ga0070692_102516101 221
407 3300005440 Ga0070705_100040131 Ga0070705_1000401312 221
408 3300005441 Ga0070700_100349594 Ga0070700_1003495942 221
409 3300005444 Ga0070694_100013920 Ga0070694_1000139202 221
410 3300005539 Ga0068853_100197466 Ga0068853_1001974663 221
411 3300005548 Ga0070665_100462654 Ga0070665_1004626542 221
412 3300005549 Ga0070704_100010948 Ga0070704_1000109486 221
413 3300005616 Ga0068852_100409185 Ga0068852_1004091852 221
414 3300005618 Ga0068864_100582003 Ga0068864_1005820031 221
415 3300005834 Ga0068851_10151960 Ga0068851_101519602 221
416 3300005842 Ga0068858_100036842 Ga0068858_1000368422 221
417 3300006195 Ga0075366_10054578 Ga0075366_100545783 221
418 3300006353 Ga0075370_10033120 Ga0075370_100331203 221
419 3300006844 Ga0075428_100102438 Ga0075428_1001024383 221
420 3300009147 Ga0114129_10524507 Ga0114129_105245072 221
421 3300009147 Ga0114129_10663454 Ga0114129_106634542 221
422 3300009545 Ga0105237_10001605 Ga0105237_1000160523 221
423 3300013306 Ga0163162_10037891 Ga0163162_100378916 221
424 3300013307 Ga0157372_10346239 Ga0157372_103462392 221
425 3300014745 Ga0157377_10327289 Ga0157377_103272892 221
426 3300025885 Ga0207653_10001629 Ga0207653_100016297 221
427 3300025914 Ga0207671_10003525 Ga0207671_1000352510 221
428 3300025918 Ga0207662_10011883 Ga0207662_100118834 221
429 3300025918 Ga0207662_10128657 Ga0207662_101286573 221
430 3300025932 Ga0207690_10474734 Ga0207690_104747342 221
431 3300025938 Ga0207704_10382764 Ga0207704_103827642 221
432 3300026118 Ga0207675_100180796 Ga0207675_1001807962 221
433 3300028379 Ga0268266_10223248 Ga0268266_102232482 221
434 3300031548 Ga0307408_100146495 Ga0307408_1001464953 221
435 3300032005 Ga0307411_10256221 Ga0307411_102562212 221
436 3300046492 Ga0495585_0130195 Ga0495585_0130195_528_1226 221
437 3300046539 Ga0495621_0069244 Ga0495621_0069244_254_952 221
438 3300049521 Ga0501298_042395 Ga0501298_042395_30_776 221
439 3300049665 Ga0501227_006404 Ga0501227_006404_127_873 221
440 3300049673 Ga0501240_022566 Ga0501240_022566_125_871 221
441 3300049768 Ga0501271_010394 Ga0501271_010394_99_845 221
442 3300049851 Ga0501212_008037 Ga0501212_008037_41_787 221
443 3300050493 nmdc:mga0k408_32071_c1 nmdc:mga0k408_32071_c1_1341_2027 221
444 3300050496 nmdc:mga07m45_3177_c1 nmdc:mga07m45_3177_c1_95_781 221
445 3300059421 Ga0590071_001172 Ga0590071_001172_858_1616 221
446 3300003203 JGI25406J46586_10025285 JGI25406J46586_100252852 222
447 3300005289 Ga0065704_10153920 Ga0065704_101539201 222
448 3300005290 Ga0065712_10016166 Ga0065712_100161662 222
449 3300005331 Ga0070670_100071576 Ga0070670_1000715762 222
450 3300005331 Ga0070670_100500072 Ga0070670_1005000722 222
451 3300005333 Ga0070677_10059944 Ga0070677_100599442 222
452 3300005347 Ga0070668_100127988 Ga0070668_1001279882 222
453 3300005347 Ga0070668_100445241 Ga0070668_1004452412 222
454 3300005353 Ga0070669_100154516 Ga0070669_1001545162 222
455 3300005354 Ga0070675_100075497 Ga0070675_1000754973 222
456 3300005354 Ga0070675_100134579 Ga0070675_1001345791 222
457 3300005356 Ga0070674_100136853 Ga0070674_1001368532 222
458 3300005364 Ga0070673_100233756 Ga0070673_1002337561 222
459 3300005366 Ga0070659_100266754 Ga0070659_1002667542 222
460 3300005456 Ga0070678_100292017 Ga0070678_1002920172 222
461 3300005459 Ga0068867_100225054 Ga0068867_1002250542 222
462 3300005543 Ga0070672_100468492 Ga0070672_1004684922 222
463 3300005548 Ga0070665_100153067 Ga0070665_1001530673 222
464 3300005617 Ga0068859_100134300 Ga0068859_1001343003 222
465 3300005985 Ga0081539_10001769 Ga0081539_1000176922 222
466 3300006178 Ga0075367_10162981 Ga0075367_101629812 222
467 3300006195 Ga0075366_10219322 Ga0075366_102193222 222
468 3300006852 Ga0075433_10159247 Ga0075433_101592472 222
469 3300006881 Ga0068865_100098147 Ga0068865_1000981473 222
470 3300006881 Ga0068865_100201836 Ga0068865_1002018363 222
471 3300006931 Ga0097620_100134289 Ga0097620_1001342892 222
472 3300013306 Ga0163162_10072367 Ga0163162_100723673 222
473 3300014326 Ga0157380_10238880 Ga0157380_102388802 222
474 3300014968 Ga0157379_10100973 Ga0157379_101009732 222
475 3300025907 Ga0207645_10014924 Ga0207645_100149243 222
476 3300025922 Ga0207646_10547734 Ga0207646_105477341 222
477 3300025923 Ga0207681_10042241 Ga0207681_100422414 222
478 3300025926 Ga0207659_10314667 Ga0207659_103146673 222
479 3300025932 Ga0207690_10629971 Ga0207690_106299712 222
480 3300025937 Ga0207669_10000860 Ga0207669_1000086011 222
481 3300025940 Ga0207691_10037214 Ga0207691_100372144 222
482 3300025940 Ga0207691_10342784 Ga0207691_103427842 222
483 3300025972 Ga0207668_10355300 Ga0207668_103553002 222
484 3300026089 Ga0207648_10077160 Ga0207648_100771603 222
485 3300026118 Ga0207675_100584795 Ga0207675_1005847952 222
486 3300028380 Ga0268265_10063517 Ga0268265_100635172 222
487 3300028381 Ga0268264_10145929 Ga0268264_101459292 222
488 3300035091 Ga0373951_0034204 Ga0373951_0034204_261_1019 222
489 3300046460 Ga0495638_0004257 Ga0495638_0004257_9277_9966 222
490 3300046537 Ga0495598_0106180 Ga0495598_0106180_147_845 222
491 3300050494 nmdc:mga06z11_144809_c1 nmdc:mga06z11_144809_c1_248_937 222
492 3300053727 Ga0500611_002917 Ga0500611_002917_1003_1692 222
493 3300005340 Ga0070689_100100654 Ga0070689_1001006544 223
494 3300005457 Ga0070662_100550188 Ga0070662_1005501881 223
495 3300005518 Ga0070699_100151262 Ga0070699_1001512622 223
496 3300005539 Ga0068853_100004645 Ga0068853_1000046451 223
497 3300005564 Ga0070664_100033946 Ga0070664_1000339462 223
498 3300005577 Ga0068857_100105733 Ga0068857_1001057334 223
499 3300005618 Ga0068864_100054305 Ga0068864_1000543054 223
500 3300006871 Ga0075434_100060618 Ga0075434_1000606183 223
501 3300013307 Ga0157372_10369262 Ga0157372_103692622 223
502 3300014325 Ga0163163_10079861 Ga0163163_100798612 223
503 3300014325 Ga0163163_10449160 Ga0163163_104491602 223
504 3300025912 Ga0207707_10071114 Ga0207707_100711142 223
505 3300025921 Ga0207652_10061700 Ga0207652_100617003 223
506 3300025933 Ga0207706_10577395 Ga0207706_105773952 223
507 3300025945 Ga0207679_10034122 Ga0207679_100341224 223
508 3300026095 Ga0207676_10031246 Ga0207676_100312464 223
509 3300026116 Ga0207674_10000079 Ga0207674_1000007927 223
510 3300032005 Ga0307411_10061901 Ga0307411_100619012 223
511 3300050512 nmdc:mga0n895_136419_c1 nmdc:mga0n895_136419_c1_952_1710 223
512 3300050512 nmdc:mga0n895_13720_c1 nmdc:mga0n895_13720_c1_3688_4368 223
513 3300050512 nmdc:mga0n895_56795_c1 nmdc:mga0n895_56795_c1_2862_3545 223
514 3300050515 nmdc:mga0a205_857408_c1 nmdc:mga0a205_857408_c1_29_709 223
515 3300005295 Ga0065707_10090215 Ga0065707_100902154 224
516 3300005458 Ga0070681_10000273 Ga0070681_1000027336 224
517 3300006844 Ga0075428_100110669 Ga0075428_1001106692 224
518 3300006846 Ga0075430_100105973 Ga0075430_1001059733 224
519 3300006846 Ga0075430_100153334 Ga0075430_1001533342 224
520 3300006847 Ga0075431_100101664 Ga0075431_1001016643 224
521 3300006847 Ga0075431_100448728 Ga0075431_1004487282 224
522 3300006847 Ga0075431_100501857 Ga0075431_1005018572 224
523 3300006880 Ga0075429_100392938 Ga0075429_1003929382 224
524 3300009094 Ga0111539_10011387 Ga0111539_100113872 224
525 3300009094 Ga0111539_10028207 Ga0111539_100282075 224
526 3300027682 Ga0209971_1016111 Ga0209971_10161112 224
527 3300027907 Ga0207428_10001048 Ga0207428_1000104824 224
528 3300027907 Ga0207428_10008918 Ga0207428_100089182 224
529 3300045051 Ga0451576_0112797 Ga0451576_0112797_1414_2175 224
530 3300050507 nmdc:mga05p37_1_c1 nmdc:mga05p37_1_c1_36076_36837 224
531 3300050508 nmdc:mga09592_77774_c1 nmdc:mga09592_77774_c1_206_904 224
532 3300050509 nmdc:mga0qj67_106354_c1 nmdc:mga0qj67_106354_c1_730_1428 224
533 3300050509 nmdc:mga0qj67_169793_c1 nmdc:mga0qj67_169793_c1_893_1681 224
534 3300050509 nmdc:mga0qj67_191946_c1 nmdc:mga0qj67_191946_c1_308_1009 224
535 3300050510 nmdc:mga06r32_395742_c1 nmdc:mga06r32_395742_c1_75_854 224
536 3300050510 nmdc:mga06r32_663245_c1 nmdc:mga06r32_663245_c1_114_812 224
537 3300050510 nmdc:mga06r32_92361_c1 nmdc:mga06r32_92361_c1_20_772 224
538 3300050511 nmdc:mga08y16_4121_c1 nmdc:mga08y16_4121_c1_7860_8621 224
539 3300005347 Ga0070668_100137844 Ga0070668_1001378443 225
540 3300005441 Ga0070700_100050889 Ga0070700_1000508892 225
541 3300005441 Ga0070700_100193164 Ga0070700_1001931643 225
542 3300005455 Ga0070663_100314193 Ga0070663_1003141932 225
543 3300005518 Ga0070699_100373913 Ga0070699_1003739132 225
544 3300006051 Ga0075364_10319670 Ga0075364_103196701 225
545 3300006178 Ga0075367_10029494 Ga0075367_100294942 225
546 3300006847 Ga0075431_100196629 Ga0075431_1001966292 225
547 3300006852 Ga0075433_10000236 Ga0075433_1000023622 225
548 3300006871 Ga0075434_100001337 Ga0075434_10000133721 225
549 3300007076 Ga0075435_100001882 Ga0075435_1000018828 225
550 3300009094 Ga0111539_10397429 Ga0111539_103974292 225
551 3300009147 Ga0114129_10274606 Ga0114129_102746063 225
552 3300009147 Ga0114129_11499248 Ga0114129_114992481 225
553 3300025900 Ga0207710_10015587 Ga0207710_100155872 225
554 3300025960 Ga0207651_10469640 Ga0207651_104696402 225
555 3300025972 Ga0207668_10471405 Ga0207668_104714052 225
556 3300026075 Ga0207708_10064512 Ga0207708_100645122 225
557 3300026075 Ga0207708_10240498 Ga0207708_102404982 225
558 3300026089 Ga0207648_10172522 Ga0207648_101725222 225
559 3300031548 Ga0307408_100054721 Ga0307408_1000547212 225
560 3300031731 Ga0307405_10000588 Ga0307405_100005886 225
561 3300031824 Ga0307413_10009332 Ga0307413_100093324 225
562 3300031852 Ga0307410_10004093 Ga0307410_100040933 225
563 3300031995 Ga0307409_100012205 Ga0307409_1000122053 225
564 3300032002 Ga0307416_100001585 Ga0307416_1000015853 225
565 3300032005 Ga0307411_10001285 Ga0307411_100012859 225
566 3300032126 Ga0307415_100001811 Ga0307415_10000181111 225
567 3300050507 nmdc:mga05p37_251236_c1 nmdc:mga05p37_251236_c1_833_1528 225
568 3300050511 nmdc:mga08y16_209702_c1 nmdc:mga08y16_209702_c1_428_1126 225
569 3300050512 nmdc:mga0n895_25567_c1 nmdc:mga0n895_25567_c1_3819_4517 225
570 3300050515 nmdc:mga0a205_293_c2 nmdc:mga0a205_293_c2_14492_15190 225
571 3300050515 nmdc:mga0a205_306359_c1 nmdc:mga0a205_306359_c1_193_891 225
572 3300005340 Ga0070689_100114284 Ga0070689_1001142842 226
573 3300005347 Ga0070668_100267499 Ga0070668_1002674992 226
574 3300005354 Ga0070675_100241503 Ga0070675_1002415032 226
575 3300005356 Ga0070674_100492769 Ga0070674_1004927692 226
576 3300005364 Ga0070673_100164217 Ga0070673_1001642173 226
577 3300005365 Ga0070688_100015084 Ga0070688_1000150843 226
578 3300005438 Ga0070701_10044551 Ga0070701_100445513 226
579 3300005457 Ga0070662_100489548 Ga0070662_1004895481 226
580 3300005466 Ga0070685_10030778 Ga0070685_100307783 226
581 3300005544 Ga0070686_100600625 Ga0070686_1006006251 226
582 3300005617 Ga0068859_100037931 Ga0068859_1000379313 226
583 3300005618 Ga0068864_100016493 Ga0068864_1000164934 226
584 3300005842 Ga0068858_100174715 Ga0068858_1001747153 226
585 3300006880 Ga0075429_100073085 Ga0075429_1000730852 226
586 3300006931 Ga0097620_100037929 Ga0097620_1000379293 226
587 3300014325 Ga0163163_10036436 Ga0163163_100364365 226
588 3300025908 Ga0207643_10072081 Ga0207643_100720812 226
589 3300025918 Ga0207662_10053633 Ga0207662_100536332 226
590 3300025926 Ga0207659_10016074 Ga0207659_100160744 226
591 3300025945 Ga0207679_10024700 Ga0207679_100247002 226
592 3300025972 Ga0207668_10549295 Ga0207668_105492951 226
593 3300025981 Ga0207640_10268744 Ga0207640_102687442 226
594 3300026095 Ga0207676_10030545 Ga0207676_100305452 226
595 3300026116 Ga0207674_10427178 Ga0207674_104271782 226
596 3300046615 Ga0495656_0008786 Ga0495656_0008786_1638_2339 226
597 3300050508 nmdc:mga09592_74053_c1 nmdc:mga09592_74053_c1_315_1010 226
598 3300025961 Ga0207712_10399925 Ga0207712_103999252 227
599 3300001977 JGI24746J21847_1005306 JGI24746J21847_10053062 228
600 3300005289 Ga0065704_10073597 Ga0065704_100735974 228
601 3300005290 Ga0065712_10000219 Ga0065712_1000021910 228
602 3300005293 Ga0065715_10096482 Ga0065715_100964823 228
603 3300005293 Ga0065715_10097033 Ga0065715_100970333 228
604 3300005293 Ga0065715_10218196 Ga0065715_102181962 228
605 3300005295 Ga0065707_10001683 Ga0065707_100016832 228
606 3300005295 Ga0065707_10034238 Ga0065707_100342382 228
607 3300005295 Ga0065707_10232790 Ga0065707_102327901 228
608 3300005328 Ga0070676_10002802 Ga0070676_100028026 228
609 3300005328 Ga0070676_10016273 Ga0070676_100162735 228
610 3300005330 Ga0070690_100031524 Ga0070690_1000315243 228
611 3300005330 Ga0070690_100151542 Ga0070690_1001515422 228
612 3300005333 Ga0070677_10001401 Ga0070677_100014014 228
613 3300005333 Ga0070677_10063929 Ga0070677_100639292 228
614 3300005334 Ga0068869_100011805 Ga0068869_1000118054 228
615 3300005334 Ga0068869_100407333 Ga0068869_1004073332 228
616 3300005335 Ga0070666_10004032 Ga0070666_100040322 228
617 3300005335 Ga0070666_10063210 Ga0070666_100632102 228
618 3300005340 Ga0070689_100002830 Ga0070689_1000028306 228
619 3300005340 Ga0070689_100018135 Ga0070689_1000181355 228
620 3300005343 Ga0070687_100206374 Ga0070687_1002063741 228
621 3300005344 Ga0070661_100031836 Ga0070661_1000318361 228
622 3300005353 Ga0070669_100001921 Ga0070669_10000192116 228
623 3300005354 Ga0070675_100002457 Ga0070675_1000024573 228
624 3300005354 Ga0070675_100002479 Ga0070675_1000024793 228
625 3300005364 Ga0070673_100000726 Ga0070673_10000072612 228
626 3300005364 Ga0070673_100001253 Ga0070673_1000012534 228
627 3300005365 Ga0070688_100000591 Ga0070688_10000059116 228
628 3300005365 Ga0070688_100045520 Ga0070688_1000455203 228
629 3300005365 Ga0070688_100088356 Ga0070688_1000883562 228
630 3300005367 Ga0070667_100071360 Ga0070667_1000713602 228
631 3300005444 Ga0070694_100074129 Ga0070694_1000741292 228
632 3300005456 Ga0070678_100045389 Ga0070678_1000453893 228
633 3300005457 Ga0070662_100008143 Ga0070662_1000081435 228
634 3300005466 Ga0070685_10039236 Ga0070685_100392363 228
635 3300005467 Ga0070706_100166559 Ga0070706_1001665594 228
636 3300005471 Ga0070698_100007095 Ga0070698_1000070957 228
637 3300005518 Ga0070699_100003587 Ga0070699_1000035878 228
638 3300005543 Ga0070672_100000166 Ga0070672_10000016612 228
639 3300005543 Ga0070672_100166295 Ga0070672_1001662952 228
640 3300005544 Ga0070686_100029433 Ga0070686_1000294334 228
641 3300005546 Ga0070696_100017102 Ga0070696_1000171022 228
642 3300005564 Ga0070664_100010524 Ga0070664_1000105244 228
643 3300005615 Ga0070702_100184481 Ga0070702_1001844812 228
644 3300005617 Ga0068859_100007844 Ga0068859_1000078448 228
645 3300005618 Ga0068864_100203925 Ga0068864_1002039252 228
646 3300005618 Ga0068864_100371229 Ga0068864_1003712292 228
647 3300005840 Ga0068870_10032943 Ga0068870_100329432 228
648 3300005841 Ga0068863_100598458 Ga0068863_1005984582 228
649 3300005842 Ga0068858_100021713 Ga0068858_1000217137 228
650 3300005843 Ga0068860_100116460 Ga0068860_1001164603 228
651 3300005843 Ga0068860_100225107 Ga0068860_1002251072 228
652 3300005844 Ga0068862_100002024 Ga0068862_1000020243 228
653 3300005844 Ga0068862_100232554 Ga0068862_1002325542 228
654 3300006358 Ga0068871_100144118 Ga0068871_1001441182 228
655 3300006847 Ga0075431_100062799 Ga0075431_1000627992 228
656 3300006852 Ga0075433_10009913 Ga0075433_100099136 228
657 3300006871 Ga0075434_100007557 Ga0075434_1000075573 228
658 3300006880 Ga0075429_100072025 Ga0075429_1000720252 228
659 3300006931 Ga0097620_100007844 Ga0097620_1000078448 228
660 3300007076 Ga0075435_100217397 Ga0075435_1002173972 228
661 3300009094 Ga0111539_10002317 Ga0111539_1000231714 228
662 3300009094 Ga0111539_10023771 Ga0111539_100237716 228
663 3300009094 Ga0111539_10443772 Ga0111539_104437722 228
664 3300009553 Ga0105249_10003004 Ga0105249_100030046 228
665 3300011119 Ga0105246_10061211 Ga0105246_100612113 228
666 3300011119 Ga0105246_10275146 Ga0105246_102751462 228
667 3300013102 Ga0157371_10515618 Ga0157371_105156182 228
668 3300013306 Ga0163162_10004052 Ga0163162_100040527 228
669 3300013306 Ga0163162_10697308 Ga0163162_106973082 228
670 3300013308 Ga0157375_10005816 Ga0157375_100058166 228
671 3300013308 Ga0157375_10018153 Ga0157375_100181536 228
672 3300013308 Ga0157375_10153586 Ga0157375_101535863 228
673 3300014326 Ga0157380_10023425 Ga0157380_100234255 228
674 3300014326 Ga0157380_10057833 Ga0157380_100578333 228
675 3300014745 Ga0157377_10009324 Ga0157377_100093245 228
676 3300014745 Ga0157377_10040283 Ga0157377_100402832 228
677 3300014745 Ga0157377_10073747 Ga0157377_100737472 228
678 3300025315 Ga0207697_10008066 Ga0207697_100080662 228
679 3300025315 Ga0207697_10008492 Ga0207697_100084923 228
680 3300025893 Ga0207682_10019563 Ga0207682_100195634 228
681 3300025901 Ga0207688_10017187 Ga0207688_100171874 228
682 3300025901 Ga0207688_10035547 Ga0207688_100355472 228
683 3300025903 Ga0207680_10005415 Ga0207680_100054157 228
684 3300025903 Ga0207680_10043210 Ga0207680_100432102 228
685 3300025907 Ga0207645_10010688 Ga0207645_100106887 228
686 3300025908 Ga0207643_10037381 Ga0207643_100373812 228
687 3300025910 Ga0207684_10299002 Ga0207684_102990022 228
688 3300025918 Ga0207662_10048458 Ga0207662_100484584 228
689 3300025918 Ga0207662_10179089 Ga0207662_101790892 228
690 3300025919 Ga0207657_10302770 Ga0207657_103027702 228
691 3300025920 Ga0207649_10114337 Ga0207649_101143372 228
692 3300025923 Ga0207681_10133032 Ga0207681_101330322 228
693 3300025926 Ga0207659_10000585 Ga0207659_1000058515 228
694 3300025926 Ga0207659_10003424 Ga0207659_100034249 228
695 3300025926 Ga0207659_10004901 Ga0207659_100049016 228
696 3300025932 Ga0207690_10116306 Ga0207690_101163063 228
697 3300025933 Ga0207706_10009814 Ga0207706_100098144 228
698 3300025933 Ga0207706_10010833 Ga0207706_100108336 228
699 3300025933 Ga0207706_10343687 Ga0207706_103436873 228
700 3300025936 Ga0207670_10004139 Ga0207670_100041392 228
701 3300025936 Ga0207670_10180598 Ga0207670_101805982 228
702 3300025940 Ga0207691_10000888 Ga0207691_100008886 228
703 3300025940 Ga0207691_10057461 Ga0207691_100574613 228
704 3300025942 Ga0207689_10002833 Ga0207689_100028333 228
705 3300025945 Ga0207679_10001069 Ga0207679_1000106911 228
706 3300025945 Ga0207679_10294193 Ga0207679_102941931 228
707 3300025960 Ga0207651_10001222 Ga0207651_1000122210 228
708 3300025960 Ga0207651_10229305 Ga0207651_102293052 228
709 3300025961 Ga0207712_10020570 Ga0207712_100205701 228
710 3300025986 Ga0207658_10035999 Ga0207658_100359993 228
711 3300026035 Ga0207703_10015655 Ga0207703_100156552 228
712 3300026075 Ga0207708_10080753 Ga0207708_100807532 228
713 3300026088 Ga0207641_10048370 Ga0207641_100483702 228
714 3300026095 Ga0207676_10188194 Ga0207676_101881942 228
715 3300026118 Ga0207675_100969071 Ga0207675_1009690711 228
716 3300026121 Ga0207683_10255606 Ga0207683_102556062 228
717 3300027876 Ga0209974_10031852 Ga0209974_100318523 228
718 3300027907 Ga0207428_10006724 Ga0207428_100067247 228
719 3300027907 Ga0207428_10117929 Ga0207428_101179292 228
720 3300027907 Ga0207428_10170016 Ga0207428_101700162 228
721 3300028380 Ga0268265_10008392 Ga0268265_100083926 228
722 3300028380 Ga0268265_10211904 Ga0268265_102119043 228
723 3300028381 Ga0268264_10147190 Ga0268264_101471902 228
724 3300028381 Ga0268264_10188758 Ga0268264_101887582 228
725 3300035090 Ga0373949_0009446 Ga0373949_0009446_953_1651 228
726 3300042436 Ga0439435_0013999 Ga0439435_0013999_478_1176 228
727 3300045051 Ga0451576_0015927 Ga0451576_0015927_5743_6441 228
728 3300045051 Ga0451576_0381213 Ga0451576_0381213_14_712 228
729 3300046664 Ga0495659_0084266 Ga0495659_0084266_498_1187 228
730 3300048912 Ga0496109_0172228 Ga0496109_0172228_1188_1886 228
731 3300049588 Ga0501072_0311615 Ga0501072_0311615_14_709 228
732 3300049591 Ga0501075_0567548 Ga0501075_0567548_90_785 228
733 3300049688 Ga0501259_012414 Ga0501259_012414_326_1024 228
734 3300049706 Ga0501229_015824 Ga0501229_015824_104_802 228
735 3300049743 Ga0501081_0284202 Ga0501081_0284202_251_949 228
736 3300050508 nmdc:mga09592_102390_c1 nmdc:mga09592_102390_c1_1324_2022 228
737 3300050510 nmdc:mga06r32_117341_c1 nmdc:mga06r32_117341_c1_175_873 228
738 3300050511 nmdc:mga08y16_294613_c1 nmdc:mga08y16_294613_c1_912_1610 228
739 3300050511 nmdc:mga08y16_3811_c1 nmdc:mga08y16_3811_c1_13822_14517 228
740 3300050512 nmdc:mga0n895_47058_c1 nmdc:mga0n895_47058_c1_1491_2189 228
741 3300050513 nmdc:mga0rr50_267349_c1 nmdc:mga0rr50_267349_c1_362_1060 228
742 3300050515 nmdc:mga0a205_1555_c1 nmdc:mga0a205_1555_c1_684_1382 228
743 3300050515 nmdc:mga0a205_42186_c1 nmdc:mga0a205_42186_c1_1815_2525 228
744 2162886007 SwRhRL2b_contig_122425 SwRhRL2b_0676.00003140 229
745 3300005289 Ga0065704_10076056 Ga0065704_100760562 229
746 3300005295 Ga0065707_10099283 Ga0065707_100992831 229
747 3300005345 Ga0070692_10201882 Ga0070692_102018822 229
748 3300005364 Ga0070673_100202599 Ga0070673_1002025993 229
749 3300005366 Ga0070659_100233369 Ga0070659_1002333693 229
750 3300005440 Ga0070705_100038972 Ga0070705_1000389724 229
751 3300005468 Ga0070707_100178936 Ga0070707_1001789362 229
752 3300005471 Ga0070698_100063792 Ga0070698_1000637923 229
753 3300005536 Ga0070697_100111953 Ga0070697_1001119532 229
754 3300005536 Ga0070697_100401816 Ga0070697_1004018162 229
755 3300005549 Ga0070704_100260858 Ga0070704_1002608582 229
756 3300005617 Ga0068859_100015089 Ga0068859_1000150894 229
757 3300006237 Ga0097621_100065937 Ga0097621_1000659372 229
758 3300006852 Ga0075433_10323417 Ga0075433_103234171 229
759 3300006871 Ga0075434_100086968 Ga0075434_1000869682 229
760 3300006871 Ga0075434_100837596 Ga0075434_1008375962 229
761 3300006931 Ga0097620_100015088 Ga0097620_1000150885 229
762 3300007076 Ga0075435_100048142 Ga0075435_1000481422 229
763 3300009147 Ga0114129_11920224 Ga0114129_119202241 229
764 3300013296 Ga0157374_10279585 Ga0157374_102795852 229
765 3300014325 Ga0163163_10308778 Ga0163163_103087782 229
766 3300014745 Ga0157377_10312198 Ga0157377_103121981 229
767 3300025918 Ga0207662_10237987 Ga0207662_102379872 229
768 3300025926 Ga0207659_10012610 Ga0207659_100126103 229
769 3300025932 Ga0207690_10224889 Ga0207690_102248892 229
770 3300025942 Ga0207689_10143814 Ga0207689_101438144 229
771 3300025960 Ga0207651_10205324 Ga0207651_102053243 229
772 3300026095 Ga0207676_10184794 Ga0207676_101847942 229
773 3300026142 Ga0207698_10206406 Ga0207698_102064062 229
774 3300028381 Ga0268264_10009058 Ga0268264_100090585 229
775 3300045051 Ga0451576_0360104 Ga0451576_0360104_35_727 229
776 3300046455 Ga0495603_0007369 Ga0495603_0007369_3297_3995 229
777 3300046491 Ga0495584_0006176 Ga0495584_0006176_1627_2319 229
778 3300046499 Ga0495594_0067571 Ga0495594_0067571_442_1140 229
779 3300046528 Ga0495642_0010266 Ga0495642_0010266_2835_3527 229
780 3300046538 Ga0495609_0044028 Ga0495609_0044028_167_859 229
781 3300046539 Ga0495621_0006040 Ga0495621_0006040_626_1318 229
782 3300046539 Ga0495621_0066946 Ga0495621_0066946_124_816 229
783 3300046664 Ga0495659_0080928 Ga0495659_0080928_195_887 229
784 3300047318 Ga0495636_0024829 Ga0495636_0024829_320_1012 229
785 3300050512 nmdc:mga0n895_163473_c1 nmdc:mga0n895_163473_c1_58_750 229
786 3300050512 nmdc:mga0n895_45375_c1 nmdc:mga0n895_45375_c1_305_997 229
787 3300050513 nmdc:mga0rr50_192620_c1 nmdc:mga0rr50_192620_c1_699_1391 229
788 3300050513 nmdc:mga0rr50_5018_c1 nmdc:mga0rr50_5018_c1_4421_5113 229
789 3300050515 nmdc:mga0a205_7840_c2 nmdc:mga0a205_7840_c2_1205_1897 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00510

COX3

Cytochrome c oxidase subunit III

166

256

0.94

PF00510

COX3

Cytochrome c oxidase subunit III

42

173

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rh5-assembly1.cif.gz_S mycobacterial ciii2civ2 supercomplex, inhibitor free 0.9091 35 222
7e1v-assembly1.cif.gz_G cryo-em structure of apo hybrid respiratory supercomplex consisting of mycobacterium tuberculosis complexiii and mycobacterium smegmatis complexiv 0.9016 35 222
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.894 30 223
2yev-assembly2.cif.gz_A structure of caa3-type cytochrome oxidase 0.8889 36 220
7qhm-assembly1.cif.gz_S cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) 0.8877 33 222
ID Description Score Start End Superfamily
af_Q2FZK1_13_198_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8947 29 224 1.20.120.80
af_Q2FZK1_13_198_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.881 29 224 1.20.120.80
2yevD03 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8795 35 220 1.20.120.80
af_P9WP67_20_203_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8701 35 222 1.20.120.80
af_P14575_77_269_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8532 25 221 1.20.120.80
ID Description Score Start End GO Terms
AF-A0A7C2R622-F1-model_v4 Cytochrome c oxidase subunit 3 family protein 0.994 38 224 GO:0004129
GO:0005886
GO:0019646
AF-A0A2V7VQZ1-F1-model_v4 Cytochrome oxidase subunit III 0.9842 38 226 GO:0004129
GO:0005886
GO:0019646
AF-A0A561HI98-F1-model_v4 deleted 0.9817 23 224
AF-A0A359CB41-F1-model_v4 Cytochrome C oxidase subunit III 0.9812 25 222 GO:0004129
GO:0005886
GO:0019646
AF-A0A7C1X987-F1-model_v4 Cytochrome c oxidase subunit 3 family protein 0.9783 35 222 GO:0004129
GO:0005886
GO:0019646

Feature Viewer

pLDDT pTM Quality
85.57 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map