F480925
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 789 | 277 | 789 | 231 |
Family's Representative Sequence
| Representative Sequence | 3300050509|nmdc:mga0qj67_169793_c1|nmdc:mga0qj67_169793_c1_893_1681 |
| Length | 262 |
| Sequence | LAEPSTSLGPGPSTSPGGPRSKTPLPAAPHGVAVAEHAHHPRLQHHFYSMEQQLEASILGMWIFLVTEIMFFGGLFMAYLVYRTMYPQAWLDGSAALDVPLGALNTAVLICSSLTMVLSVRAAQVGSRRGQIVNLILTILFGTTFLVVKYFEYAAKFEHHLIPGPHFSVHYLEELGRTGADPFSTQLFFSLYFIMTGIHAAHMVVGIGLMSVILLMAWRGRFTPDYYGPIEVSGLYWHFVDIVWIFLFPLLYLLGLHGGHGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 118 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 179 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 180 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 183 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 184 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 185 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 186 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 187 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 188 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 189 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 191 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 193 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 194 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 196 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 197 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 198 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 199 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 200 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 201 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 202 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 203 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 204 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 205 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 206 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 207 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 208 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 209 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 210 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 211 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 212 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 213 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 214 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 215 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 216 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 232 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 233 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 235 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 236 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 237 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 238 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 247 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 248 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 249 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 250 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 255 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 257 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 258 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 259 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 260 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 261 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 262 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 272 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 273 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 274 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 275 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 277 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.87 |
| Metatranscriptomes | 0.13 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.79 |
| Nodule | 0 |
| Rhizoplane | 0.38 |
| Rhizosphere | 96.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_122425 | 2162886007 | Bacteria | 846 |
| 2 | JGI24746J21847_1005306 | 3300001977 | Bacteria | 2014 |
| 3 | JGI25406J46586_10025285 | 3300003203 | Bacteria | 2307 |
| 4 | Ga0065704_10022647 | 3300005289 | Bacteria | 1485 |
| 5 | Ga0065704_10073597 | 3300005289 | Bacteria | 6976 |
| 6 | Ga0065704_10076056 | 3300005289 | Bacteria | 5272 |
| 7 | Ga0065704_10113394 | 3300005289 | Bacteria | 1913 |
| 8 | Ga0065704_10153920 | 3300005289 | Bacteria | 1405 |
| 9 | Ga0065712_10000219 | 3300005290 | Bacteria | 22736 |
| 10 | Ga0065712_10002625 | 3300005290 | Bacteria | 5351 |
| 11 | Ga0065712_10016166 | 3300005290 | Bacteria | 2544 |
| 12 | Ga0065712_10118747 | 3300005290 | Bacteria | 1702 |
| 13 | Ga0065715_10090744 | 3300005293 | Bacteria | 6526 |
| 14 | Ga0065715_10096482 | 3300005293 | Bacteria | 3871 |
| 15 | Ga0065715_10097033 | 3300005293 | Bacteria | 3773 |
| 16 | Ga0065715_10179547 | 3300005293 | Bacteria | 1486 |
| 17 | Ga0065715_10218196 | 3300005293 | Bacteria | 1283 |
| 18 | Ga0065707_10001683 | 3300005295 | Bacteria | 5818 |
| 19 | Ga0065707_10034238 | 3300005295 | Bacteria | 1256 |
| 20 | Ga0065707_10090215 | 3300005295 | Bacteria | 4184 |
| 21 | Ga0065707_10099283 | 3300005295 | Bacteria | 3019 |
| 22 | Ga0065707_10099626 | 3300005295 | Bacteria | 2931 |
| 23 | Ga0065707_10232790 | 3300005295 | Bacteria | 1183 |
| 24 | Ga0065707_10256441 | 3300005295 | Bacteria | 1110 |
| 25 | Ga0065707_10284019 | 3300005295 | Bacteria | 1041 |
| 26 | Ga0070676_10002802 | 3300005328 | Bacteria | 9009 |
| 27 | Ga0070676_10016273 | 3300005328 | Bacteria | 4110 |
| 28 | Ga0070676_10290456 | 3300005328 | Bacteria | 1105 |
| 29 | Ga0070683_100000002 | 3300005329 | Bacteria | 427530 |
| 30 | Ga0070683_100279457 | 3300005329 | Bacteria | 1588 |
| 31 | Ga0070683_100829850 | 3300005329 | Bacteria | 886 |
| 32 | Ga0070690_100031524 | 3300005330 | Bacteria | 3303 |
| 33 | Ga0070690_100151542 | 3300005330 | Bacteria | 1582 |
| 34 | Ga0070690_100177126 | 3300005330 | Bacteria | 1471 |
| 35 | Ga0070670_100001515 | 3300005331 | Bacteria | 18706 |
| 36 | Ga0070670_100071576 | 3300005331 | Bacteria | 2977 |
| 37 | Ga0070670_100166949 | 3300005331 | Bacteria | 1909 |
| 38 | Ga0070670_100500072 | 3300005331 | Bacteria | 1081 |
| 39 | Ga0070677_10001401 | 3300005333 | Bacteria | 7688 |
| 40 | Ga0070677_10059944 | 3300005333 | Bacteria | 1566 |
| 41 | Ga0070677_10063929 | 3300005333 | Bacteria | 1527 |
| 42 | Ga0070677_10166575 | 3300005333 | Bacteria | 1038 |
| 43 | Ga0068869_100011805 | 3300005334 | Bacteria | 5746 |
| 44 | Ga0068869_100078766 | 3300005334 | Bacteria | 2455 |
| 45 | Ga0068869_100224091 | 3300005334 | Bacteria | 1491 |
| 46 | Ga0068869_100238904 | 3300005334 | Bacteria | 1447 |
| 47 | Ga0068869_100407333 | 3300005334 | Bacteria | 1120 |
| 48 | Ga0070666_10004032 | 3300005335 | Bacteria | 8913 |
| 49 | Ga0070666_10063210 | 3300005335 | Bacteria | 2509 |
| 50 | Ga0070680_100643545 | 3300005336 | Bacteria | 911 |
| 51 | Ga0070682_100353829 | 3300005337 | Bacteria | 1096 |
| 52 | Ga0068868_100557053 | 3300005338 | Bacteria | 1011 |
| 53 | Ga0068868_100763363 | 3300005338 | Bacteria | 870 |
| 54 | Ga0070689_100002830 | 3300005340 | Bacteria | 11412 |
| 55 | Ga0070689_100018135 | 3300005340 | Bacteria | 5181 |
| 56 | Ga0070689_100035664 | 3300005340 | Bacteria | 3801 |
| 57 | Ga0070689_100042217 | 3300005340 | Bacteria | 3501 |
| 58 | Ga0070689_100100654 | 3300005340 | Bacteria | 2287 |
| 59 | Ga0070689_100114284 | 3300005340 | Bacteria | 2150 |
| 60 | Ga0070689_100268935 | 3300005340 | Bacteria | 1411 |
| 61 | Ga0070687_100014988 | 3300005343 | Bacteria | 3495 |
| 62 | Ga0070687_100023099 | 3300005343 | Bacteria | 2951 |
| 63 | Ga0070687_100206374 | 3300005343 | Bacteria | 1194 |
| 64 | Ga0070661_100031836 | 3300005344 | Bacteria | 3815 |
| 65 | Ga0070692_10201882 | 3300005345 | Bacteria | 1165 |
| 66 | Ga0070692_10251610 | 3300005345 | Unclassified | 1058 |
| 67 | Ga0070668_100060823 | 3300005347 | Bacteria | 2926 |
| 68 | Ga0070668_100127988 | 3300005347 | Bacteria | 2036 |
| 69 | Ga0070668_100137844 | 3300005347 | Bacteria | 1964 |
| 70 | Ga0070668_100267499 | 3300005347 | Bacteria | 1424 |
| 71 | Ga0070668_100445241 | 3300005347 | Bacteria | 1113 |
| 72 | Ga0070669_100001921 | 3300005353 | Bacteria | 15002 |
| 73 | Ga0070669_100002059 | 3300005353 | Bacteria | 14549 |
| 74 | Ga0070669_100005541 | 3300005353 | Bacteria | 9116 |
| 75 | Ga0070669_100154516 | 3300005353 | Bacteria | 1778 |
| 76 | Ga0070675_100002457 | 3300005354 | Bacteria | 13856 |
| 77 | Ga0070675_100002479 | 3300005354 | Bacteria | 13810 |
| 78 | Ga0070675_100075497 | 3300005354 | Bacteria | 2802 |
| 79 | Ga0070675_100087517 | 3300005354 | Bacteria | 2605 |
| 80 | Ga0070675_100110037 | 3300005354 | Bacteria | 2329 |
| 81 | Ga0070675_100128284 | 3300005354 | Bacteria | 2159 |
| 82 | Ga0070675_100134579 | 3300005354 | Bacteria | 2109 |
| 83 | Ga0070675_100188634 | 3300005354 | Bacteria | 1785 |
| 84 | Ga0070675_100241503 | 3300005354 | Bacteria | 1578 |
| 85 | Ga0070671_100004964 | 3300005355 | Bacteria | 10589 |
| 86 | Ga0070671_100008105 | 3300005355 | Bacteria | 8413 |
| 87 | Ga0070671_100074506 | 3300005355 | Bacteria | 2836 |
| 88 | Ga0070674_100100131 | 3300005356 | Bacteria | 2109 |
| 89 | Ga0070674_100136853 | 3300005356 | Bacteria | 1833 |
| 90 | Ga0070674_100492769 | 3300005356 | Bacteria | 1019 |
| 91 | Ga0070673_100000726 | 3300005364 | Bacteria | 18223 |
| 92 | Ga0070673_100001253 | 3300005364 | Bacteria | 14749 |
| 93 | Ga0070673_100006498 | 3300005364 | Bacteria | 7602 |
| 94 | Ga0070673_100022334 | 3300005364 | Bacteria | 4603 |
| 95 | Ga0070673_100164217 | 3300005364 | Bacteria | 1890 |
| 96 | Ga0070673_100202599 | 3300005364 | Bacteria | 1709 |
| 97 | Ga0070673_100207321 | 3300005364 | Bacteria | 1691 |
| 98 | Ga0070673_100207555 | 3300005364 | Bacteria | 1690 |
| 99 | Ga0070673_100233756 | 3300005364 | Bacteria | 1595 |
| 100 | Ga0070673_100521474 | 3300005364 | Bacteria | 1077 |
| 101 | Ga0070688_100000591 | 3300005365 | Bacteria | 18259 |
| 102 | Ga0070688_100013523 | 3300005365 | Bacteria | 4606 |
| 103 | Ga0070688_100015084 | 3300005365 | Bacteria | 4386 |
| 104 | Ga0070688_100045520 | 3300005365 | Bacteria | 2712 |
| 105 | Ga0070688_100088356 | 3300005365 | Bacteria | 2021 |
| 106 | Ga0070688_100254058 | 3300005365 | Bacteria | 1253 |
| 107 | Ga0070659_100002627 | 3300005366 | Bacteria | 12778 |
| 108 | Ga0070659_100233369 | 3300005366 | Bacteria | 1521 |
| 109 | Ga0070659_100266754 | 3300005366 | Bacteria | 1421 |
| 110 | Ga0070659_100568797 | 3300005366 | Bacteria | 972 |
| 111 | Ga0070667_100071360 | 3300005367 | Bacteria | 2958 |
| 112 | Ga0070703_10032020 | 3300005406 | Bacteria | 1594 |
| 113 | Ga0070714_100179072 | 3300005435 | Unclassified | 1928 |
| 114 | Ga0070701_10044551 | 3300005438 | Bacteria | 2273 |
| 115 | Ga0070705_100038972 | 3300005440 | Bacteria | 2693 |
| 116 | Ga0070705_100040131 | 3300005440 | Unclassified | 2660 |
| 117 | Ga0070705_100161038 | 3300005440 | Bacteria | 1500 |
| 118 | Ga0070705_100379780 | 3300005440 | Bacteria | 1039 |
| 119 | Ga0070700_100050889 | 3300005441 | Bacteria | 2577 |
| 120 | Ga0070700_100193164 | 3300005441 | Bacteria | 1425 |
| 121 | Ga0070700_100349594 | 3300005441 | Bacteria | 1095 |
| 122 | Ga0070694_100012339 | 3300005444 | Bacteria | 5308 |
| 123 | Ga0070694_100013920 | 3300005444 | Bacteria | 5030 |
| 124 | Ga0070694_100074129 | 3300005444 | Bacteria | 2352 |
| 125 | Ga0070694_100179232 | 3300005444 | Bacteria | 1566 |
| 126 | Ga0070708_100008725 | 3300005445 | Bacteria | 8146 |
| 127 | Ga0070663_100314193 | 3300005455 | Bacteria | 1258 |
| 128 | Ga0070678_100045389 | 3300005456 | Bacteria | 3144 |
| 129 | Ga0070678_100183990 | 3300005456 | Bacteria | 1713 |
| 130 | Ga0070678_100292017 | 3300005456 | Bacteria | 1382 |
| 131 | Ga0070662_100008143 | 3300005457 | Bacteria | 6829 |
| 132 | Ga0070662_100066280 | 3300005457 | Bacteria | 2649 |
| 133 | Ga0070662_100345232 | 3300005457 | Bacteria | 1218 |
| 134 | Ga0070662_100489548 | 3300005457 | Bacteria | 1025 |
| 135 | Ga0070662_100550188 | 3300005457 | Unclassified | 967 |
| 136 | Ga0070681_10000273 | 3300005458 | Bacteria | 41372 |
| 137 | Ga0070681_10002209 | 3300005458 | Bacteria | 17745 |
| 138 | Ga0070681_10348588 | 3300005458 | Bacteria | 1391 |
| 139 | Ga0068867_100035716 | 3300005459 | Bacteria | 3606 |
| 140 | Ga0068867_100188593 | 3300005459 | Bacteria | 1644 |
| 141 | Ga0068867_100225054 | 3300005459 | Bacteria | 1513 |
| 142 | Ga0070685_10030778 | 3300005466 | Bacteria | 2994 |
| 143 | Ga0070685_10039236 | 3300005466 | Bacteria | 2689 |
| 144 | Ga0070685_10049081 | 3300005466 | Bacteria | 2433 |
| 145 | Ga0070685_10061739 | 3300005466 | Bacteria | 2196 |
| 146 | Ga0070706_100000017 | 3300005467 | Bacteria | 172828 |
| 147 | Ga0070706_100041728 | 3300005467 | Bacteria | 4236 |
| 148 | Ga0070706_100105195 | 3300005467 | Bacteria | 2626 |
| 149 | Ga0070706_100166559 | 3300005467 | Bacteria | 2058 |
| 150 | Ga0070707_100000983 | 3300005468 | Bacteria | 28206 |
| 151 | Ga0070707_100178936 | 3300005468 | Bacteria | 2067 |
| 152 | Ga0070698_100007095 | 3300005471 | Bacteria | 12136 |
| 153 | Ga0070698_100063792 | 3300005471 | Bacteria | 3714 |
| 154 | Ga0070698_100090695 | 3300005471 | Bacteria | 3039 |
| 155 | Ga0070699_100003587 | 3300005518 | Bacteria | 13725 |
| 156 | Ga0070699_100151262 | 3300005518 | Unclassified | 2053 |
| 157 | Ga0070699_100262197 | 3300005518 | Bacteria | 1546 |
| 158 | Ga0070699_100373913 | 3300005518 | Bacteria | 1286 |
| 159 | Ga0070679_100000737 | 3300005530 | Bacteria | 28290 |
| 160 | Ga0070679_100466879 | 3300005530 | Bacteria | 1207 |
| 161 | Ga0070697_100111953 | 3300005536 | Bacteria | 2276 |
| 162 | Ga0070697_100282478 | 3300005536 | Bacteria | 1424 |
| 163 | Ga0070697_100401816 | 3300005536 | Bacteria | 1189 |
| 164 | Ga0068853_100004645 | 3300005539 | Bacteria | 10650 |
| 165 | Ga0068853_100197466 | 3300005539 | Unclassified | 1830 |
| 166 | Ga0070672_100000166 | 3300005543 | Bacteria | 36328 |
| 167 | Ga0070672_100020617 | 3300005543 | Bacteria | 4811 |
| 168 | Ga0070672_100166295 | 3300005543 | Bacteria | 1832 |
| 169 | Ga0070672_100325214 | 3300005543 | Bacteria | 1307 |
| 170 | Ga0070672_100468492 | 3300005543 | Bacteria | 1087 |
| 171 | Ga0070686_100029433 | 3300005544 | Bacteria | 3342 |
| 172 | Ga0070686_100112288 | 3300005544 | Bacteria | 1859 |
| 173 | Ga0070686_100129779 | 3300005544 | Bacteria | 1741 |
| 174 | Ga0070686_100600625 | 3300005544 | Bacteria | 867 |
| 175 | Ga0070695_100099652 | 3300005545 | Bacteria | 1955 |
| 176 | Ga0070696_100015437 | 3300005546 | Bacteria | 5129 |
| 177 | Ga0070696_100017102 | 3300005546 | Bacteria | 4895 |
| 178 | Ga0070696_100054966 | 3300005546 | Unclassified | 2776 |
| 179 | Ga0070696_100292281 | 3300005546 | Bacteria | 1245 |
| 180 | Ga0070693_100295660 | 3300005547 | Viruses | 1090 |
| 181 | Ga0070665_100000281 | 3300005548 | Bacteria | 83503 |
| 182 | Ga0070665_100153067 | 3300005548 | Bacteria | 2308 |
| 183 | Ga0070665_100462654 | 3300005548 | Bacteria | 1279 |
| 184 | Ga0070665_100514964 | 3300005548 | Bacteria | 1208 |
| 185 | Ga0070704_100010948 | 3300005549 | Bacteria | 5532 |
| 186 | Ga0070704_100017442 | 3300005549 | Bacteria | 4564 |
| 187 | Ga0070704_100044235 | 3300005549 | Bacteria | 3093 |
| 188 | Ga0070704_100260858 | 3300005549 | Bacteria | 1427 |
| 189 | Ga0068855_100183077 | 3300005563 | Bacteria | 2367 |
| 190 | Ga0070664_100010524 | 3300005564 | Bacteria | 7497 |
| 191 | Ga0070664_100033946 | 3300005564 | Bacteria | 4277 |
| 192 | Ga0070664_100093533 | 3300005564 | Bacteria | 2605 |
| 193 | Ga0068857_100105733 | 3300005577 | Bacteria | 2527 |
| 194 | Ga0068857_100125098 | 3300005577 | Bacteria | 2316 |
| 195 | Ga0068854_100070373 | 3300005578 | Bacteria | 2557 |
| 196 | Ga0068856_100010662 | 3300005614 | Bacteria | 8929 |
| 197 | Ga0068856_100525033 | 3300005614 | Bacteria | 1205 |
| 198 | Ga0070702_100184481 | 3300005615 | Bacteria | 1368 |
| 199 | Ga0068852_100320017 | 3300005616 | Bacteria | 1506 |
| 200 | Ga0068852_100409185 | 3300005616 | Unclassified | 1336 |
| 201 | Ga0068859_100006608 | 3300005617 | Bacteria | 11775 |
| 202 | Ga0068859_100007844 | 3300005617 | Bacteria | 10834 |
| 203 | Ga0068859_100015089 | 3300005617 | Bacteria | 7756 |
| 204 | Ga0068859_100037931 | 3300005617 | Bacteria | 4835 |
| 205 | Ga0068859_100081330 | 3300005617 | Bacteria | 3282 |
| 206 | Ga0068859_100134300 | 3300005617 | Bacteria | 2546 |
| 207 | Ga0068859_100455762 | 3300005617 | Unclassified | 1375 |
| 208 | Ga0068864_100002881 | 3300005618 | Bacteria | 14212 |
| 209 | Ga0068864_100016493 | 3300005618 | Bacteria | 6148 |
| 210 | Ga0068864_100054305 | 3300005618 | Unclassified | 3457 |
| 211 | Ga0068864_100073380 | 3300005618 | Bacteria | 2983 |
| 212 | Ga0068864_100203925 | 3300005618 | Bacteria | 1818 |
| 213 | Ga0068864_100371229 | 3300005618 | Bacteria | 1354 |
| 214 | Ga0068864_100476115 | 3300005618 | Bacteria | 1198 |
| 215 | Ga0068864_100582003 | 3300005618 | Unclassified | 1085 |
| 216 | Ga0068866_10177249 | 3300005718 | Bacteria | 1256 |
| 217 | Ga0068861_100001191 | 3300005719 | Bacteria | 16176 |
| 218 | Ga0068851_10151960 | 3300005834 | Bacteria | 1266 |
| 219 | Ga0068870_10001143 | 3300005840 | Bacteria | 10612 |
| 220 | Ga0068870_10032943 | 3300005840 | Bacteria | 2640 |
| 221 | Ga0068870_10036479 | 3300005840 | Bacteria | 2529 |
| 222 | Ga0068863_100054815 | 3300005841 | Bacteria | 3777 |
| 223 | Ga0068863_100119373 | 3300005841 | Bacteria | 2514 |
| 224 | Ga0068863_100598458 | 3300005841 | Bacteria | 1091 |
| 225 | Ga0068858_100021713 | 3300005842 | Bacteria | 5998 |
| 226 | Ga0068858_100035013 | 3300005842 | Unclassified | 4658 |
| 227 | Ga0068858_100036842 | 3300005842 | Unclassified | 4535 |
| 228 | Ga0068858_100077467 | 3300005842 | Bacteria | 3089 |
| 229 | Ga0068858_100174715 | 3300005842 | Bacteria | 2026 |
| 230 | Ga0068858_100989899 | 3300005842 | Bacteria | 824 |
| 231 | Ga0068860_100116460 | 3300005843 | Bacteria | 2557 |
| 232 | Ga0068860_100194224 | 3300005843 | Bacteria | 1965 |
| 233 | Ga0068860_100225107 | 3300005843 | Bacteria | 1822 |
| 234 | Ga0068862_100002024 | 3300005844 | Bacteria | 18363 |
| 235 | Ga0068862_100019276 | 3300005844 | Bacteria | 5691 |
| 236 | Ga0068862_100148510 | 3300005844 | Bacteria | 2085 |
| 237 | Ga0068862_100232554 | 3300005844 | Bacteria | 1673 |
| 238 | Ga0081539_10001769 | 3300005985 | Bacteria | 34433 |
| 239 | Ga0075368_10004669 | 3300006042 | Bacteria | 4659 |
| 240 | Ga0075364_10319670 | 3300006051 | Bacteria | 1057 |
| 241 | Ga0075367_10008309 | 3300006178 | Bacteria | 5376 |
| 242 | Ga0075367_10029494 | 3300006178 | Bacteria | 3138 |
| 243 | Ga0075367_10162981 | 3300006178 | Bacteria | 1387 |
| 244 | Ga0075366_10002715 | 3300006195 | Bacteria | 9138 |
| 245 | Ga0075366_10054578 | 3300006195 | Bacteria | 2373 |
| 246 | Ga0075366_10219322 | 3300006195 | Bacteria | 1159 |
| 247 | Ga0097621_100065937 | 3300006237 | Bacteria | 2981 |
| 248 | Ga0097621_100073884 | 3300006237 | Bacteria | 2823 |
| 249 | Ga0075370_10033120 | 3300006353 | Bacteria | 2892 |
| 250 | Ga0068871_100102965 | 3300006358 | Bacteria | 2393 |
| 251 | Ga0068871_100144118 | 3300006358 | Bacteria | 2027 |
| 252 | Ga0068871_100737756 | 3300006358 | Bacteria | 904 |
| 253 | Ga0075428_100024015 | 3300006844 | Bacteria | 6747 |
| 254 | Ga0075428_100069048 | 3300006844 | Bacteria | 3865 |
| 255 | Ga0075428_100102438 | 3300006844 | Bacteria | 3121 |
| 256 | Ga0075428_100110669 | 3300006844 | Bacteria | 2992 |
| 257 | Ga0075428_100278782 | 3300006844 | Bacteria | 1799 |
| 258 | Ga0075428_100307863 | 3300006844 | Bacteria | 1703 |
| 259 | Ga0075430_100034887 | 3300006846 | Bacteria | 4271 |
| 260 | Ga0075430_100040830 | 3300006846 | Bacteria | 3926 |
| 261 | Ga0075430_100064842 | 3300006846 | Bacteria | 3069 |
| 262 | Ga0075430_100105973 | 3300006846 | Bacteria | 2346 |
| 263 | Ga0075430_100110091 | 3300006846 | Bacteria | 2297 |
| 264 | Ga0075430_100153334 | 3300006846 | Bacteria | 1918 |
| 265 | Ga0075431_100015539 | 3300006847 | Bacteria | 7714 |
| 266 | Ga0075431_100054172 | 3300006847 | Bacteria | 4136 |
| 267 | Ga0075431_100062799 | 3300006847 | Bacteria | 3833 |
| 268 | Ga0075431_100101664 | 3300006847 | Bacteria | 2966 |
| 269 | Ga0075431_100196629 | 3300006847 | Bacteria | 2064 |
| 270 | Ga0075431_100268034 | 3300006847 | Bacteria | 1731 |
| 271 | Ga0075431_100302394 | 3300006847 | Bacteria | 1616 |
| 272 | Ga0075431_100448728 | 3300006847 | Bacteria | 1286 |
| 273 | Ga0075431_100501857 | 3300006847 | Bacteria | 1204 |
| 274 | Ga0075433_10000236 | 3300006852 | Bacteria | 31700 |
| 275 | Ga0075433_10008532 | 3300006852 | Bacteria | 8173 |
| 276 | Ga0075433_10009913 | 3300006852 | Bacteria | 7637 |
| 277 | Ga0075433_10018529 | 3300006852 | Bacteria | 5789 |
| 278 | Ga0075433_10019163 | 3300006852 | Bacteria | 5694 |
| 279 | Ga0075433_10159247 | 3300006852 | Bacteria | 2009 |
| 280 | Ga0075433_10245982 | 3300006852 | Bacteria | 1587 |
| 281 | Ga0075433_10323417 | 3300006852 | Bacteria | 1364 |
| 282 | Ga0075434_100001337 | 3300006871 | Bacteria | 20658 |
| 283 | Ga0075434_100007557 | 3300006871 | Bacteria | 10068 |
| 284 | Ga0075434_100060618 | 3300006871 | Bacteria | 3763 |
| 285 | Ga0075434_100086968 | 3300006871 | Bacteria | 3126 |
| 286 | Ga0075434_100092464 | 3300006871 | Bacteria | 3027 |
| 287 | Ga0075434_100363791 | 3300006871 | Unclassified | 1467 |
| 288 | Ga0075434_100837596 | 3300006871 | Bacteria | 935 |
| 289 | Ga0075429_100072025 | 3300006880 | Bacteria | 3010 |
| 290 | Ga0075429_100073085 | 3300006880 | Bacteria | 2986 |
| 291 | Ga0075429_100153766 | 3300006880 | Bacteria | 2014 |
| 292 | Ga0075429_100392938 | 3300006880 | Bacteria | 1214 |
| 293 | Ga0068865_100098147 | 3300006881 | Bacteria | 2140 |
| 294 | Ga0068865_100126489 | 3300006881 | Bacteria | 1908 |
| 295 | Ga0068865_100144722 | 3300006881 | Bacteria | 1796 |
| 296 | Ga0068865_100201836 | 3300006881 | Unclassified | 1544 |
| 297 | Ga0068865_100236005 | 3300006881 | Bacteria | 1437 |
| 298 | Ga0075436_100000743 | 3300006914 | Bacteria | 21632 |
| 299 | Ga0075436_100075227 | 3300006914 | Bacteria | 2338 |
| 300 | Ga0075436_100242378 | 3300006914 | Bacteria | 1282 |
| 301 | Ga0097620_100006608 | 3300006931 | Bacteria | 11775 |
| 302 | Ga0097620_100007844 | 3300006931 | Bacteria | 10834 |
| 303 | Ga0097620_100015088 | 3300006931 | Bacteria | 7756 |
| 304 | Ga0097620_100037929 | 3300006931 | Bacteria | 4835 |
| 305 | Ga0097620_100081330 | 3300006931 | Bacteria | 3282 |
| 306 | Ga0097620_100134289 | 3300006931 | Bacteria | 2546 |
| 307 | Ga0097620_100455728 | 3300006931 | Unclassified | 1375 |
| 308 | Ga0075435_100001882 | 3300007076 | Bacteria | 13650 |
| 309 | Ga0075435_100048142 | 3300007076 | Bacteria | 3424 |
| 310 | Ga0075435_100217397 | 3300007076 | Bacteria | 1622 |
| 311 | Ga0075435_100256365 | 3300007076 | Bacteria | 1490 |
| 312 | Ga0075435_100590887 | 3300007076 | Unclassified | 962 |
| 313 | Ga0105240_10013257 | 3300009093 | Bacteria | 11336 |
| 314 | Ga0105240_10203959 | 3300009093 | Bacteria | 2316 |
| 315 | Ga0111539_10002317 | 3300009094 | Bacteria | 25338 |
| 316 | Ga0111539_10005574 | 3300009094 | Bacteria | 16275 |
| 317 | Ga0111539_10011387 | 3300009094 | Bacteria | 11166 |
| 318 | Ga0111539_10023771 | 3300009094 | Bacteria | 7530 |
| 319 | Ga0111539_10028207 | 3300009094 | Bacteria | 6851 |
| 320 | Ga0111539_10079531 | 3300009094 | Unclassified | 3856 |
| 321 | Ga0111539_10089798 | 3300009094 | Bacteria | 3611 |
| 322 | Ga0111539_10311777 | 3300009094 | Bacteria | 1831 |
| 323 | Ga0111539_10397429 | 3300009094 | Bacteria | 1605 |
| 324 | Ga0111539_10413225 | 3300009094 | Bacteria | 1571 |
| 325 | Ga0111539_10443772 | 3300009094 | Bacteria | 1511 |
| 326 | Ga0105247_10051255 | 3300009101 | Bacteria | 2541 |
| 327 | Ga0105247_10248973 | 3300009101 | Bacteria | 1214 |
| 328 | Ga0114129_10024805 | 3300009147 | Bacteria | 8501 |
| 329 | Ga0114129_10049203 | 3300009147 | Bacteria | 5924 |
| 330 | Ga0114129_10055343 | 3300009147 | Bacteria | 5560 |
| 331 | Ga0114129_10109572 | 3300009147 | Bacteria | 3811 |
| 332 | Ga0114129_10274606 | 3300009147 | Bacteria | 2254 |
| 333 | Ga0114129_10475000 | 3300009147 | Bacteria | 1637 |
| 334 | Ga0114129_10524507 | 3300009147 | Unclassified | 1544 |
| 335 | Ga0114129_10663454 | 3300009147 | Bacteria | 1345 |
| 336 | Ga0114129_11499248 | 3300009147 | Bacteria | 829 |
| 337 | Ga0114129_11920224 | 3300009147 | Bacteria | 717 |
| 338 | Ga0105242_10451036 | 3300009176 | Bacteria | 1212 |
| 339 | Ga0105242_10643737 | 3300009176 | Bacteria | 1030 |
| 340 | Ga0105248_10053476 | 3300009177 | Bacteria | 4531 |
| 341 | Ga0105248_10087961 | 3300009177 | Bacteria | 3497 |
| 342 | Ga0105248_10185633 | 3300009177 | Bacteria | 2343 |
| 343 | Ga0105248_10230990 | 3300009177 | Bacteria | 2083 |
| 344 | Ga0105248_11346235 | 3300009177 | Bacteria | 808 |
| 345 | Ga0105237_10001605 | 3300009545 | Bacteria | 29357 |
| 346 | Ga0105237_10104408 | 3300009545 | Unclassified | 2825 |
| 347 | Ga0105237_10105838 | 3300009545 | Bacteria | 2804 |
| 348 | Ga0105237_10384704 | 3300009545 | Bacteria | 1408 |
| 349 | Ga0105238_11104259 | 3300009551 | Bacteria | 816 |
| 350 | Ga0105249_10003004 | 3300009553 | Bacteria | 14549 |
| 351 | Ga0105249_10004273 | 3300009553 | Bacteria | 12348 |
| 352 | Ga0105249_10046251 | 3300009553 | Bacteria | 3960 |
| 353 | Ga0105249_10046440 | 3300009553 | Bacteria | 3952 |
| 354 | Ga0105249_10757433 | 3300009553 | Bacteria | 1033 |
| 355 | Ga0105239_10018785 | 3300010375 | Bacteria | 7638 |
| 356 | Ga0105239_10725689 | 3300010375 | Bacteria | 1137 |
| 357 | Ga0105239_10871401 | 3300010375 | Bacteria | 1033 |
| 358 | Ga0105246_10061211 | 3300011119 | Bacteria | 2618 |
| 359 | Ga0105246_10275146 | 3300011119 | Bacteria | 1348 |
| 360 | Ga0157371_10515618 | 3300013102 | Bacteria | 884 |
| 361 | Ga0157370_10409549 | 3300013104 | Unclassified | 1248 |
| 362 | Ga0157369_10013391 | 3300013105 | Bacteria | 9276 |
| 363 | Ga0157369_10024559 | 3300013105 | Bacteria | 6701 |
| 364 | Ga0157369_10459050 | 3300013105 | Bacteria | 1319 |
| 365 | Ga0157374_10019423 | 3300013296 | Bacteria | 6014 |
| 366 | Ga0157374_10279585 | 3300013296 | Bacteria | 1648 |
| 367 | Ga0157378_10008418 | 3300013297 | Bacteria | 8985 |
| 368 | Ga0157378_10104249 | 3300013297 | Bacteria | 2592 |
| 369 | Ga0157378_10298078 | 3300013297 | Bacteria | 1559 |
| 370 | Ga0157378_10402419 | 3300013297 | Bacteria | 1349 |
| 371 | Ga0163162_10000539 | 3300013306 | Bacteria | 34986 |
| 372 | Ga0163162_10004052 | 3300013306 | Bacteria | 14058 |
| 373 | Ga0163162_10037891 | 3300013306 | Unclassified | 4812 |
| 374 | Ga0163162_10072367 | 3300013306 | Bacteria | 3502 |
| 375 | Ga0163162_10088850 | 3300013306 | Bacteria | 3170 |
| 376 | Ga0163162_10447279 | 3300013306 | Unclassified | 1424 |
| 377 | Ga0163162_10697308 | 3300013306 | Bacteria | 1137 |
| 378 | Ga0157372_10010413 | 3300013307 | Bacteria | 9886 |
| 379 | Ga0157372_10074395 | 3300013307 | Unclassified | 3831 |
| 380 | Ga0157372_10346239 | 3300013307 | Bacteria | 1731 |
| 381 | Ga0157372_10369262 | 3300013307 | Bacteria | 1672 |
| 382 | Ga0157375_10005816 | 3300013308 | Bacteria | 10732 |
| 383 | Ga0157375_10018153 | 3300013308 | Bacteria | 6375 |
| 384 | Ga0157375_10111777 | 3300013308 | Bacteria | 2831 |
| 385 | Ga0157375_10153586 | 3300013308 | Bacteria | 2439 |
| 386 | Ga0157375_10190919 | 3300013308 | Bacteria | 2203 |
| 387 | Ga0157375_10230020 | 3300013308 | Bacteria | 2013 |
| 388 | Ga0157375_10316157 | 3300013308 | Bacteria | 1726 |
| 389 | Ga0157375_10966423 | 3300013308 | Bacteria | 993 |
| 390 | Ga0163163_10006853 | 3300014325 | Bacteria | 10001 |
| 391 | Ga0163163_10036436 | 3300014325 | Bacteria | 4779 |
| 392 | Ga0163163_10079861 | 3300014325 | Bacteria | 3270 |
| 393 | Ga0163163_10308778 | 3300014325 | Bacteria | 1634 |
| 394 | Ga0163163_10449160 | 3300014325 | Bacteria | 1349 |
| 395 | Ga0157380_10023425 | 3300014326 | Bacteria | 4657 |
| 396 | Ga0157380_10027968 | 3300014326 | Bacteria | 4295 |
| 397 | Ga0157380_10057833 | 3300014326 | Bacteria | 3089 |
| 398 | Ga0157380_10090655 | 3300014326 | Bacteria | 2522 |
| 399 | Ga0157380_10238880 | 3300014326 | Bacteria | 1637 |
| 400 | Ga0157380_10363076 | 3300014326 | Bacteria | 1359 |
| 401 | Ga0157377_10009324 | 3300014745 | Bacteria | 4808 |
| 402 | Ga0157377_10040283 | 3300014745 | Bacteria | 2586 |
| 403 | Ga0157377_10073747 | 3300014745 | Bacteria | 1979 |
| 404 | Ga0157377_10078250 | 3300014745 | Bacteria | 1927 |
| 405 | Ga0157377_10312198 | 3300014745 | Bacteria | 1042 |
| 406 | Ga0157377_10327289 | 3300014745 | Bacteria | 1020 |
| 407 | Ga0157379_10100973 | 3300014968 | Bacteria | 2589 |
| 408 | Ga0157376_10385473 | 3300014969 | Bacteria | 1351 |
| 409 | Ga0213872_10039578 | 3300021361 | Bacteria | 2151 |
| 410 | Ga0207697_10008066 | 3300025315 | Bacteria | 4647 |
| 411 | Ga0207697_10008492 | 3300025315 | Bacteria | 4490 |
| 412 | Ga0207697_10047928 | 3300025315 | Bacteria | 1762 |
| 413 | Ga0207653_10001629 | 3300025885 | Bacteria | 7226 |
| 414 | Ga0207653_10059183 | 3300025885 | Bacteria | 1289 |
| 415 | Ga0207682_10019563 | 3300025893 | Bacteria | 2651 |
| 416 | Ga0207692_10239798 | 3300025898 | Unclassified | 1082 |
| 417 | Ga0207710_10015587 | 3300025900 | Bacteria | 3214 |
| 418 | Ga0207710_10208532 | 3300025900 | Bacteria | 967 |
| 419 | Ga0207688_10005700 | 3300025901 | Bacteria | 6772 |
| 420 | Ga0207688_10017187 | 3300025901 | Bacteria | 3930 |
| 421 | Ga0207688_10035547 | 3300025901 | Bacteria | 2761 |
| 422 | Ga0207680_10005415 | 3300025903 | Bacteria | 6098 |
| 423 | Ga0207680_10043210 | 3300025903 | Bacteria | 2641 |
| 424 | Ga0207647_10062073 | 3300025904 | Bacteria | 2277 |
| 425 | Ga0207645_10010688 | 3300025907 | Bacteria | 6296 |
| 426 | Ga0207645_10014924 | 3300025907 | Bacteria | 5181 |
| 427 | Ga0207645_10214207 | 3300025907 | Bacteria | 1269 |
| 428 | Ga0207643_10018772 | 3300025908 | Bacteria | 3787 |
| 429 | Ga0207643_10037381 | 3300025908 | Bacteria | 2724 |
| 430 | Ga0207643_10072081 | 3300025908 | Bacteria | 1989 |
| 431 | Ga0207643_10073932 | 3300025908 | Bacteria | 1965 |
| 432 | Ga0207684_10000079 | 3300025910 | Bacteria | 179842 |
| 433 | Ga0207684_10031952 | 3300025910 | Bacteria | 4478 |
| 434 | Ga0207684_10299002 | 3300025910 | Bacteria | 1388 |
| 435 | Ga0207684_10634132 | 3300025910 | Bacteria | 911 |
| 436 | Ga0207707_10021834 | 3300025912 | Bacteria | 5594 |
| 437 | Ga0207707_10071114 | 3300025912 | Bacteria | 3031 |
| 438 | Ga0207695_10171597 | 3300025913 | Bacteria | 2094 |
| 439 | Ga0207695_10404193 | 3300025913 | Viruses | 1250 |
| 440 | Ga0207671_10003525 | 3300025914 | Bacteria | 15516 |
| 441 | Ga0207671_10037683 | 3300025914 | Bacteria | 3585 |
| 442 | Ga0207671_10363500 | 3300025914 | Bacteria | 1149 |
| 443 | Ga0207671_10419078 | 3300025914 | Viruses | 1065 |
| 444 | Ga0207693_10198463 | 3300025915 | Unclassified | 1578 |
| 445 | Ga0207662_10011883 | 3300025918 | Bacteria | 4840 |
| 446 | Ga0207662_10048458 | 3300025918 | Bacteria | 2517 |
| 447 | Ga0207662_10053633 | 3300025918 | Bacteria | 2402 |
| 448 | Ga0207662_10128657 | 3300025918 | Unclassified | 1594 |
| 449 | Ga0207662_10179089 | 3300025918 | Bacteria | 1363 |
| 450 | Ga0207662_10237987 | 3300025918 | Bacteria | 1191 |
| 451 | Ga0207657_10168407 | 3300025919 | Bacteria | 1776 |
| 452 | Ga0207657_10302770 | 3300025919 | Bacteria | 1266 |
| 453 | Ga0207649_10114337 | 3300025920 | Bacteria | 1809 |
| 454 | Ga0207652_10061700 | 3300025921 | Bacteria | 3238 |
| 455 | Ga0207646_10000282 | 3300025922 | Bacteria | 69731 |
| 456 | Ga0207646_10547734 | 3300025922 | Unclassified | 1040 |
| 457 | Ga0207681_10000879 | 3300025923 | Bacteria | 19782 |
| 458 | Ga0207681_10042241 | 3300025923 | Bacteria | 3044 |
| 459 | Ga0207681_10063967 | 3300025923 | Bacteria | 2538 |
| 460 | Ga0207681_10072204 | 3300025923 | Bacteria | 2410 |
| 461 | Ga0207681_10133032 | 3300025923 | Bacteria | 1841 |
| 462 | Ga0207681_10348693 | 3300025923 | Bacteria | 1185 |
| 463 | Ga0207650_10006493 | 3300025925 | Bacteria | 7972 |
| 464 | Ga0207650_10011443 | 3300025925 | Bacteria | 6108 |
| 465 | Ga0207659_10000585 | 3300025926 | Bacteria | 21814 |
| 466 | Ga0207659_10003424 | 3300025926 | Bacteria | 9509 |
| 467 | Ga0207659_10004901 | 3300025926 | Bacteria | 8108 |
| 468 | Ga0207659_10012610 | 3300025926 | Bacteria | 5386 |
| 469 | Ga0207659_10016074 | 3300025926 | Bacteria | 4865 |
| 470 | Ga0207659_10064693 | 3300025926 | Bacteria | 2648 |
| 471 | Ga0207659_10151964 | 3300025926 | Bacteria | 1809 |
| 472 | Ga0207659_10314667 | 3300025926 | Bacteria | 1290 |
| 473 | Ga0207664_10168483 | 3300025929 | Bacteria | 1873 |
| 474 | Ga0207664_10185652 | 3300025929 | Bacteria | 1787 |
| 475 | Ga0207644_10000824 | 3300025931 | Bacteria | 19722 |
| 476 | Ga0207644_10006210 | 3300025931 | Bacteria | 7791 |
| 477 | Ga0207690_10116306 | 3300025932 | Bacteria | 1934 |
| 478 | Ga0207690_10224889 | 3300025932 | Bacteria | 1438 |
| 479 | Ga0207690_10474734 | 3300025932 | Bacteria | 1009 |
| 480 | Ga0207690_10555578 | 3300025932 | Bacteria | 934 |
| 481 | Ga0207690_10629971 | 3300025932 | Bacteria | 877 |
| 482 | Ga0207706_10009814 | 3300025933 | Bacteria | 8783 |
| 483 | Ga0207706_10010833 | 3300025933 | Bacteria | 8318 |
| 484 | Ga0207706_10298043 | 3300025933 | Bacteria | 1405 |
| 485 | Ga0207706_10343687 | 3300025933 | Bacteria | 1298 |
| 486 | Ga0207706_10482778 | 3300025933 | Bacteria | 1071 |
| 487 | Ga0207706_10577395 | 3300025933 | Unclassified | 967 |
| 488 | Ga0207709_10028359 | 3300025935 | Bacteria | 3236 |
| 489 | Ga0207670_10004139 | 3300025936 | Bacteria | 7770 |
| 490 | Ga0207670_10180598 | 3300025936 | Bacteria | 1589 |
| 491 | Ga0207670_10211309 | 3300025936 | Bacteria | 1480 |
| 492 | Ga0207670_10267520 | 3300025936 | Bacteria | 1327 |
| 493 | Ga0207669_10000860 | 3300025937 | Bacteria | 12929 |
| 494 | Ga0207704_10076399 | 3300025938 | Bacteria | 2146 |
| 495 | Ga0207704_10382764 | 3300025938 | Bacteria | 1105 |
| 496 | Ga0207704_10457730 | 3300025938 | Bacteria | 1020 |
| 497 | Ga0207691_10000888 | 3300025940 | Bacteria | 29662 |
| 498 | Ga0207691_10008155 | 3300025940 | Bacteria | 10055 |
| 499 | Ga0207691_10037214 | 3300025940 | Bacteria | 4507 |
| 500 | Ga0207691_10057461 | 3300025940 | Bacteria | 3541 |
| 501 | Ga0207691_10154162 | 3300025940 | Bacteria | 2019 |
| 502 | Ga0207691_10342784 | 3300025940 | Bacteria | 1279 |
| 503 | Ga0207711_10078119 | 3300025941 | Bacteria | 2886 |
| 504 | Ga0207711_10097151 | 3300025941 | Bacteria | 2601 |
| 505 | Ga0207711_10420960 | 3300025941 | Bacteria | 1242 |
| 506 | Ga0207689_10002833 | 3300025942 | Bacteria | 16002 |
| 507 | Ga0207689_10143814 | 3300025942 | Bacteria | 1965 |
| 508 | Ga0207689_10149738 | 3300025942 | Unclassified | 1924 |
| 509 | Ga0207689_10212385 | 3300025942 | Bacteria | 1599 |
| 510 | Ga0207661_10000003 | 3300025944 | Bacteria | 611941 |
| 511 | Ga0207679_10001069 | 3300025945 | Bacteria | 17433 |
| 512 | Ga0207679_10024700 | 3300025945 | Bacteria | 4123 |
| 513 | Ga0207679_10034122 | 3300025945 | Bacteria | 3587 |
| 514 | Ga0207679_10070632 | 3300025945 | Bacteria | 2631 |
| 515 | Ga0207679_10294193 | 3300025945 | Bacteria | 1397 |
| 516 | Ga0207651_10001222 | 3300025960 | Bacteria | 11527 |
| 517 | Ga0207651_10015033 | 3300025960 | Bacteria | 4486 |
| 518 | Ga0207651_10019400 | 3300025960 | Bacteria | 4074 |
| 519 | Ga0207651_10190568 | 3300025960 | Bacteria | 1635 |
| 520 | Ga0207651_10205324 | 3300025960 | Bacteria | 1582 |
| 521 | Ga0207651_10229305 | 3300025960 | Bacteria | 1506 |
| 522 | Ga0207651_10349705 | 3300025960 | Bacteria | 1244 |
| 523 | Ga0207651_10469640 | 3300025960 | Bacteria | 1082 |
| 524 | Ga0207712_10002060 | 3300025961 | Bacteria | 13198 |
| 525 | Ga0207712_10020570 | 3300025961 | Bacteria | 4324 |
| 526 | Ga0207712_10399925 | 3300025961 | Bacteria | 1154 |
| 527 | Ga0207668_10355300 | 3300025972 | Bacteria | 1226 |
| 528 | Ga0207668_10471405 | 3300025972 | Bacteria | 1075 |
| 529 | Ga0207668_10549295 | 3300025972 | Bacteria | 1000 |
| 530 | Ga0207640_10038408 | 3300025981 | Unclassified | 3021 |
| 531 | Ga0207640_10073182 | 3300025981 | Bacteria | 2315 |
| 532 | Ga0207640_10268744 | 3300025981 | Bacteria | 1333 |
| 533 | Ga0207658_10035999 | 3300025986 | Bacteria | 3548 |
| 534 | Ga0207658_10506125 | 3300025986 | Bacteria | 1076 |
| 535 | Ga0207703_10015655 | 3300026035 | Bacteria | 5914 |
| 536 | Ga0207703_10025335 | 3300026035 | Unclassified | 4666 |
| 537 | Ga0207703_10367669 | 3300026035 | Bacteria | 1328 |
| 538 | Ga0207708_10064512 | 3300026075 | Bacteria | 2798 |
| 539 | Ga0207708_10080753 | 3300026075 | Bacteria | 2499 |
| 540 | Ga0207708_10240498 | 3300026075 | Bacteria | 1456 |
| 541 | Ga0207702_10014773 | 3300026078 | Bacteria | 6477 |
| 542 | Ga0207702_10443319 | 3300026078 | Bacteria | 1259 |
| 543 | Ga0207641_10048370 | 3300026088 | Bacteria | 3589 |
| 544 | Ga0207641_10126926 | 3300026088 | Bacteria | 2285 |
| 545 | Ga0207641_10188868 | 3300026088 | Bacteria | 1892 |
| 546 | Ga0207641_10309634 | 3300026088 | Bacteria | 1494 |
| 547 | Ga0207648_10011476 | 3300026089 | Bacteria | 8341 |
| 548 | Ga0207648_10023955 | 3300026089 | Bacteria | 5457 |
| 549 | Ga0207648_10077160 | 3300026089 | Bacteria | 2904 |
| 550 | Ga0207648_10172522 | 3300026089 | Bacteria | 1912 |
| 551 | Ga0207676_10005286 | 3300026095 | Bacteria | 9143 |
| 552 | Ga0207676_10030545 | 3300026095 | Bacteria | 4045 |
| 553 | Ga0207676_10031246 | 3300026095 | Bacteria | 4004 |
| 554 | Ga0207676_10184794 | 3300026095 | Bacteria | 1828 |
| 555 | Ga0207676_10188194 | 3300026095 | Bacteria | 1814 |
| 556 | Ga0207676_10424127 | 3300026095 | Bacteria | 1248 |
| 557 | Ga0207674_10000079 | 3300026116 | Bacteria | 102085 |
| 558 | Ga0207674_10427178 | 3300026116 | Bacteria | 1280 |
| 559 | Ga0207675_100001985 | 3300026118 | Bacteria | 20408 |
| 560 | Ga0207675_100180796 | 3300026118 | Bacteria | 2019 |
| 561 | Ga0207675_100584795 | 3300026118 | Bacteria | 1118 |
| 562 | Ga0207675_100969071 | 3300026118 | Bacteria | 868 |
| 563 | Ga0207683_10094437 | 3300026121 | Bacteria | 2665 |
| 564 | Ga0207683_10230999 | 3300026121 | Bacteria | 1687 |
| 565 | Ga0207683_10255606 | 3300026121 | Bacteria | 1599 |
| 566 | Ga0207683_10303232 | 3300026121 | Bacteria | 1461 |
| 567 | Ga0207698_10206406 | 3300026142 | Bacteria | 1764 |
| 568 | Ga0207698_10375646 | 3300026142 | Bacteria | 1351 |
| 569 | Ga0207698_11086780 | 3300026142 | Unclassified | 812 |
| 570 | Ga0209968_1035156 | 3300027526 | Bacteria | 845 |
| 571 | Ga0209971_1016111 | 3300027682 | Bacteria | 1772 |
| 572 | Ga0209974_10031852 | 3300027876 | Bacteria | 1747 |
| 573 | Ga0209974_10064369 | 3300027876 | Bacteria | 1244 |
| 574 | Ga0207428_10001048 | 3300027907 | Bacteria | 30412 |
| 575 | Ga0207428_10001642 | 3300027907 | Bacteria | 23263 |
| 576 | Ga0207428_10006724 | 3300027907 | Bacteria | 10556 |
| 577 | Ga0207428_10008918 | 3300027907 | Bacteria | 9035 |
| 578 | Ga0207428_10117929 | 3300027907 | Bacteria | 2037 |
| 579 | Ga0207428_10170016 | 3300027907 | Bacteria | 1651 |
| 580 | Ga0207428_10180609 | 3300027907 | Bacteria | 1594 |
| 581 | Ga0207428_10202726 | 3300027907 | Bacteria | 1492 |
| 582 | Ga0207428_10241546 | 3300027907 | Bacteria | 1349 |
| 583 | Ga0268266_10000161 | 3300028379 | Bacteria | 125387 |
| 584 | Ga0268266_10223248 | 3300028379 | Bacteria | 1733 |
| 585 | Ga0268265_10000135 | 3300028380 | Bacteria | 93986 |
| 586 | Ga0268265_10008392 | 3300028380 | Bacteria | 6976 |
| 587 | Ga0268265_10063517 | 3300028380 | Bacteria | 2841 |
| 588 | Ga0268265_10134071 | 3300028380 | Bacteria | 2063 |
| 589 | Ga0268265_10211904 | 3300028380 | Bacteria | 1689 |
| 590 | Ga0268265_10539278 | 3300028380 | Bacteria | 1106 |
| 591 | Ga0268264_10009058 | 3300028381 | Bacteria | 8259 |
| 592 | Ga0268264_10145929 | 3300028381 | Unclassified | 2116 |
| 593 | Ga0268264_10147190 | 3300028381 | Bacteria | 2108 |
| 594 | Ga0268264_10188758 | 3300028381 | Bacteria | 1877 |
| 595 | Ga0268264_10575924 | 3300028381 | Bacteria | 1107 |
| 596 | Ga0268264_10679563 | 3300028381 | Bacteria | 1021 |
| 597 | Ga0265338_10000029 | 3300028800 | Bacteria | 271824 |
| 598 | Ga0265760_10000038 | 3300031090 | Bacteria | 42230 |
| 599 | Ga0265331_10088025 | 3300031250 | Bacteria | 1438 |
| 600 | Ga0307408_100054721 | 3300031548 | Bacteria | 2886 |
| 601 | Ga0307408_100146495 | 3300031548 | Bacteria | 1859 |
| 602 | Ga0265314_10035447 | 3300031711 | Bacteria | 3637 |
| 603 | Ga0307405_10000588 | 3300031731 | Bacteria | 13937 |
| 604 | Ga0307413_10009332 | 3300031824 | Bacteria | 4691 |
| 605 | Ga0307413_10224684 | 3300031824 | Bacteria | 1374 |
| 606 | Ga0307410_10004093 | 3300031852 | Bacteria | 7467 |
| 607 | Ga0307407_10121615 | 3300031903 | Bacteria | 1656 |
| 608 | Ga0307409_100012205 | 3300031995 | Bacteria | 5464 |
| 609 | Ga0307416_100001585 | 3300032002 | Bacteria | 12480 |
| 610 | Ga0307416_100018839 | 3300032002 | Bacteria | 4877 |
| 611 | Ga0307416_100400576 | 3300032002 | Bacteria | 1410 |
| 612 | Ga0307416_100674023 | 3300032002 | Bacteria | 1121 |
| 613 | Ga0307411_10001285 | 3300032005 | Bacteria | 10069 |
| 614 | Ga0307411_10061901 | 3300032005 | Bacteria | 2494 |
| 615 | Ga0307411_10256221 | 3300032005 | Bacteria | 1379 |
| 616 | Ga0307415_100001811 | 3300032126 | Bacteria | 10464 |
| 617 | Ga0307415_100071602 | 3300032126 | Bacteria | 2439 |
| 618 | Ga0373958_0042837 | 3300034819 | Bacteria | 931 |
| 619 | Ga0373949_0009446 | 3300035090 | Bacteria | 2137 |
| 620 | Ga0373951_0034204 | 3300035091 | Bacteria | 1206 |
| 621 | Ga0373939_0021159 | 3300035114 | Bacteria | 1777 |
| 622 | Ga0373939_0078368 | 3300035114 | Bacteria | 1092 |
| 623 | Ga0373961_0000297 | 3300035241 | Bacteria | 22207 |
| 624 | Ga0373937_0091916 | 3300036401 | Unclassified | 2812 |
| 625 | Ga0395900_0414868 | 3300037418 | Bacteria | 1308 |
| 626 | Ga0395898_0015655 | 3300037466 | Bacteria | 7772 |
| 627 | Ga0395901_0462618 | 3300038443 | Bacteria | 1296 |
| 628 | Ga0242420_009417 | 3300038996 | Bacteria | 1601 |
| 629 | Ga0436365_1053164 | 3300039437 | Unclassified | 1024 |
| 630 | Ga0436361_0156101 | 3300039447 | Bacteria | 21426 |
| 631 | Ga0439448_0027297 | 3300042005 | Bacteria | 1798 |
| 632 | Ga0450891_016591 | 3300042129 | Bacteria | 704 |
| 633 | Ga0439458_0001621 | 3300042157 | Bacteria | 5620 |
| 634 | Ga0439435_0009902 | 3300042436 | Bacteria | 2249 |
| 635 | Ga0439435_0013999 | 3300042436 | Bacteria | 1975 |
| 636 | Ga0439459_0045375 | 3300042438 | Bacteria | 948 |
| 637 | Ga0450916_001806 | 3300042530 | Bacteria | 2188 |
| 638 | Ga0451577_0006065 | 3300042876 | Bacteria | 12155 |
| 639 | Ga0451577_0073780 | 3300042876 | Bacteria | 3044 |
| 640 | Ga0451577_0757099 | 3300042876 | Bacteria | 878 |
| 641 | Ga0453683_0023191 | 3300044673 | Bacteria | 3956 |
| 642 | Ga0453683_0193404 | 3300044673 | Bacteria | 1291 |
| 643 | Ga0466963_0052559 | 3300044694 | Bacteria | 2704 |
| 644 | Ga0466963_0256185 | 3300044694 | Bacteria | 1228 |
| 645 | Ga0453684_0007016 | 3300044712 | Bacteria | 21048 |
| 646 | Ga0453684_0211404 | 3300044712 | Bacteria | 2254 |
| 647 | Ga0466957_0034189 | 3300044842 | Bacteria | 3050 |
| 648 | Ga0466959_0453710 | 3300045049 | Bacteria | 869 |
| 649 | Ga0451576_0006728 | 3300045051 | Bacteria | 14003 |
| 650 | Ga0451576_0015927 | 3300045051 | Bacteria | 8311 |
| 651 | Ga0451576_0112797 | 3300045051 | Bacteria | 2830 |
| 652 | Ga0451576_0360104 | 3300045051 | Bacteria | 1523 |
| 653 | Ga0451576_0381213 | 3300045051 | Bacteria | 1478 |
| 654 | Ga0466958_0104906 | 3300045836 | Bacteria | 1761 |
| 655 | Ga0466967_0020441 | 3300045976 | Bacteria | 5352 |
| 656 | Ga0495603_0007369 | 3300046455 | Bacteria | 6617 |
| 657 | Ga0495638_0004257 | 3300046460 | Bacteria | 10891 |
| 658 | Ga0495662_0237579 | 3300046476 | Bacteria | 898 |
| 659 | Ga0495584_0006176 | 3300046491 | Bacteria | 6298 |
| 660 | Ga0495585_0130195 | 3300046492 | Bacteria | 1325 |
| 661 | Ga0495594_0067571 | 3300046499 | Bacteria | 1984 |
| 662 | Ga0495642_0010266 | 3300046528 | Bacteria | 3586 |
| 663 | Ga0495642_0145168 | 3300046528 | Bacteria | 1025 |
| 664 | Ga0495598_0106180 | 3300046537 | Bacteria | 935 |
| 665 | Ga0495609_0044028 | 3300046538 | Bacteria | 2003 |
| 666 | Ga0495609_0175589 | 3300046538 | Bacteria | 903 |
| 667 | Ga0495621_0006040 | 3300046539 | Bacteria | 3516 |
| 668 | Ga0495621_0007839 | 3300046539 | Bacteria | 3175 |
| 669 | Ga0495621_0066946 | 3300046539 | Bacteria | 1315 |
| 670 | Ga0495621_0069244 | 3300046539 | Bacteria | 1296 |
| 671 | Ga0495621_0094989 | 3300046539 | Bacteria | 1128 |
| 672 | Ga0495656_0008786 | 3300046615 | Bacteria | 3620 |
| 673 | Ga0495659_0080928 | 3300046664 | Bacteria | 1232 |
| 674 | Ga0495659_0084266 | 3300046664 | Bacteria | 1211 |
| 675 | Ga0495669_0088025 | 3300046684 | Bacteria | 1431 |
| 676 | Ga0495670_0011807 | 3300046691 | Bacteria | 4300 |
| 677 | Ga0495636_0024829 | 3300047318 | Bacteria | 2432 |
| 678 | Ga0496103_0028216 | 3300048906 | Bacteria | 3405 |
| 679 | Ga0496106_0184013 | 3300048909 | Unclassified | 1659 |
| 680 | Ga0496109_0172228 | 3300048912 | Bacteria | 2031 |
| 681 | Ga0496116_0043856 | 3300048919 | Bacteria | 3043 |
| 682 | Ga0496117_0098185 | 3300048920 | Bacteria | 1863 |
| 683 | Ga0496126_0079201 | 3300048929 | Bacteria | 2909 |
| 684 | Ga0501298_042395 | 3300049521 | Bacteria | 925 |
| 685 | Ga0501040_0089114 | 3300049576 | Bacteria | 2143 |
| 686 | Ga0501042_0655782 | 3300049578 | Bacteria | 763 |
| 687 | Ga0501048_0051528 | 3300049582 | Bacteria | 2930 |
| 688 | Ga0501068_0088698 | 3300049584 | Bacteria | 1906 |
| 689 | Ga0501071_0024452 | 3300049587 | Bacteria | 4227 |
| 690 | Ga0501071_0516628 | 3300049587 | Bacteria | 916 |
| 691 | Ga0501072_0284710 | 3300049588 | Bacteria | 1314 |
| 692 | Ga0501072_0311615 | 3300049588 | Bacteria | 1251 |
| 693 | Ga0501074_0450960 | 3300049590 | Bacteria | 912 |
| 694 | Ga0501075_0021253 | 3300049591 | Bacteria | 4730 |
| 695 | Ga0501075_0289361 | 3300049591 | Bacteria | 1248 |
| 696 | Ga0501075_0529504 | 3300049591 | Bacteria | 899 |
| 697 | Ga0501075_0567548 | 3300049591 | Bacteria | 866 |
| 698 | Ga0501227_006404 | 3300049665 | Bacteria | 2531 |
| 699 | Ga0501240_022566 | 3300049673 | Bacteria | 959 |
| 700 | Ga0501259_012414 | 3300049688 | Bacteria | 1421 |
| 701 | Ga0501229_015824 | 3300049706 | Bacteria | 980 |
| 702 | Ga0501079_0066374 | 3300049741 | Bacteria | 2784 |
| 703 | Ga0501080_0212080 | 3300049742 | Bacteria | 1775 |
| 704 | Ga0501081_0190749 | 3300049743 | Bacteria | 1484 |
| 705 | Ga0501081_0284202 | 3300049743 | Bacteria | 1212 |
| 706 | Ga0501083_0001386 | 3300049744 | Bacteria | 16465 |
| 707 | Ga0501271_010394 | 3300049768 | Unclassified | 982 |
| 708 | Ga0501045_0041432 | 3300049824 | Bacteria | 3351 |
| 709 | Ga0501045_0309578 | 3300049824 | Bacteria | 1175 |
| 710 | Ga0501212_008037 | 3300049851 | Bacteria | 1458 |
| 711 | nmdc:mga00v17_119854_c1 | 3300050491 | Bacteria | 1674 |
| 712 | nmdc:mga0k408_32071_c1 | 3300050493 | Bacteria | 3002 |
| 713 | nmdc:mga0k408_74420_c1 | 3300050493 | Bacteria | 1984 |
| 714 | nmdc:mga0k408_8831_c1 | 3300050493 | Bacteria | 5422 |
| 715 | nmdc:mga06z11_144809_c1 | 3300050494 | Bacteria | 1346 |
| 716 | nmdc:mga06z11_79006_c1 | 3300050494 | Bacteria | 1760 |
| 717 | nmdc:mga04h51_16446_c1 | 3300050495 | Bacteria | 2147 |
| 718 | nmdc:mga07m45_3177_c1 | 3300050496 | Bacteria | 7886 |
| 719 | nmdc:mga05p37_1_c1 | 3300050507 | Bacteria | 177088 |
| 720 | nmdc:mga05p37_251236_c1 | 3300050507 | Bacteria | 2121 |
| 721 | nmdc:mga05p37_40487_c1 | 3300050507 | Bacteria | 5723 |
| 722 | nmdc:mga05p37_58869_c1 | 3300050507 | Bacteria | 4731 |
| 723 | nmdc:mga09592_102390_c1 | 3300050508 | Bacteria | 2453 |
| 724 | nmdc:mga09592_126612_c1 | 3300050508 | Bacteria | 2196 |
| 725 | nmdc:mga09592_301948_c1 | 3300050508 | Bacteria | 1388 |
| 726 | nmdc:mga09592_412521_c1 | 3300050508 | Unclassified | 1167 |
| 727 | nmdc:mga09592_74053_c1 | 3300050508 | Bacteria | 2894 |
| 728 | nmdc:mga09592_77774_c1 | 3300050508 | Bacteria | 2823 |
| 729 | nmdc:mga0qj67_106354_c1 | 3300050509 | Bacteria | 2264 |
| 730 | nmdc:mga0qj67_169793_c1 | 3300050509 | Bacteria | 1771 |
| 731 | nmdc:mga0qj67_191946_c1 | 3300050509 | Bacteria | 1660 |
| 732 | nmdc:mga0qj67_77166_c1 | 3300050509 | Bacteria | 2665 |
| 733 | nmdc:mga0qj67_84948_c1 | 3300050509 | Bacteria | 2538 |
| 734 | nmdc:mga06r32_117341_c1 | 3300050510 | Bacteria | 2623 |
| 735 | nmdc:mga06r32_229568_c1 | 3300050510 | Bacteria | 1844 |
| 736 | nmdc:mga06r32_395742_c1 | 3300050510 | Bacteria | 1364 |
| 737 | nmdc:mga06r32_569058_c1 | 3300050510 | Bacteria | 1106 |
| 738 | nmdc:mga06r32_663245_c1 | 3300050510 | Bacteria | 1011 |
| 739 | nmdc:mga06r32_725078_c1 | 3300050510 | Bacteria | 959 |
| 740 | nmdc:mga06r32_92361_c1 | 3300050510 | Bacteria | 2959 |
| 741 | nmdc:mga08y16_153419_c1 | 3300050511 | Unclassified | 2394 |
| 742 | nmdc:mga08y16_16314_c1 | 3300050511 | Bacteria | 7808 |
| 743 | nmdc:mga08y16_20018_c1 | 3300050511 | Bacteria | 7059 |
| 744 | nmdc:mga08y16_209702_c1 | 3300050511 | Bacteria | 2018 |
| 745 | nmdc:mga08y16_294613_c1 | 3300050511 | Bacteria | 1673 |
| 746 | nmdc:mga08y16_327926_c1 | 3300050511 | Bacteria | 1575 |
| 747 | nmdc:mga08y16_3811_c1 | 3300050511 | Bacteria | 15684 |
| 748 | nmdc:mga08y16_4121_c1 | 3300050511 | Bacteria | 15166 |
| 749 | nmdc:mga08y16_557302_c1 | 3300050511 | Bacteria | 1159 |
| 750 | nmdc:mga0n895_136419_c1 | 3300050512 | Bacteria | 2480 |
| 751 | nmdc:mga0n895_13720_c1 | 3300050512 | Bacteria | 7326 |
| 752 | nmdc:mga0n895_163473_c1 | 3300050512 | Bacteria | 2258 |
| 753 | nmdc:mga0n895_23710_c1 | 3300050512 | Bacteria | 5771 |
| 754 | nmdc:mga0n895_25567_c1 | 3300050512 | Bacteria | 5580 |
| 755 | nmdc:mga0n895_45375_c1 | 3300050512 | Bacteria | 4289 |
| 756 | nmdc:mga0n895_47058_c1 | 3300050512 | Bacteria | 4216 |
| 757 | nmdc:mga0n895_56795_c1 | 3300050512 | Bacteria | 3857 |
| 758 | nmdc:mga0rr50_129821_c1 | 3300050513 | Bacteria | 2016 |
| 759 | nmdc:mga0rr50_192620_c1 | 3300050513 | Bacteria | 1672 |
| 760 | nmdc:mga0rr50_211847_c1 | 3300050513 | Bacteria | 1596 |
| 761 | nmdc:mga0rr50_267349_c1 | 3300050513 | Bacteria | 1424 |
| 762 | nmdc:mga0rr50_330706_c1 | 3300050513 | Unclassified | 1279 |
| 763 | nmdc:mga0rr50_392986_c1 | 3300050513 | Bacteria | 1171 |
| 764 | nmdc:mga0rr50_5018_c1 | 3300050513 | Bacteria | 7841 |
| 765 | nmdc:mga08x19_1968_c1 | 3300050514 | Bacteria | 12567 |
| 766 | nmdc:mga08x19_39410_c1 | 3300050514 | Bacteria | 3003 |
| 767 | nmdc:mga08x19_44398_c1 | 3300050514 | Bacteria | 2838 |
| 768 | nmdc:mga0a205_114150_c1 | 3300050515 | Bacteria | 2600 |
| 769 | nmdc:mga0a205_150089_c1 | 3300050515 | Unclassified | 2231 |
| 770 | nmdc:mga0a205_1555_c1 | 3300050515 | Bacteria | 19642 |
| 771 | nmdc:mga0a205_161954_c1 | 3300050515 | Bacteria | 2133 |
| 772 | nmdc:mga0a205_19009_c1 | 3300050515 | Bacteria | 6473 |
| 773 | nmdc:mga0a205_293_c2 | 3300050515 | Bacteria | 34916 |
| 774 | nmdc:mga0a205_306359_c1 | 3300050515 | Bacteria | 1461 |
| 775 | nmdc:mga0a205_42186_c1 | 3300050515 | Bacteria | 4395 |
| 776 | nmdc:mga0a205_509108_c1 | 3300050515 | Bacteria | 1061 |
| 777 | nmdc:mga0a205_7840_c2 | 3300050515 | Bacteria | 2036 |
| 778 | nmdc:mga0a205_857408_c1 | 3300050515 | Bacteria | 755 |
| 779 | Ga0500555_001047 | 3300053103 | Bacteria | 9328 |
| 780 | Ga0500616_0000829 | 3300053153 | Bacteria | 34893 |
| 781 | Ga0500616_0001144 | 3300053153 | Bacteria | 27218 |
| 782 | Ga0500611_002917 | 3300053727 | Bacteria | 2120 |
| 783 | Ga0500645_002423 | 3300053730 | Bacteria | 8342 |
| 784 | Ga0501084_0198139 | 3300054114 | Bacteria | 1694 |
| 785 | Ga0501084_0294563 | 3300054114 | Bacteria | 1370 |
| 786 | Ga0590071_001172 | 3300059421 | Bacteria | 7088 |
| 787 | Ga0590071_005369 | 3300059421 | Bacteria | 3084 |
| 788 | Ga0501082_0082565 | 3300060353 | Bacteria | 2773 |
| 789 | Ga0501082_0359596 | 3300060353 | Bacteria | 1270 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042876 | Ga0451577_0757099 | Ga0451577_0757099_38_610 | 182 |
| 2 | 3300048919 | Ga0496116_0043856 | Ga0496116_0043856_2392_2964 | 183 |
| 3 | 3300009101 | Ga0105247_10051255 | Ga0105247_100512553 | 189 |
| 4 | 3300050510 | nmdc:mga06r32_725078_c1 | nmdc:mga06r32_725078_c1_352_933 | 192 |
| 5 | 3300050513 | nmdc:mga0rr50_392986_c1 | nmdc:mga0rr50_392986_c1_38_649 | 198 |
| 6 | 3300042129 | Ga0450891_016591 | Ga0450891_016591_67_687 | 199 |
| 7 | 3300044694 | Ga0466963_0256185 | Ga0466963_0256185_228_845 | 199 |
| 8 | 3300045976 | Ga0466967_0020441 | Ga0466967_0020441_3159_3776 | 199 |
| 9 | 3300035114 | Ga0373939_0078368 | Ga0373939_0078368_21_674 | 200 |
| 10 | 3300006846 | Ga0075430_100064842 | Ga0075430_1000648422 | 201 |
| 11 | 3300006847 | Ga0075431_100268034 | Ga0075431_1002680342 | 201 |
| 12 | 3300013105 | Ga0157369_10024559 | Ga0157369_100245592 | 201 |
| 13 | 3300025929 | Ga0207664_10168483 | Ga0207664_101684833 | 201 |
| 14 | 3300005290 | Ga0065712_10118747 | Ga0065712_101187473 | 202 |
| 15 | 3300005293 | Ga0065715_10090744 | Ga0065715_100907446 | 202 |
| 16 | 3300005328 | Ga0070676_10290456 | Ga0070676_102904562 | 202 |
| 17 | 3300005334 | Ga0068869_100078766 | Ga0068869_1000787662 | 202 |
| 18 | 3300005354 | Ga0070675_100087517 | Ga0070675_1000875173 | 202 |
| 19 | 3300005355 | Ga0070671_100074506 | Ga0070671_1000745062 | 202 |
| 20 | 3300005444 | Ga0070694_100179232 | Ga0070694_1001792323 | 202 |
| 21 | 3300005457 | Ga0070662_100066280 | Ga0070662_1000662802 | 202 |
| 22 | 3300005546 | Ga0070696_100054966 | Ga0070696_1000549663 | 202 |
| 23 | 3300009553 | Ga0105249_10046440 | Ga0105249_100464402 | 202 |
| 24 | 3300005366 | Ga0070659_100002627 | Ga0070659_1000026279 | 203 |
| 25 | 3300005445 | Ga0070708_100008725 | Ga0070708_1000087252 | 203 |
| 26 | 3300005458 | Ga0070681_10002209 | Ga0070681_1000220914 | 203 |
| 27 | 3300005467 | Ga0070706_100041728 | Ga0070706_1000417282 | 203 |
| 28 | 3300005468 | Ga0070707_100000983 | Ga0070707_10000098322 | 203 |
| 29 | 3300005471 | Ga0070698_100090695 | Ga0070698_1000906954 | 203 |
| 30 | 3300005530 | Ga0070679_100000737 | Ga0070679_1000007374 | 203 |
| 31 | 3300005536 | Ga0070697_100282478 | Ga0070697_1002824782 | 203 |
| 32 | 3300014326 | Ga0157380_10027968 | Ga0157380_100279684 | 203 |
| 33 | 3300025910 | Ga0207684_10634132 | Ga0207684_106341322 | 203 |
| 34 | 3300025922 | Ga0207646_10000282 | Ga0207646_1000028255 | 203 |
| 35 | 3300031090 | Ga0265760_10000038 | Ga0265760_100000383 | 203 |
| 36 | 3300050511 | nmdc:mga08y16_153419_c1 | nmdc:mga08y16_153419_c1_66_746 | 203 |
| 37 | 3300050511 | nmdc:mga08y16_557302_c1 | nmdc:mga08y16_557302_c1_255_974 | 203 |
| 38 | 3300005518 | Ga0070699_100262197 | Ga0070699_1002621972 | 204 |
| 39 | 3300006844 | Ga0075428_100024015 | Ga0075428_1000240155 | 204 |
| 40 | 3300006846 | Ga0075430_100040830 | Ga0075430_1000408303 | 204 |
| 41 | 3300009147 | Ga0114129_10109572 | Ga0114129_101095722 | 204 |
| 42 | 3300044673 | Ga0453683_0023191 | Ga0453683_0023191_967_1620 | 204 |
| 43 | 3300044712 | Ga0453684_0007016 | Ga0453684_0007016_20349_21002 | 204 |
| 44 | 3300045051 | Ga0451576_0006728 | Ga0451576_0006728_11556_12209 | 204 |
| 45 | 3300049578 | Ga0501042_0655782 | Ga0501042_0655782_52_693 | 204 |
| 46 | 3300050508 | nmdc:mga09592_126612_c1 | nmdc:mga09592_126612_c1_1056_1697 | 204 |
| 47 | 3300053153 | Ga0500616_0001144 | Ga0500616_0001144_6748_7443 | 204 |
| 48 | 3300005841 | Ga0068863_100054815 | Ga0068863_1000548152 | 206 |
| 49 | 3300009551 | Ga0105238_11104259 | Ga0105238_111042592 | 206 |
| 50 | 3300021361 | Ga0213872_10039578 | Ga0213872_100395783 | 206 |
| 51 | 3300026088 | Ga0207641_10188868 | Ga0207641_101888682 | 206 |
| 52 | 3300039447 | Ga0436361_0156101 | Ga0436361_0156101_10376_11020 | 206 |
| 53 | 3300060353 | Ga0501082_0359596 | Ga0501082_0359596_36_782 | 206 |
| 54 | 3300005329 | Ga0070683_100000002 | Ga0070683_100000002364 | 207 |
| 55 | 3300005364 | Ga0070673_100022334 | Ga0070673_1000223342 | 207 |
| 56 | 3300005435 | Ga0070714_100179072 | Ga0070714_1001790722 | 207 |
| 57 | 3300013105 | Ga0157369_10013391 | Ga0157369_100133919 | 207 |
| 58 | 3300013105 | Ga0157369_10459050 | Ga0157369_104590503 | 207 |
| 59 | 3300025960 | Ga0207651_10019400 | Ga0207651_100194003 | 207 |
| 60 | 3300049591 | Ga0501075_0529504 | Ga0501075_0529504_131_880 | 207 |
| 61 | 3300005329 | Ga0070683_100279457 | Ga0070683_1002794572 | 208 |
| 62 | 3300010375 | Ga0105239_10725689 | Ga0105239_107256891 | 208 |
| 63 | 3300013307 | Ga0157372_10010413 | Ga0157372_100104134 | 208 |
| 64 | 3300028800 | Ga0265338_10000029 | Ga0265338_1000002952 | 208 |
| 65 | 3300031250 | Ga0265331_10088025 | Ga0265331_100880251 | 208 |
| 66 | 3300005355 | Ga0070671_100008105 | Ga0070671_1000081053 | 209 |
| 67 | 3300025931 | Ga0207644_10006210 | Ga0207644_100062103 | 209 |
| 68 | 3300042876 | Ga0451577_0073780 | Ga0451577_0073780_1899_2555 | 209 |
| 69 | 3300044712 | Ga0453684_0211404 | Ga0453684_0211404_817_1473 | 209 |
| 70 | 3300048920 | Ga0496117_0098185 | Ga0496117_0098185_738_1400 | 209 |
| 71 | 3300048929 | Ga0496126_0079201 | Ga0496126_0079201_1711_2373 | 209 |
| 72 | 3300005440 | Ga0070705_100161038 | Ga0070705_1001610382 | 210 |
| 73 | 3300013308 | Ga0157375_10316157 | Ga0157375_103161571 | 210 |
| 74 | 3300049591 | Ga0501075_0289361 | Ga0501075_0289361_450_1166 | 210 |
| 75 | 3300049744 | Ga0501083_0001386 | Ga0501083_0001386_6200_6919 | 210 |
| 76 | 3300049824 | Ga0501045_0309578 | Ga0501045_0309578_101_817 | 210 |
| 77 | 3300054114 | Ga0501084_0294563 | Ga0501084_0294563_552_1268 | 210 |
| 78 | 3300060353 | Ga0501082_0082565 | Ga0501082_0082565_630_1346 | 210 |
| 79 | 3300005459 | Ga0068867_100188593 | Ga0068867_1001885932 | 211 |
| 80 | 3300009176 | Ga0105242_10451036 | Ga0105242_104510362 | 211 |
| 81 | 3300026089 | Ga0207648_10023955 | Ga0207648_100239555 | 211 |
| 82 | 3300027526 | Ga0209968_1035156 | Ga0209968_10351561 | 211 |
| 83 | 3300035241 | Ga0373961_0000297 | Ga0373961_0000297_11558_12250 | 211 |
| 84 | 3300050510 | nmdc:mga06r32_229568_c1 | nmdc:mga06r32_229568_c1_406_1122 | 211 |
| 85 | 3300005331 | Ga0070670_100001515 | Ga0070670_1000015153 | 212 |
| 86 | 3300005336 | Ga0070680_100643545 | Ga0070680_1006435452 | 212 |
| 87 | 3300005337 | Ga0070682_100353829 | Ga0070682_1003538292 | 212 |
| 88 | 3300005340 | Ga0070689_100035664 | Ga0070689_1000356643 | 212 |
| 89 | 3300006881 | Ga0068865_100236005 | Ga0068865_1002360052 | 212 |
| 90 | 3300006914 | Ga0075436_100000743 | Ga0075436_10000074313 | 212 |
| 91 | 3300006914 | Ga0075436_100075227 | Ga0075436_1000752271 | 212 |
| 92 | 3300006914 | Ga0075436_100242378 | Ga0075436_1002423782 | 212 |
| 93 | 3300007076 | Ga0075435_100590887 | Ga0075435_1005908872 | 212 |
| 94 | 3300013104 | Ga0157370_10409549 | Ga0157370_104095492 | 212 |
| 95 | 3300013308 | Ga0157375_10966423 | Ga0157375_109664231 | 212 |
| 96 | 3300025898 | Ga0207692_10239798 | Ga0207692_102397982 | 212 |
| 97 | 3300025915 | Ga0207693_10198463 | Ga0207693_101984632 | 212 |
| 98 | 3300025925 | Ga0207650_10011443 | Ga0207650_100114436 | 212 |
| 99 | 3300025929 | Ga0207664_10185652 | Ga0207664_101856522 | 212 |
| 100 | 3300025938 | Ga0207704_10457730 | Ga0207704_104577302 | 212 |
| 101 | 3300026088 | Ga0207641_10309634 | Ga0207641_103096342 | 212 |
| 102 | 3300028381 | Ga0268264_10679563 | Ga0268264_106795632 | 212 |
| 103 | 3300050513 | nmdc:mga0rr50_330706_c1 | nmdc:mga0rr50_330706_c1_166_834 | 212 |
| 104 | 3300050514 | nmdc:mga08x19_1968_c1 | nmdc:mga08x19_1968_c1_5971_6639 | 212 |
| 105 | 3300050514 | nmdc:mga08x19_39410_c1 | nmdc:mga08x19_39410_c1_920_1588 | 212 |
| 106 | 3300050514 | nmdc:mga08x19_44398_c1 | nmdc:mga08x19_44398_c1_669_1337 | 212 |
| 107 | 3300005353 | Ga0070669_100005541 | Ga0070669_1000055414 | 213 |
| 108 | 3300005364 | Ga0070673_100207321 | Ga0070673_1002073212 | 213 |
| 109 | 3300005364 | Ga0070673_100207555 | Ga0070673_1002075552 | 213 |
| 110 | 3300005545 | Ga0070695_100099652 | Ga0070695_1000996521 | 213 |
| 111 | 3300005563 | Ga0068855_100183077 | Ga0068855_1001830774 | 213 |
| 112 | 3300005618 | Ga0068864_100476115 | Ga0068864_1004761151 | 213 |
| 113 | 3300006881 | Ga0068865_100126489 | Ga0068865_1001264893 | 213 |
| 114 | 3300009094 | Ga0111539_10079531 | Ga0111539_100795315 | 213 |
| 115 | 3300009147 | Ga0114129_10049203 | Ga0114129_100492031 | 213 |
| 116 | 3300009177 | Ga0105248_11346235 | Ga0105248_113462352 | 213 |
| 117 | 3300009553 | Ga0105249_10046251 | Ga0105249_100462514 | 213 |
| 118 | 3300013297 | Ga0157378_10104249 | Ga0157378_101042492 | 213 |
| 119 | 3300013297 | Ga0157378_10402419 | Ga0157378_104024192 | 213 |
| 120 | 3300013306 | Ga0163162_10447279 | Ga0163162_104472792 | 213 |
| 121 | 3300014969 | Ga0157376_10385473 | Ga0157376_103854732 | 213 |
| 122 | 3300025923 | Ga0207681_10000879 | Ga0207681_100008795 | 213 |
| 123 | 3300025944 | Ga0207661_10000003 | Ga0207661_10000003358 | 213 |
| 124 | 3300025960 | Ga0207651_10190568 | Ga0207651_101905682 | 213 |
| 125 | 3300026035 | Ga0207703_10367669 | Ga0207703_103676692 | 213 |
| 126 | 3300026095 | Ga0207676_10424127 | Ga0207676_104241272 | 213 |
| 127 | 3300028380 | Ga0268265_10539278 | Ga0268265_105392781 | 213 |
| 128 | 3300031824 | Ga0307413_10224684 | Ga0307413_102246842 | 213 |
| 129 | 3300031903 | Ga0307407_10121615 | Ga0307407_101216152 | 213 |
| 130 | 3300032002 | Ga0307416_100018839 | Ga0307416_1000188393 | 213 |
| 131 | 3300032126 | Ga0307415_100071602 | Ga0307415_1000716023 | 213 |
| 132 | 3300039437 | Ga0436365_1053164 | Ga0436365_1053164_100_807 | 213 |
| 133 | 3300044673 | Ga0453683_0193404 | Ga0453683_0193404_96_770 | 213 |
| 134 | 3300049587 | Ga0501071_0516628 | Ga0501071_0516628_91_789 | 213 |
| 135 | 3300050493 | nmdc:mga0k408_8831_c1 | nmdc:mga0k408_8831_c1_4128_4826 | 213 |
| 136 | 3300050495 | nmdc:mga04h51_16446_c1 | nmdc:mga04h51_16446_c1_976_1674 | 213 |
| 137 | 3300050515 | nmdc:mga0a205_509108_c1 | nmdc:mga0a205_509108_c1_172_858 | 213 |
| 138 | 3300053730 | Ga0500645_002423 | Ga0500645_002423_4063_4740 | 213 |
| 139 | 3300005356 | Ga0070674_100100131 | Ga0070674_1001001312 | 214 |
| 140 | 3300009094 | Ga0111539_10089798 | Ga0111539_100897981 | 214 |
| 141 | 3300009147 | Ga0114129_10475000 | Ga0114129_104750001 | 214 |
| 142 | 3300028381 | Ga0268264_10575924 | Ga0268264_105759241 | 214 |
| 143 | 3300044694 | Ga0466963_0052559 | Ga0466963_0052559_24_704 | 214 |
| 144 | 3300044842 | Ga0466957_0034189 | Ga0466957_0034189_700_1380 | 214 |
| 145 | 3300045049 | Ga0466959_0453710 | Ga0466959_0453710_136_816 | 214 |
| 146 | 3300045836 | Ga0466958_0104906 | Ga0466958_0104906_863_1543 | 214 |
| 147 | 3300046476 | Ga0495662_0237579 | Ga0495662_0237579_15_716 | 214 |
| 148 | 3300046528 | Ga0495642_0145168 | Ga0495642_0145168_227_919 | 214 |
| 149 | 3300046538 | Ga0495609_0175589 | Ga0495609_0175589_151_843 | 214 |
| 150 | 3300046539 | Ga0495621_0007839 | Ga0495621_0007839_2051_2743 | 214 |
| 151 | 3300046684 | Ga0495669_0088025 | Ga0495669_0088025_256_948 | 214 |
| 152 | 3300046691 | Ga0495670_0011807 | Ga0495670_0011807_3191_3883 | 214 |
| 153 | 3300050493 | nmdc:mga0k408_74420_c1 | nmdc:mga0k408_74420_c1_381_1076 | 214 |
| 154 | 3300005365 | Ga0070688_100254058 | Ga0070688_1002540582 | 215 |
| 155 | 3300005466 | Ga0070685_10049081 | Ga0070685_100490812 | 215 |
| 156 | 3300005467 | Ga0070706_100105195 | Ga0070706_1001051954 | 215 |
| 157 | 3300005546 | Ga0070696_100292281 | Ga0070696_1002922812 | 215 |
| 158 | 3300005548 | Ga0070665_100000281 | Ga0070665_10000028140 | 215 |
| 159 | 3300006847 | Ga0075431_100302394 | Ga0075431_1003023942 | 215 |
| 160 | 3300013308 | Ga0157375_10230020 | Ga0157375_102300202 | 215 |
| 161 | 3300025910 | Ga0207684_10031952 | Ga0207684_100319522 | 215 |
| 162 | 3300026121 | Ga0207683_10094437 | Ga0207683_100944372 | 215 |
| 163 | 3300027907 | Ga0207428_10180609 | Ga0207428_101806093 | 215 |
| 164 | 3300028379 | Ga0268266_10000161 | Ga0268266_1000016120 | 215 |
| 165 | 3300031711 | Ga0265314_10035447 | Ga0265314_100354473 | 215 |
| 166 | 3300042876 | Ga0451577_0006065 | Ga0451577_0006065_500_1156 | 215 |
| 167 | 3300005333 | Ga0070677_10166575 | Ga0070677_101665752 | 216 |
| 168 | 3300005338 | Ga0068868_100557053 | Ga0068868_1005570532 | 216 |
| 169 | 3300005842 | Ga0068858_100989899 | Ga0068858_1009898991 | 216 |
| 170 | 3300006844 | Ga0075428_100278782 | Ga0075428_1002787822 | 216 |
| 171 | 3300006844 | Ga0075428_100307863 | Ga0075428_1003078633 | 216 |
| 172 | 3300006846 | Ga0075430_100110091 | Ga0075430_1001100913 | 216 |
| 173 | 3300006847 | Ga0075431_100015539 | Ga0075431_1000155393 | 216 |
| 174 | 3300009093 | Ga0105240_10013257 | Ga0105240_100132572 | 216 |
| 175 | 3300009177 | Ga0105248_10230990 | Ga0105248_102309903 | 216 |
| 176 | 3300009545 | Ga0105237_10384704 | Ga0105237_103847042 | 216 |
| 177 | 3300009553 | Ga0105249_10757433 | Ga0105249_107574332 | 216 |
| 178 | 3300010375 | Ga0105239_10018785 | Ga0105239_100187858 | 216 |
| 179 | 3300025913 | Ga0207695_10171597 | Ga0207695_101715972 | 216 |
| 180 | 3300025914 | Ga0207671_10363500 | Ga0207671_103635002 | 216 |
| 181 | 3300025919 | Ga0207657_10168407 | Ga0207657_101684072 | 216 |
| 182 | 3300025923 | Ga0207681_10348693 | Ga0207681_103486932 | 216 |
| 183 | 3300025941 | Ga0207711_10097151 | Ga0207711_100971514 | 216 |
| 184 | 3300027876 | Ga0209974_10064369 | Ga0209974_100643692 | 216 |
| 185 | 3300038443 | Ga0395901_0462618 | Ga0395901_0462618_92_838 | 216 |
| 186 | 3300049584 | Ga0501068_0088698 | Ga0501068_0088698_249_944 | 216 |
| 187 | 3300050509 | nmdc:mga0qj67_84948_c1 | nmdc:mga0qj67_84948_c1_1077_1775 | 216 |
| 188 | 3300050515 | nmdc:mga0a205_161954_c1 | nmdc:mga0a205_161954_c1_961_1716 | 216 |
| 189 | 3300005289 | Ga0065704_10113394 | Ga0065704_101133943 | 217 |
| 190 | 3300005295 | Ga0065707_10256441 | Ga0065707_102564412 | 217 |
| 191 | 3300005295 | Ga0065707_10284019 | Ga0065707_102840192 | 217 |
| 192 | 3300005329 | Ga0070683_100829850 | Ga0070683_1008298502 | 217 |
| 193 | 3300005330 | Ga0070690_100177126 | Ga0070690_1001771262 | 217 |
| 194 | 3300005331 | Ga0070670_100166949 | Ga0070670_1001669493 | 217 |
| 195 | 3300005334 | Ga0068869_100238904 | Ga0068869_1002389042 | 217 |
| 196 | 3300005340 | Ga0070689_100042217 | Ga0070689_1000422174 | 217 |
| 197 | 3300005343 | Ga0070687_100023099 | Ga0070687_1000230993 | 217 |
| 198 | 3300005347 | Ga0070668_100060823 | Ga0070668_1000608233 | 217 |
| 199 | 3300005353 | Ga0070669_100002059 | Ga0070669_1000020598 | 217 |
| 200 | 3300005354 | Ga0070675_100110037 | Ga0070675_1001100372 | 217 |
| 201 | 3300005365 | Ga0070688_100013523 | Ga0070688_1000135234 | 217 |
| 202 | 3300005366 | Ga0070659_100568797 | Ga0070659_1005687971 | 217 |
| 203 | 3300005406 | Ga0070703_10032020 | Ga0070703_100320203 | 217 |
| 204 | 3300005440 | Ga0070705_100379780 | Ga0070705_1003797801 | 217 |
| 205 | 3300005444 | Ga0070694_100012339 | Ga0070694_1000123392 | 217 |
| 206 | 3300005457 | Ga0070662_100345232 | Ga0070662_1003452321 | 217 |
| 207 | 3300005458 | Ga0070681_10348588 | Ga0070681_103485882 | 217 |
| 208 | 3300005459 | Ga0068867_100035716 | Ga0068867_1000357163 | 217 |
| 209 | 3300005466 | Ga0070685_10061739 | Ga0070685_100617393 | 217 |
| 210 | 3300005530 | Ga0070679_100466879 | Ga0070679_1004668792 | 217 |
| 211 | 3300005543 | Ga0070672_100020617 | Ga0070672_1000206173 | 217 |
| 212 | 3300005544 | Ga0070686_100112288 | Ga0070686_1001122882 | 217 |
| 213 | 3300005544 | Ga0070686_100129779 | Ga0070686_1001297793 | 217 |
| 214 | 3300005546 | Ga0070696_100015437 | Ga0070696_1000154373 | 217 |
| 215 | 3300005549 | Ga0070704_100017442 | Ga0070704_1000174422 | 217 |
| 216 | 3300005549 | Ga0070704_100044235 | Ga0070704_1000442352 | 217 |
| 217 | 3300005577 | Ga0068857_100125098 | Ga0068857_1001250983 | 217 |
| 218 | 3300005614 | Ga0068856_100525033 | Ga0068856_1005250332 | 217 |
| 219 | 3300005617 | Ga0068859_100006608 | Ga0068859_10000660810 | 217 |
| 220 | 3300005618 | Ga0068864_100073380 | Ga0068864_1000733802 | 217 |
| 221 | 3300005719 | Ga0068861_100001191 | Ga0068861_10000119110 | 217 |
| 222 | 3300005840 | Ga0068870_10001143 | Ga0068870_100011431 | 217 |
| 223 | 3300005842 | Ga0068858_100077467 | Ga0068858_1000774672 | 217 |
| 224 | 3300005844 | Ga0068862_100019276 | Ga0068862_1000192765 | 217 |
| 225 | 3300006358 | Ga0068871_100102965 | Ga0068871_1001029652 | 217 |
| 226 | 3300006358 | Ga0068871_100737756 | Ga0068871_1007377562 | 217 |
| 227 | 3300006844 | Ga0075428_100069048 | Ga0075428_1000690483 | 217 |
| 228 | 3300006846 | Ga0075430_100034887 | Ga0075430_1000348873 | 217 |
| 229 | 3300006931 | Ga0097620_100006608 | Ga0097620_1000066081 | 217 |
| 230 | 3300009093 | Ga0105240_10203959 | Ga0105240_102039592 | 217 |
| 231 | 3300009094 | Ga0111539_10005574 | Ga0111539_1000557410 | 217 |
| 232 | 3300009094 | Ga0111539_10311777 | Ga0111539_103117773 | 217 |
| 233 | 3300009094 | Ga0111539_10413225 | Ga0111539_104132252 | 217 |
| 234 | 3300009101 | Ga0105247_10248973 | Ga0105247_102489732 | 217 |
| 235 | 3300009147 | Ga0114129_10055343 | Ga0114129_100553435 | 217 |
| 236 | 3300009176 | Ga0105242_10643737 | Ga0105242_106437372 | 217 |
| 237 | 3300009177 | Ga0105248_10185633 | Ga0105248_101856332 | 217 |
| 238 | 3300009553 | Ga0105249_10004273 | Ga0105249_100042736 | 217 |
| 239 | 3300010375 | Ga0105239_10871401 | Ga0105239_108714012 | 217 |
| 240 | 3300013297 | Ga0157378_10298078 | Ga0157378_102980782 | 217 |
| 241 | 3300013306 | Ga0163162_10088850 | Ga0163162_100888502 | 217 |
| 242 | 3300014326 | Ga0157380_10363076 | Ga0157380_103630763 | 217 |
| 243 | 3300025315 | Ga0207697_10047928 | Ga0207697_100479282 | 217 |
| 244 | 3300025885 | Ga0207653_10059183 | Ga0207653_100591831 | 217 |
| 245 | 3300025900 | Ga0207710_10208532 | Ga0207710_102085322 | 217 |
| 246 | 3300025901 | Ga0207688_10005700 | Ga0207688_100057003 | 217 |
| 247 | 3300025904 | Ga0207647_10062073 | Ga0207647_100620732 | 217 |
| 248 | 3300025907 | Ga0207645_10214207 | Ga0207645_102142072 | 217 |
| 249 | 3300025908 | Ga0207643_10073932 | Ga0207643_100739321 | 217 |
| 250 | 3300025912 | Ga0207707_10021834 | Ga0207707_100218346 | 217 |
| 251 | 3300025914 | Ga0207671_10037683 | Ga0207671_100376835 | 217 |
| 252 | 3300025923 | Ga0207681_10063967 | Ga0207681_100639672 | 217 |
| 253 | 3300025925 | Ga0207650_10006493 | Ga0207650_100064936 | 217 |
| 254 | 3300025932 | Ga0207690_10555578 | Ga0207690_105555781 | 217 |
| 255 | 3300025933 | Ga0207706_10298043 | Ga0207706_102980432 | 217 |
| 256 | 3300025935 | Ga0207709_10028359 | Ga0207709_100283592 | 217 |
| 257 | 3300025936 | Ga0207670_10267520 | Ga0207670_102675202 | 217 |
| 258 | 3300025940 | Ga0207691_10008155 | Ga0207691_100081559 | 217 |
| 259 | 3300025941 | Ga0207711_10420960 | Ga0207711_104209602 | 217 |
| 260 | 3300025960 | Ga0207651_10349705 | Ga0207651_103497052 | 217 |
| 261 | 3300025961 | Ga0207712_10002060 | Ga0207712_100020607 | 217 |
| 262 | 3300025981 | Ga0207640_10073182 | Ga0207640_100731823 | 217 |
| 263 | 3300026078 | Ga0207702_10443319 | Ga0207702_104433192 | 217 |
| 264 | 3300026089 | Ga0207648_10011476 | Ga0207648_100114766 | 217 |
| 265 | 3300026118 | Ga0207675_100001985 | Ga0207675_10000198511 | 217 |
| 266 | 3300026121 | Ga0207683_10230999 | Ga0207683_102309992 | 217 |
| 267 | 3300026142 | Ga0207698_11086780 | Ga0207698_110867801 | 217 |
| 268 | 3300027907 | Ga0207428_10001642 | Ga0207428_1000164218 | 217 |
| 269 | 3300027907 | Ga0207428_10202726 | Ga0207428_102027263 | 217 |
| 270 | 3300027907 | Ga0207428_10241546 | Ga0207428_102415462 | 217 |
| 271 | 3300028380 | Ga0268265_10000135 | Ga0268265_100001356 | 217 |
| 272 | 3300032002 | Ga0307416_100674023 | Ga0307416_1006740231 | 217 |
| 273 | 3300035114 | Ga0373939_0021159 | Ga0373939_0021159_201_893 | 217 |
| 274 | 3300049576 | Ga0501040_0089114 | Ga0501040_0089114_1245_1946 | 217 |
| 275 | 3300049582 | Ga0501048_0051528 | Ga0501048_0051528_1809_2510 | 217 |
| 276 | 3300049587 | Ga0501071_0024452 | Ga0501071_0024452_2474_3175 | 217 |
| 277 | 3300049588 | Ga0501072_0284710 | Ga0501072_0284710_374_1075 | 217 |
| 278 | 3300049590 | Ga0501074_0450960 | Ga0501074_0450960_168_869 | 217 |
| 279 | 3300049591 | Ga0501075_0021253 | Ga0501075_0021253_3234_3935 | 217 |
| 280 | 3300049741 | Ga0501079_0066374 | Ga0501079_0066374_1716_2417 | 217 |
| 281 | 3300049742 | Ga0501080_0212080 | Ga0501080_0212080_949_1650 | 217 |
| 282 | 3300049743 | Ga0501081_0190749 | Ga0501081_0190749_477_1178 | 217 |
| 283 | 3300049824 | Ga0501045_0041432 | Ga0501045_0041432_885_1586 | 217 |
| 284 | 3300050507 | nmdc:mga05p37_40487_c1 | nmdc:mga05p37_40487_c1_435_1136 | 217 |
| 285 | 3300050508 | nmdc:mga09592_301948_c1 | nmdc:mga09592_301948_c1_338_1036 | 217 |
| 286 | 3300050509 | nmdc:mga0qj67_77166_c1 | nmdc:mga0qj67_77166_c1_562_1263 | 217 |
| 287 | 3300050511 | nmdc:mga08y16_16314_c1 | nmdc:mga08y16_16314_c1_1603_2295 | 217 |
| 288 | 3300050511 | nmdc:mga08y16_20018_c1 | nmdc:mga08y16_20018_c1_5765_6466 | 217 |
| 289 | 3300050511 | nmdc:mga08y16_327926_c1 | nmdc:mga08y16_327926_c1_677_1366 | 217 |
| 290 | 3300054114 | Ga0501084_0198139 | Ga0501084_0198139_421_1122 | 217 |
| 291 | 3300059421 | Ga0590071_005369 | Ga0590071_005369_2257_3057 | 217 |
| 292 | 3300006042 | Ga0075368_10004669 | Ga0075368_100046696 | 218 |
| 293 | 3300006178 | Ga0075367_10008309 | Ga0075367_100083094 | 218 |
| 294 | 3300006195 | Ga0075366_10002715 | Ga0075366_100027152 | 218 |
| 295 | 3300009545 | Ga0105237_10105838 | Ga0105237_101058382 | 218 |
| 296 | 3300025986 | Ga0207658_10506125 | Ga0207658_105061252 | 218 |
| 297 | 3300032002 | Ga0307416_100400576 | Ga0307416_1004005762 | 218 |
| 298 | 3300034819 | Ga0373958_0042837 | Ga0373958_0042837_95_796 | 218 |
| 299 | 3300042530 | Ga0450916_001806 | Ga0450916_001806_1162_1863 | 218 |
| 300 | 3300046539 | Ga0495621_0094989 | Ga0495621_0094989_287_988 | 218 |
| 301 | 3300050491 | nmdc:mga00v17_119854_c1 | nmdc:mga00v17_119854_c1_392_1066 | 218 |
| 302 | 3300005290 | Ga0065712_10002625 | Ga0065712_100026253 | 219 |
| 303 | 3300005293 | Ga0065715_10179547 | Ga0065715_101795472 | 219 |
| 304 | 3300005338 | Ga0068868_100763363 | Ga0068868_1007633632 | 219 |
| 305 | 3300005340 | Ga0070689_100268935 | Ga0070689_1002689352 | 219 |
| 306 | 3300005354 | Ga0070675_100128284 | Ga0070675_1001282842 | 219 |
| 307 | 3300005364 | Ga0070673_100006498 | Ga0070673_1000064984 | 219 |
| 308 | 3300005364 | Ga0070673_100521474 | Ga0070673_1005214742 | 219 |
| 309 | 3300005467 | Ga0070706_100000017 | Ga0070706_1000000174 | 219 |
| 310 | 3300005543 | Ga0070672_100325214 | Ga0070672_1003252142 | 219 |
| 311 | 3300005548 | Ga0070665_100514964 | Ga0070665_1005149642 | 219 |
| 312 | 3300013308 | Ga0157375_10190919 | Ga0157375_101909192 | 219 |
| 313 | 3300014326 | Ga0157380_10090655 | Ga0157380_100906553 | 219 |
| 314 | 3300025910 | Ga0207684_10000079 | Ga0207684_1000007987 | 219 |
| 315 | 3300025923 | Ga0207681_10072204 | Ga0207681_100722043 | 219 |
| 316 | 3300025926 | Ga0207659_10151964 | Ga0207659_101519642 | 219 |
| 317 | 3300025936 | Ga0207670_10211309 | Ga0207670_102113092 | 219 |
| 318 | 3300025940 | Ga0207691_10154162 | Ga0207691_101541622 | 219 |
| 319 | 3300025960 | Ga0207651_10015033 | Ga0207651_100150333 | 219 |
| 320 | 3300037466 | Ga0395898_0015655 | Ga0395898_0015655_1014_1754 | 219 |
| 321 | 3300042005 | Ga0439448_0027297 | Ga0439448_0027297_241_978 | 219 |
| 322 | 3300042157 | Ga0439458_0001621 | Ga0439458_0001621_2604_3341 | 219 |
| 323 | 3300042436 | Ga0439435_0009902 | Ga0439435_0009902_1421_2158 | 219 |
| 324 | 3300042438 | Ga0439459_0045375 | Ga0439459_0045375_180_917 | 219 |
| 325 | 3300053103 | Ga0500555_001047 | Ga0500555_001047_1777_2451 | 219 |
| 326 | 3300005289 | Ga0065704_10022647 | Ga0065704_100226471 | 220 |
| 327 | 3300005295 | Ga0065707_10099626 | Ga0065707_100996264 | 220 |
| 328 | 3300005334 | Ga0068869_100224091 | Ga0068869_1002240912 | 220 |
| 329 | 3300005354 | Ga0070675_100188634 | Ga0070675_1001886341 | 220 |
| 330 | 3300005355 | Ga0070671_100004964 | Ga0070671_1000049648 | 220 |
| 331 | 3300005456 | Ga0070678_100183990 | Ga0070678_1001839902 | 220 |
| 332 | 3300005547 | Ga0070693_100295660 | Ga0070693_1002956602 | 220 |
| 333 | 3300005564 | Ga0070664_100093533 | Ga0070664_1000935332 | 220 |
| 334 | 3300005578 | Ga0068854_100070373 | Ga0068854_1000703733 | 220 |
| 335 | 3300005614 | Ga0068856_100010662 | Ga0068856_1000106629 | 220 |
| 336 | 3300005616 | Ga0068852_100320017 | Ga0068852_1003200172 | 220 |
| 337 | 3300005617 | Ga0068859_100081330 | Ga0068859_1000813302 | 220 |
| 338 | 3300005617 | Ga0068859_100455762 | Ga0068859_1004557621 | 220 |
| 339 | 3300005618 | Ga0068864_100002881 | Ga0068864_1000028816 | 220 |
| 340 | 3300005718 | Ga0068866_10177249 | Ga0068866_101772492 | 220 |
| 341 | 3300005840 | Ga0068870_10036479 | Ga0068870_100364793 | 220 |
| 342 | 3300005841 | Ga0068863_100119373 | Ga0068863_1001193732 | 220 |
| 343 | 3300005842 | Ga0068858_100035013 | Ga0068858_1000350136 | 220 |
| 344 | 3300005843 | Ga0068860_100194224 | Ga0068860_1001942242 | 220 |
| 345 | 3300005844 | Ga0068862_100148510 | Ga0068862_1001485102 | 220 |
| 346 | 3300006237 | Ga0097621_100073884 | Ga0097621_1000738843 | 220 |
| 347 | 3300006847 | Ga0075431_100054172 | Ga0075431_1000541722 | 220 |
| 348 | 3300006852 | Ga0075433_10008532 | Ga0075433_100085325 | 220 |
| 349 | 3300006852 | Ga0075433_10018529 | Ga0075433_100185294 | 220 |
| 350 | 3300006852 | Ga0075433_10019163 | Ga0075433_100191635 | 220 |
| 351 | 3300006852 | Ga0075433_10245982 | Ga0075433_102459822 | 220 |
| 352 | 3300006871 | Ga0075434_100092464 | Ga0075434_1000924642 | 220 |
| 353 | 3300006871 | Ga0075434_100363791 | Ga0075434_1003637911 | 220 |
| 354 | 3300006880 | Ga0075429_100153766 | Ga0075429_1001537662 | 220 |
| 355 | 3300006881 | Ga0068865_100144722 | Ga0068865_1001447222 | 220 |
| 356 | 3300006931 | Ga0097620_100081330 | Ga0097620_1000813304 | 220 |
| 357 | 3300006931 | Ga0097620_100455728 | Ga0097620_1004557281 | 220 |
| 358 | 3300007076 | Ga0075435_100256365 | Ga0075435_1002563652 | 220 |
| 359 | 3300009147 | Ga0114129_10024805 | Ga0114129_100248054 | 220 |
| 360 | 3300009177 | Ga0105248_10053476 | Ga0105248_100534763 | 220 |
| 361 | 3300009177 | Ga0105248_10087961 | Ga0105248_100879614 | 220 |
| 362 | 3300009545 | Ga0105237_10104408 | Ga0105237_101044084 | 220 |
| 363 | 3300013296 | Ga0157374_10019423 | Ga0157374_100194234 | 220 |
| 364 | 3300013297 | Ga0157378_10008418 | Ga0157378_100084183 | 220 |
| 365 | 3300013306 | Ga0163162_10000539 | Ga0163162_100005398 | 220 |
| 366 | 3300013307 | Ga0157372_10074395 | Ga0157372_100743955 | 220 |
| 367 | 3300013308 | Ga0157375_10111777 | Ga0157375_101117773 | 220 |
| 368 | 3300014325 | Ga0163163_10006853 | Ga0163163_100068534 | 220 |
| 369 | 3300014745 | Ga0157377_10078250 | Ga0157377_100782502 | 220 |
| 370 | 3300025908 | Ga0207643_10018772 | Ga0207643_100187722 | 220 |
| 371 | 3300025913 | Ga0207695_10404193 | Ga0207695_104041932 | 220 |
| 372 | 3300025914 | Ga0207671_10419078 | Ga0207671_104190782 | 220 |
| 373 | 3300025926 | Ga0207659_10064693 | Ga0207659_100646932 | 220 |
| 374 | 3300025931 | Ga0207644_10000824 | Ga0207644_1000082412 | 220 |
| 375 | 3300025933 | Ga0207706_10482778 | Ga0207706_104827782 | 220 |
| 376 | 3300025938 | Ga0207704_10076399 | Ga0207704_100763992 | 220 |
| 377 | 3300025941 | Ga0207711_10078119 | Ga0207711_100781192 | 220 |
| 378 | 3300025942 | Ga0207689_10149738 | Ga0207689_101497382 | 220 |
| 379 | 3300025942 | Ga0207689_10212385 | Ga0207689_102123852 | 220 |
| 380 | 3300025945 | Ga0207679_10070632 | Ga0207679_100706322 | 220 |
| 381 | 3300025981 | Ga0207640_10038408 | Ga0207640_100384082 | 220 |
| 382 | 3300026035 | Ga0207703_10025335 | Ga0207703_100253351 | 220 |
| 383 | 3300026078 | Ga0207702_10014773 | Ga0207702_100147736 | 220 |
| 384 | 3300026088 | Ga0207641_10126926 | Ga0207641_101269263 | 220 |
| 385 | 3300026095 | Ga0207676_10005286 | Ga0207676_100052866 | 220 |
| 386 | 3300026121 | Ga0207683_10303232 | Ga0207683_103032322 | 220 |
| 387 | 3300026142 | Ga0207698_10375646 | Ga0207698_103756462 | 220 |
| 388 | 3300028380 | Ga0268265_10134071 | Ga0268265_101340712 | 220 |
| 389 | 3300036401 | Ga0373937_0091916 | Ga0373937_0091916_1723_2463 | 220 |
| 390 | 3300037418 | Ga0395900_0414868 | Ga0395900_0414868_479_1219 | 220 |
| 391 | 3300038996 | Ga0242420_009417 | Ga0242420_009417_136_876 | 220 |
| 392 | 3300048906 | Ga0496103_0028216 | Ga0496103_0028216_2513_3253 | 220 |
| 393 | 3300048909 | Ga0496106_0184013 | Ga0496106_0184013_779_1519 | 220 |
| 394 | 3300050494 | nmdc:mga06z11_79006_c1 | nmdc:mga06z11_79006_c1_13_693 | 220 |
| 395 | 3300050507 | nmdc:mga05p37_58869_c1 | nmdc:mga05p37_58869_c1_875_1615 | 220 |
| 396 | 3300050508 | nmdc:mga09592_412521_c1 | nmdc:mga09592_412521_c1_410_1153 | 220 |
| 397 | 3300050510 | nmdc:mga06r32_569058_c1 | nmdc:mga06r32_569058_c1_202_954 | 220 |
| 398 | 3300050512 | nmdc:mga0n895_23710_c1 | nmdc:mga0n895_23710_c1_4553_5293 | 220 |
| 399 | 3300050513 | nmdc:mga0rr50_129821_c1 | nmdc:mga0rr50_129821_c1_1147_1887 | 220 |
| 400 | 3300050513 | nmdc:mga0rr50_211847_c1 | nmdc:mga0rr50_211847_c1_24_764 | 220 |
| 401 | 3300050515 | nmdc:mga0a205_114150_c1 | nmdc:mga0a205_114150_c1_848_1588 | 220 |
| 402 | 3300050515 | nmdc:mga0a205_150089_c1 | nmdc:mga0a205_150089_c1_1184_1930 | 220 |
| 403 | 3300050515 | nmdc:mga0a205_19009_c1 | nmdc:mga0a205_19009_c1_2853_3593 | 220 |
| 404 | 3300053153 | Ga0500616_0000829 | Ga0500616_0000829_3505_4182 | 220 |
| 405 | 3300005343 | Ga0070687_100014988 | Ga0070687_1000149882 | 221 |
| 406 | 3300005345 | Ga0070692_10251610 | Ga0070692_102516101 | 221 |
| 407 | 3300005440 | Ga0070705_100040131 | Ga0070705_1000401312 | 221 |
| 408 | 3300005441 | Ga0070700_100349594 | Ga0070700_1003495942 | 221 |
| 409 | 3300005444 | Ga0070694_100013920 | Ga0070694_1000139202 | 221 |
| 410 | 3300005539 | Ga0068853_100197466 | Ga0068853_1001974663 | 221 |
| 411 | 3300005548 | Ga0070665_100462654 | Ga0070665_1004626542 | 221 |
| 412 | 3300005549 | Ga0070704_100010948 | Ga0070704_1000109486 | 221 |
| 413 | 3300005616 | Ga0068852_100409185 | Ga0068852_1004091852 | 221 |
| 414 | 3300005618 | Ga0068864_100582003 | Ga0068864_1005820031 | 221 |
| 415 | 3300005834 | Ga0068851_10151960 | Ga0068851_101519602 | 221 |
| 416 | 3300005842 | Ga0068858_100036842 | Ga0068858_1000368422 | 221 |
| 417 | 3300006195 | Ga0075366_10054578 | Ga0075366_100545783 | 221 |
| 418 | 3300006353 | Ga0075370_10033120 | Ga0075370_100331203 | 221 |
| 419 | 3300006844 | Ga0075428_100102438 | Ga0075428_1001024383 | 221 |
| 420 | 3300009147 | Ga0114129_10524507 | Ga0114129_105245072 | 221 |
| 421 | 3300009147 | Ga0114129_10663454 | Ga0114129_106634542 | 221 |
| 422 | 3300009545 | Ga0105237_10001605 | Ga0105237_1000160523 | 221 |
| 423 | 3300013306 | Ga0163162_10037891 | Ga0163162_100378916 | 221 |
| 424 | 3300013307 | Ga0157372_10346239 | Ga0157372_103462392 | 221 |
| 425 | 3300014745 | Ga0157377_10327289 | Ga0157377_103272892 | 221 |
| 426 | 3300025885 | Ga0207653_10001629 | Ga0207653_100016297 | 221 |
| 427 | 3300025914 | Ga0207671_10003525 | Ga0207671_1000352510 | 221 |
| 428 | 3300025918 | Ga0207662_10011883 | Ga0207662_100118834 | 221 |
| 429 | 3300025918 | Ga0207662_10128657 | Ga0207662_101286573 | 221 |
| 430 | 3300025932 | Ga0207690_10474734 | Ga0207690_104747342 | 221 |
| 431 | 3300025938 | Ga0207704_10382764 | Ga0207704_103827642 | 221 |
| 432 | 3300026118 | Ga0207675_100180796 | Ga0207675_1001807962 | 221 |
| 433 | 3300028379 | Ga0268266_10223248 | Ga0268266_102232482 | 221 |
| 434 | 3300031548 | Ga0307408_100146495 | Ga0307408_1001464953 | 221 |
| 435 | 3300032005 | Ga0307411_10256221 | Ga0307411_102562212 | 221 |
| 436 | 3300046492 | Ga0495585_0130195 | Ga0495585_0130195_528_1226 | 221 |
| 437 | 3300046539 | Ga0495621_0069244 | Ga0495621_0069244_254_952 | 221 |
| 438 | 3300049521 | Ga0501298_042395 | Ga0501298_042395_30_776 | 221 |
| 439 | 3300049665 | Ga0501227_006404 | Ga0501227_006404_127_873 | 221 |
| 440 | 3300049673 | Ga0501240_022566 | Ga0501240_022566_125_871 | 221 |
| 441 | 3300049768 | Ga0501271_010394 | Ga0501271_010394_99_845 | 221 |
| 442 | 3300049851 | Ga0501212_008037 | Ga0501212_008037_41_787 | 221 |
| 443 | 3300050493 | nmdc:mga0k408_32071_c1 | nmdc:mga0k408_32071_c1_1341_2027 | 221 |
| 444 | 3300050496 | nmdc:mga07m45_3177_c1 | nmdc:mga07m45_3177_c1_95_781 | 221 |
| 445 | 3300059421 | Ga0590071_001172 | Ga0590071_001172_858_1616 | 221 |
| 446 | 3300003203 | JGI25406J46586_10025285 | JGI25406J46586_100252852 | 222 |
| 447 | 3300005289 | Ga0065704_10153920 | Ga0065704_101539201 | 222 |
| 448 | 3300005290 | Ga0065712_10016166 | Ga0065712_100161662 | 222 |
| 449 | 3300005331 | Ga0070670_100071576 | Ga0070670_1000715762 | 222 |
| 450 | 3300005331 | Ga0070670_100500072 | Ga0070670_1005000722 | 222 |
| 451 | 3300005333 | Ga0070677_10059944 | Ga0070677_100599442 | 222 |
| 452 | 3300005347 | Ga0070668_100127988 | Ga0070668_1001279882 | 222 |
| 453 | 3300005347 | Ga0070668_100445241 | Ga0070668_1004452412 | 222 |
| 454 | 3300005353 | Ga0070669_100154516 | Ga0070669_1001545162 | 222 |
| 455 | 3300005354 | Ga0070675_100075497 | Ga0070675_1000754973 | 222 |
| 456 | 3300005354 | Ga0070675_100134579 | Ga0070675_1001345791 | 222 |
| 457 | 3300005356 | Ga0070674_100136853 | Ga0070674_1001368532 | 222 |
| 458 | 3300005364 | Ga0070673_100233756 | Ga0070673_1002337561 | 222 |
| 459 | 3300005366 | Ga0070659_100266754 | Ga0070659_1002667542 | 222 |
| 460 | 3300005456 | Ga0070678_100292017 | Ga0070678_1002920172 | 222 |
| 461 | 3300005459 | Ga0068867_100225054 | Ga0068867_1002250542 | 222 |
| 462 | 3300005543 | Ga0070672_100468492 | Ga0070672_1004684922 | 222 |
| 463 | 3300005548 | Ga0070665_100153067 | Ga0070665_1001530673 | 222 |
| 464 | 3300005617 | Ga0068859_100134300 | Ga0068859_1001343003 | 222 |
| 465 | 3300005985 | Ga0081539_10001769 | Ga0081539_1000176922 | 222 |
| 466 | 3300006178 | Ga0075367_10162981 | Ga0075367_101629812 | 222 |
| 467 | 3300006195 | Ga0075366_10219322 | Ga0075366_102193222 | 222 |
| 468 | 3300006852 | Ga0075433_10159247 | Ga0075433_101592472 | 222 |
| 469 | 3300006881 | Ga0068865_100098147 | Ga0068865_1000981473 | 222 |
| 470 | 3300006881 | Ga0068865_100201836 | Ga0068865_1002018363 | 222 |
| 471 | 3300006931 | Ga0097620_100134289 | Ga0097620_1001342892 | 222 |
| 472 | 3300013306 | Ga0163162_10072367 | Ga0163162_100723673 | 222 |
| 473 | 3300014326 | Ga0157380_10238880 | Ga0157380_102388802 | 222 |
| 474 | 3300014968 | Ga0157379_10100973 | Ga0157379_101009732 | 222 |
| 475 | 3300025907 | Ga0207645_10014924 | Ga0207645_100149243 | 222 |
| 476 | 3300025922 | Ga0207646_10547734 | Ga0207646_105477341 | 222 |
| 477 | 3300025923 | Ga0207681_10042241 | Ga0207681_100422414 | 222 |
| 478 | 3300025926 | Ga0207659_10314667 | Ga0207659_103146673 | 222 |
| 479 | 3300025932 | Ga0207690_10629971 | Ga0207690_106299712 | 222 |
| 480 | 3300025937 | Ga0207669_10000860 | Ga0207669_1000086011 | 222 |
| 481 | 3300025940 | Ga0207691_10037214 | Ga0207691_100372144 | 222 |
| 482 | 3300025940 | Ga0207691_10342784 | Ga0207691_103427842 | 222 |
| 483 | 3300025972 | Ga0207668_10355300 | Ga0207668_103553002 | 222 |
| 484 | 3300026089 | Ga0207648_10077160 | Ga0207648_100771603 | 222 |
| 485 | 3300026118 | Ga0207675_100584795 | Ga0207675_1005847952 | 222 |
| 486 | 3300028380 | Ga0268265_10063517 | Ga0268265_100635172 | 222 |
| 487 | 3300028381 | Ga0268264_10145929 | Ga0268264_101459292 | 222 |
| 488 | 3300035091 | Ga0373951_0034204 | Ga0373951_0034204_261_1019 | 222 |
| 489 | 3300046460 | Ga0495638_0004257 | Ga0495638_0004257_9277_9966 | 222 |
| 490 | 3300046537 | Ga0495598_0106180 | Ga0495598_0106180_147_845 | 222 |
| 491 | 3300050494 | nmdc:mga06z11_144809_c1 | nmdc:mga06z11_144809_c1_248_937 | 222 |
| 492 | 3300053727 | Ga0500611_002917 | Ga0500611_002917_1003_1692 | 222 |
| 493 | 3300005340 | Ga0070689_100100654 | Ga0070689_1001006544 | 223 |
| 494 | 3300005457 | Ga0070662_100550188 | Ga0070662_1005501881 | 223 |
| 495 | 3300005518 | Ga0070699_100151262 | Ga0070699_1001512622 | 223 |
| 496 | 3300005539 | Ga0068853_100004645 | Ga0068853_1000046451 | 223 |
| 497 | 3300005564 | Ga0070664_100033946 | Ga0070664_1000339462 | 223 |
| 498 | 3300005577 | Ga0068857_100105733 | Ga0068857_1001057334 | 223 |
| 499 | 3300005618 | Ga0068864_100054305 | Ga0068864_1000543054 | 223 |
| 500 | 3300006871 | Ga0075434_100060618 | Ga0075434_1000606183 | 223 |
| 501 | 3300013307 | Ga0157372_10369262 | Ga0157372_103692622 | 223 |
| 502 | 3300014325 | Ga0163163_10079861 | Ga0163163_100798612 | 223 |
| 503 | 3300014325 | Ga0163163_10449160 | Ga0163163_104491602 | 223 |
| 504 | 3300025912 | Ga0207707_10071114 | Ga0207707_100711142 | 223 |
| 505 | 3300025921 | Ga0207652_10061700 | Ga0207652_100617003 | 223 |
| 506 | 3300025933 | Ga0207706_10577395 | Ga0207706_105773952 | 223 |
| 507 | 3300025945 | Ga0207679_10034122 | Ga0207679_100341224 | 223 |
| 508 | 3300026095 | Ga0207676_10031246 | Ga0207676_100312464 | 223 |
| 509 | 3300026116 | Ga0207674_10000079 | Ga0207674_1000007927 | 223 |
| 510 | 3300032005 | Ga0307411_10061901 | Ga0307411_100619012 | 223 |
| 511 | 3300050512 | nmdc:mga0n895_136419_c1 | nmdc:mga0n895_136419_c1_952_1710 | 223 |
| 512 | 3300050512 | nmdc:mga0n895_13720_c1 | nmdc:mga0n895_13720_c1_3688_4368 | 223 |
| 513 | 3300050512 | nmdc:mga0n895_56795_c1 | nmdc:mga0n895_56795_c1_2862_3545 | 223 |
| 514 | 3300050515 | nmdc:mga0a205_857408_c1 | nmdc:mga0a205_857408_c1_29_709 | 223 |
| 515 | 3300005295 | Ga0065707_10090215 | Ga0065707_100902154 | 224 |
| 516 | 3300005458 | Ga0070681_10000273 | Ga0070681_1000027336 | 224 |
| 517 | 3300006844 | Ga0075428_100110669 | Ga0075428_1001106692 | 224 |
| 518 | 3300006846 | Ga0075430_100105973 | Ga0075430_1001059733 | 224 |
| 519 | 3300006846 | Ga0075430_100153334 | Ga0075430_1001533342 | 224 |
| 520 | 3300006847 | Ga0075431_100101664 | Ga0075431_1001016643 | 224 |
| 521 | 3300006847 | Ga0075431_100448728 | Ga0075431_1004487282 | 224 |
| 522 | 3300006847 | Ga0075431_100501857 | Ga0075431_1005018572 | 224 |
| 523 | 3300006880 | Ga0075429_100392938 | Ga0075429_1003929382 | 224 |
| 524 | 3300009094 | Ga0111539_10011387 | Ga0111539_100113872 | 224 |
| 525 | 3300009094 | Ga0111539_10028207 | Ga0111539_100282075 | 224 |
| 526 | 3300027682 | Ga0209971_1016111 | Ga0209971_10161112 | 224 |
| 527 | 3300027907 | Ga0207428_10001048 | Ga0207428_1000104824 | 224 |
| 528 | 3300027907 | Ga0207428_10008918 | Ga0207428_100089182 | 224 |
| 529 | 3300045051 | Ga0451576_0112797 | Ga0451576_0112797_1414_2175 | 224 |
| 530 | 3300050507 | nmdc:mga05p37_1_c1 | nmdc:mga05p37_1_c1_36076_36837 | 224 |
| 531 | 3300050508 | nmdc:mga09592_77774_c1 | nmdc:mga09592_77774_c1_206_904 | 224 |
| 532 | 3300050509 | nmdc:mga0qj67_106354_c1 | nmdc:mga0qj67_106354_c1_730_1428 | 224 |
| 533 | 3300050509 | nmdc:mga0qj67_169793_c1 | nmdc:mga0qj67_169793_c1_893_1681 | 224 |
| 534 | 3300050509 | nmdc:mga0qj67_191946_c1 | nmdc:mga0qj67_191946_c1_308_1009 | 224 |
| 535 | 3300050510 | nmdc:mga06r32_395742_c1 | nmdc:mga06r32_395742_c1_75_854 | 224 |
| 536 | 3300050510 | nmdc:mga06r32_663245_c1 | nmdc:mga06r32_663245_c1_114_812 | 224 |
| 537 | 3300050510 | nmdc:mga06r32_92361_c1 | nmdc:mga06r32_92361_c1_20_772 | 224 |
| 538 | 3300050511 | nmdc:mga08y16_4121_c1 | nmdc:mga08y16_4121_c1_7860_8621 | 224 |
| 539 | 3300005347 | Ga0070668_100137844 | Ga0070668_1001378443 | 225 |
| 540 | 3300005441 | Ga0070700_100050889 | Ga0070700_1000508892 | 225 |
| 541 | 3300005441 | Ga0070700_100193164 | Ga0070700_1001931643 | 225 |
| 542 | 3300005455 | Ga0070663_100314193 | Ga0070663_1003141932 | 225 |
| 543 | 3300005518 | Ga0070699_100373913 | Ga0070699_1003739132 | 225 |
| 544 | 3300006051 | Ga0075364_10319670 | Ga0075364_103196701 | 225 |
| 545 | 3300006178 | Ga0075367_10029494 | Ga0075367_100294942 | 225 |
| 546 | 3300006847 | Ga0075431_100196629 | Ga0075431_1001966292 | 225 |
| 547 | 3300006852 | Ga0075433_10000236 | Ga0075433_1000023622 | 225 |
| 548 | 3300006871 | Ga0075434_100001337 | Ga0075434_10000133721 | 225 |
| 549 | 3300007076 | Ga0075435_100001882 | Ga0075435_1000018828 | 225 |
| 550 | 3300009094 | Ga0111539_10397429 | Ga0111539_103974292 | 225 |
| 551 | 3300009147 | Ga0114129_10274606 | Ga0114129_102746063 | 225 |
| 552 | 3300009147 | Ga0114129_11499248 | Ga0114129_114992481 | 225 |
| 553 | 3300025900 | Ga0207710_10015587 | Ga0207710_100155872 | 225 |
| 554 | 3300025960 | Ga0207651_10469640 | Ga0207651_104696402 | 225 |
| 555 | 3300025972 | Ga0207668_10471405 | Ga0207668_104714052 | 225 |
| 556 | 3300026075 | Ga0207708_10064512 | Ga0207708_100645122 | 225 |
| 557 | 3300026075 | Ga0207708_10240498 | Ga0207708_102404982 | 225 |
| 558 | 3300026089 | Ga0207648_10172522 | Ga0207648_101725222 | 225 |
| 559 | 3300031548 | Ga0307408_100054721 | Ga0307408_1000547212 | 225 |
| 560 | 3300031731 | Ga0307405_10000588 | Ga0307405_100005886 | 225 |
| 561 | 3300031824 | Ga0307413_10009332 | Ga0307413_100093324 | 225 |
| 562 | 3300031852 | Ga0307410_10004093 | Ga0307410_100040933 | 225 |
| 563 | 3300031995 | Ga0307409_100012205 | Ga0307409_1000122053 | 225 |
| 564 | 3300032002 | Ga0307416_100001585 | Ga0307416_1000015853 | 225 |
| 565 | 3300032005 | Ga0307411_10001285 | Ga0307411_100012859 | 225 |
| 566 | 3300032126 | Ga0307415_100001811 | Ga0307415_10000181111 | 225 |
| 567 | 3300050507 | nmdc:mga05p37_251236_c1 | nmdc:mga05p37_251236_c1_833_1528 | 225 |
| 568 | 3300050511 | nmdc:mga08y16_209702_c1 | nmdc:mga08y16_209702_c1_428_1126 | 225 |
| 569 | 3300050512 | nmdc:mga0n895_25567_c1 | nmdc:mga0n895_25567_c1_3819_4517 | 225 |
| 570 | 3300050515 | nmdc:mga0a205_293_c2 | nmdc:mga0a205_293_c2_14492_15190 | 225 |
| 571 | 3300050515 | nmdc:mga0a205_306359_c1 | nmdc:mga0a205_306359_c1_193_891 | 225 |
| 572 | 3300005340 | Ga0070689_100114284 | Ga0070689_1001142842 | 226 |
| 573 | 3300005347 | Ga0070668_100267499 | Ga0070668_1002674992 | 226 |
| 574 | 3300005354 | Ga0070675_100241503 | Ga0070675_1002415032 | 226 |
| 575 | 3300005356 | Ga0070674_100492769 | Ga0070674_1004927692 | 226 |
| 576 | 3300005364 | Ga0070673_100164217 | Ga0070673_1001642173 | 226 |
| 577 | 3300005365 | Ga0070688_100015084 | Ga0070688_1000150843 | 226 |
| 578 | 3300005438 | Ga0070701_10044551 | Ga0070701_100445513 | 226 |
| 579 | 3300005457 | Ga0070662_100489548 | Ga0070662_1004895481 | 226 |
| 580 | 3300005466 | Ga0070685_10030778 | Ga0070685_100307783 | 226 |
| 581 | 3300005544 | Ga0070686_100600625 | Ga0070686_1006006251 | 226 |
| 582 | 3300005617 | Ga0068859_100037931 | Ga0068859_1000379313 | 226 |
| 583 | 3300005618 | Ga0068864_100016493 | Ga0068864_1000164934 | 226 |
| 584 | 3300005842 | Ga0068858_100174715 | Ga0068858_1001747153 | 226 |
| 585 | 3300006880 | Ga0075429_100073085 | Ga0075429_1000730852 | 226 |
| 586 | 3300006931 | Ga0097620_100037929 | Ga0097620_1000379293 | 226 |
| 587 | 3300014325 | Ga0163163_10036436 | Ga0163163_100364365 | 226 |
| 588 | 3300025908 | Ga0207643_10072081 | Ga0207643_100720812 | 226 |
| 589 | 3300025918 | Ga0207662_10053633 | Ga0207662_100536332 | 226 |
| 590 | 3300025926 | Ga0207659_10016074 | Ga0207659_100160744 | 226 |
| 591 | 3300025945 | Ga0207679_10024700 | Ga0207679_100247002 | 226 |
| 592 | 3300025972 | Ga0207668_10549295 | Ga0207668_105492951 | 226 |
| 593 | 3300025981 | Ga0207640_10268744 | Ga0207640_102687442 | 226 |
| 594 | 3300026095 | Ga0207676_10030545 | Ga0207676_100305452 | 226 |
| 595 | 3300026116 | Ga0207674_10427178 | Ga0207674_104271782 | 226 |
| 596 | 3300046615 | Ga0495656_0008786 | Ga0495656_0008786_1638_2339 | 226 |
| 597 | 3300050508 | nmdc:mga09592_74053_c1 | nmdc:mga09592_74053_c1_315_1010 | 226 |
| 598 | 3300025961 | Ga0207712_10399925 | Ga0207712_103999252 | 227 |
| 599 | 3300001977 | JGI24746J21847_1005306 | JGI24746J21847_10053062 | 228 |
| 600 | 3300005289 | Ga0065704_10073597 | Ga0065704_100735974 | 228 |
| 601 | 3300005290 | Ga0065712_10000219 | Ga0065712_1000021910 | 228 |
| 602 | 3300005293 | Ga0065715_10096482 | Ga0065715_100964823 | 228 |
| 603 | 3300005293 | Ga0065715_10097033 | Ga0065715_100970333 | 228 |
| 604 | 3300005293 | Ga0065715_10218196 | Ga0065715_102181962 | 228 |
| 605 | 3300005295 | Ga0065707_10001683 | Ga0065707_100016832 | 228 |
| 606 | 3300005295 | Ga0065707_10034238 | Ga0065707_100342382 | 228 |
| 607 | 3300005295 | Ga0065707_10232790 | Ga0065707_102327901 | 228 |
| 608 | 3300005328 | Ga0070676_10002802 | Ga0070676_100028026 | 228 |
| 609 | 3300005328 | Ga0070676_10016273 | Ga0070676_100162735 | 228 |
| 610 | 3300005330 | Ga0070690_100031524 | Ga0070690_1000315243 | 228 |
| 611 | 3300005330 | Ga0070690_100151542 | Ga0070690_1001515422 | 228 |
| 612 | 3300005333 | Ga0070677_10001401 | Ga0070677_100014014 | 228 |
| 613 | 3300005333 | Ga0070677_10063929 | Ga0070677_100639292 | 228 |
| 614 | 3300005334 | Ga0068869_100011805 | Ga0068869_1000118054 | 228 |
| 615 | 3300005334 | Ga0068869_100407333 | Ga0068869_1004073332 | 228 |
| 616 | 3300005335 | Ga0070666_10004032 | Ga0070666_100040322 | 228 |
| 617 | 3300005335 | Ga0070666_10063210 | Ga0070666_100632102 | 228 |
| 618 | 3300005340 | Ga0070689_100002830 | Ga0070689_1000028306 | 228 |
| 619 | 3300005340 | Ga0070689_100018135 | Ga0070689_1000181355 | 228 |
| 620 | 3300005343 | Ga0070687_100206374 | Ga0070687_1002063741 | 228 |
| 621 | 3300005344 | Ga0070661_100031836 | Ga0070661_1000318361 | 228 |
| 622 | 3300005353 | Ga0070669_100001921 | Ga0070669_10000192116 | 228 |
| 623 | 3300005354 | Ga0070675_100002457 | Ga0070675_1000024573 | 228 |
| 624 | 3300005354 | Ga0070675_100002479 | Ga0070675_1000024793 | 228 |
| 625 | 3300005364 | Ga0070673_100000726 | Ga0070673_10000072612 | 228 |
| 626 | 3300005364 | Ga0070673_100001253 | Ga0070673_1000012534 | 228 |
| 627 | 3300005365 | Ga0070688_100000591 | Ga0070688_10000059116 | 228 |
| 628 | 3300005365 | Ga0070688_100045520 | Ga0070688_1000455203 | 228 |
| 629 | 3300005365 | Ga0070688_100088356 | Ga0070688_1000883562 | 228 |
| 630 | 3300005367 | Ga0070667_100071360 | Ga0070667_1000713602 | 228 |
| 631 | 3300005444 | Ga0070694_100074129 | Ga0070694_1000741292 | 228 |
| 632 | 3300005456 | Ga0070678_100045389 | Ga0070678_1000453893 | 228 |
| 633 | 3300005457 | Ga0070662_100008143 | Ga0070662_1000081435 | 228 |
| 634 | 3300005466 | Ga0070685_10039236 | Ga0070685_100392363 | 228 |
| 635 | 3300005467 | Ga0070706_100166559 | Ga0070706_1001665594 | 228 |
| 636 | 3300005471 | Ga0070698_100007095 | Ga0070698_1000070957 | 228 |
| 637 | 3300005518 | Ga0070699_100003587 | Ga0070699_1000035878 | 228 |
| 638 | 3300005543 | Ga0070672_100000166 | Ga0070672_10000016612 | 228 |
| 639 | 3300005543 | Ga0070672_100166295 | Ga0070672_1001662952 | 228 |
| 640 | 3300005544 | Ga0070686_100029433 | Ga0070686_1000294334 | 228 |
| 641 | 3300005546 | Ga0070696_100017102 | Ga0070696_1000171022 | 228 |
| 642 | 3300005564 | Ga0070664_100010524 | Ga0070664_1000105244 | 228 |
| 643 | 3300005615 | Ga0070702_100184481 | Ga0070702_1001844812 | 228 |
| 644 | 3300005617 | Ga0068859_100007844 | Ga0068859_1000078448 | 228 |
| 645 | 3300005618 | Ga0068864_100203925 | Ga0068864_1002039252 | 228 |
| 646 | 3300005618 | Ga0068864_100371229 | Ga0068864_1003712292 | 228 |
| 647 | 3300005840 | Ga0068870_10032943 | Ga0068870_100329432 | 228 |
| 648 | 3300005841 | Ga0068863_100598458 | Ga0068863_1005984582 | 228 |
| 649 | 3300005842 | Ga0068858_100021713 | Ga0068858_1000217137 | 228 |
| 650 | 3300005843 | Ga0068860_100116460 | Ga0068860_1001164603 | 228 |
| 651 | 3300005843 | Ga0068860_100225107 | Ga0068860_1002251072 | 228 |
| 652 | 3300005844 | Ga0068862_100002024 | Ga0068862_1000020243 | 228 |
| 653 | 3300005844 | Ga0068862_100232554 | Ga0068862_1002325542 | 228 |
| 654 | 3300006358 | Ga0068871_100144118 | Ga0068871_1001441182 | 228 |
| 655 | 3300006847 | Ga0075431_100062799 | Ga0075431_1000627992 | 228 |
| 656 | 3300006852 | Ga0075433_10009913 | Ga0075433_100099136 | 228 |
| 657 | 3300006871 | Ga0075434_100007557 | Ga0075434_1000075573 | 228 |
| 658 | 3300006880 | Ga0075429_100072025 | Ga0075429_1000720252 | 228 |
| 659 | 3300006931 | Ga0097620_100007844 | Ga0097620_1000078448 | 228 |
| 660 | 3300007076 | Ga0075435_100217397 | Ga0075435_1002173972 | 228 |
| 661 | 3300009094 | Ga0111539_10002317 | Ga0111539_1000231714 | 228 |
| 662 | 3300009094 | Ga0111539_10023771 | Ga0111539_100237716 | 228 |
| 663 | 3300009094 | Ga0111539_10443772 | Ga0111539_104437722 | 228 |
| 664 | 3300009553 | Ga0105249_10003004 | Ga0105249_100030046 | 228 |
| 665 | 3300011119 | Ga0105246_10061211 | Ga0105246_100612113 | 228 |
| 666 | 3300011119 | Ga0105246_10275146 | Ga0105246_102751462 | 228 |
| 667 | 3300013102 | Ga0157371_10515618 | Ga0157371_105156182 | 228 |
| 668 | 3300013306 | Ga0163162_10004052 | Ga0163162_100040527 | 228 |
| 669 | 3300013306 | Ga0163162_10697308 | Ga0163162_106973082 | 228 |
| 670 | 3300013308 | Ga0157375_10005816 | Ga0157375_100058166 | 228 |
| 671 | 3300013308 | Ga0157375_10018153 | Ga0157375_100181536 | 228 |
| 672 | 3300013308 | Ga0157375_10153586 | Ga0157375_101535863 | 228 |
| 673 | 3300014326 | Ga0157380_10023425 | Ga0157380_100234255 | 228 |
| 674 | 3300014326 | Ga0157380_10057833 | Ga0157380_100578333 | 228 |
| 675 | 3300014745 | Ga0157377_10009324 | Ga0157377_100093245 | 228 |
| 676 | 3300014745 | Ga0157377_10040283 | Ga0157377_100402832 | 228 |
| 677 | 3300014745 | Ga0157377_10073747 | Ga0157377_100737472 | 228 |
| 678 | 3300025315 | Ga0207697_10008066 | Ga0207697_100080662 | 228 |
| 679 | 3300025315 | Ga0207697_10008492 | Ga0207697_100084923 | 228 |
| 680 | 3300025893 | Ga0207682_10019563 | Ga0207682_100195634 | 228 |
| 681 | 3300025901 | Ga0207688_10017187 | Ga0207688_100171874 | 228 |
| 682 | 3300025901 | Ga0207688_10035547 | Ga0207688_100355472 | 228 |
| 683 | 3300025903 | Ga0207680_10005415 | Ga0207680_100054157 | 228 |
| 684 | 3300025903 | Ga0207680_10043210 | Ga0207680_100432102 | 228 |
| 685 | 3300025907 | Ga0207645_10010688 | Ga0207645_100106887 | 228 |
| 686 | 3300025908 | Ga0207643_10037381 | Ga0207643_100373812 | 228 |
| 687 | 3300025910 | Ga0207684_10299002 | Ga0207684_102990022 | 228 |
| 688 | 3300025918 | Ga0207662_10048458 | Ga0207662_100484584 | 228 |
| 689 | 3300025918 | Ga0207662_10179089 | Ga0207662_101790892 | 228 |
| 690 | 3300025919 | Ga0207657_10302770 | Ga0207657_103027702 | 228 |
| 691 | 3300025920 | Ga0207649_10114337 | Ga0207649_101143372 | 228 |
| 692 | 3300025923 | Ga0207681_10133032 | Ga0207681_101330322 | 228 |
| 693 | 3300025926 | Ga0207659_10000585 | Ga0207659_1000058515 | 228 |
| 694 | 3300025926 | Ga0207659_10003424 | Ga0207659_100034249 | 228 |
| 695 | 3300025926 | Ga0207659_10004901 | Ga0207659_100049016 | 228 |
| 696 | 3300025932 | Ga0207690_10116306 | Ga0207690_101163063 | 228 |
| 697 | 3300025933 | Ga0207706_10009814 | Ga0207706_100098144 | 228 |
| 698 | 3300025933 | Ga0207706_10010833 | Ga0207706_100108336 | 228 |
| 699 | 3300025933 | Ga0207706_10343687 | Ga0207706_103436873 | 228 |
| 700 | 3300025936 | Ga0207670_10004139 | Ga0207670_100041392 | 228 |
| 701 | 3300025936 | Ga0207670_10180598 | Ga0207670_101805982 | 228 |
| 702 | 3300025940 | Ga0207691_10000888 | Ga0207691_100008886 | 228 |
| 703 | 3300025940 | Ga0207691_10057461 | Ga0207691_100574613 | 228 |
| 704 | 3300025942 | Ga0207689_10002833 | Ga0207689_100028333 | 228 |
| 705 | 3300025945 | Ga0207679_10001069 | Ga0207679_1000106911 | 228 |
| 706 | 3300025945 | Ga0207679_10294193 | Ga0207679_102941931 | 228 |
| 707 | 3300025960 | Ga0207651_10001222 | Ga0207651_1000122210 | 228 |
| 708 | 3300025960 | Ga0207651_10229305 | Ga0207651_102293052 | 228 |
| 709 | 3300025961 | Ga0207712_10020570 | Ga0207712_100205701 | 228 |
| 710 | 3300025986 | Ga0207658_10035999 | Ga0207658_100359993 | 228 |
| 711 | 3300026035 | Ga0207703_10015655 | Ga0207703_100156552 | 228 |
| 712 | 3300026075 | Ga0207708_10080753 | Ga0207708_100807532 | 228 |
| 713 | 3300026088 | Ga0207641_10048370 | Ga0207641_100483702 | 228 |
| 714 | 3300026095 | Ga0207676_10188194 | Ga0207676_101881942 | 228 |
| 715 | 3300026118 | Ga0207675_100969071 | Ga0207675_1009690711 | 228 |
| 716 | 3300026121 | Ga0207683_10255606 | Ga0207683_102556062 | 228 |
| 717 | 3300027876 | Ga0209974_10031852 | Ga0209974_100318523 | 228 |
| 718 | 3300027907 | Ga0207428_10006724 | Ga0207428_100067247 | 228 |
| 719 | 3300027907 | Ga0207428_10117929 | Ga0207428_101179292 | 228 |
| 720 | 3300027907 | Ga0207428_10170016 | Ga0207428_101700162 | 228 |
| 721 | 3300028380 | Ga0268265_10008392 | Ga0268265_100083926 | 228 |
| 722 | 3300028380 | Ga0268265_10211904 | Ga0268265_102119043 | 228 |
| 723 | 3300028381 | Ga0268264_10147190 | Ga0268264_101471902 | 228 |
| 724 | 3300028381 | Ga0268264_10188758 | Ga0268264_101887582 | 228 |
| 725 | 3300035090 | Ga0373949_0009446 | Ga0373949_0009446_953_1651 | 228 |
| 726 | 3300042436 | Ga0439435_0013999 | Ga0439435_0013999_478_1176 | 228 |
| 727 | 3300045051 | Ga0451576_0015927 | Ga0451576_0015927_5743_6441 | 228 |
| 728 | 3300045051 | Ga0451576_0381213 | Ga0451576_0381213_14_712 | 228 |
| 729 | 3300046664 | Ga0495659_0084266 | Ga0495659_0084266_498_1187 | 228 |
| 730 | 3300048912 | Ga0496109_0172228 | Ga0496109_0172228_1188_1886 | 228 |
| 731 | 3300049588 | Ga0501072_0311615 | Ga0501072_0311615_14_709 | 228 |
| 732 | 3300049591 | Ga0501075_0567548 | Ga0501075_0567548_90_785 | 228 |
| 733 | 3300049688 | Ga0501259_012414 | Ga0501259_012414_326_1024 | 228 |
| 734 | 3300049706 | Ga0501229_015824 | Ga0501229_015824_104_802 | 228 |
| 735 | 3300049743 | Ga0501081_0284202 | Ga0501081_0284202_251_949 | 228 |
| 736 | 3300050508 | nmdc:mga09592_102390_c1 | nmdc:mga09592_102390_c1_1324_2022 | 228 |
| 737 | 3300050510 | nmdc:mga06r32_117341_c1 | nmdc:mga06r32_117341_c1_175_873 | 228 |
| 738 | 3300050511 | nmdc:mga08y16_294613_c1 | nmdc:mga08y16_294613_c1_912_1610 | 228 |
| 739 | 3300050511 | nmdc:mga08y16_3811_c1 | nmdc:mga08y16_3811_c1_13822_14517 | 228 |
| 740 | 3300050512 | nmdc:mga0n895_47058_c1 | nmdc:mga0n895_47058_c1_1491_2189 | 228 |
| 741 | 3300050513 | nmdc:mga0rr50_267349_c1 | nmdc:mga0rr50_267349_c1_362_1060 | 228 |
| 742 | 3300050515 | nmdc:mga0a205_1555_c1 | nmdc:mga0a205_1555_c1_684_1382 | 228 |
| 743 | 3300050515 | nmdc:mga0a205_42186_c1 | nmdc:mga0a205_42186_c1_1815_2525 | 228 |
| 744 | 2162886007 | SwRhRL2b_contig_122425 | SwRhRL2b_0676.00003140 | 229 |
| 745 | 3300005289 | Ga0065704_10076056 | Ga0065704_100760562 | 229 |
| 746 | 3300005295 | Ga0065707_10099283 | Ga0065707_100992831 | 229 |
| 747 | 3300005345 | Ga0070692_10201882 | Ga0070692_102018822 | 229 |
| 748 | 3300005364 | Ga0070673_100202599 | Ga0070673_1002025993 | 229 |
| 749 | 3300005366 | Ga0070659_100233369 | Ga0070659_1002333693 | 229 |
| 750 | 3300005440 | Ga0070705_100038972 | Ga0070705_1000389724 | 229 |
| 751 | 3300005468 | Ga0070707_100178936 | Ga0070707_1001789362 | 229 |
| 752 | 3300005471 | Ga0070698_100063792 | Ga0070698_1000637923 | 229 |
| 753 | 3300005536 | Ga0070697_100111953 | Ga0070697_1001119532 | 229 |
| 754 | 3300005536 | Ga0070697_100401816 | Ga0070697_1004018162 | 229 |
| 755 | 3300005549 | Ga0070704_100260858 | Ga0070704_1002608582 | 229 |
| 756 | 3300005617 | Ga0068859_100015089 | Ga0068859_1000150894 | 229 |
| 757 | 3300006237 | Ga0097621_100065937 | Ga0097621_1000659372 | 229 |
| 758 | 3300006852 | Ga0075433_10323417 | Ga0075433_103234171 | 229 |
| 759 | 3300006871 | Ga0075434_100086968 | Ga0075434_1000869682 | 229 |
| 760 | 3300006871 | Ga0075434_100837596 | Ga0075434_1008375962 | 229 |
| 761 | 3300006931 | Ga0097620_100015088 | Ga0097620_1000150885 | 229 |
| 762 | 3300007076 | Ga0075435_100048142 | Ga0075435_1000481422 | 229 |
| 763 | 3300009147 | Ga0114129_11920224 | Ga0114129_119202241 | 229 |
| 764 | 3300013296 | Ga0157374_10279585 | Ga0157374_102795852 | 229 |
| 765 | 3300014325 | Ga0163163_10308778 | Ga0163163_103087782 | 229 |
| 766 | 3300014745 | Ga0157377_10312198 | Ga0157377_103121981 | 229 |
| 767 | 3300025918 | Ga0207662_10237987 | Ga0207662_102379872 | 229 |
| 768 | 3300025926 | Ga0207659_10012610 | Ga0207659_100126103 | 229 |
| 769 | 3300025932 | Ga0207690_10224889 | Ga0207690_102248892 | 229 |
| 770 | 3300025942 | Ga0207689_10143814 | Ga0207689_101438144 | 229 |
| 771 | 3300025960 | Ga0207651_10205324 | Ga0207651_102053243 | 229 |
| 772 | 3300026095 | Ga0207676_10184794 | Ga0207676_101847942 | 229 |
| 773 | 3300026142 | Ga0207698_10206406 | Ga0207698_102064062 | 229 |
| 774 | 3300028381 | Ga0268264_10009058 | Ga0268264_100090585 | 229 |
| 775 | 3300045051 | Ga0451576_0360104 | Ga0451576_0360104_35_727 | 229 |
| 776 | 3300046455 | Ga0495603_0007369 | Ga0495603_0007369_3297_3995 | 229 |
| 777 | 3300046491 | Ga0495584_0006176 | Ga0495584_0006176_1627_2319 | 229 |
| 778 | 3300046499 | Ga0495594_0067571 | Ga0495594_0067571_442_1140 | 229 |
| 779 | 3300046528 | Ga0495642_0010266 | Ga0495642_0010266_2835_3527 | 229 |
| 780 | 3300046538 | Ga0495609_0044028 | Ga0495609_0044028_167_859 | 229 |
| 781 | 3300046539 | Ga0495621_0006040 | Ga0495621_0006040_626_1318 | 229 |
| 782 | 3300046539 | Ga0495621_0066946 | Ga0495621_0066946_124_816 | 229 |
| 783 | 3300046664 | Ga0495659_0080928 | Ga0495659_0080928_195_887 | 229 |
| 784 | 3300047318 | Ga0495636_0024829 | Ga0495636_0024829_320_1012 | 229 |
| 785 | 3300050512 | nmdc:mga0n895_163473_c1 | nmdc:mga0n895_163473_c1_58_750 | 229 |
| 786 | 3300050512 | nmdc:mga0n895_45375_c1 | nmdc:mga0n895_45375_c1_305_997 | 229 |
| 787 | 3300050513 | nmdc:mga0rr50_192620_c1 | nmdc:mga0rr50_192620_c1_699_1391 | 229 |
| 788 | 3300050513 | nmdc:mga0rr50_5018_c1 | nmdc:mga0rr50_5018_c1_4421_5113 | 229 |
| 789 | 3300050515 | nmdc:mga0a205_7840_c2 | nmdc:mga0a205_7840_c2_1205_1897 | 229 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7rh5-assembly1.cif.gz_S | mycobacterial ciii2civ2 supercomplex, inhibitor free | 0.9091 | 35 | 222 |
| 7e1v-assembly1.cif.gz_G | cryo-em structure of apo hybrid respiratory supercomplex consisting of mycobacterium tuberculosis complexiii and mycobacterium smegmatis complexiv | 0.9016 | 35 | 222 |
| 7cub-assembly1.cif.gz_C | 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane | 0.894 | 30 | 223 |
| 2yev-assembly2.cif.gz_A | structure of caa3-type cytochrome oxidase | 0.8889 | 36 | 220 |
| 7qhm-assembly1.cif.gz_S | cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) | 0.8877 | 33 | 222 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZK1_13_198_1.20.120.80 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.8947 | 29 | 224 | 1.20.120.80 |
| af_Q2FZK1_13_198_1.20.120.80 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.881 | 29 | 224 | 1.20.120.80 |
| 2yevD03 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.8795 | 35 | 220 | 1.20.120.80 |
| af_P9WP67_20_203_1.20.120.80 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.8701 | 35 | 222 | 1.20.120.80 |
| af_P14575_77_269_1.20.120.80 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.8532 | 25 | 221 | 1.20.120.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C2R622-F1-model_v4 | Cytochrome c oxidase subunit 3 family protein | 0.994 | 38 | 224 |
GO:0004129
GO:0005886 GO:0019646 |
| AF-A0A2V7VQZ1-F1-model_v4 | Cytochrome oxidase subunit III | 0.9842 | 38 | 226 |
GO:0004129
GO:0005886 GO:0019646 |
| AF-A0A561HI98-F1-model_v4 | deleted | 0.9817 | 23 | 224 |
|
| AF-A0A359CB41-F1-model_v4 | Cytochrome C oxidase subunit III | 0.9812 | 25 | 222 |
GO:0004129
GO:0005886 GO:0019646 |
| AF-A0A7C1X987-F1-model_v4 | Cytochrome c oxidase subunit 3 family protein | 0.9783 | 35 | 222 |
GO:0004129
GO:0005886 GO:0019646 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar