F480960

General Info

Members Datasets Scaffolds Average Seq Length
790 408 1580 193

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0109887|Ga0495672_0109887_439_1122
Length 227
Sequence MLTMNATQIRFVKTSFTSAWKWCGTQQEKSNMSAPSSSTTNLSDLIRDIETSAGADRDLAARALGIVRDGVITGEGPTTEGRVHFSRAIDVVDVAWCMRILNAMAVADLPISRAEAETLFEINEAASDRNDDGRFDDLFAKAIVHHAASASGLPVPPRSVALSPETAIESWAPTQAIGVNIEVLEWIAAQMRGKRRSNRKLMALVATLIGAATLPLIALPNVFDLGM

Samples

Sample ID Description Type Environment
1 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
148 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
149 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
150 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
151 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
152 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
156 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
164 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
165 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
168 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
171 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
172 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
188 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
204 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
205 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
208 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
213 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
214 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
215 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
218 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
219 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
220 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
221 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
232 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
235 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
238 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
239 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
243 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
244 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
245 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
246 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
247 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
265 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
266 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
267 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
268 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
269 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
270 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
271 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
272 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
273 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
276 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
291 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
292 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
293 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
294 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
295 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
296 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
297 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
298 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
299 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
300 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
301 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
302 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
305 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
306 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
307 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
308 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
309 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
310 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
311 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
312 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
313 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
314 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
315 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
316 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
317 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
318 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
319 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
320 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
321 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
322 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
323 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
324 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
325 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
326 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
327 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
328 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
329 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
330 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
331 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
332 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
333 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
334 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
335 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
336 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
337 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
338 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
339 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
340 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
341 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
342 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
343 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
344 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
345 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
346 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
347 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
348 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
349 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
350 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
351 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
352 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
353 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
354 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
355 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
356 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
357 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
358 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
359 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
360 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
361 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
362 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
363 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
364 2643221651 Afipia sp. Root123D2 Isolate Unclassified
365 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
366 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
367 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
368 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
369 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
370 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
371 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
372 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
373 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
374 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
375 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
376 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
377 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
378 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
379 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
380 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
381 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
382 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
383 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
384 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
385 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
386 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
387 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
388 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
389 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
390 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
391 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
392 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
393 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
394 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
395 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
396 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
397 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
398 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
399 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
400 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
401 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
402 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
403 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
404 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
405 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
406 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
407 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
408 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.8
Metatranscriptomes 0.13
Isolates 6.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.65
Nodule 4.94
Rhizoplane 6.2
Rhizosphere 69.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495672_0109887 3300047320 Bacteria 1481
2 JGI24739J22299_10036348 3300001989 Bacteria 1664
3 JGI25406J46586_10000026 3300003203 Bacteria 70727
4 Ga0055526_1019466 3300003771 Bacteria 2472
5 Ga0070658_10118578 3300005327 Bacteria 2197
6 Ga0070658_10166257 3300005327 Bacteria 1852
7 Ga0070683_100045939 3300005329 Bacteria 4032
8 Ga0070670_100294362 3300005331 Bacteria 1419
9 Ga0068869_100312161 3300005334 Bacteria 1273
10 Ga0070680_100073397 3300005336 Bacteria 2814
11 Ga0070680_100101229 3300005336 Bacteria 2392
12 Ga0070680_100262730 3300005336 Bacteria 1460
13 Ga0070682_100607605 3300005337 Bacteria 864
14 Ga0070660_100002660 3300005339 Bacteria 12271
15 Ga0070660_100051412 3300005339 Bacteria 3174
16 Ga0070661_100259700 3300005344 Bacteria 1343
17 Ga0070661_100701276 3300005344 Bacteria 825
18 Ga0070668_100071970 3300005347 Bacteria 2693
19 Ga0070668_100318970 3300005347 Bacteria 1308
20 Ga0070671_100528120 3300005355 Bacteria 1016
21 Ga0070674_100140046 3300005356 Bacteria 1815
22 Ga0070674_100242806 3300005356 Bacteria 1411
23 Ga0070688_100615208 3300005365 Bacteria 833
24 Ga0070659_100155825 3300005366 Bacteria 1865
25 Ga0070659_100183135 3300005366 Bacteria 1719
26 Ga0070659_100548395 3300005366 Bacteria 989
27 Ga0070659_100929921 3300005366 Bacteria 761
28 Ga0070667_100026062 3300005367 Bacteria 4862
29 Ga0070667_100694192 3300005367 Bacteria 941
30 Ga0070709_10529164 3300005434 Bacteria 899
31 Ga0070709_10551853 3300005434 Bacteria 882
32 Ga0070714_100230058 3300005435 Bacteria 1707
33 Ga0070713_100049276 3300005436 Bacteria 3474
34 Ga0070713_100100772 3300005436 Bacteria 2501
35 Ga0070713_100171727 3300005436 Bacteria 1943
36 Ga0070710_10045473 3300005437 Bacteria 2441
37 Ga0070711_100034860 3300005439 Bacteria 3360
38 Ga0070711_100056887 3300005439 Bacteria 2706
39 Ga0070711_100169802 3300005439 Bacteria 1661
40 Ga0070663_100024598 3300005455 Bacteria 4056
41 Ga0070663_100355027 3300005455 Bacteria 1188
42 Ga0070678_100175253 3300005456 Bacteria 1750
43 Ga0070678_100562876 3300005456 Bacteria 1013
44 Ga0070678_100732279 3300005456 Bacteria 893
45 Ga0070681_10067318 3300005458 Bacteria 3550
46 Ga0070681_10140481 3300005458 Bacteria 2345
47 Ga0070681_10895345 3300005458 Bacteria 806
48 Ga0070681_11084600 3300005458 Bacteria 721
49 Ga0068867_100162898 3300005459 Bacteria 1760
50 Ga0068867_100232517 3300005459 Bacteria 1491
51 Ga0070698_100853116 3300005471 Bacteria 856
52 Ga0070679_100111961 3300005530 Bacteria 2715
53 Ga0070679_100131554 3300005530 Bacteria 2483
54 Ga0070679_100253970 3300005530 Bacteria 1714
55 Ga0070684_100153890 3300005535 Bacteria 2084
56 Ga0070697_100120213 3300005536 Bacteria 2197
57 Ga0068853_100023154 3300005539 Bacteria 5197
58 Ga0068853_100063322 3300005539 Bacteria 3203
59 Ga0068853_100123108 3300005539 Bacteria 2315
60 Ga0068853_100272630 3300005539 Bacteria 1558
61 Ga0068853_100451109 3300005539 Bacteria 1210
62 Ga0070672_100344729 3300005543 Bacteria 1269
63 Ga0070672_100465792 3300005543 Bacteria 1090
64 Ga0070665_100591559 3300005548 Bacteria 1122
65 Ga0068855_100135334 3300005563 Bacteria 2812
66 Ga0068855_100155099 3300005563 Bacteria 2602
67 Ga0068855_100272066 3300005563 Bacteria 1883
68 Ga0068855_100614685 3300005563 Bacteria 1171
69 Ga0068855_100676037 3300005563 Bacteria 1107
70 Ga0070664_100456864 3300005564 Bacteria 1173
71 Ga0070664_100636716 3300005564 Bacteria 990
72 Ga0068857_100081508 3300005577 Bacteria 2889
73 Ga0068857_100528458 3300005577 Bacteria 1109
74 Ga0068854_100002399 3300005578 Bacteria 11565
75 Ga0068856_100032368 3300005614 Bacteria 5119
76 Ga0068856_100084302 3300005614 Bacteria 3157
77 Ga0068856_100132771 3300005614 Bacteria 2495
78 Ga0068856_100204667 3300005614 Bacteria 1988
79 Ga0070702_100142173 3300005615 Bacteria 1530
80 Ga0068852_100032186 3300005616 Bacteria 4339
81 Ga0068852_100155019 3300005616 Bacteria 2133
82 Ga0068859_100273395 3300005617 Bacteria 1782
83 Ga0068859_100675135 3300005617 Bacteria 1124
84 Ga0068864_100263030 3300005618 Bacteria 1605
85 Ga0068866_10266112 3300005718 Bacteria 1056
86 Ga0068861_100636371 3300005719 Bacteria 983
87 Ga0068851_10003285 3300005834 Bacteria 7177
88 Ga0068863_100445325 3300005841 Bacteria 1271
89 Ga0068863_100554693 3300005841 Bacteria 1135
90 Ga0068858_100585512 3300005842 Bacteria 1082
91 Ga0068858_100677819 3300005842 Bacteria 1002
92 Ga0081539_10000140 3300005985 Bacteria 166746
93 Ga0070717_10196146 3300006028 Bacteria 1766
94 Ga0075365_10057876 3300006038 Bacteria 2579
95 Ga0075368_10018117 3300006042 Bacteria 2643
96 Ga0075363_100007216 3300006048 Bacteria 5095
97 Ga0075363_100296365 3300006048 Bacteria 938
98 Ga0070716_100023710 3300006173 Bacteria 3257
99 Ga0070712_100076838 3300006175 Bacteria 2405
100 Ga0070712_100230676 3300006175 Bacteria 1470
101 Ga0070712_100423341 3300006175 Bacteria 1104
102 Ga0075367_10264593 3300006178 Bacteria 1080
103 Ga0075369_10006130 3300006186 Bacteria 4535
104 Ga0075369_10012128 3300006186 Bacteria 3401
105 Ga0075369_10256569 3300006186 Bacteria 812
106 Ga0097621_100115822 3300006237 Bacteria 2269
107 Ga0097621_101083762 3300006237 Bacteria 752
108 Ga0097620_100273392 3300006931 Bacteria 1782
109 Ga0097620_100675148 3300006931 Bacteria 1124
110 Ga0099794_10030760 3300007265 Bacteria 2509
111 Ga0099794_10100578 3300007265 Bacteria 1443
112 Ga0099794_10153022 3300007265 Bacteria 1171
113 Ga0099795_10001655 3300007788 Bacteria 4935
114 Ga0099795_10024616 3300007788 Bacteria 2010
115 Ga0105240_10009181 3300009093 Bacteria 14025
116 Ga0105240_10057007 3300009093 Bacteria 4885
117 Ga0105240_10073472 3300009093 Bacteria 4222
118 Ga0105245_10581494 3300009098 Bacteria 1144
119 Ga0105245_10664700 3300009098 Bacteria 1073
120 Ga0105245_10751942 3300009098 Bacteria 1011
121 Ga0105247_10239109 3300009101 Bacteria 1237
122 Ga0105247_10250180 3300009101 Bacteria 1211
123 Ga0105243_10095901 3300009148 Bacteria 2452
124 Ga0105243_10356137 3300009148 Bacteria 1345
125 Ga0105243_10902484 3300009148 Bacteria 879
126 Ga0105243_11440501 3300009148 Bacteria 711
127 Ga0105241_10000959 3300009174 Bacteria 21816
128 Ga0105241_10207269 3300009174 Bacteria 1641
129 Ga0105241_10697731 3300009174 Bacteria 926
130 Ga0105242_10515908 3300009176 Bacteria 1139
131 Ga0105248_10539325 3300009177 Bacteria 1316
132 Ga0105248_10723099 3300009177 Bacteria 1123
133 Ga0105237_10017220 3300009545 Bacteria 7496
134 Ga0105237_10023237 3300009545 Bacteria 6354
135 Ga0105237_10082872 3300009545 Bacteria 3198
136 Ga0105237_10327889 3300009545 Bacteria 1535
137 Ga0105237_10350865 3300009545 Bacteria 1480
138 Ga0105237_10654327 3300009545 Bacteria 1057
139 Ga0105237_10833650 3300009545 Bacteria 929
140 Ga0105238_10006415 3300009551 Bacteria 11705
141 Ga0105238_10012964 3300009551 Bacteria 8414
142 Ga0105238_10040259 3300009551 Bacteria 4736
143 Ga0105238_10969805 3300009551 Bacteria 870
144 Ga0105249_10102029 3300009553 Bacteria 2699
145 Ga0099796_10022056 3300010159 Bacteria 1971
146 Ga0099796_10027282 3300010159 Bacteria 1822
147 Ga0105239_10012362 3300010375 Bacteria 9507
148 Ga0105239_10033023 3300010375 Bacteria 5684
149 Ga0105239_10126696 3300010375 Bacteria 2838
150 Ga0105239_10232996 3300010375 Bacteria 2066
151 Ga0105239_10625231 3300010375 Bacteria 1229
152 Ga0105246_10120330 3300011119 Bacteria 1944
153 Ga0105246_10620246 3300011119 Bacteria 937
154 Ga0105246_10966464 3300011119 Bacteria 769
155 Ga0157373_10031903 3300013100 Bacteria 3794
156 Ga0157370_10114738 3300013104 Bacteria 2516
157 Ga0157370_10242807 3300013104 Bacteria 1666
158 Ga0157369_10008434 3300013105 Bacteria 11819
159 Ga0157369_10192607 3300013105 Bacteria 2142
160 Ga0157369_10196290 3300013105 Bacteria 2119
161 Ga0157378_10227304 3300013297 Bacteria 1776
162 Ga0157378_10322121 3300013297 Bacteria 1502
163 Ga0163162_10186479 3300013306 Bacteria 2201
164 Ga0163162_10332057 3300013306 Bacteria 1653
165 Ga0157375_10692247 3300013308 Bacteria 1173
166 Ga0157375_11670572 3300013308 Bacteria 754
167 Ga0163163_10003210 3300014325 Bacteria 13850
168 Ga0163163_10183129 3300014325 Bacteria 2142
169 Ga0163163_10270501 3300014325 Bacteria 1751
170 Ga0163163_10882518 3300014325 Bacteria 958
171 Ga0163163_11457481 3300014325 Bacteria 746
172 Ga0157379_10195820 3300014968 Bacteria 1826
173 Ga0157379_10321731 3300014968 Bacteria 1412
174 Ga0157376_10487600 3300014969 Bacteria 1209
175 Ga0163161_10451274 3300017792 Bacteria 1039
176 Ga0206354_10482704 3300020081 Bacteria 1245
177 Ga0213876_10010852 3300021384 Bacteria 4879
178 Ga0209563_103084 3300025230 Bacteria 3540
179 Ga0209677_102110 3300025253 Bacteria 7816
180 Ga0209233_1002206 3300025261 Bacteria 7307
181 Ga0209564_1001156 3300025295 Bacteria 30779
182 Ga0209564_1017381 3300025295 Bacteria 2806
183 Ga0209758_1013540 3300025297 Bacteria 4435
184 Ga0209758_1024692 3300025297 Bacteria 2669
185 Ga0209256_1020440 3300025299 Bacteria 2066
186 Ga0209257_1014115 3300025304 Bacteria 3467
187 Ga0207656_10045602 3300025321 Bacteria 1877
188 Ga0207656_10093135 3300025321 Bacteria 1370
189 Ga0207656_10239897 3300025321 Bacteria 885
190 Ga0207682_10402613 3300025893 Bacteria 647
191 Ga0207692_10395723 3300025898 Bacteria 860
192 Ga0207710_10103043 3300025900 Bacteria 1348
193 Ga0207710_10248261 3300025900 Bacteria 889
194 Ga0207688_10143224 3300025901 Bacteria 1408
195 Ga0207647_10009458 3300025904 Bacteria 6925
196 Ga0207645_10594927 3300025907 Bacteria 751
197 Ga0207705_10017885 3300025909 Bacteria 5070
198 Ga0207705_10041088 3300025909 Bacteria 3317
199 Ga0207705_10368122 3300025909 Bacteria 1109
200 Ga0207654_10001069 3300025911 Bacteria 14896
201 Ga0207654_10121581 3300025911 Bacteria 1640
202 Ga0207654_10284977 3300025911 Bacteria 1119
203 Ga0207707_10001819 3300025912 Bacteria 19559
204 Ga0207695_10002303 3300025913 Bacteria 28471
205 Ga0207695_10062858 3300025913 Bacteria 3830
206 Ga0207695_10749179 3300025913 Bacteria 857
207 Ga0207671_10020984 3300025914 Bacteria 4965
208 Ga0207671_10046036 3300025914 Bacteria 3227
209 Ga0207671_10079958 3300025914 Bacteria 2450
210 Ga0207671_10088969 3300025914 Bacteria 2324
211 Ga0207671_10309196 3300025914 Bacteria 1249
212 Ga0207693_10043440 3300025915 Bacteria 3536
213 Ga0207693_10603394 3300025915 Bacteria 854
214 Ga0207663_10054440 3300025916 Bacteria 2505
215 Ga0207660_10063326 3300025917 Bacteria 2666
216 Ga0207660_10109390 3300025917 Bacteria 2077
217 Ga0207660_10824091 3300025917 Bacteria 757
218 Ga0207657_10003059 3300025919 Bacteria 17896
219 Ga0207657_10128746 3300025919 Bacteria 2077
220 Ga0207652_10022569 3300025921 Bacteria 5207
221 Ga0207652_10088047 3300025921 Bacteria 2724
222 Ga0207652_10287304 3300025921 Bacteria 1484
223 Ga0207652_10440238 3300025921 Bacteria 1175
224 Ga0207694_10000640 3300025924 Bacteria 31572
225 Ga0207694_10078904 3300025924 Bacteria 2581
226 Ga0207650_10220622 3300025925 Bacteria 1526
227 Ga0207659_10308667 3300025926 Bacteria 1302
228 Ga0207700_10036760 3300025928 Bacteria 3540
229 Ga0207700_10321423 3300025928 Bacteria 1341
230 Ga0207644_10073366 3300025931 Bacteria 2509
231 Ga0207690_10123606 3300025932 Bacteria 1884
232 Ga0207686_10161944 3300025934 Bacteria 1569
233 Ga0207709_10124471 3300025935 Bacteria 1746
234 Ga0207709_10138772 3300025935 Bacteria 1668
235 Ga0207709_10421735 3300025935 Bacteria 1025
236 Ga0207669_10125399 3300025937 Bacteria 1753
237 Ga0207704_10243640 3300025938 Bacteria 1345
238 Ga0207665_10036733 3300025939 Bacteria 3259
239 Ga0207691_10440168 3300025940 Bacteria 1110
240 Ga0207691_10460983 3300025940 Bacteria 1081
241 Ga0207711_10361520 3300025941 Bacteria 1345
242 Ga0207661_10000232 3300025944 Bacteria 36587
243 Ga0207679_10311137 3300025945 Bacteria 1361
244 Ga0207667_10009250 3300025949 Bacteria 11634
245 Ga0207667_10009830 3300025949 Bacteria 11241
246 Ga0207667_10205348 3300025949 Bacteria 2020
247 Ga0207667_10286804 3300025949 Bacteria 1682
248 Ga0207667_10865091 3300025949 Bacteria 898
249 Ga0207668_10176376 3300025972 Bacteria 1681
250 Ga0207640_10147195 3300025981 Bacteria 1725
251 Ga0207658_10151503 3300025986 Bacteria 1890
252 Ga0207677_10187818 3300026023 Bacteria 1632
253 Ga0207703_10141486 3300026035 Bacteria 2088
254 Ga0207703_11253346 3300026035 Bacteria 713
255 Ga0207639_10016871 3300026041 Bacteria 5174
256 Ga0207639_10030751 3300026041 Bacteria 3940
257 Ga0207639_10350414 3300026041 Bacteria 1319
258 Ga0207639_11103227 3300026041 Bacteria 744
259 Ga0207678_10009055 3300026067 Bacteria 8766
260 Ga0207678_10110255 3300026067 Bacteria 2348
261 Ga0207678_10138504 3300026067 Bacteria 2077
262 Ga0207678_10163089 3300026067 Bacteria 1903
263 Ga0207678_10228689 3300026067 Bacteria 1592
264 Ga0207678_10627151 3300026067 Bacteria 943
265 Ga0207678_10924023 3300026067 Bacteria 772
266 Ga0207702_10000005 3300026078 Bacteria 420296
267 Ga0207702_10582346 3300026078 Bacteria 1097
268 Ga0207702_11301887 3300026078 Bacteria 721
269 Ga0207641_10212908 3300026088 Bacteria 1788
270 Ga0207648_10237459 3300026089 Bacteria 1622
271 Ga0207648_10347001 3300026089 Bacteria 1337
272 Ga0207676_10133729 3300026095 Bacteria 2113
273 Ga0207676_10959727 3300026095 Bacteria 841
274 Ga0207674_10007968 3300026116 Bacteria 12293
275 Ga0207674_10034337 3300026116 Bacteria 5304
276 Ga0207674_10169507 3300026116 Bacteria 2137
277 Ga0207675_100337818 3300026118 Bacteria 1474
278 Ga0207683_10220710 3300026121 Bacteria 1727
279 Ga0207683_10298793 3300026121 Bacteria 1473
280 Ga0207683_10305126 3300026121 Bacteria 1456
281 Ga0207683_10589508 3300026121 Bacteria 1028
282 Ga0207698_10032585 3300026142 Bacteria 3777
283 Ga0207698_10296647 3300026142 Bacteria 1503
284 Ga0207698_11249253 3300026142 Bacteria 757
285 Ga0209179_1003548 3300027512 Bacteria 2261
286 Ga0209179_1008802 3300027512 Bacteria 1712
287 Ga0209179_1017725 3300027512 Bacteria 1353
288 Ga0209179_1073517 3300027512 Bacteria 750
289 Ga0209588_1052730 3300027671 Bacteria 1316
290 Ga0268266_10072576 3300028379 Bacteria 2985
291 Ga0268265_10355647 3300028380 Bacteria 1339
292 Ga0268264_10798829 3300028381 Bacteria 942
293 Ga0265337_1009221 3300028556 Bacteria 3537
294 Ga0265326_10018617 3300028558 Bacteria 1999
295 Ga0265334_10009110 3300028573 Bacteria 4208
296 Ga0265318_10032293 3300028577 Bacteria 2026
297 Ga0265323_10023799 3300028653 Bacteria 2333
298 Ga0265336_10000322 3300028666 Bacteria 32476
299 Ga0307515_10167965 3300028794 Bacteria 2202
300 Ga0265338_10001338 3300028800 Bacteria 40180
301 Ga0265324_10015926 3300029957 Bacteria 2758
302 Ga0265330_10032386 3300031235 Bacteria 2342
303 Ga0265325_10390331 3300031241 Bacteria 611
304 Ga0265340_10002383 3300031247 Bacteria 10694
305 Ga0265316_10120155 3300031344 Bacteria 1985
306 Ga0307508_10167611 3300031616 Bacteria 1800
307 Ga0265314_10118340 3300031711 Bacteria 1672
308 Ga0265342_10019156 3300031712 Bacteria 4415
309 Ga0265342_10163976 3300031712 Bacteria 1227
310 Ga0373934_0002672 3300035086 Bacteria 6553
311 Ga0373934_0075156 3300035086 Bacteria 1354
312 Ga0373952_0076311 3300035092 Bacteria 847
313 Ga0373923_0000076 3300035111 Bacteria 16201
314 Ga0373936_0117259 3300035113 Bacteria 1134
315 Ga0373941_0099912 3300035115 Bacteria 1008
316 Ga0373953_0008940 3300035117 Bacteria 3422
317 Ga0373954_0008912 3300035118 Bacteria 4414
318 Ga0373954_0048567 3300035118 Bacteria 1988
319 Ga0373956_0001935 3300035119 Bacteria 8560
320 Ga0373957_0000856 3300035120 Bacteria 7964
321 Ga0373960_0053274 3300035121 Bacteria 1207
322 Ga0373955_0000624 3300035172 Bacteria 15179
323 Ga0373955_0007478 3300035172 Bacteria 5021
324 Ga0373924_0006603 3300035410 Bacteria 4160
325 Ga0373924_0143574 3300035410 Bacteria 1042
326 Ga0373931_0029564 3300035691 Bacteria 2814
327 Ga0373935_0271482 3300035692 Bacteria 1192
328 Ga0373927_0062000 3300035695 Bacteria 2418
329 Ga0373927_0266960 3300035695 Bacteria 1125
330 Ga0373933_0022629 3300035724 Bacteria 3581
331 Ga0373933_0034164 3300035724 Bacteria 2962
332 Ga0373933_0087173 3300035724 Bacteria 1922
333 Ga0373937_0069526 3300036401 Bacteria 3246
334 Ga0373937_0150921 3300036401 Bacteria 2176
335 Ga0373937_0921182 3300036401 Bacteria 823
336 Ga0373925_0025341 3300037068 Bacteria 4333
337 Ga0395899_0044542 3300037312 Bacteria 3306
338 Ga0395898_0163606 3300037466 Bacteria 2128
339 Ga0395898_0950459 3300037466 Bacteria 796
340 Ga0395901_1168518 3300038443 Bacteria 737
341 Ga0436365_0440186 3300039437 Bacteria 746
342 Ga0436365_1601192 3300039437 Bacteria 824
343 Ga0436360_1151463 3300039438 Bacteria 1082
344 Ga0436361_1171468 3300039447 Bacteria 817
345 Ga0436362_0074706 3300039453 Bacteria 2084
346 Ga0451853_2115815 3300041512 Bacteria 1167
347 Ga0466966_0031750 3300044684 Bacteria 3425
348 Ga0466966_0264062 3300044684 Bacteria 1036
349 Ga0466963_0258825 3300044694 Bacteria 1222
350 Ga0466957_0100327 3300044842 Bacteria 1824
351 Ga0466959_0017989 3300045049 Bacteria 5186
352 Ga0466959_0019376 3300045049 Bacteria 5004
353 Ga0466958_0071322 3300045836 Bacteria 2127
354 Ga0466967_0301305 3300045976 Bacteria 1542
355 Ga0466967_0680035 3300045976 Bacteria 1019
356 Ga0495592_0001191 3300046454 Bacteria 18057
357 Ga0495592_0011883 3300046454 Bacteria 6599
358 Ga0495629_0000450 3300046459 Bacteria 34200
359 Ga0495629_0279259 3300046459 Bacteria 1146
360 Ga0495638_0022108 3300046460 Bacteria 4177
361 Ga0495638_0079631 3300046460 Bacteria 1992
362 Ga0495651_0019753 3300046462 Bacteria 5223
363 Ga0495651_0105498 3300046462 Bacteria 2090
364 Ga0495651_0170416 3300046462 Bacteria 1551
365 Ga0495653_0001141 3300046463 Bacteria 20414
366 Ga0495653_0094070 3300046463 Bacteria 2184
367 Ga0495582_0211940 3300046473 Bacteria 1107
368 Ga0495639_0203801 3300046475 Bacteria 969
369 Ga0495662_0086888 3300046476 Bacteria 1523
370 Ga0495664_0119442 3300046477 Bacteria 1594
371 Ga0495583_0049631 3300046506 Bacteria 1921
372 Ga0495606_0003861 3300046507 Bacteria 15472
373 Ga0495606_0029376 3300046507 Bacteria 3861
374 Ga0495606_0376604 3300046507 Bacteria 746
375 Ga0495608_0000519 3300046511 Bacteria 26476
376 Ga0495608_0041504 3300046511 Bacteria 3078
377 Ga0495608_0266185 3300046511 Bacteria 1066
378 Ga0495610_0096333 3300046512 Bacteria 1332
379 Ga0495610_0209820 3300046512 Bacteria 792
380 Ga0495616_0054947 3300046513 Bacteria 1973
381 Ga0495616_0163355 3300046513 Bacteria 1000
382 Ga0495618_0079130 3300046514 Bacteria 2096
383 Ga0495618_0247054 3300046514 Bacteria 1120
384 Ga0495620_0040673 3300046515 Bacteria 2044
385 Ga0495628_0008002 3300046516 Bacteria 9110
386 Ga0495628_0094668 3300046516 Bacteria 2308
387 Ga0495631_0250762 3300046518 Bacteria 754
388 Ga0495632_0074265 3300046519 Bacteria 1629
389 Ga0495643_0021762 3300046522 Bacteria 3670
390 Ga0495648_0273187 3300046524 Bacteria 805
391 Ga0495652_0013345 3300046529 Bacteria 7393
392 Ga0495652_0327523 3300046529 Bacteria 1104
393 Ga0495652_0626862 3300046529 Bacteria 731
394 Ga0495652_0635547 3300046529 Bacteria 724
395 Ga0495654_0057259 3300046530 Bacteria 1883
396 Ga0495640_0009479 3300046533 Bacteria 7584
397 Ga0495640_0028307 3300046533 Bacteria 4036
398 Ga0495586_0052173 3300046535 Bacteria 2214
399 Ga0495587_0004141 3300046536 Bacteria 9593
400 Ga0495587_0022528 3300046536 Bacteria 3878
401 Ga0495597_0220731 3300046542 Bacteria 753
402 Ga0495645_0010029 3300046543 Bacteria 6634
403 Ga0495667_0000128 3300046559 Bacteria 54804
404 Ga0495667_0167279 3300046559 Bacteria 1413
405 Ga0495634_0027266 3300046642 Bacteria 3975
406 Ga0495634_0078381 3300046642 Bacteria 2165
407 Ga0495625_0381747 3300046660 Bacteria 884
408 Ga0495635_0000232 3300046663 Bacteria 35357
409 Ga0495635_0072032 3300046663 Bacteria 2368
410 Ga0495635_0289328 3300046663 Bacteria 1100
411 Ga0495661_0109086 3300046665 Bacteria 1545
412 Ga0495588_0055117 3300046674 Bacteria 2052
413 Ga0495657_0005432 3300046675 Bacteria 10090
414 Ga0495657_0230900 3300046675 Bacteria 1119
415 Ga0495599_0006443 3300046678 Bacteria 7080
416 Ga0495599_0038668 3300046678 Bacteria 2998
417 Ga0495623_0043851 3300046679 Bacteria 2844
418 Ga0495623_0048122 3300046679 Bacteria 2705
419 Ga0495623_0358808 3300046679 Bacteria 792
420 Ga0495623_0369775 3300046679 Bacteria 777
421 Ga0495646_0001526 3300046680 Bacteria 13800
422 Ga0495646_0024282 3300046680 Bacteria 3818
423 Ga0495613_0086839 3300046689 Bacteria 2268
424 Ga0495613_0143636 3300046689 Bacteria 1704
425 Ga0495613_0423573 3300046689 Bacteria 905
426 Ga0495670_0015024 3300046691 Bacteria 3809
427 Ga0495649_0155693 3300046694 Bacteria 1199
428 Ga0495600_0002638 3300046809 Bacteria 10351
429 Ga0495660_0127340 3300046810 Bacteria 1281
430 Ga0495604_0006026 3300047317 Bacteria 9620
431 Ga0495674_0008861 3300047319 Bacteria 9572
432 Ga0495674_0179855 3300047319 Bacteria 1761
433 Ga0495674_0253803 3300047319 Bacteria 1447
434 Ga0495672_0010039 3300047320 Bacteria 6784
435 Ga0495680_0000314 3300047322 Bacteria 54452
436 Ga0495675_0003282 3300047444 Bacteria 9723
437 Ga0495675_0030419 3300047444 Bacteria 3445
438 Ga0495681_0106604 3300047470 Bacteria 1218
439 Ga0495684_0001551 3300047471 Bacteria 18398
440 Ga0495684_0021762 3300047471 Bacteria 4936
441 Ga0495686_0083998 3300047472 Bacteria 1941
442 Ga0495686_0247619 3300047472 Bacteria 1002
443 Ga0495593_0001148 3300047673 Bacteria 15449
444 Ga0495593_0076075 3300047673 Bacteria 1740
445 Ga0495602_0053304 3300048088 Bacteria 3583
446 Ga0495602_0086183 3300048088 Bacteria 2622
447 Ga0495626_0117556 3300048091 Bacteria 1146
448 Ga0496100_0071739 3300048903 Bacteria 2313
449 Ga0496100_0346914 3300048903 Bacteria 1120
450 Ga0496101_0031209 3300048904 Bacteria 3744
451 Ga0496101_0124207 3300048904 Bacteria 1954
452 Ga0496101_0234582 3300048904 Bacteria 1427
453 Ga0496102_0044377 3300048905 Bacteria 4034
454 Ga0496102_0140983 3300048905 Bacteria 2260
455 Ga0496102_0414274 3300048905 Bacteria 1266
456 Ga0496103_0107564 3300048906 Bacteria 1769
457 Ga0496103_0538501 3300048906 Bacteria 746
458 Ga0496104_0036376 3300048907 Bacteria 4602
459 Ga0496104_0116553 3300048907 Bacteria 2563
460 Ga0496104_0272369 3300048907 Bacteria 1605
461 Ga0496105_0084888 3300048908 Bacteria 2616
462 Ga0496105_0135906 3300048908 Bacteria 2025
463 Ga0496105_0875321 3300048908 Bacteria 678
464 Ga0496106_0315901 3300048909 Bacteria 1254
465 Ga0496106_0326165 3300048909 Bacteria 1232
466 Ga0496106_0537512 3300048909 Bacteria 938
467 Ga0496107_0058622 3300048910 Bacteria 2784
468 Ga0496107_0216749 3300048910 Bacteria 1424
469 Ga0496108_0112873 3300048911 Bacteria 2325
470 Ga0496108_0226931 3300048911 Bacteria 1623
471 Ga0496108_0232400 3300048911 Bacteria 1603
472 Ga0496108_0694932 3300048911 Bacteria 882
473 Ga0496108_0949624 3300048911 Bacteria 736
474 Ga0496109_0114213 3300048912 Bacteria 2512
475 Ga0496109_0153790 3300048912 Bacteria 2154
476 Ga0496109_0454641 3300048912 Bacteria 1209
477 Ga0496109_0789872 3300048912 Bacteria 887
478 Ga0496110_0041078 3300048913 Bacteria 4034
479 Ga0496110_0087443 3300048913 Bacteria 2783
480 Ga0496110_0123160 3300048913 Bacteria 2338
481 Ga0496110_0695418 3300048913 Bacteria 918
482 Ga0496111_0102443 3300048914 Bacteria 2104
483 Ga0496112_0000004 3300048915 Bacteria 553294
484 Ga0496112_0022306 3300048915 Bacteria 6032
485 Ga0496112_0062122 3300048915 Bacteria 3684
486 Ga0496112_0085495 3300048915 Bacteria 3120
487 Ga0496112_0162578 3300048915 Bacteria 2199
488 Ga0496112_0175420 3300048915 Bacteria 2108
489 Ga0496113_0092186 3300048916 Bacteria 2336
490 Ga0496113_0108462 3300048916 Bacteria 2158
491 Ga0496113_0176882 3300048916 Bacteria 1691
492 Ga0496114_0217544 3300048917 Bacteria 1676
493 Ga0496114_0650136 3300048917 Bacteria 927
494 Ga0496115_0129517 3300048918 Bacteria 2079
495 Ga0496115_0493249 3300048918 Bacteria 985
496 Ga0496116_0003689 3300048919 Bacteria 14990
497 Ga0496116_0238303 3300048919 Bacteria 916
498 Ga0496116_0243610 3300048919 Bacteria 901
499 Ga0496117_0048041 3300048920 Bacteria 3053
500 Ga0496117_0080863 3300048920 Bacteria 2135
501 Ga0496117_0135606 3300048920 Bacteria 1483
502 Ga0496117_0185200 3300048920 Bacteria 1192
503 Ga0496118_0033077 3300048921 Bacteria 4250
504 Ga0496118_0041550 3300048921 Bacteria 3639
505 Ga0496118_0102382 3300048921 Bacteria 1930
506 Ga0496118_0382035 3300048921 Bacteria 738
507 Ga0496119_0108848 3300048922 Bacteria 1542
508 Ga0496119_0139118 3300048922 Bacteria 1313
509 Ga0496119_0202497 3300048922 Bacteria 1026
510 Ga0496119_0307083 3300048922 Bacteria 780
511 Ga0496120_0019074 3300048923 Bacteria 4399
512 Ga0496120_0080056 3300048923 Bacteria 1772
513 Ga0496121_0000902 3300048924 Bacteria 53572
514 Ga0496121_0021472 3300048924 Bacteria 6320
515 Ga0496121_0025337 3300048924 Bacteria 5633
516 Ga0496121_0039817 3300048924 Bacteria 4133
517 Ga0496121_0338335 3300048924 Bacteria 1007
518 Ga0496122_0020324 3300048925 Bacteria 6006
519 Ga0496122_0055633 3300048925 Bacteria 2958
520 Ga0496122_0152213 3300048925 Bacteria 1426
521 Ga0496122_0220085 3300048925 Bacteria 1090
522 Ga0496123_0113121 3300048926 Bacteria 1546
523 Ga0496123_0125719 3300048926 Bacteria 1432
524 Ga0496123_0208355 3300048926 Bacteria 996
525 Ga0496124_0069442 3300048927 Bacteria 2925
526 Ga0496124_0143796 3300048927 Bacteria 1879
527 Ga0496125_0000125 3300048928 Bacteria 169979
528 Ga0496125_0000681 3300048928 Bacteria 56691
529 Ga0496125_0032853 3300048928 Bacteria 4602
530 Ga0496125_0036097 3300048928 Bacteria 4322
531 Ga0496125_0169927 3300048928 Bacteria 1467
532 Ga0496125_0233932 3300048928 Bacteria 1172
533 Ga0496125_0393964 3300048928 Bacteria 812
534 Ga0496126_0006866 3300048929 Bacteria 12618
535 Ga0496126_0018674 3300048929 Bacteria 6862
536 Ga0496126_0020167 3300048929 Bacteria 6542
537 Ga0496126_0040409 3300048929 Bacteria 4324
538 Ga0496126_0081975 3300048929 Bacteria 2851
539 Ga0496126_0158425 3300048929 Bacteria 1936
540 Ga0496126_0307437 3300048929 Bacteria 1306
541 Ga0496126_0416341 3300048929 Bacteria 1087
542 Ga0495682_0083657 3300049460 Bacteria 1147
543 Ga0501031_0002681 3300049568 Bacteria 11330
544 Ga0501031_0021438 3300049568 Bacteria 4211
545 Ga0501031_0030096 3300049568 Bacteria 3540
546 Ga0501031_0244378 3300049568 Bacteria 1166
547 Ga0501032_0000188 3300049569 Bacteria 51273
548 Ga0501032_0041760 3300049569 Bacteria 3113
549 Ga0501032_0146271 3300049569 Bacteria 1555
550 Ga0501032_0200750 3300049569 Bacteria 1301
551 Ga0501032_0379188 3300049569 Bacteria 909
552 Ga0501033_0000094 3300049570 Bacteria 84669
553 Ga0501033_0005103 3300049570 Bacteria 10448
554 Ga0501033_0062192 3300049570 Bacteria 2749
555 Ga0501033_0069175 3300049570 Bacteria 2595
556 Ga0501033_0078162 3300049570 Bacteria 2428
557 Ga0501033_0078278 3300049570 Bacteria 2426
558 Ga0501034_0000021 3300049571 Bacteria 266023
559 Ga0501034_0063922 3300049571 Bacteria 3694
560 Ga0501034_0201245 3300049571 Bacteria 1949
561 Ga0501034_0387715 3300049571 Bacteria 1321
562 Ga0501034_0471823 3300049571 Bacteria 1171
563 Ga0501034_0618214 3300049571 Bacteria 987
564 Ga0501036_0000115 3300049572 Bacteria 49866
565 Ga0501036_0094605 3300049572 Bacteria 2525
566 Ga0501036_0884628 3300049572 Bacteria 733
567 Ga0501037_0000174 3300049573 Bacteria 60960
568 Ga0501037_0004737 3300049573 Bacteria 9887
569 Ga0501037_0247701 3300049573 Bacteria 1247
570 Ga0501037_0621169 3300049573 Bacteria 724
571 Ga0501038_0000052 3300049574 Bacteria 94841
572 Ga0501038_0002268 3300049574 Bacteria 17879
573 Ga0501038_0014273 3300049574 Bacteria 7237
574 Ga0501038_0208778 3300049574 Bacteria 1563
575 Ga0501039_0000156 3300049575 Bacteria 47049
576 Ga0501039_0146047 3300049575 Bacteria 1858
577 Ga0501039_0164884 3300049575 Bacteria 1742
578 Ga0501039_0205719 3300049575 Bacteria 1547
579 Ga0501039_0291211 3300049575 Bacteria 1283
580 Ga0501039_0765876 3300049575 Bacteria 753
581 Ga0501040_0094664 3300049576 Bacteria 2078
582 Ga0501040_0250786 3300049576 Bacteria 1262
583 Ga0501042_0023389 3300049578 Bacteria 4324
584 Ga0501042_0030155 3300049578 Bacteria 3829
585 Ga0501043_0002971 3300049579 Bacteria 14129
586 Ga0501043_0004414 3300049579 Bacteria 11423
587 Ga0501043_0010117 3300049579 Bacteria 7394
588 Ga0501043_0023674 3300049579 Bacteria 4816
589 Ga0501043_0093594 3300049579 Bacteria 2362
590 Ga0501043_0129254 3300049579 Bacteria 1980
591 Ga0501043_0152006 3300049579 Bacteria 1811
592 Ga0501043_0153524 3300049579 Bacteria 1801
593 Ga0501043_0697903 3300049579 Bacteria 741
594 Ga0501046_0000133 3300049580 Bacteria 79467
595 Ga0501046_0012576 3300049580 Bacteria 7197
596 Ga0501046_0045072 3300049580 Bacteria 3505
597 Ga0501046_0070224 3300049580 Bacteria 2724
598 Ga0501046_0076237 3300049580 Bacteria 2598
599 Ga0501047_0000511 3300049581 Bacteria 41841
600 Ga0501047_0033517 3300049581 Bacteria 4957
601 Ga0501047_0041283 3300049581 Bacteria 4458
602 Ga0501047_0058669 3300049581 Bacteria 3717
603 Ga0501047_0131383 3300049581 Bacteria 2384
604 Ga0501047_0554525 3300049581 Bacteria 973
605 Ga0501048_0000072 3300049582 Bacteria 51953
606 Ga0501067_0000045 3300049583 Bacteria 73394
607 Ga0501067_0025701 3300049583 Bacteria 3263
608 Ga0501068_0011425 3300049584 Bacteria 5015
609 Ga0501068_0088801 3300049584 Bacteria 1904
610 Ga0501069_0003290 3300049585 Bacteria 8295
611 Ga0501070_0020238 3300049586 Bacteria 5580
612 Ga0501070_0086990 3300049586 Bacteria 2587
613 Ga0501070_0133883 3300049586 Bacteria 2046
614 Ga0501070_0519537 3300049586 Bacteria 955
615 Ga0501072_0008854 3300049588 Bacteria 7645
616 Ga0501072_0099026 3300049588 Bacteria 2317
617 Ga0501073_0000099 3300049589 Bacteria 55207
618 Ga0501073_0118264 3300049589 Bacteria 1837
619 Ga0501073_0119826 3300049589 Bacteria 1824
620 Ga0501073_0127943 3300049589 Bacteria 1760
621 Ga0501073_0238825 3300049589 Bacteria 1255
622 Ga0501074_0001112 3300049590 Bacteria 17543
623 Ga0501074_0023594 3300049590 Bacteria 4471
624 Ga0501074_0107271 3300049590 Bacteria 1999
625 Ga0501074_0607897 3300049590 Bacteria 773
626 Ga0501076_0107774 3300049592 Bacteria 2250
627 Ga0501077_0207883 3300049593 Bacteria 1244
628 Ga0501077_0457661 3300049593 Bacteria 817
629 Ga0501079_0003234 3300049741 Bacteria 11930
630 Ga0501079_0195375 3300049741 Bacteria 1579
631 Ga0501079_0205298 3300049741 Bacteria 1539
632 Ga0501080_0003659 3300049742 Bacteria 13567
633 Ga0501080_0082855 3300049742 Bacteria 2979
634 Ga0501080_0145209 3300049742 Bacteria 2193
635 Ga0501080_0255559 3300049742 Bacteria 1597
636 Ga0501083_0001322 3300049744 Bacteria 16804
637 Ga0501083_0059244 3300049744 Bacteria 2561
638 Ga0501083_0524688 3300049744 Bacteria 771
639 Ga0501035_0000726 3300049822 Bacteria 35708
640 Ga0501035_0002501 3300049822 Bacteria 17968
641 Ga0501035_0062818 3300049822 Bacteria 3303
642 Ga0501035_0071384 3300049822 Bacteria 3074
643 Ga0501035_0151449 3300049822 Bacteria 2012
644 Ga0501035_0273120 3300049822 Bacteria 1430
645 Ga0501035_0369113 3300049822 Bacteria 1198
646 Ga0501044_0000141 3300049823 Bacteria 88569
647 Ga0501044_0015357 3300049823 Bacteria 8246
648 Ga0501044_0021407 3300049823 Bacteria 6898
649 Ga0501044_0024327 3300049823 Bacteria 6432
650 Ga0501044_0030642 3300049823 Bacteria 5667
651 Ga0501044_0075980 3300049823 Bacteria 3411
652 Ga0501044_0120825 3300049823 Bacteria 2621
653 Ga0501044_0163547 3300049823 Bacteria 2200
654 Ga0501044_0253134 3300049823 Bacteria 1701
655 Ga0501044_0303491 3300049823 Bacteria 1525
656 Ga0501044_0568358 3300049823 Bacteria 1029
657 Ga0501045_0089167 3300049824 Bacteria 2278
658 Ga0501045_0093918 3300049824 Bacteria 2218
659 nmdc:mga03n38_39366_c1 3300050490 Bacteria 2050
660 nmdc:mga00v17_60742_c1 3300050491 Bacteria 2322
661 nmdc:mga0yw44_10806_c1 3300050492 Bacteria 4678
662 nmdc:mga0yw44_40728_c1 3300050492 Bacteria 2762
663 nmdc:mga0yw44_62719_c1 3300050492 Bacteria 2284
664 nmdc:mga0k408_266101_c1 3300050493 Bacteria 1024
665 nmdc:mga06z11_62028_c1 3300050494 Bacteria 1952
666 nmdc:mga07m45_29010_c1 3300050496 Bacteria 3057
667 nmdc:mga0sz30_11565_c1 3300050516 Bacteria 3412
668 nmdc:mga0sz30_162261_c1 3300050516 Bacteria 990
669 nmdc:mga0sz30_28765_c1 3300050516 Bacteria 2288
670 Ga0495601_0011938 3300053077 Bacteria 5207
671 Ga0495601_0163119 3300053077 Bacteria 1456
672 Ga0495612_0015722 3300053078 Bacteria 3033
673 Ga0500610_0094424 3300053079 Bacteria 1552
674 Ga0495655_0002386 3300053083 Bacteria 2979
675 Ga0495595_0004962 3300053084 Bacteria 5368
676 Ga0495619_0001294 3300053085 Bacteria 16443
677 Ga0495619_0176297 3300053085 Bacteria 1478
678 Ga0500578_0194960 3300053086 Bacteria 1242
679 Ga0500578_0244093 3300053086 Bacteria 1084
680 Ga0500578_0250232 3300053086 Bacteria 1068
681 Ga0500643_000114 3300053087 Bacteria 84221
682 Ga0500643_014470 3300053087 Bacteria 2741
683 Ga0500646_0007575 3300053090 Bacteria 2775
684 Ga0500583_0004883 3300053092 Bacteria 4431
685 Ga0500651_0009100 3300053093 Bacteria 5881
686 Ga0500651_0020699 3300053093 Bacteria 4097
687 Ga0500651_0182680 3300053093 Bacteria 1245
688 Ga0500651_0419321 3300053093 Bacteria 749
689 Ga0500566_0006392 3300053094 Bacteria 6993
690 Ga0500566_0035417 3300053094 Bacteria 2900
691 Ga0500566_0265217 3300053094 Bacteria 827
692 Ga0500650_0012501 3300053098 Bacteria 3532
693 Ga0500555_006398 3300053103 Bacteria 3345
694 Ga0500556_0000002 3300053104 Bacteria 773626
695 Ga0500569_038919 3300053109 Bacteria 1382
696 Ga0500569_087746 3300053109 Bacteria 1004
697 Ga0500593_069510 3300053117 Bacteria 1531
698 Ga0500594_0007611 3300053118 Bacteria 2453
699 Ga0500595_001592 3300053119 Bacteria 11990
700 Ga0500595_028613 3300053119 Bacteria 1899
701 Ga0500607_083496 3300053121 Bacteria 1623
702 Ga0500608_002380 3300053122 Bacteria 6834
703 Ga0500608_251851 3300053122 Bacteria 688
704 Ga0500614_053172 3300053123 Bacteria 1069
705 Ga0500618_027052 3300053125 Bacteria 1366
706 Ga0500642_0000016 3300053130 Bacteria 176560
707 Ga0500642_0046420 3300053130 Bacteria 1899
708 Ga0500642_0093022 3300053130 Bacteria 1395
709 Ga0500652_001448 3300053131 Bacteria 7362
710 Ga0500652_180926 3300053131 Bacteria 864
711 Ga0500658_0200274 3300053134 Bacteria 912
712 Ga0500559_0003046 3300053136 Bacteria 8376
713 Ga0500564_093080 3300053138 Bacteria 1339
714 Ga0500568_0008958 3300053139 Bacteria 4783
715 Ga0500568_0037365 3300053139 Bacteria 1970
716 Ga0500577_0000643 3300053142 Bacteria 8969
717 Ga0500586_000742 3300053145 Bacteria 6679
718 Ga0500588_0064449 3300053146 Bacteria 1184
719 Ga0500589_080799 3300053147 Bacteria 1452
720 Ga0500590_088817 3300053148 Bacteria 1504
721 Ga0500604_0002554 3300053151 Bacteria 4964
722 Ga0500604_0049954 3300053151 Bacteria 1288
723 Ga0500616_0000061 3300053153 Bacteria 249158
724 Ga0500616_0000085 3300053153 Bacteria 193192
725 Ga0500619_102853 3300053154 Bacteria 969
726 Ga0500620_080205 3300053155 Bacteria 1130
727 Ga0500622_0004251 3300053156 Bacteria 9103
728 Ga0500622_0011717 3300053156 Bacteria 4766
729 Ga0500627_0036838 3300053158 Bacteria 2085
730 Ga0500627_0091002 3300053158 Bacteria 1365
731 Ga0500633_0271380 3300053160 Bacteria 628
732 Ga0500634_0099853 3300053161 Bacteria 1455
733 Ga0500634_0264767 3300053161 Bacteria 704
734 Ga0500636_0029603 3300053177 Bacteria 3235
735 Ga0500636_0035169 3300053177 Bacteria 2965
736 Ga0500570_070167 3300053724 Bacteria 1639
737 Ga0500625_185831 3300053729 Bacteria 720
738 Ga0500596_009584 3300053735 Bacteria 1509
739 Ga0500601_000777 3300053737 Bacteria 4087
740 Ga0501084_0006916 3300054114 Bacteria 9336
741 Ga0501084_0429084 3300054114 Bacteria 1117
742 Ga0501082_0002578 3300060353 Bacteria 15849
743 2513646242 2513237095 Bacteria 8976980
744 2528858720 2528768022 Bacteria 10457665
745 2603856731 2602042107 Bacteria 6226103
746 2644288063 2643221651 Bacteria 4798932
747 2793060331 2791355196 Bacteria 7323613
748 2818241419 2816332527 Bacteria 8933356
749 2824666979 2824661429 Bacteria 9877870
750 2857528206 2857524615 Bacteria 6615449
751 2874636568 2874628541 Bacteria 8630250
752 2885416647 2885409591 Bacteria 9235467
753 2893068649 2893066018 Bacteria 6158120
754 2906628184 2906626472 Bacteria 8826946
755 2919075628 2919073203 Bacteria 6531949
756 2932792075 2932784394 Bacteria 9704911
757 2932814058 2932809354 Bacteria 9135765
758 2932819454 2932818245 Bacteria 9955613
759 2932833837 2932828146 Bacteria 9745859
760 2935618633 2935616580 Bacteria 9032984
761 2935644524 2935638405 Bacteria 10015038
762 2935673585 2935665750 Bacteria 9571747
763 2935678472 2935675223 Bacteria 9928132
764 2935688025 2935684952 Bacteria 9590419
765 2935701364 2935694250 Bacteria 9291695
766 2935708381 2935703347 Bacteria 10242284
767 2935715045 2935713505 Bacteria 9608509
768 2935726390 2935722832 Bacteria 9608746
769 2935733863 2935732158 Bacteria 9706831
770 2935743242 2935741537 Bacteria 9707219
771 2935754719 2935750917 Bacteria 9590372
772 2935765425 2935760218 Bacteria 9817913
773 2935805376 2935801545 Bacteria 9301974
774 2935816674 2935810662 Bacteria 9401221
775 2935833727 2935827899 Bacteria 10038562
776 2935839587 2935837841 Bacteria 9454360
777 2935856998 2935855204 Bacteria 9035059
778 2935871174 2935864058 Bacteria 9784707
779 2935876323 2935873716 Bacteria 9632195
780 2935997713 2935992306 Bacteria 9802711
781 2936007226 2936002035 Bacteria 9362176
782 2936043064 2936037263 Bacteria 9446081
783 2940559904 2940556831 Bacteria 9590747
784 2941540276 2941538514 Bacteria 9402094
785 8016514596 8016511872 Bacteria 9921665
786 8016591367 8016583857 Bacteria 10421953
787 8017061834 8017057580 Bacteria 10023680
788 8019588989 8019586578 Bacteria 10212056
789 8019602245 8019597564 Bacteria 10041141
790 8019616318 8019608314 Bacteria 10042931
791 Ga0495672_0109887
792 JGI24739J22299_10036348
793 JGI25406J46586_10000026
794 Ga0055526_1019466
795 Ga0070658_10118578
796 Ga0070658_10166257
797 Ga0070683_100045939
798 Ga0070670_100294362
799 Ga0068869_100312161
800 Ga0070680_100073397
801 Ga0070680_100101229
802 Ga0070680_100262730
803 Ga0070682_100607605
804 Ga0070660_100002660
805 Ga0070660_100051412
806 Ga0070661_100259700
807 Ga0070661_100701276
808 Ga0070668_100071970
809 Ga0070668_100318970
810 Ga0070671_100528120
811 Ga0070674_100140046
812 Ga0070674_100242806
813 Ga0070688_100615208
814 Ga0070659_100155825
815 Ga0070659_100183135
816 Ga0070659_100548395
817 Ga0070659_100929921
818 Ga0070667_100026062
819 Ga0070667_100694192
820 Ga0070709_10529164
821 Ga0070709_10551853
822 Ga0070714_100230058
823 Ga0070713_100049276
824 Ga0070713_100100772
825 Ga0070713_100171727
826 Ga0070710_10045473
827 Ga0070711_100034860
828 Ga0070711_100056887
829 Ga0070711_100169802
830 Ga0070663_100024598
831 Ga0070663_100355027
832 Ga0070678_100175253
833 Ga0070678_100562876
834 Ga0070678_100732279
835 Ga0070681_10067318
836 Ga0070681_10140481
837 Ga0070681_10895345
838 Ga0070681_11084600
839 Ga0068867_100162898
840 Ga0068867_100232517
841 Ga0070698_100853116
842 Ga0070679_100111961
843 Ga0070679_100131554
844 Ga0070679_100253970
845 Ga0070684_100153890
846 Ga0070697_100120213
847 Ga0068853_100023154
848 Ga0068853_100063322
849 Ga0068853_100123108
850 Ga0068853_100272630
851 Ga0068853_100451109
852 Ga0070672_100344729
853 Ga0070672_100465792
854 Ga0070665_100591559
855 Ga0068855_100135334
856 Ga0068855_100155099
857 Ga0068855_100272066
858 Ga0068855_100614685
859 Ga0068855_100676037
860 Ga0070664_100456864
861 Ga0070664_100636716
862 Ga0068857_100081508
863 Ga0068857_100528458
864 Ga0068854_100002399
865 Ga0068856_100032368
866 Ga0068856_100084302
867 Ga0068856_100132771
868 Ga0068856_100204667
869 Ga0070702_100142173
870 Ga0068852_100032186
871 Ga0068852_100155019
872 Ga0068859_100273395
873 Ga0068859_100675135
874 Ga0068864_100263030
875 Ga0068866_10266112
876 Ga0068861_100636371
877 Ga0068851_10003285
878 Ga0068863_100445325
879 Ga0068863_100554693
880 Ga0068858_100585512
881 Ga0068858_100677819
882 Ga0081539_10000140
883 Ga0070717_10196146
884 Ga0075365_10057876
885 Ga0075368_10018117
886 Ga0075363_100007216
887 Ga0075363_100296365
888 Ga0070716_100023710
889 Ga0070712_100076838
890 Ga0070712_100230676
891 Ga0070712_100423341
892 Ga0075367_10264593
893 Ga0075369_10006130
894 Ga0075369_10012128
895 Ga0075369_10256569
896 Ga0097621_100115822
897 Ga0097621_101083762
898 Ga0097620_100273392
899 Ga0097620_100675148
900 Ga0099794_10030760
901 Ga0099794_10100578
902 Ga0099794_10153022
903 Ga0099795_10001655
904 Ga0099795_10024616
905 Ga0105240_10009181
906 Ga0105240_10057007
907 Ga0105240_10073472
908 Ga0105245_10581494
909 Ga0105245_10664700
910 Ga0105245_10751942
911 Ga0105247_10239109
912 Ga0105247_10250180
913 Ga0105243_10095901
914 Ga0105243_10356137
915 Ga0105243_10902484
916 Ga0105243_11440501
917 Ga0105241_10000959
918 Ga0105241_10207269
919 Ga0105241_10697731
920 Ga0105242_10515908
921 Ga0105248_10539325
922 Ga0105248_10723099
923 Ga0105237_10017220
924 Ga0105237_10023237
925 Ga0105237_10082872
926 Ga0105237_10327889
927 Ga0105237_10350865
928 Ga0105237_10654327
929 Ga0105237_10833650
930 Ga0105238_10006415
931 Ga0105238_10012964
932 Ga0105238_10040259
933 Ga0105238_10969805
934 Ga0105249_10102029
935 Ga0099796_10022056
936 Ga0099796_10027282
937 Ga0105239_10012362
938 Ga0105239_10033023
939 Ga0105239_10126696
940 Ga0105239_10232996
941 Ga0105239_10625231
942 Ga0105246_10120330
943 Ga0105246_10620246
944 Ga0105246_10966464
945 Ga0157373_10031903
946 Ga0157370_10114738
947 Ga0157370_10242807
948 Ga0157369_10008434
949 Ga0157369_10192607
950 Ga0157369_10196290
951 Ga0157378_10227304
952 Ga0157378_10322121
953 Ga0163162_10186479
954 Ga0163162_10332057
955 Ga0157375_10692247
956 Ga0157375_11670572
957 Ga0163163_10003210
958 Ga0163163_10183129
959 Ga0163163_10270501
960 Ga0163163_10882518
961 Ga0163163_11457481
962 Ga0157379_10195820
963 Ga0157379_10321731
964 Ga0157376_10487600
965 Ga0163161_10451274
966 Ga0206354_10482704
967 Ga0213876_10010852
968 Ga0209563_103084
969 Ga0209677_102110
970 Ga0209233_1002206
971 Ga0209564_1001156
972 Ga0209564_1017381
973 Ga0209758_1013540
974 Ga0209758_1024692
975 Ga0209256_1020440
976 Ga0209257_1014115
977 Ga0207656_10045602
978 Ga0207656_10093135
979 Ga0207656_10239897
980 Ga0207682_10402613
981 Ga0207692_10395723
982 Ga0207710_10103043
983 Ga0207710_10248261
984 Ga0207688_10143224
985 Ga0207647_10009458
986 Ga0207645_10594927
987 Ga0207705_10017885
988 Ga0207705_10041088
989 Ga0207705_10368122
990 Ga0207654_10001069
991 Ga0207654_10121581
992 Ga0207654_10284977
993 Ga0207707_10001819
994 Ga0207695_10002303
995 Ga0207695_10062858
996 Ga0207695_10749179
997 Ga0207671_10020984
998 Ga0207671_10046036
999 Ga0207671_10079958
1000 Ga0207671_10088969
1001 Ga0207671_10309196
1002 Ga0207693_10043440
1003 Ga0207693_10603394
1004 Ga0207663_10054440
1005 Ga0207660_10063326
1006 Ga0207660_10109390
1007 Ga0207660_10824091
1008 Ga0207657_10003059
1009 Ga0207657_10128746
1010 Ga0207652_10022569
1011 Ga0207652_10088047
1012 Ga0207652_10287304
1013 Ga0207652_10440238
1014 Ga0207694_10000640
1015 Ga0207694_10078904
1016 Ga0207650_10220622
1017 Ga0207659_10308667
1018 Ga0207700_10036760
1019 Ga0207700_10321423
1020 Ga0207644_10073366
1021 Ga0207690_10123606
1022 Ga0207686_10161944
1023 Ga0207709_10124471
1024 Ga0207709_10138772
1025 Ga0207709_10421735
1026 Ga0207669_10125399
1027 Ga0207704_10243640
1028 Ga0207665_10036733
1029 Ga0207691_10440168
1030 Ga0207691_10460983
1031 Ga0207711_10361520
1032 Ga0207661_10000232
1033 Ga0207679_10311137
1034 Ga0207667_10009250
1035 Ga0207667_10009830
1036 Ga0207667_10205348
1037 Ga0207667_10286804
1038 Ga0207667_10865091
1039 Ga0207668_10176376
1040 Ga0207640_10147195
1041 Ga0207658_10151503
1042 Ga0207677_10187818
1043 Ga0207703_10141486
1044 Ga0207703_11253346
1045 Ga0207639_10016871
1046 Ga0207639_10030751
1047 Ga0207639_10350414
1048 Ga0207639_11103227
1049 Ga0207678_10009055
1050 Ga0207678_10110255
1051 Ga0207678_10138504
1052 Ga0207678_10163089
1053 Ga0207678_10228689
1054 Ga0207678_10627151
1055 Ga0207678_10924023
1056 Ga0207702_10000005
1057 Ga0207702_10582346
1058 Ga0207702_11301887
1059 Ga0207641_10212908
1060 Ga0207648_10237459
1061 Ga0207648_10347001
1062 Ga0207676_10133729
1063 Ga0207676_10959727
1064 Ga0207674_10007968
1065 Ga0207674_10034337
1066 Ga0207674_10169507
1067 Ga0207675_100337818
1068 Ga0207683_10220710
1069 Ga0207683_10298793
1070 Ga0207683_10305126
1071 Ga0207683_10589508
1072 Ga0207698_10032585
1073 Ga0207698_10296647
1074 Ga0207698_11249253
1075 Ga0209179_1003548
1076 Ga0209179_1008802
1077 Ga0209179_1017725
1078 Ga0209179_1073517
1079 Ga0209588_1052730
1080 Ga0268266_10072576
1081 Ga0268265_10355647
1082 Ga0268264_10798829
1083 Ga0265337_1009221
1084 Ga0265326_10018617
1085 Ga0265334_10009110
1086 Ga0265318_10032293
1087 Ga0265323_10023799
1088 Ga0265336_10000322
1089 Ga0307515_10167965
1090 Ga0265338_10001338
1091 Ga0265324_10015926
1092 Ga0265330_10032386
1093 Ga0265325_10390331
1094 Ga0265340_10002383
1095 Ga0265316_10120155
1096 Ga0307508_10167611
1097 Ga0265314_10118340
1098 Ga0265342_10019156
1099 Ga0265342_10163976
1100 Ga0373934_0002672
1101 Ga0373934_0075156
1102 Ga0373952_0076311
1103 Ga0373923_0000076
1104 Ga0373936_0117259
1105 Ga0373941_0099912
1106 Ga0373953_0008940
1107 Ga0373954_0008912
1108 Ga0373954_0048567
1109 Ga0373956_0001935
1110 Ga0373957_0000856
1111 Ga0373960_0053274
1112 Ga0373955_0000624
1113 Ga0373955_0007478
1114 Ga0373924_0006603
1115 Ga0373924_0143574
1116 Ga0373931_0029564
1117 Ga0373935_0271482
1118 Ga0373927_0062000
1119 Ga0373927_0266960
1120 Ga0373933_0022629
1121 Ga0373933_0034164
1122 Ga0373933_0087173
1123 Ga0373937_0069526
1124 Ga0373937_0150921
1125 Ga0373937_0921182
1126 Ga0373925_0025341
1127 Ga0395899_0044542
1128 Ga0395898_0163606
1129 Ga0395898_0950459
1130 Ga0395901_1168518
1131 Ga0436365_0440186
1132 Ga0436365_1601192
1133 Ga0436360_1151463
1134 Ga0436361_1171468
1135 Ga0436362_0074706
1136 Ga0451853_2115815
1137 Ga0466966_0031750
1138 Ga0466966_0264062
1139 Ga0466963_0258825
1140 Ga0466957_0100327
1141 Ga0466959_0017989
1142 Ga0466959_0019376
1143 Ga0466958_0071322
1144 Ga0466967_0301305
1145 Ga0466967_0680035
1146 Ga0495592_0001191
1147 Ga0495592_0011883
1148 Ga0495629_0000450
1149 Ga0495629_0279259
1150 Ga0495638_0022108
1151 Ga0495638_0079631
1152 Ga0495651_0019753
1153 Ga0495651_0105498
1154 Ga0495651_0170416
1155 Ga0495653_0001141
1156 Ga0495653_0094070
1157 Ga0495582_0211940
1158 Ga0495639_0203801
1159 Ga0495662_0086888
1160 Ga0495664_0119442
1161 Ga0495583_0049631
1162 Ga0495606_0003861
1163 Ga0495606_0029376
1164 Ga0495606_0376604
1165 Ga0495608_0000519
1166 Ga0495608_0041504
1167 Ga0495608_0266185
1168 Ga0495610_0096333
1169 Ga0495610_0209820
1170 Ga0495616_0054947
1171 Ga0495616_0163355
1172 Ga0495618_0079130
1173 Ga0495618_0247054
1174 Ga0495620_0040673
1175 Ga0495628_0008002
1176 Ga0495628_0094668
1177 Ga0495631_0250762
1178 Ga0495632_0074265
1179 Ga0495643_0021762
1180 Ga0495648_0273187
1181 Ga0495652_0013345
1182 Ga0495652_0327523
1183 Ga0495652_0626862
1184 Ga0495652_0635547
1185 Ga0495654_0057259
1186 Ga0495640_0009479
1187 Ga0495640_0028307
1188 Ga0495586_0052173
1189 Ga0495587_0004141
1190 Ga0495587_0022528
1191 Ga0495597_0220731
1192 Ga0495645_0010029
1193 Ga0495667_0000128
1194 Ga0495667_0167279
1195 Ga0495634_0027266
1196 Ga0495634_0078381
1197 Ga0495625_0381747
1198 Ga0495635_0000232
1199 Ga0495635_0072032
1200 Ga0495635_0289328
1201 Ga0495661_0109086
1202 Ga0495588_0055117
1203 Ga0495657_0005432
1204 Ga0495657_0230900
1205 Ga0495599_0006443
1206 Ga0495599_0038668
1207 Ga0495623_0043851
1208 Ga0495623_0048122
1209 Ga0495623_0358808
1210 Ga0495623_0369775
1211 Ga0495646_0001526
1212 Ga0495646_0024282
1213 Ga0495613_0086839
1214 Ga0495613_0143636
1215 Ga0495613_0423573
1216 Ga0495670_0015024
1217 Ga0495649_0155693
1218 Ga0495600_0002638
1219 Ga0495660_0127340
1220 Ga0495604_0006026
1221 Ga0495674_0008861
1222 Ga0495674_0179855
1223 Ga0495674_0253803
1224 Ga0495672_0010039
1225 Ga0495680_0000314
1226 Ga0495675_0003282
1227 Ga0495675_0030419
1228 Ga0495681_0106604
1229 Ga0495684_0001551
1230 Ga0495684_0021762
1231 Ga0495686_0083998
1232 Ga0495686_0247619
1233 Ga0495593_0001148
1234 Ga0495593_0076075
1235 Ga0495602_0053304
1236 Ga0495602_0086183
1237 Ga0495626_0117556
1238 Ga0496100_0071739
1239 Ga0496100_0346914
1240 Ga0496101_0031209
1241 Ga0496101_0124207
1242 Ga0496101_0234582
1243 Ga0496102_0044377
1244 Ga0496102_0140983
1245 Ga0496102_0414274
1246 Ga0496103_0107564
1247 Ga0496103_0538501
1248 Ga0496104_0036376
1249 Ga0496104_0116553
1250 Ga0496104_0272369
1251 Ga0496105_0084888
1252 Ga0496105_0135906
1253 Ga0496105_0875321
1254 Ga0496106_0315901
1255 Ga0496106_0326165
1256 Ga0496106_0537512
1257 Ga0496107_0058622
1258 Ga0496107_0216749
1259 Ga0496108_0112873
1260 Ga0496108_0226931
1261 Ga0496108_0232400
1262 Ga0496108_0694932
1263 Ga0496108_0949624
1264 Ga0496109_0114213
1265 Ga0496109_0153790
1266 Ga0496109_0454641
1267 Ga0496109_0789872
1268 Ga0496110_0041078
1269 Ga0496110_0087443
1270 Ga0496110_0123160
1271 Ga0496110_0695418
1272 Ga0496111_0102443
1273 Ga0496112_0000004
1274 Ga0496112_0022306
1275 Ga0496112_0062122
1276 Ga0496112_0085495
1277 Ga0496112_0162578
1278 Ga0496112_0175420
1279 Ga0496113_0092186
1280 Ga0496113_0108462
1281 Ga0496113_0176882
1282 Ga0496114_0217544
1283 Ga0496114_0650136
1284 Ga0496115_0129517
1285 Ga0496115_0493249
1286 Ga0496116_0003689
1287 Ga0496116_0238303
1288 Ga0496116_0243610
1289 Ga0496117_0048041
1290 Ga0496117_0080863
1291 Ga0496117_0135606
1292 Ga0496117_0185200
1293 Ga0496118_0033077
1294 Ga0496118_0041550
1295 Ga0496118_0102382
1296 Ga0496118_0382035
1297 Ga0496119_0108848
1298 Ga0496119_0139118
1299 Ga0496119_0202497
1300 Ga0496119_0307083
1301 Ga0496120_0019074
1302 Ga0496120_0080056
1303 Ga0496121_0000902
1304 Ga0496121_0021472
1305 Ga0496121_0025337
1306 Ga0496121_0039817
1307 Ga0496121_0338335
1308 Ga0496122_0020324
1309 Ga0496122_0055633
1310 Ga0496122_0152213
1311 Ga0496122_0220085
1312 Ga0496123_0113121
1313 Ga0496123_0125719
1314 Ga0496123_0208355
1315 Ga0496124_0069442
1316 Ga0496124_0143796
1317 Ga0496125_0000125
1318 Ga0496125_0000681
1319 Ga0496125_0032853
1320 Ga0496125_0036097
1321 Ga0496125_0169927
1322 Ga0496125_0233932
1323 Ga0496125_0393964
1324 Ga0496126_0006866
1325 Ga0496126_0018674
1326 Ga0496126_0020167
1327 Ga0496126_0040409
1328 Ga0496126_0081975
1329 Ga0496126_0158425
1330 Ga0496126_0307437
1331 Ga0496126_0416341
1332 Ga0495682_0083657
1333 Ga0501031_0002681
1334 Ga0501031_0021438
1335 Ga0501031_0030096
1336 Ga0501031_0244378
1337 Ga0501032_0000188
1338 Ga0501032_0041760
1339 Ga0501032_0146271
1340 Ga0501032_0200750
1341 Ga0501032_0379188
1342 Ga0501033_0000094
1343 Ga0501033_0005103
1344 Ga0501033_0062192
1345 Ga0501033_0069175
1346 Ga0501033_0078162
1347 Ga0501033_0078278
1348 Ga0501034_0000021
1349 Ga0501034_0063922
1350 Ga0501034_0201245
1351 Ga0501034_0387715
1352 Ga0501034_0471823
1353 Ga0501034_0618214
1354 Ga0501036_0000115
1355 Ga0501036_0094605
1356 Ga0501036_0884628
1357 Ga0501037_0000174
1358 Ga0501037_0004737
1359 Ga0501037_0247701
1360 Ga0501037_0621169
1361 Ga0501038_0000052
1362 Ga0501038_0002268
1363 Ga0501038_0014273
1364 Ga0501038_0208778
1365 Ga0501039_0000156
1366 Ga0501039_0146047
1367 Ga0501039_0164884
1368 Ga0501039_0205719
1369 Ga0501039_0291211
1370 Ga0501039_0765876
1371 Ga0501040_0094664
1372 Ga0501040_0250786
1373 Ga0501042_0023389
1374 Ga0501042_0030155
1375 Ga0501043_0002971
1376 Ga0501043_0004414
1377 Ga0501043_0010117
1378 Ga0501043_0023674
1379 Ga0501043_0093594
1380 Ga0501043_0129254
1381 Ga0501043_0152006
1382 Ga0501043_0153524
1383 Ga0501043_0697903
1384 Ga0501046_0000133
1385 Ga0501046_0012576
1386 Ga0501046_0045072
1387 Ga0501046_0070224
1388 Ga0501046_0076237
1389 Ga0501047_0000511
1390 Ga0501047_0033517
1391 Ga0501047_0041283
1392 Ga0501047_0058669
1393 Ga0501047_0131383
1394 Ga0501047_0554525
1395 Ga0501048_0000072
1396 Ga0501067_0000045
1397 Ga0501067_0025701
1398 Ga0501068_0011425
1399 Ga0501068_0088801
1400 Ga0501069_0003290
1401 Ga0501070_0020238
1402 Ga0501070_0086990
1403 Ga0501070_0133883
1404 Ga0501070_0519537
1405 Ga0501072_0008854
1406 Ga0501072_0099026
1407 Ga0501073_0000099
1408 Ga0501073_0118264
1409 Ga0501073_0119826
1410 Ga0501073_0127943
1411 Ga0501073_0238825
1412 Ga0501074_0001112
1413 Ga0501074_0023594
1414 Ga0501074_0107271
1415 Ga0501074_0607897
1416 Ga0501076_0107774
1417 Ga0501077_0207883
1418 Ga0501077_0457661
1419 Ga0501079_0003234
1420 Ga0501079_0195375
1421 Ga0501079_0205298
1422 Ga0501080_0003659
1423 Ga0501080_0082855
1424 Ga0501080_0145209
1425 Ga0501080_0255559
1426 Ga0501083_0001322
1427 Ga0501083_0059244
1428 Ga0501083_0524688
1429 Ga0501035_0000726
1430 Ga0501035_0002501
1431 Ga0501035_0062818
1432 Ga0501035_0071384
1433 Ga0501035_0151449
1434 Ga0501035_0273120
1435 Ga0501035_0369113
1436 Ga0501044_0000141
1437 Ga0501044_0015357
1438 Ga0501044_0021407
1439 Ga0501044_0024327
1440 Ga0501044_0030642
1441 Ga0501044_0075980
1442 Ga0501044_0120825
1443 Ga0501044_0163547
1444 Ga0501044_0253134
1445 Ga0501044_0303491
1446 Ga0501044_0568358
1447 Ga0501045_0089167
1448 Ga0501045_0093918
1449 nmdc:mga03n38_39366_c1
1450 nmdc:mga00v17_60742_c1
1451 nmdc:mga0yw44_10806_c1
1452 nmdc:mga0yw44_40728_c1
1453 nmdc:mga0yw44_62719_c1
1454 nmdc:mga0k408_266101_c1
1455 nmdc:mga06z11_62028_c1
1456 nmdc:mga07m45_29010_c1
1457 nmdc:mga0sz30_11565_c1
1458 nmdc:mga0sz30_162261_c1
1459 nmdc:mga0sz30_28765_c1
1460 Ga0495601_0011938
1461 Ga0495601_0163119
1462 Ga0495612_0015722
1463 Ga0500610_0094424
1464 Ga0495655_0002386
1465 Ga0495595_0004962
1466 Ga0495619_0001294
1467 Ga0495619_0176297
1468 Ga0500578_0194960
1469 Ga0500578_0244093
1470 Ga0500578_0250232
1471 Ga0500643_000114
1472 Ga0500643_014470
1473 Ga0500646_0007575
1474 Ga0500583_0004883
1475 Ga0500651_0009100
1476 Ga0500651_0020699
1477 Ga0500651_0182680
1478 Ga0500651_0419321
1479 Ga0500566_0006392
1480 Ga0500566_0035417
1481 Ga0500566_0265217
1482 Ga0500650_0012501
1483 Ga0500555_006398
1484 Ga0500556_0000002
1485 Ga0500569_038919
1486 Ga0500569_087746
1487 Ga0500593_069510
1488 Ga0500594_0007611
1489 Ga0500595_001592
1490 Ga0500595_028613
1491 Ga0500607_083496
1492 Ga0500608_002380
1493 Ga0500608_251851
1494 Ga0500614_053172
1495 Ga0500618_027052
1496 Ga0500642_0000016
1497 Ga0500642_0046420
1498 Ga0500642_0093022
1499 Ga0500652_001448
1500 Ga0500652_180926
1501 Ga0500658_0200274
1502 Ga0500559_0003046
1503 Ga0500564_093080
1504 Ga0500568_0008958
1505 Ga0500568_0037365
1506 Ga0500577_0000643
1507 Ga0500586_000742
1508 Ga0500588_0064449
1509 Ga0500589_080799
1510 Ga0500590_088817
1511 Ga0500604_0002554
1512 Ga0500604_0049954
1513 Ga0500616_0000061
1514 Ga0500616_0000085
1515 Ga0500619_102853
1516 Ga0500620_080205
1517 Ga0500622_0004251
1518 Ga0500622_0011717
1519 Ga0500627_0036838
1520 Ga0500627_0091002
1521 Ga0500633_0271380
1522 Ga0500634_0099853
1523 Ga0500634_0264767
1524 Ga0500636_0029603
1525 Ga0500636_0035169
1526 Ga0500570_070167
1527 Ga0500625_185831
1528 Ga0500596_009584
1529 Ga0500601_000777
1530 Ga0501084_0006916
1531 Ga0501084_0429084
1532 Ga0501082_0002578
1533 2513646242
1534 2528858720
1535 2603856731
1536 2644288063
1537 2793060331
1538 2818241419
1539 2824666979
1540 2857528206
1541 2874636568
1542 2885416647
1543 2893068649
1544 2906628184
1545 2919075628
1546 2932792075
1547 2932814058
1548 2932819454
1549 2932833837
1550 2935618633
1551 2935644524
1552 2935673585
1553 2935678472
1554 2935688025
1555 2935701364
1556 2935708381
1557 2935715045
1558 2935726390
1559 2935733863
1560 2935743242
1561 2935754719
1562 2935765425
1563 2935805376
1564 2935816674
1565 2935833727
1566 2935839587
1567 2935856998
1568 2935871174
1569 2935876323
1570 2935997713
1571 2936007226
1572 2936043064
1573 2940559904
1574 2941540276
1575 8016514596
1576 8016591367
1577 8017061834
1578 8019588989
1579 8019602245
1580 8019616318

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3esl-assembly1.cif.gz_A crystal structure of the conserved n-terminal domain of the mitotic checkpoint component bub1 0.4303 19 175
3esl-assembly2.cif.gz_B crystal structure of the conserved n-terminal domain of the mitotic checkpoint component bub1 0.4231 19 175
5ee5-assembly1.cif.gz_A structure of human arl1 in complex with the dcb domain of big1 0.4044 14 183
6hiw-assembly1.cif.gz_DA cryo-em structure of the trypanosoma brucei mitochondrial ribosome - this entry contains the complete small mitoribosomal subunit in complex with mt-if-3 0.3484 7 162
6n86-assembly1.cif.gz_B resistance to inhibitors of cholinesterase 8a (ric8a) protein 0.34 19 190
ID Description Score Start End Superfamily
af_O16637_4_593_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.476 9 176 1.25.10.10
af_A0A2R8RXH9_30_171_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4599 15 175 1.25.10.10
af_D4A631_28_213_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4394 14 154 1.25.10.10
af_A0A1D8PS18_6_190_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4351 19 175 1.25.40.10
af_K7KKA5_360_495_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4346 19 181 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A4Q7FA60-F1-model_v4 Uncharacterized protein 0.9354 1 135
AF-A0A4Q7FA60-F1-model_v4 Uncharacterized protein 0.9288 1 135
AF-A0A6G6YV36-F1-model_v4 Uncharacterized protein 0.9077 43 170
AF-A0A521VYP7-F1-model_v4 DUF222 domain-containing protein 0.8976 19 190 GO:0016020
AF-A0A7Y6T4K1-F1-model_v4 deleted 0.8875 19 177

Map