F480978

General Info

Members Datasets Scaffolds Average Seq Length
791 340 1582 174

Family's Representative Sequence

Representative Sequence 3300012512|Ga0157327_1031428|Ga0157327_10314281
Length 180
Sequence MSRIGKKPVAMPSGVSAIVEGQTLTVKGPKGTLSMQLLDDLVKYEVGESEIRVTPLVDAQRNRAAWGMQRTNVQNLVTGVTEGFSKVLEITGVGYRAQAQGRNLKLQLGYSHDVNFAVPEGVDVKTPDNTTVEISGIDKQKVGQVAAEIRRWRKPEPYKGKGIKYSDERVRRKEGKTGTA

Samples

Sample ID Description Type Environment
1 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
127 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
131 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
209 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
210 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
211 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
212 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
213 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
214 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
215 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
216 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
217 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
218 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
219 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
220 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
221 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
222 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
228 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
229 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
230 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
231 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
232 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
233 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
234 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
235 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
236 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
237 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
238 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
239 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
240 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
241 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
242 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
243 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
246 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
247 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
248 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
249 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
250 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
251 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
252 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
253 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
254 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
255 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
260 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
261 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
262 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
263 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
264 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
265 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
266 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
267 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
268 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
269 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
270 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
271 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
272 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
273 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
276 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
277 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
278 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
279 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
290 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
291 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
292 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
293 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
294 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
295 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
296 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
312 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
313 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
314 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
315 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
316 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
317 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
318 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
319 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
320 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
321 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
322 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
323 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
324 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
325 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
326 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
327 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
328 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
329 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
330 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
331 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
333 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
334 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
335 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
336 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
337 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
338 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
339 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
340 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 97.09
Metatranscriptomes 2.53
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.63
Nodule 0
Rhizoplane 3.41
Rhizosphere 94.31
Stem 0
Stem Tuber 0.13
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157327_1031428 3300012512 Bacteria 665
2 JGI24741J21665_1006520 3300001915 Bacteria 2339
3 JGI24752J21851_1004884 3300001976 Bacteria 1752
4 JGI24740J21852_10010818 3300001979 Bacteria 3492
5 JGI24740J21852_10018734 3300001979 Bacteria 2448
6 JGI24737J22298_10034385 3300001990 Bacteria 1571
7 JGI24737J22298_10046990 3300001990 Bacteria 1316
8 JGI24743J22301_10000178 3300001991 Bacteria 6554
9 JGI24749J21850_1000439 3300002076 Bacteria 6188
10 JGI24744J21845_10009478 3300002077 Bacteria 1997
11 JGI24035J26624_1004802 3300002126 Bacteria 1286
12 JGI24034J26672_10000592 3300002239 Bacteria 4635
13 JGI24742J22300_10025233 3300002244 Bacteria 1026
14 JGI24751J29686_10005113 3300002459 Bacteria 2671
15 JGI25406J46586_10064507 3300003203 Bacteria 1170
16 JGI25404J52841_10001145 3300003659 Bacteria 4494
17 Ga0055537_1003606 3300003773 Bacteria 4709
18 Ga0065704_10278062 3300005289 Bacteria 928
19 Ga0065712_10457988 3300005290 Bacteria 680
20 Ga0065715_10000098 3300005293 Bacteria 2789
21 Ga0065715_10117061 3300005293 Bacteria 2360
22 Ga0070658_10001004 3300005327 Bacteria 24213
23 Ga0070658_10132527 3300005327 Bacteria 2077
24 Ga0070658_10223389 3300005327 Bacteria 1593
25 Ga0070658_10378900 3300005327 Bacteria 1213
26 Ga0070658_10552614 3300005327 Bacteria 996
27 Ga0070658_10950177 3300005327 Bacteria 747
28 Ga0070658_11401525 3300005327 Bacteria 606
29 Ga0070676_10000510 3300005328 Bacteria 18623
30 Ga0070676_10010202 3300005328 Bacteria 5093
31 Ga0070683_100141134 3300005329 Bacteria 2283
32 Ga0070683_100149576 3300005329 Bacteria 2213
33 Ga0070683_100212970 3300005329 Bacteria 1836
34 Ga0070683_100311267 3300005329 Bacteria 1498
35 Ga0070683_100371257 3300005329 Bacteria 1363
36 Ga0070690_100000366 3300005330 Bacteria 23062
37 Ga0070670_100003103 3300005331 Bacteria 13747
38 Ga0070670_100067246 3300005331 Bacteria 3075
39 Ga0070670_100233027 3300005331 Bacteria 1602
40 Ga0070670_100352805 3300005331 Bacteria 1292
41 Ga0070670_100626732 3300005331 Bacteria 963
42 Ga0070677_10000441 3300005333 Bacteria 14198
43 Ga0068869_100001184 3300005334 Bacteria 15307
44 Ga0070666_10002375 3300005335 Bacteria 11377
45 Ga0070666_10099061 3300005335 Bacteria 2007
46 Ga0070680_100057831 3300005336 Bacteria 3171
47 Ga0070680_100098228 3300005336 Bacteria 2428
48 Ga0070682_100106826 3300005337 Bacteria 1858
49 Ga0068868_100002098 3300005338 Bacteria 13728
50 Ga0068868_100839213 3300005338 Bacteria 832
51 Ga0068868_101119623 3300005338 Bacteria 725
52 Ga0070660_100011537 3300005339 Bacteria 6287
53 Ga0070660_100058924 3300005339 Bacteria 2977
54 Ga0070660_100060217 3300005339 Bacteria 2946
55 Ga0070660_100067200 3300005339 Bacteria 2792
56 Ga0070660_100601361 3300005339 Bacteria 919
57 Ga0070689_100001862 3300005340 Bacteria 13594
58 Ga0070691_10041885 3300005341 Bacteria 2166
59 Ga0070687_100000205 3300005343 Bacteria 20626
60 Ga0070687_100225814 3300005343 Bacteria 1150
61 Ga0070661_100025547 3300005344 Bacteria 4246
62 Ga0070661_100040240 3300005344 Bacteria 3409
63 Ga0070661_100061205 3300005344 Bacteria 2763
64 Ga0070661_100089385 3300005344 Bacteria 2281
65 Ga0070661_100128861 3300005344 Bacteria 1899
66 Ga0070661_100370975 3300005344 Bacteria 1127
67 Ga0070661_100485140 3300005344 Bacteria 987
68 Ga0070692_10043576 3300005345 Bacteria 2308
69 Ga0070668_100000831 3300005347 Bacteria 21324
70 Ga0070668_100001206 3300005347 Bacteria 18356
71 Ga0070668_100078113 3300005347 Bacteria 2588
72 Ga0070668_100327285 3300005347 Bacteria 1291
73 Ga0070669_100004586 3300005353 Bacteria 9976
74 Ga0070669_100014400 3300005353 Bacteria 5629
75 Ga0070669_101410076 3300005353 Bacteria 605
76 Ga0070675_100002314 3300005354 Bacteria 14155
77 Ga0070675_100065186 3300005354 Bacteria 3011
78 Ga0070675_100108237 3300005354 Bacteria 2347
79 Ga0070675_100357794 3300005354 Bacteria 1296
80 Ga0070675_100650967 3300005354 Bacteria 958
81 Ga0070671_100005888 3300005355 Bacteria 9769
82 Ga0070671_100010810 3300005355 Bacteria 7323
83 Ga0070671_100024172 3300005355 Bacteria 4973
84 Ga0070671_100025309 3300005355 Bacteria 4869
85 Ga0070671_100100447 3300005355 Bacteria 2427
86 Ga0070671_100195832 3300005355 Bacteria 1713
87 Ga0070674_100000202 3300005356 Bacteria 28786
88 Ga0070674_100073643 3300005356 Bacteria 2421
89 Ga0070673_100008582 3300005364 Bacteria 6802
90 Ga0070673_100689283 3300005364 Bacteria 937
91 Ga0070688_100000519 3300005365 Bacteria 19443
92 Ga0070659_100000088 3300005366 Bacteria 69112
93 Ga0070659_100005923 3300005366 Bacteria 8812
94 Ga0070659_100105721 3300005366 Bacteria 2268
95 Ga0070659_100130169 3300005366 Bacteria 2043
96 Ga0070659_100220436 3300005366 Bacteria 1565
97 Ga0070659_100832802 3300005366 Bacteria 804
98 Ga0070667_100003853 3300005367 Bacteria 12741
99 Ga0070667_100050290 3300005367 Bacteria 3512
100 Ga0070667_100096520 3300005367 Bacteria 2549
101 Ga0070667_100119238 3300005367 Bacteria 2294
102 Ga0070667_100224380 3300005367 Bacteria 1673
103 Ga0070714_100076407 3300005435 Bacteria 2908
104 Ga0070701_10006641 3300005438 Bacteria 4882
105 Ga0070705_100000543 3300005440 Bacteria 21853
106 Ga0070700_100029124 3300005441 Bacteria 3290
107 Ga0070708_100000092 3300005445 Bacteria 59199
108 Ga0070708_101735851 3300005445 Bacteria 580
109 Ga0070663_100017076 3300005455 Bacteria 4729
110 Ga0070663_100055622 3300005455 Bacteria 2833
111 Ga0070663_100068014 3300005455 Bacteria 2585
112 Ga0070663_100071851 3300005455 Bacteria 2519
113 Ga0070663_100144915 3300005455 Bacteria 1816
114 Ga0070663_100157603 3300005455 Bacteria 1745
115 Ga0070663_100192857 3300005455 Bacteria 1586
116 Ga0070663_100433432 3300005455 Bacteria 1080
117 Ga0070663_100581671 3300005455 Bacteria 939
118 Ga0070663_100588174 3300005455 Bacteria 935
119 Ga0070678_100004288 3300005456 Bacteria 8062
120 Ga0070662_100016619 3300005457 Bacteria 4944
121 Ga0070662_100070818 3300005457 Bacteria 2569
122 Ga0070662_100079754 3300005457 Bacteria 2435
123 Ga0070681_10696654 3300005458 Bacteria 931
124 Ga0068867_100003546 3300005459 Bacteria 10969
125 Ga0070685_10000717 3300005466 Bacteria 18012
126 Ga0070685_10628372 3300005466 Bacteria 776
127 Ga0070706_100000413 3300005467 Bacteria 51554
128 Ga0070707_100001436 3300005468 Bacteria 23324
129 Ga0070698_100172452 3300005471 Bacteria 2104
130 Ga0070699_100017943 3300005518 Bacteria 6079
131 Ga0070699_100263345 3300005518 Bacteria 1542
132 Ga0070679_100014535 3300005530 Bacteria 7562
133 Ga0070679_100095276 3300005530 Bacteria 2964
134 Ga0070679_100345306 3300005530 Bacteria 1436
135 Ga0070697_100003058 3300005536 Bacteria 12828
136 Ga0068853_100000347 3300005539 Bacteria 32301
137 Ga0068853_100062920 3300005539 Bacteria 3213
138 Ga0068853_100118397 3300005539 Bacteria 2360
139 Ga0068853_100149077 3300005539 Bacteria 2104
140 Ga0068853_101399234 3300005539 Bacteria 676
141 Ga0070672_100000351 3300005543 Bacteria 26640
142 Ga0070672_100025504 3300005543 Bacteria 4385
143 Ga0070672_100026194 3300005543 Bacteria 4335
144 Ga0070672_100073362 3300005543 Bacteria 2727
145 Ga0070686_100000914 3300005544 Bacteria 17078
146 Ga0070696_100011247 3300005546 Bacteria 5992
147 Ga0070693_100131023 3300005547 Bacteria 1568
148 Ga0070665_100036491 3300005548 Bacteria 4944
149 Ga0070665_100106898 3300005548 Bacteria 2800
150 Ga0070665_100255212 3300005548 Bacteria 1754
151 Ga0070665_100300379 3300005548 Bacteria 1608
152 Ga0068855_100000527 3300005563 Bacteria 46819
153 Ga0068855_100031223 3300005563 Bacteria 6362
154 Ga0068855_100569500 3300005563 Bacteria 1224
155 Ga0070664_100008108 3300005564 Bacteria 8491
156 Ga0070664_100033941 3300005564 Bacteria 4278
157 Ga0070664_100089353 3300005564 Bacteria 2665
158 Ga0070664_100311588 3300005564 Bacteria 1424
159 Ga0070664_100420852 3300005564 Bacteria 1223
160 Ga0068857_100005689 3300005577 Bacteria 10657
161 Ga0068857_100604626 3300005577 Bacteria 1037
162 Ga0068854_100003534 3300005578 Bacteria 9764
163 Ga0068854_100007235 3300005578 Bacteria 7086
164 Ga0068854_100097678 3300005578 Bacteria 2196
165 Ga0068854_100817315 3300005578 Bacteria 813
166 Ga0068856_100022481 3300005614 Bacteria 6131
167 Ga0068856_100043909 3300005614 Bacteria 4397
168 Ga0068856_100398829 3300005614 Bacteria 1395
169 Ga0068856_100620104 3300005614 Bacteria 1102
170 Ga0068856_101018186 3300005614 Bacteria 846
171 Ga0068852_100001092 3300005616 Bacteria 17912
172 Ga0068852_100009746 3300005616 Bacteria 7141
173 Ga0068852_100248694 3300005616 Bacteria 1702
174 Ga0068852_100321706 3300005616 Bacteria 1502
175 Ga0068859_100000315 3300005617 Bacteria 48378
176 Ga0068859_100245045 3300005617 Bacteria 1882
177 Ga0068859_100259541 3300005617 Bacteria 1829
178 Ga0068859_100573114 3300005617 Bacteria 1222
179 Ga0068864_100000998 3300005618 Bacteria 23675
180 Ga0068864_100205907 3300005618 Bacteria 1809
181 Ga0068866_10000101 3300005718 Bacteria 36354
182 Ga0068861_100003544 3300005719 Bacteria 10382
183 Ga0068861_100079732 3300005719 Bacteria 2560
184 Ga0068851_10000245 3300005834 Bacteria 25653
185 Ga0068870_10000036 3300005840 Bacteria 42809
186 Ga0068870_10140267 3300005840 Bacteria 1414
187 Ga0068863_100000017 3300005841 Bacteria 207950
188 Ga0068863_100000343 3300005841 Bacteria 47460
189 Ga0068863_100239151 3300005841 Bacteria 1753
190 Ga0068863_100770775 3300005841 Bacteria 958
191 Ga0068858_100031245 3300005842 Bacteria 4944
192 Ga0068858_101911090 3300005842 Bacteria 586
193 Ga0068860_100007807 3300005843 Bacteria 10686
194 Ga0068860_100019357 3300005843 Bacteria 6604
195 Ga0068860_100028829 3300005843 Bacteria 5342
196 Ga0068862_100006359 3300005844 Bacteria 9822
197 Ga0068862_100175025 3300005844 Bacteria 1923
198 Ga0068862_100316435 3300005844 Bacteria 1439
199 Ga0068862_100318148 3300005844 Bacteria 1436
200 Ga0068862_100427983 3300005844 Bacteria 1243
201 Ga0068862_101645406 3300005844 Bacteria 649
202 Ga0081540_1000264 3300005983 Bacteria 55128
203 Ga0081540_1010957 3300005983 Bacteria 6089
204 Ga0081540_1081297 3300005983 Bacteria 1458
205 Ga0081539_10019248 3300005985 Bacteria 4683
206 Ga0081539_10064992 3300005985 Bacteria 1982
207 Ga0075366_10054394 3300006195 Bacteria 2377
208 Ga0075366_10366875 3300006195 Bacteria 885
209 Ga0097621_100000177 3300006237 Bacteria 40430
210 Ga0097621_100706364 3300006237 Bacteria 929
211 Ga0068871_100006948 3300006358 Bacteria 8062
212 Ga0075428_100469259 3300006844 Bacteria 1347
213 Ga0075430_100178807 3300006846 Bacteria 1765
214 Ga0075431_100216471 3300006847 Bacteria 1955
215 Ga0068865_100003317 3300006881 Bacteria 9639
216 Ga0097620_100000315 3300006931 Bacteria 48378
217 Ga0097620_100245036 3300006931 Bacteria 1882
218 Ga0097620_100259550 3300006931 Bacteria 1829
219 Ga0097620_100573133 3300006931 Bacteria 1222
220 Ga0099794_10000042 3300007265 Bacteria 50201
221 Ga0099794_10301772 3300007265 Bacteria 829
222 Ga0105250_10005148 3300009092 Bacteria 5902
223 Ga0105240_10001116 3300009093 Bacteria 47225
224 Ga0105240_10001604 3300009093 Bacteria 38373
225 Ga0105240_10164926 3300009093 Bacteria 2628
226 Ga0111539_10078190 3300009094 Bacteria 3893
227 Ga0111539_10215683 3300009094 Bacteria 2235
228 Ga0111539_12302850 3300009094 Bacteria 625
229 Ga0105245_10000166 3300009098 Bacteria 62554
230 Ga0105247_10001356 3300009101 Bacteria 17787
231 Ga0105243_10010544 3300009148 Bacteria 7017
232 Ga0105241_10164393 3300009174 Bacteria 1827
233 Ga0105242_10010636 3300009176 Bacteria 7064
234 Ga0105242_10661672 3300009176 Bacteria 1017
235 Ga0105248_10006569 3300009177 Bacteria 12749
236 Ga0105248_10286325 3300009177 Bacteria 1855
237 Ga0105248_10287771 3300009177 Bacteria 1850
238 Ga0105237_10001703 3300009545 Bacteria 28456
239 Ga0105237_10382351 3300009545 Bacteria 1413
240 Ga0105238_10000391 3300009551 Bacteria 46771
241 Ga0105249_10000319 3300009553 Bacteria 48708
242 Ga0105249_10388278 3300009553 Bacteria 1423
243 Ga0105249_10530039 3300009553 Bacteria 1226
244 Ga0105239_10000546 3300010375 Bacteria 53959
245 Ga0105239_10000707 3300010375 Bacteria 47294
246 Ga0105239_12287318 3300010375 Bacteria 629
247 Ga0105246_10000493 3300011119 Bacteria 21438
248 Ga0157318_1007091 3300012482 Bacteria 755
249 Ga0157373_10033566 3300013100 Bacteria 3691
250 Ga0157373_10205856 3300013100 Bacteria 1387
251 Ga0157373_10426538 3300013100 Bacteria 952
252 Ga0157371_10000492 3300013102 Bacteria 47893
253 Ga0157371_10065322 3300013102 Bacteria 2577
254 Ga0157371_10216972 3300013102 Bacteria 1373
255 Ga0157371_10757502 3300013102 Bacteria 729
256 Ga0157370_10002611 3300013104 Bacteria 21670
257 Ga0157370_10126388 3300013104 Bacteria 2386
258 Ga0157370_10354672 3300013104 Bacteria 1352
259 Ga0157370_10641543 3300013104 Bacteria 971
260 Ga0157369_10004814 3300013105 Bacteria 15850
261 Ga0157369_10005353 3300013105 Bacteria 14954
262 Ga0157369_10079508 3300013105 Bacteria 3512
263 Ga0157369_10143117 3300013105 Bacteria 2529
264 Ga0157369_10767368 3300013105 Bacteria 991
265 Ga0157369_11727003 3300013105 Bacteria 636
266 Ga0157374_10001527 3300013296 Bacteria 19489
267 Ga0157378_10000975 3300013297 Bacteria 26209
268 Ga0163162_10001548 3300013306 Bacteria 21476
269 Ga0163162_10252219 3300013306 Bacteria 1896
270 Ga0163162_10758287 3300013306 Bacteria 1089
271 Ga0163162_10967153 3300013306 Bacteria 962
272 Ga0157372_10002029 3300013307 Bacteria 22018
273 Ga0157372_10524217 3300013307 Bacteria 1381
274 Ga0157372_11532304 3300013307 Bacteria 768
275 Ga0157375_10011893 3300013308 Bacteria 7699
276 Ga0157375_10098036 3300013308 Bacteria 3007
277 Ga0157375_10307553 3300013308 Bacteria 1749
278 Ga0157375_11479591 3300013308 Bacteria 801
279 Ga0163163_10001027 3300014325 Bacteria 23654
280 Ga0163163_10212201 3300014325 Bacteria 1985
281 Ga0163163_10370914 3300014325 Bacteria 1488
282 Ga0157380_10866248 3300014326 Bacteria 926
283 Ga0157380_10868040 3300014326 Bacteria 926
284 Ga0182008_10314847 3300014497 Bacteria 822
285 Ga0157377_10000364 3300014745 Bacteria 20226
286 Ga0157377_10648577 3300014745 Bacteria 760
287 Ga0157379_10000136 3300014968 Bacteria 52716
288 Ga0157376_10000282 3300014969 Bacteria 34358
289 Ga0157376_11021398 3300014969 Bacteria 850
290 Ga0163161_10002730 3300017792 Bacteria 12551
291 Ga0163161_10003977 3300017792 Bacteria 10351
292 Ga0163161_10076147 3300017792 Bacteria 2462
293 Ga0206355_1165007 3300020076 Bacteria 722
294 Ga0206353_11488455 3300020082 Bacteria 902
295 Ga0213874_10222209 3300021377 Bacteria 687
296 Ga0213876_10327543 3300021384 Bacteria 814
297 Ga0213875_10002383 3300021388 Bacteria 11310
298 Ga0224712_10175988 3300022467 Bacteria 962
299 Ga0224712_10222221 3300022467 Bacteria 865
300 Ga0207697_10001580 3300025315 Bacteria 12319
301 Ga0207697_10001780 3300025315 Bacteria 11536
302 Ga0207697_10059998 3300025315 Bacteria 1581
303 Ga0207656_10000860 3300025321 Bacteria 9915
304 Ga0207696_1055166 3300025711 Bacteria 1128
305 Ga0207682_10000392 3300025893 Bacteria 20119
306 Ga0207642_10000451 3300025899 Bacteria 12507
307 Ga0207710_10002367 3300025900 Bacteria 8810
308 Ga0207688_10000089 3300025901 Bacteria 35353
309 Ga0207688_10444326 3300025901 Bacteria 808
310 Ga0207680_10001553 3300025903 Bacteria 10821
311 Ga0207680_10136479 3300025903 Bacteria 1622
312 Ga0207647_10000810 3300025904 Bacteria 24235
313 Ga0207647_10007301 3300025904 Bacteria 7999
314 Ga0207645_10003099 3300025907 Bacteria 12749
315 Ga0207645_10014351 3300025907 Bacteria 5302
316 Ga0207645_10058437 3300025907 Bacteria 2462
317 Ga0207643_10000030 3300025908 Bacteria 97831
318 Ga0207643_10104561 3300025908 Bacteria 1663
319 Ga0207705_10000059 3300025909 Bacteria 155683
320 Ga0207705_10003131 3300025909 Bacteria 12595
321 Ga0207705_10003572 3300025909 Bacteria 11842
322 Ga0207705_10004342 3300025909 Bacteria 10726
323 Ga0207705_10033282 3300025909 Bacteria 3681
324 Ga0207705_10038076 3300025909 Bacteria 3442
325 Ga0207705_10105375 3300025909 Bacteria 2078
326 Ga0207705_10219755 3300025909 Bacteria 1443
327 Ga0207705_10505031 3300025909 Bacteria 939
328 Ga0207705_10964867 3300025909 Bacteria 659
329 Ga0207684_10000038 3300025910 Bacteria 274884
330 Ga0207654_10004913 3300025911 Bacteria 6769
331 Ga0207707_10285101 3300025912 Bacteria 1430
332 Ga0207707_10756542 3300025912 Bacteria 812
333 Ga0207695_10000288 3300025913 Bacteria 125085
334 Ga0207671_10002141 3300025914 Bacteria 21552
335 Ga0207671_10891600 3300025914 Bacteria 703
336 Ga0207660_10361398 3300025917 Bacteria 1165
337 Ga0207662_10000128 3300025918 Bacteria 36490
338 Ga0207657_10000011 3300025919 Bacteria 186233
339 Ga0207657_10093111 3300025919 Bacteria 2510
340 Ga0207657_10110332 3300025919 Bacteria 2272
341 Ga0207657_10152200 3300025919 Bacteria 1883
342 Ga0207657_10171817 3300025919 Bacteria 1755
343 Ga0207657_10992729 3300025919 Bacteria 644
344 Ga0207649_10000785 3300025920 Bacteria 20599
345 Ga0207649_10002988 3300025920 Bacteria 9318
346 Ga0207649_10008036 3300025920 Bacteria 5743
347 Ga0207649_10030679 3300025920 Bacteria 3187
348 Ga0207649_10041499 3300025920 Bacteria 2800
349 Ga0207649_10118313 3300025920 Bacteria 1782
350 Ga0207649_10232088 3300025920 Bacteria 1320
351 Ga0207652_10010335 3300025921 Bacteria 7518
352 Ga0207646_10005592 3300025922 Bacteria 13195
353 Ga0207681_10000822 3300025923 Bacteria 20467
354 Ga0207681_10001216 3300025923 Bacteria 16580
355 Ga0207694_10004879 3300025924 Bacteria 10418
356 Ga0207650_10000283 3300025925 Bacteria 52381
357 Ga0207650_10001567 3300025925 Bacteria 16344
358 Ga0207650_10012172 3300025925 Bacteria 5931
359 Ga0207650_10109683 3300025925 Bacteria 2135
360 Ga0207650_10226356 3300025925 Bacteria 1507
361 Ga0207659_10000996 3300025926 Bacteria 16842
362 Ga0207659_10001819 3300025926 Bacteria 12629
363 Ga0207659_10002689 3300025926 Bacteria 10592
364 Ga0207687_10007010 3300025927 Bacteria 7428
365 Ga0207664_10207073 3300025929 Bacteria 1696
366 Ga0207664_10269717 3300025929 Bacteria 1491
367 Ga0207644_10000145 3300025931 Bacteria 50586
368 Ga0207644_10003525 3300025931 Bacteria 10129
369 Ga0207644_10014067 3300025931 Bacteria 5350
370 Ga0207644_10020338 3300025931 Bacteria 4513
371 Ga0207644_10111004 3300025931 Bacteria 2073
372 Ga0207644_10414884 3300025931 Bacteria 1102
373 Ga0207690_10002489 3300025932 Bacteria 11132
374 Ga0207690_10074295 3300025932 Bacteria 2354
375 Ga0207690_10171256 3300025932 Bacteria 1627
376 Ga0207690_10641089 3300025932 Bacteria 870
377 Ga0207706_10000284 3300025933 Bacteria 55240
378 Ga0207706_10000365 3300025933 Bacteria 48957
379 Ga0207706_10412643 3300025933 Bacteria 1170
380 Ga0207686_10007170 3300025934 Bacteria 6000
381 Ga0207709_10009854 3300025935 Bacteria 5259
382 Ga0207670_10000186 3300025936 Bacteria 41273
383 Ga0207669_10000920 3300025937 Bacteria 12480
384 Ga0207669_10251004 3300025937 Bacteria 1317
385 Ga0207704_10000310 3300025938 Bacteria 22888
386 Ga0207691_10000341 3300025940 Bacteria 46943
387 Ga0207691_10039696 3300025940 Bacteria 4354
388 Ga0207691_10213999 3300025940 Bacteria 1673
389 Ga0207691_10245951 3300025940 Bacteria 1545
390 Ga0207711_10003067 3300025941 Bacteria 14585
391 Ga0207711_10208422 3300025941 Bacteria 1785
392 Ga0207711_10248915 3300025941 Bacteria 1631
393 Ga0207689_10000224 3300025942 Bacteria 50152
394 Ga0207661_10005036 3300025944 Bacteria 9269
395 Ga0207661_10117474 3300025944 Bacteria 2259
396 Ga0207661_10286959 3300025944 Bacteria 1472
397 Ga0207661_10374780 3300025944 Bacteria 1287
398 Ga0207679_10000998 3300025945 Bacteria 18155
399 Ga0207679_10001466 3300025945 Bacteria 14785
400 Ga0207679_10001873 3300025945 Bacteria 13076
401 Ga0207679_10045308 3300025945 Bacteria 3180
402 Ga0207679_10570742 3300025945 Bacteria 1017
403 Ga0207667_10005271 3300025949 Bacteria 15770
404 Ga0207667_10016050 3300025949 Bacteria 8482
405 Ga0207667_10364153 3300025949 Bacteria 1474
406 Ga0207667_10364568 3300025949 Bacteria 1473
407 Ga0207651_10000056 3300025960 Bacteria 49478
408 Ga0207651_10057032 3300025960 Bacteria 2691
409 Ga0207651_10327677 3300025960 Bacteria 1282
410 Ga0207712_10003530 3300025961 Bacteria 9864
411 Ga0207712_10076049 3300025961 Bacteria 2429
412 Ga0207712_10268664 3300025961 Bacteria 1386
413 Ga0207712_10437919 3300025961 Bacteria 1106
414 Ga0207668_10000113 3300025972 Bacteria 57453
415 Ga0207668_10005099 3300025972 Bacteria 7729
416 Ga0207668_10013730 3300025972 Bacteria 4997
417 Ga0207640_10002157 3300025981 Bacteria 10574
418 Ga0207640_10140546 3300025981 Bacteria 1759
419 Ga0207658_10000630 3300025986 Bacteria 31077
420 Ga0207658_10034961 3300025986 Bacteria 3596
421 Ga0207677_10000047 3300026023 Bacteria 104149
422 Ga0207703_10002371 3300026035 Bacteria 16383
423 Ga0207703_10116922 3300026035 Bacteria 2284
424 Ga0207639_10000846 3300026041 Bacteria 20822
425 Ga0207639_10024005 3300026041 Bacteria 4407
426 Ga0207678_10017400 3300026067 Bacteria 6312
427 Ga0207678_10019901 3300026067 Bacteria 5899
428 Ga0207678_10052257 3300026067 Bacteria 3526
429 Ga0207678_10117497 3300026067 Bacteria 2269
430 Ga0207678_10244269 3300026067 Bacteria 1538
431 Ga0207678_10253914 3300026067 Bacteria 1506
432 Ga0207678_10453087 3300026067 Bacteria 1115
433 Ga0207708_10012614 3300026075 Bacteria 6302
434 Ga0207708_10443413 3300026075 Bacteria 1080
435 Ga0207702_10005139 3300026078 Bacteria 11514
436 Ga0207702_10009675 3300026078 Bacteria 8093
437 Ga0207702_10550052 3300026078 Bacteria 1129
438 Ga0207702_10836081 3300026078 Bacteria 911
439 Ga0207641_10000036 3300026088 Bacteria 213165
440 Ga0207641_10000554 3300026088 Bacteria 41888
441 Ga0207641_10234214 3300026088 Bacteria 1708
442 Ga0207641_11102734 3300026088 Bacteria 792
443 Ga0207648_10002554 3300026089 Bacteria 19510
444 Ga0207648_10085028 3300026089 Bacteria 2759
445 Ga0207676_10101097 3300026095 Bacteria 2390
446 Ga0207676_11204671 3300026095 Bacteria 750
447 Ga0207674_10021388 3300026116 Bacteria 6967
448 Ga0207674_10118260 3300026116 Bacteria 2620
449 Ga0207674_10454221 3300026116 Bacteria 1238
450 Ga0207675_100000009 3300026118 Bacteria 163023
451 Ga0207675_100112244 3300026118 Bacteria 2572
452 Ga0207683_10010789 3300026121 Bacteria 7791
453 Ga0207683_10379483 3300026121 Bacteria 1299
454 Ga0207683_10479404 3300026121 Bacteria 1148
455 Ga0207683_11431762 3300026121 Bacteria 639
456 Ga0207698_10001088 3300026142 Bacteria 15791
457 Ga0207698_10001432 3300026142 Bacteria 13858
458 Ga0207698_10001810 3300026142 Bacteria 12488
459 Ga0209969_1010017 3300027360 Bacteria 1354
460 Ga0209967_1006278 3300027364 Bacteria 1610
461 Ga0209967_1043280 3300027364 Bacteria 686
462 Ga0209981_1010911 3300027378 Bacteria 1249
463 Ga0209999_1009428 3300027543 Bacteria 1763
464 Ga0209982_1005054 3300027552 Bacteria 1901
465 Ga0209982_1010275 3300027552 Bacteria 1386
466 Ga0209970_1005223 3300027614 Bacteria 2145
467 Ga0210002_1004434 3300027617 Bacteria 2089
468 Ga0209983_1005617 3300027665 Bacteria 2588
469 Ga0209588_1000034 3300027671 Bacteria 66337
470 Ga0209971_1004089 3300027682 Bacteria 3453
471 Ga0209974_10032552 3300027876 Bacteria 1728
472 Ga0209974_10271497 3300027876 Bacteria 643
473 Ga0207428_10310576 3300027907 Bacteria 1166
474 Ga0268266_10001917 3300028379 Bacteria 23380
475 Ga0268266_10150596 3300028379 Bacteria 2096
476 Ga0268265_10003513 3300028380 Bacteria 11220
477 Ga0268265_10061666 3300028380 Bacteria 2878
478 Ga0268265_10379726 3300028380 Bacteria 1299
479 Ga0268264_10002140 3300028381 Bacteria 17627
480 Ga0268264_10177873 3300028381 Bacteria 1930
481 Ga0268264_10191863 3300028381 Bacteria 1863
482 Ga0268264_10816159 3300028381 Bacteria 932
483 Ga0307515_10176796 3300028794 Bacteria 2102
484 Ga0307408_100097685 3300031548 Bacteria 2231
485 Ga0307408_100198881 3300031548 Bacteria 1620
486 Ga0307408_100218729 3300031548 Bacteria 1553
487 Ga0307408_100225361 3300031548 Bacteria 1532
488 Ga0307408_100274685 3300031548 Bacteria 1401
489 Ga0307408_100294625 3300031548 Bacteria 1356
490 Ga0307408_100693471 3300031548 Bacteria 914
491 Ga0307408_101108518 3300031548 Bacteria 734
492 Ga0307408_101520309 3300031548 Bacteria 633
493 Ga0307405_10010430 3300031731 Bacteria 4814
494 Ga0307405_10014308 3300031731 Bacteria 4261
495 Ga0307405_10038207 3300031731 Bacteria 2891
496 Ga0307405_10039649 3300031731 Bacteria 2848
497 Ga0307405_10476058 3300031731 Bacteria 996
498 Ga0307405_10515868 3300031731 Bacteria 961
499 Ga0307405_11558112 3300031731 Bacteria 582
500 Ga0316577_10239475 3300031733 Bacteria 1026
501 Ga0307413_10006332 3300031824 Bacteria 5390
502 Ga0307413_10024262 3300031824 Bacteria 3303
503 Ga0307413_10070135 3300031824 Bacteria 2202
504 Ga0307413_10096683 3300031824 Bacteria 1939
505 Ga0307413_10105914 3300031824 Bacteria 1870
506 Ga0307413_10226492 3300031824 Bacteria 1369
507 Ga0307413_10341034 3300031824 Bacteria 1152
508 Ga0307413_10524186 3300031824 Bacteria 956
509 Ga0307413_11099498 3300031824 Bacteria 686
510 Ga0307413_11453804 3300031824 Bacteria 604
511 Ga0307410_10035633 3300031852 Bacteria 3233
512 Ga0307410_10085846 3300031852 Bacteria 2222
513 Ga0307410_10092287 3300031852 Bacteria 2152
514 Ga0307410_10149458 3300031852 Bacteria 1737
515 Ga0307410_10360228 3300031852 Bacteria 1164
516 Ga0307410_10742363 3300031852 Bacteria 830
517 Ga0307410_10898703 3300031852 Bacteria 758
518 Ga0307410_10942661 3300031852 Bacteria 741
519 Ga0307410_11228590 3300031852 Bacteria 653
520 Ga0307406_10018877 3300031901 Bacteria 4037
521 Ga0307406_10106389 3300031901 Bacteria 1921
522 Ga0307406_10270114 3300031901 Bacteria 1291
523 Ga0307406_10385588 3300031901 Bacteria 1106
524 Ga0307406_10512498 3300031901 Bacteria 974
525 Ga0307407_10008290 3300031903 Bacteria 4761
526 Ga0307407_10054383 3300031903 Bacteria 2308
527 Ga0307407_10209795 3300031903 Bacteria 1310
528 Ga0307407_10255786 3300031903 Bacteria 1202
529 Ga0307407_10282249 3300031903 Bacteria 1151
530 Ga0307407_10538346 3300031903 Bacteria 861
531 Ga0307407_10661387 3300031903 Bacteria 783
532 Ga0307407_11152616 3300031903 Bacteria 604
533 Ga0307412_10007362 3300031911 Bacteria 6241
534 Ga0307412_10024915 3300031911 Bacteria 3699
535 Ga0307412_10047521 3300031911 Bacteria 2819
536 Ga0307412_10142115 3300031911 Bacteria 1759
537 Ga0307412_10198056 3300031911 Bacteria 1523
538 Ga0307412_10601221 3300031911 Bacteria 931
539 Ga0307409_100042387 3300031995 Bacteria 3408
540 Ga0307409_100044176 3300031995 Bacteria 3353
541 Ga0307409_100138621 3300031995 Bacteria 2092
542 Ga0307409_100161836 3300031995 Bacteria 1958
543 Ga0307409_100384380 3300031995 Bacteria 1335
544 Ga0307409_100426352 3300031995 Bacteria 1274
545 Ga0307409_100587913 3300031995 Bacteria 1098
546 Ga0307409_101095529 3300031995 Bacteria 817
547 Ga0307409_101126900 3300031995 Bacteria 806
548 Ga0307409_101420291 3300031995 Bacteria 720
549 Ga0307409_101432398 3300031995 Bacteria 717
550 Ga0307416_100017376 3300032002 Bacteria 5032
551 Ga0307416_100103134 3300032002 Bacteria 2489
552 Ga0307416_100133760 3300032002 Bacteria 2238
553 Ga0307416_100178428 3300032002 Bacteria 1987
554 Ga0307416_100343654 3300032002 Bacteria 1506
555 Ga0307416_100471105 3300032002 Bacteria 1313
556 Ga0307416_100485507 3300032002 Bacteria 1296
557 Ga0307416_100498231 3300032002 Bacteria 1282
558 Ga0307414_10014366 3300032004 Bacteria 4746
559 Ga0307414_10022834 3300032004 Bacteria 3955
560 Ga0307414_10027901 3300032004 Bacteria 3654
561 Ga0307414_10138309 3300032004 Bacteria 1902
562 Ga0307414_10172272 3300032004 Bacteria 1731
563 Ga0307414_10421947 3300032004 Bacteria 1163
564 Ga0307414_10456784 3300032004 Bacteria 1121
565 Ga0307414_10612811 3300032004 Bacteria 977
566 Ga0307414_10621065 3300032004 Bacteria 971
567 Ga0307414_10638721 3300032004 Bacteria 958
568 Ga0307414_10676678 3300032004 Bacteria 932
569 Ga0307414_11414137 3300032004 Bacteria 646
570 Ga0307414_11518428 3300032004 Bacteria 623
571 Ga0307411_10023406 3300032005 Bacteria 3658
572 Ga0307411_10055263 3300032005 Bacteria 2611
573 Ga0307411_10055647 3300032005 Bacteria 2603
574 Ga0307411_10068393 3300032005 Bacteria 2393
575 Ga0307411_10293357 3300032005 Bacteria 1300
576 Ga0307411_10329685 3300032005 Bacteria 1236
577 Ga0307411_10429526 3300032005 Bacteria 1099
578 Ga0307411_10527412 3300032005 Bacteria 1003
579 Ga0307411_10586327 3300032005 Bacteria 956
580 Ga0307411_10896837 3300032005 Bacteria 787
581 Ga0307411_11130811 3300032005 Bacteria 707
582 Ga0307415_100446031 3300032126 Bacteria 1117
583 Ga0307415_100507582 3300032126 Bacteria 1055
584 Ga0307415_100590687 3300032126 Bacteria 986
585 Ga0307415_100777509 3300032126 Bacteria 872
586 Ga0307415_101558562 3300032126 Bacteria 633
587 Ga0373941_0083366 3300035115 Bacteria 1084
588 Ga0373931_0085326 3300035691 Bacteria 1750
589 Ga0373935_0058812 3300035692 Bacteria 2456
590 Ga0373927_1014949 3300035695 Bacteria 547
591 Ga0373925_0116542 3300037068 Bacteria 2069
592 Ga0395899_0001865 3300037312 Bacteria 17421
593 Ga0395899_0003333 3300037312 Bacteria 12734
594 Ga0395899_0022136 3300037312 Bacteria 4819
595 Ga0395899_0262892 3300037312 Bacteria 1179
596 Ga0395900_0001624 3300037418 Bacteria 26427
597 Ga0395900_0001654 3300037418 Bacteria 26100
598 Ga0395900_0013701 3300037418 Bacteria 8277
599 Ga0395900_0095779 3300037418 Bacteria 3049
600 Ga0395900_0162564 3300037418 Bacteria 2276
601 Ga0395900_0318078 3300037418 Bacteria 1537
602 Ga0395900_0713559 3300037418 Bacteria 935
603 Ga0395900_0717186 3300037418 Bacteria 932
604 Ga0395900_0719741 3300037418 Bacteria 930
605 Ga0395898_0002949 3300037466 Bacteria 19348
606 Ga0395898_0004457 3300037466 Bacteria 15305
607 Ga0395898_0022781 3300037466 Bacteria 6338
608 Ga0395898_0083183 3300037466 Bacteria 3085
609 Ga0395898_0100183 3300037466 Bacteria 2782
610 Ga0395898_0508534 3300037466 Bacteria 1145
611 Ga0395905_0001805 3300037471 Bacteria 24778
612 Ga0395905_0003172 3300037471 Bacteria 17706
613 Ga0395905_0065628 3300037471 Bacteria 3398
614 Ga0395905_0478449 3300037471 Bacteria 1144
615 Ga0395905_0650416 3300037471 Bacteria 956
616 Ga0436364_0191800 3300037853 Bacteria 21312
617 Ga0395901_0000936 3300038443 Bacteria 31749
618 Ga0395901_0005009 3300038443 Bacteria 13375
619 Ga0395901_0014323 3300038443 Bacteria 8075
620 Ga0395901_0023480 3300038443 Bacteria 6323
621 Ga0395901_0161871 3300038443 Bacteria 2350
622 Ga0436365_1601760 3300039437 Bacteria 1556
623 Ga0436363_0009593 3300039450 Bacteria 1246
624 Ga0436363_0382645 3300039450 Bacteria 808
625 Ga0436363_0582477 3300039450 Bacteria 1337
626 Ga0436362_0450971 3300039453 Bacteria 915
627 Ga0439465_0038660 3300041413 Bacteria 1538
628 Ga0439448_0007010 3300042005 Bacteria 3253
629 Ga0439432_068569 3300042006 Bacteria 1084
630 Ga0439449_0066491 3300042007 Bacteria 1330
631 Ga0439449_0224759 3300042007 Bacteria 704
632 Ga0439455_0002496 3300042012 Bacteria 3355
633 Ga0439458_0081197 3300042157 Bacteria 827
634 Ga0439464_0029369 3300042439 Bacteria 1536
635 Ga0450893_0031521 3300042532 Bacteria 946
636 Ga0451577_0133226 3300042876 Bacteria 2230
637 Ga0466969_0035413 3300044656 Bacteria 2524
638 Ga0466969_0058717 3300044656 Bacteria 1872
639 Ga0466969_0148825 3300044656 Bacteria 1079
640 Ga0466972_0162712 3300044658 Bacteria 1048
641 Ga0466965_0130318 3300044683 Bacteria 1304
642 Ga0466966_0000003 3300044684 Bacteria 233677
643 Ga0466966_0002392 3300044684 Bacteria 12260
644 Ga0466966_0017916 3300044684 Bacteria 4676
645 Ga0466966_0183670 3300044684 Bacteria 1268
646 Ga0466961_0022784 3300044693 Bacteria 4028
647 Ga0466963_0020178 3300044694 Bacteria 4189
648 Ga0466963_0342691 3300044694 Bacteria 1052
649 Ga0466963_0508565 3300044694 Bacteria 850
650 Ga0453684_0829572 3300044712 Bacteria 995
651 Ga0466971_0105025 3300044719 Bacteria 1300
652 Ga0466971_0151312 3300044719 Bacteria 1083
653 Ga0466970_0010888 3300044765 Bacteria 4626
654 Ga0466957_0007229 3300044842 Bacteria 6275
655 Ga0466957_0115022 3300044842 Bacteria 1710
656 Ga0466957_0165203 3300044842 Bacteria 1439
657 Ga0466957_0298144 3300044842 Bacteria 1082
658 Ga0466959_0013556 3300045049 Bacteria 5908
659 Ga0466959_0026808 3300045049 Bacteria 4274
660 Ga0466959_0173460 3300045049 Bacteria 1511
661 Ga0466959_0245174 3300045049 Bacteria 1236
662 Ga0466959_0349096 3300045049 Bacteria 1009
663 Ga0451576_0179428 3300045051 Bacteria 2211
664 Ga0466958_0033868 3300045836 Bacteria 3045
665 Ga0466958_0100194 3300045836 Bacteria 1800
666 Ga0466958_0333509 3300045836 Bacteria 975
667 Ga0466958_0546692 3300045836 Bacteria 752
668 Ga0466958_0614538 3300045836 Bacteria 707
669 Ga0466967_0027054 3300045976 Bacteria 4764
670 Ga0466967_0283325 3300045976 Bacteria 1590
671 Ga0495580_0085407 3300046472 Bacteria 2198
672 Ga0495639_0402897 3300046475 Bacteria 691
673 Ga0495585_0111771 3300046492 Bacteria 1452
674 Ga0495596_0030500 3300046500 Bacteria 2158
675 Ga0495583_0181166 3300046506 Bacteria 862
676 Ga0495606_0086055 3300046507 Bacteria 1943
677 Ga0495644_0317631 3300046523 Bacteria 611
678 Ga0495663_0005671 3300046525 Bacteria 3456
679 Ga0495598_0011293 3300046537 Bacteria 2161
680 Ga0495621_0011525 3300046539 Bacteria 2738
681 Ga0495633_0006943 3300046558 Bacteria 6620
682 Ga0495668_0057240 3300046616 Bacteria 2151
683 Ga0495625_0141925 3300046660 Bacteria 1620
684 Ga0495659_0009325 3300046664 Bacteria 3130
685 Ga0495659_0107089 3300046664 Bacteria 1088
686 Ga0495659_0155216 3300046664 Bacteria 921
687 Ga0495658_0016370 3300046683 Bacteria 3817
688 Ga0495669_0034415 3300046684 Bacteria 2233
689 Ga0495669_0053699 3300046684 Bacteria 1812
690 Ga0495669_0141348 3300046684 Bacteria 1136
691 Ga0495669_0142607 3300046684 Bacteria 1131
692 Ga0495670_0063490 3300046691 Bacteria 1859
693 Ga0495670_0129768 3300046691 Bacteria 1313
694 Ga0495670_0227894 3300046691 Bacteria 990
695 Ga0495670_0344608 3300046691 Bacteria 801
696 Ga0495670_0361866 3300046691 Bacteria 781
697 Ga0495670_0467892 3300046691 Bacteria 683
698 Ga0495671_0193704 3300046692 Bacteria 987
699 Ga0495636_0019475 3300047318 Bacteria 2728
700 Ga0495636_0034606 3300047318 Bacteria 2080
701 Ga0495636_0393259 3300047318 Bacteria 659
702 Ga0495677_0014591 3300047445 Bacteria 2858
703 Ga0495677_0063411 3300047445 Bacteria 1372
704 Ga0495615_0034620 3300048090 Bacteria 1230
705 Ga0495615_0035961 3300048090 Bacteria 1213
706 Ga0495615_0051695 3300048090 Bacteria 1060
707 Ga0496100_0047644 3300048903 Bacteria 2763
708 Ga0496100_0070208 3300048903 Bacteria 2335
709 Ga0496100_0330596 3300048903 Bacteria 1147
710 Ga0496100_0347406 3300048903 Bacteria 1120
711 Ga0496101_0023969 3300048904 Bacteria 4220
712 Ga0496102_0003907 3300048905 Bacteria 12623
713 Ga0496103_0045168 3300048906 Bacteria 2718
714 Ga0496106_0004746 3300048909 Bacteria 10054
715 Ga0496106_0165714 3300048909 Bacteria 1749
716 Ga0496107_0017261 3300048910 Bacteria 5076
717 Ga0496107_0017654 3300048910 Bacteria 5019
718 Ga0496108_0147895 3300048911 Bacteria 2026
719 Ga0496108_0196169 3300048911 Bacteria 1751
720 Ga0496109_0102330 3300048912 Bacteria 2658
721 Ga0496109_0115705 3300048912 Bacteria 2495
722 Ga0496109_0806961 3300048912 Bacteria 876
723 Ga0496110_0008894 3300048913 Bacteria 8095
724 Ga0496110_0207381 3300048913 Bacteria 1781
725 Ga0496111_0122201 3300048914 Bacteria 1923
726 Ga0496111_0122641 3300048914 Bacteria 1920
727 Ga0496112_0002572 3300048915 Bacteria 14656
728 Ga0496113_0072771 3300048916 Bacteria 2617
729 Ga0496113_0329783 3300048916 Bacteria 1224
730 Ga0496114_0011923 3300048917 Bacteria 6955
731 Ga0496114_0051679 3300048917 Bacteria 3422
732 Ga0496115_0041463 3300048918 Bacteria 3664
733 Ga0496115_0240259 3300048918 Bacteria 1493
734 Ga0496121_0169882 3300048924 Bacteria 1585
735 Ga0496126_0350550 3300048929 Bacteria 1207
736 Ga0501309_011144 3300049129 Bacteria 1168
737 Ga0501309_037966 3300049129 Bacteria 729
738 Ga0501305_010576 3300049161 Bacteria 1234
739 Ga0501307_023487 3300049162 Bacteria 817
740 Ga0501311_005502 3300049527 Bacteria 1391
741 Ga0501313_038186 3300049529 Bacteria 640
742 Ga0501315_004455 3300049531 Bacteria 1466
743 Ga0501316_002728 3300049532 Bacteria 1658
744 Ga0501317_008979 3300049533 Bacteria 1164
745 Ga0501318_000817 3300049534 Bacteria 2176
746 Ga0501321_001351 3300049537 Bacteria 1927
747 Ga0501321_010935 3300049537 Bacteria 1004
748 Ga0501323_001069 3300049539 Bacteria 2305
749 Ga0501323_035775 3300049539 Bacteria 713
750 Ga0501324_002615 3300049540 Bacteria 1317
751 Ga0501336_002157 3300049552 Bacteria 1247
752 Ga0501034_0425193 3300049571 Bacteria 1249
753 Ga0501036_0199491 3300049572 Bacteria 1683
754 Ga0501209_076416 3300049656 Bacteria 960
755 Ga0501217_008391 3300049661 Bacteria 2231
756 Ga0501217_009914 3300049661 Bacteria 2080
757 Ga0501223_028643 3300049663 Bacteria 1084
758 Ga0501227_053392 3300049665 Bacteria 1024
759 Ga0501233_039549 3300049668 Bacteria 1103
760 Ga0501235_069953 3300049669 Bacteria 830
761 Ga0501242_038909 3300049674 Bacteria 667
762 Ga0501243_018964 3300049675 Bacteria 1125
763 Ga0501249_016640 3300049679 Bacteria 1580
764 Ga0501249_046817 3300049679 Bacteria 989
765 Ga0501249_134604 3300049679 Bacteria 612
766 Ga0501258_007630 3300049687 Bacteria 1097
767 Ga0501260_017184 3300049689 Bacteria 764
768 Ga0501221_023165 3300049704 Bacteria 1236
769 Ga0501221_023828 3300049704 Bacteria 1224
770 Ga0501225_0006407 3300049705 Bacteria 3435
771 Ga0501079_0538530 3300049741 Bacteria 918
772 Ga0501232_009484 3300049757 Bacteria 1076
773 Ga0501262_009686 3300049759 Bacteria 1195
774 Ga0501263_046542 3300049760 Bacteria 650
775 Ga0501263_069915 3300049760 Bacteria 565
776 Ga0501267_007295 3300049764 Bacteria 1074
777 Ga0501267_027407 3300049764 Bacteria 657
778 Ga0501268_014058 3300049765 Bacteria 1300
779 Ga0501272_002892 3300049769 Bacteria 1720
780 Ga0501035_0000637 3300049822 Bacteria 38663
781 Ga0501044_0351732 3300049823 Bacteria 1393
782 nmdc:mga0k408_23588_c1 3300050493 Bacteria 3473
783 nmdc:mga08y16_709643_c1 3300050511 Bacteria 1005
784 Ga0500643_000004 3300053087 Bacteria 857484
785 Ga0466962_0011886 3300061719 Bacteria 4191
786 Ga0466962_0122401 3300061719 Bacteria 1255
787 Ga0466962_0216230 3300061719 Bacteria 938
788 Ga0530510_0560726 3300061734 Bacteria 868
789 2643948847 2643221588 Bacteria 3692460
790 2882808213 2882806704 Bacteria 3007728
791 2885427585 2885427238 Bacteria 2291351
792 Ga0157327_1031428
793 JGI24741J21665_1006520
794 JGI24752J21851_1004884
795 JGI24740J21852_10010818
796 JGI24740J21852_10018734
797 JGI24737J22298_10034385
798 JGI24737J22298_10046990
799 JGI24743J22301_10000178
800 JGI24749J21850_1000439
801 JGI24744J21845_10009478
802 JGI24035J26624_1004802
803 JGI24034J26672_10000592
804 JGI24742J22300_10025233
805 JGI24751J29686_10005113
806 JGI25406J46586_10064507
807 JGI25404J52841_10001145
808 Ga0055537_1003606
809 Ga0065704_10278062
810 Ga0065712_10457988
811 Ga0065715_10000098
812 Ga0065715_10117061
813 Ga0070658_10001004
814 Ga0070658_10132527
815 Ga0070658_10223389
816 Ga0070658_10378900
817 Ga0070658_10552614
818 Ga0070658_10950177
819 Ga0070658_11401525
820 Ga0070676_10000510
821 Ga0070676_10010202
822 Ga0070683_100141134
823 Ga0070683_100149576
824 Ga0070683_100212970
825 Ga0070683_100311267
826 Ga0070683_100371257
827 Ga0070690_100000366
828 Ga0070670_100003103
829 Ga0070670_100067246
830 Ga0070670_100233027
831 Ga0070670_100352805
832 Ga0070670_100626732
833 Ga0070677_10000441
834 Ga0068869_100001184
835 Ga0070666_10002375
836 Ga0070666_10099061
837 Ga0070680_100057831
838 Ga0070680_100098228
839 Ga0070682_100106826
840 Ga0068868_100002098
841 Ga0068868_100839213
842 Ga0068868_101119623
843 Ga0070660_100011537
844 Ga0070660_100058924
845 Ga0070660_100060217
846 Ga0070660_100067200
847 Ga0070660_100601361
848 Ga0070689_100001862
849 Ga0070691_10041885
850 Ga0070687_100000205
851 Ga0070687_100225814
852 Ga0070661_100025547
853 Ga0070661_100040240
854 Ga0070661_100061205
855 Ga0070661_100089385
856 Ga0070661_100128861
857 Ga0070661_100370975
858 Ga0070661_100485140
859 Ga0070692_10043576
860 Ga0070668_100000831
861 Ga0070668_100001206
862 Ga0070668_100078113
863 Ga0070668_100327285
864 Ga0070669_100004586
865 Ga0070669_100014400
866 Ga0070669_101410076
867 Ga0070675_100002314
868 Ga0070675_100065186
869 Ga0070675_100108237
870 Ga0070675_100357794
871 Ga0070675_100650967
872 Ga0070671_100005888
873 Ga0070671_100010810
874 Ga0070671_100024172
875 Ga0070671_100025309
876 Ga0070671_100100447
877 Ga0070671_100195832
878 Ga0070674_100000202
879 Ga0070674_100073643
880 Ga0070673_100008582
881 Ga0070673_100689283
882 Ga0070688_100000519
883 Ga0070659_100000088
884 Ga0070659_100005923
885 Ga0070659_100105721
886 Ga0070659_100130169
887 Ga0070659_100220436
888 Ga0070659_100832802
889 Ga0070667_100003853
890 Ga0070667_100050290
891 Ga0070667_100096520
892 Ga0070667_100119238
893 Ga0070667_100224380
894 Ga0070714_100076407
895 Ga0070701_10006641
896 Ga0070705_100000543
897 Ga0070700_100029124
898 Ga0070708_100000092
899 Ga0070708_101735851
900 Ga0070663_100017076
901 Ga0070663_100055622
902 Ga0070663_100068014
903 Ga0070663_100071851
904 Ga0070663_100144915
905 Ga0070663_100157603
906 Ga0070663_100192857
907 Ga0070663_100433432
908 Ga0070663_100581671
909 Ga0070663_100588174
910 Ga0070678_100004288
911 Ga0070662_100016619
912 Ga0070662_100070818
913 Ga0070662_100079754
914 Ga0070681_10696654
915 Ga0068867_100003546
916 Ga0070685_10000717
917 Ga0070685_10628372
918 Ga0070706_100000413
919 Ga0070707_100001436
920 Ga0070698_100172452
921 Ga0070699_100017943
922 Ga0070699_100263345
923 Ga0070679_100014535
924 Ga0070679_100095276
925 Ga0070679_100345306
926 Ga0070697_100003058
927 Ga0068853_100000347
928 Ga0068853_100062920
929 Ga0068853_100118397
930 Ga0068853_100149077
931 Ga0068853_101399234
932 Ga0070672_100000351
933 Ga0070672_100025504
934 Ga0070672_100026194
935 Ga0070672_100073362
936 Ga0070686_100000914
937 Ga0070696_100011247
938 Ga0070693_100131023
939 Ga0070665_100036491
940 Ga0070665_100106898
941 Ga0070665_100255212
942 Ga0070665_100300379
943 Ga0068855_100000527
944 Ga0068855_100031223
945 Ga0068855_100569500
946 Ga0070664_100008108
947 Ga0070664_100033941
948 Ga0070664_100089353
949 Ga0070664_100311588
950 Ga0070664_100420852
951 Ga0068857_100005689
952 Ga0068857_100604626
953 Ga0068854_100003534
954 Ga0068854_100007235
955 Ga0068854_100097678
956 Ga0068854_100817315
957 Ga0068856_100022481
958 Ga0068856_100043909
959 Ga0068856_100398829
960 Ga0068856_100620104
961 Ga0068856_101018186
962 Ga0068852_100001092
963 Ga0068852_100009746
964 Ga0068852_100248694
965 Ga0068852_100321706
966 Ga0068859_100000315
967 Ga0068859_100245045
968 Ga0068859_100259541
969 Ga0068859_100573114
970 Ga0068864_100000998
971 Ga0068864_100205907
972 Ga0068866_10000101
973 Ga0068861_100003544
974 Ga0068861_100079732
975 Ga0068851_10000245
976 Ga0068870_10000036
977 Ga0068870_10140267
978 Ga0068863_100000017
979 Ga0068863_100000343
980 Ga0068863_100239151
981 Ga0068863_100770775
982 Ga0068858_100031245
983 Ga0068858_101911090
984 Ga0068860_100007807
985 Ga0068860_100019357
986 Ga0068860_100028829
987 Ga0068862_100006359
988 Ga0068862_100175025
989 Ga0068862_100316435
990 Ga0068862_100318148
991 Ga0068862_100427983
992 Ga0068862_101645406
993 Ga0081540_1000264
994 Ga0081540_1010957
995 Ga0081540_1081297
996 Ga0081539_10019248
997 Ga0081539_10064992
998 Ga0075366_10054394
999 Ga0075366_10366875
1000 Ga0097621_100000177
1001 Ga0097621_100706364
1002 Ga0068871_100006948
1003 Ga0075428_100469259
1004 Ga0075430_100178807
1005 Ga0075431_100216471
1006 Ga0068865_100003317
1007 Ga0097620_100000315
1008 Ga0097620_100245036
1009 Ga0097620_100259550
1010 Ga0097620_100573133
1011 Ga0099794_10000042
1012 Ga0099794_10301772
1013 Ga0105250_10005148
1014 Ga0105240_10001116
1015 Ga0105240_10001604
1016 Ga0105240_10164926
1017 Ga0111539_10078190
1018 Ga0111539_10215683
1019 Ga0111539_12302850
1020 Ga0105245_10000166
1021 Ga0105247_10001356
1022 Ga0105243_10010544
1023 Ga0105241_10164393
1024 Ga0105242_10010636
1025 Ga0105242_10661672
1026 Ga0105248_10006569
1027 Ga0105248_10286325
1028 Ga0105248_10287771
1029 Ga0105237_10001703
1030 Ga0105237_10382351
1031 Ga0105238_10000391
1032 Ga0105249_10000319
1033 Ga0105249_10388278
1034 Ga0105249_10530039
1035 Ga0105239_10000546
1036 Ga0105239_10000707
1037 Ga0105239_12287318
1038 Ga0105246_10000493
1039 Ga0157318_1007091
1040 Ga0157373_10033566
1041 Ga0157373_10205856
1042 Ga0157373_10426538
1043 Ga0157371_10000492
1044 Ga0157371_10065322
1045 Ga0157371_10216972
1046 Ga0157371_10757502
1047 Ga0157370_10002611
1048 Ga0157370_10126388
1049 Ga0157370_10354672
1050 Ga0157370_10641543
1051 Ga0157369_10004814
1052 Ga0157369_10005353
1053 Ga0157369_10079508
1054 Ga0157369_10143117
1055 Ga0157369_10767368
1056 Ga0157369_11727003
1057 Ga0157374_10001527
1058 Ga0157378_10000975
1059 Ga0163162_10001548
1060 Ga0163162_10252219
1061 Ga0163162_10758287
1062 Ga0163162_10967153
1063 Ga0157372_10002029
1064 Ga0157372_10524217
1065 Ga0157372_11532304
1066 Ga0157375_10011893
1067 Ga0157375_10098036
1068 Ga0157375_10307553
1069 Ga0157375_11479591
1070 Ga0163163_10001027
1071 Ga0163163_10212201
1072 Ga0163163_10370914
1073 Ga0157380_10866248
1074 Ga0157380_10868040
1075 Ga0182008_10314847
1076 Ga0157377_10000364
1077 Ga0157377_10648577
1078 Ga0157379_10000136
1079 Ga0157376_10000282
1080 Ga0157376_11021398
1081 Ga0163161_10002730
1082 Ga0163161_10003977
1083 Ga0163161_10076147
1084 Ga0206355_1165007
1085 Ga0206353_11488455
1086 Ga0213874_10222209
1087 Ga0213876_10327543
1088 Ga0213875_10002383
1089 Ga0224712_10175988
1090 Ga0224712_10222221
1091 Ga0207697_10001580
1092 Ga0207697_10001780
1093 Ga0207697_10059998
1094 Ga0207656_10000860
1095 Ga0207696_1055166
1096 Ga0207682_10000392
1097 Ga0207642_10000451
1098 Ga0207710_10002367
1099 Ga0207688_10000089
1100 Ga0207688_10444326
1101 Ga0207680_10001553
1102 Ga0207680_10136479
1103 Ga0207647_10000810
1104 Ga0207647_10007301
1105 Ga0207645_10003099
1106 Ga0207645_10014351
1107 Ga0207645_10058437
1108 Ga0207643_10000030
1109 Ga0207643_10104561
1110 Ga0207705_10000059
1111 Ga0207705_10003131
1112 Ga0207705_10003572
1113 Ga0207705_10004342
1114 Ga0207705_10033282
1115 Ga0207705_10038076
1116 Ga0207705_10105375
1117 Ga0207705_10219755
1118 Ga0207705_10505031
1119 Ga0207705_10964867
1120 Ga0207684_10000038
1121 Ga0207654_10004913
1122 Ga0207707_10285101
1123 Ga0207707_10756542
1124 Ga0207695_10000288
1125 Ga0207671_10002141
1126 Ga0207671_10891600
1127 Ga0207660_10361398
1128 Ga0207662_10000128
1129 Ga0207657_10000011
1130 Ga0207657_10093111
1131 Ga0207657_10110332
1132 Ga0207657_10152200
1133 Ga0207657_10171817
1134 Ga0207657_10992729
1135 Ga0207649_10000785
1136 Ga0207649_10002988
1137 Ga0207649_10008036
1138 Ga0207649_10030679
1139 Ga0207649_10041499
1140 Ga0207649_10118313
1141 Ga0207649_10232088
1142 Ga0207652_10010335
1143 Ga0207646_10005592
1144 Ga0207681_10000822
1145 Ga0207681_10001216
1146 Ga0207694_10004879
1147 Ga0207650_10000283
1148 Ga0207650_10001567
1149 Ga0207650_10012172
1150 Ga0207650_10109683
1151 Ga0207650_10226356
1152 Ga0207659_10000996
1153 Ga0207659_10001819
1154 Ga0207659_10002689
1155 Ga0207687_10007010
1156 Ga0207664_10207073
1157 Ga0207664_10269717
1158 Ga0207644_10000145
1159 Ga0207644_10003525
1160 Ga0207644_10014067
1161 Ga0207644_10020338
1162 Ga0207644_10111004
1163 Ga0207644_10414884
1164 Ga0207690_10002489
1165 Ga0207690_10074295
1166 Ga0207690_10171256
1167 Ga0207690_10641089
1168 Ga0207706_10000284
1169 Ga0207706_10000365
1170 Ga0207706_10412643
1171 Ga0207686_10007170
1172 Ga0207709_10009854
1173 Ga0207670_10000186
1174 Ga0207669_10000920
1175 Ga0207669_10251004
1176 Ga0207704_10000310
1177 Ga0207691_10000341
1178 Ga0207691_10039696
1179 Ga0207691_10213999
1180 Ga0207691_10245951
1181 Ga0207711_10003067
1182 Ga0207711_10208422
1183 Ga0207711_10248915
1184 Ga0207689_10000224
1185 Ga0207661_10005036
1186 Ga0207661_10117474
1187 Ga0207661_10286959
1188 Ga0207661_10374780
1189 Ga0207679_10000998
1190 Ga0207679_10001466
1191 Ga0207679_10001873
1192 Ga0207679_10045308
1193 Ga0207679_10570742
1194 Ga0207667_10005271
1195 Ga0207667_10016050
1196 Ga0207667_10364153
1197 Ga0207667_10364568
1198 Ga0207651_10000056
1199 Ga0207651_10057032
1200 Ga0207651_10327677
1201 Ga0207712_10003530
1202 Ga0207712_10076049
1203 Ga0207712_10268664
1204 Ga0207712_10437919
1205 Ga0207668_10000113
1206 Ga0207668_10005099
1207 Ga0207668_10013730
1208 Ga0207640_10002157
1209 Ga0207640_10140546
1210 Ga0207658_10000630
1211 Ga0207658_10034961
1212 Ga0207677_10000047
1213 Ga0207703_10002371
1214 Ga0207703_10116922
1215 Ga0207639_10000846
1216 Ga0207639_10024005
1217 Ga0207678_10017400
1218 Ga0207678_10019901
1219 Ga0207678_10052257
1220 Ga0207678_10117497
1221 Ga0207678_10244269
1222 Ga0207678_10253914
1223 Ga0207678_10453087
1224 Ga0207708_10012614
1225 Ga0207708_10443413
1226 Ga0207702_10005139
1227 Ga0207702_10009675
1228 Ga0207702_10550052
1229 Ga0207702_10836081
1230 Ga0207641_10000036
1231 Ga0207641_10000554
1232 Ga0207641_10234214
1233 Ga0207641_11102734
1234 Ga0207648_10002554
1235 Ga0207648_10085028
1236 Ga0207676_10101097
1237 Ga0207676_11204671
1238 Ga0207674_10021388
1239 Ga0207674_10118260
1240 Ga0207674_10454221
1241 Ga0207675_100000009
1242 Ga0207675_100112244
1243 Ga0207683_10010789
1244 Ga0207683_10379483
1245 Ga0207683_10479404
1246 Ga0207683_11431762
1247 Ga0207698_10001088
1248 Ga0207698_10001432
1249 Ga0207698_10001810
1250 Ga0209969_1010017
1251 Ga0209967_1006278
1252 Ga0209967_1043280
1253 Ga0209981_1010911
1254 Ga0209999_1009428
1255 Ga0209982_1005054
1256 Ga0209982_1010275
1257 Ga0209970_1005223
1258 Ga0210002_1004434
1259 Ga0209983_1005617
1260 Ga0209588_1000034
1261 Ga0209971_1004089
1262 Ga0209974_10032552
1263 Ga0209974_10271497
1264 Ga0207428_10310576
1265 Ga0268266_10001917
1266 Ga0268266_10150596
1267 Ga0268265_10003513
1268 Ga0268265_10061666
1269 Ga0268265_10379726
1270 Ga0268264_10002140
1271 Ga0268264_10177873
1272 Ga0268264_10191863
1273 Ga0268264_10816159
1274 Ga0307515_10176796
1275 Ga0307408_100097685
1276 Ga0307408_100198881
1277 Ga0307408_100218729
1278 Ga0307408_100225361
1279 Ga0307408_100274685
1280 Ga0307408_100294625
1281 Ga0307408_100693471
1282 Ga0307408_101108518
1283 Ga0307408_101520309
1284 Ga0307405_10010430
1285 Ga0307405_10014308
1286 Ga0307405_10038207
1287 Ga0307405_10039649
1288 Ga0307405_10476058
1289 Ga0307405_10515868
1290 Ga0307405_11558112
1291 Ga0316577_10239475
1292 Ga0307413_10006332
1293 Ga0307413_10024262
1294 Ga0307413_10070135
1295 Ga0307413_10096683
1296 Ga0307413_10105914
1297 Ga0307413_10226492
1298 Ga0307413_10341034
1299 Ga0307413_10524186
1300 Ga0307413_11099498
1301 Ga0307413_11453804
1302 Ga0307410_10035633
1303 Ga0307410_10085846
1304 Ga0307410_10092287
1305 Ga0307410_10149458
1306 Ga0307410_10360228
1307 Ga0307410_10742363
1308 Ga0307410_10898703
1309 Ga0307410_10942661
1310 Ga0307410_11228590
1311 Ga0307406_10018877
1312 Ga0307406_10106389
1313 Ga0307406_10270114
1314 Ga0307406_10385588
1315 Ga0307406_10512498
1316 Ga0307407_10008290
1317 Ga0307407_10054383
1318 Ga0307407_10209795
1319 Ga0307407_10255786
1320 Ga0307407_10282249
1321 Ga0307407_10538346
1322 Ga0307407_10661387
1323 Ga0307407_11152616
1324 Ga0307412_10007362
1325 Ga0307412_10024915
1326 Ga0307412_10047521
1327 Ga0307412_10142115
1328 Ga0307412_10198056
1329 Ga0307412_10601221
1330 Ga0307409_100042387
1331 Ga0307409_100044176
1332 Ga0307409_100138621
1333 Ga0307409_100161836
1334 Ga0307409_100384380
1335 Ga0307409_100426352
1336 Ga0307409_100587913
1337 Ga0307409_101095529
1338 Ga0307409_101126900
1339 Ga0307409_101420291
1340 Ga0307409_101432398
1341 Ga0307416_100017376
1342 Ga0307416_100103134
1343 Ga0307416_100133760
1344 Ga0307416_100178428
1345 Ga0307416_100343654
1346 Ga0307416_100471105
1347 Ga0307416_100485507
1348 Ga0307416_100498231
1349 Ga0307414_10014366
1350 Ga0307414_10022834
1351 Ga0307414_10027901
1352 Ga0307414_10138309
1353 Ga0307414_10172272
1354 Ga0307414_10421947
1355 Ga0307414_10456784
1356 Ga0307414_10612811
1357 Ga0307414_10621065
1358 Ga0307414_10638721
1359 Ga0307414_10676678
1360 Ga0307414_11414137
1361 Ga0307414_11518428
1362 Ga0307411_10023406
1363 Ga0307411_10055263
1364 Ga0307411_10055647
1365 Ga0307411_10068393
1366 Ga0307411_10293357
1367 Ga0307411_10329685
1368 Ga0307411_10429526
1369 Ga0307411_10527412
1370 Ga0307411_10586327
1371 Ga0307411_10896837
1372 Ga0307411_11130811
1373 Ga0307415_100446031
1374 Ga0307415_100507582
1375 Ga0307415_100590687
1376 Ga0307415_100777509
1377 Ga0307415_101558562
1378 Ga0373941_0083366
1379 Ga0373931_0085326
1380 Ga0373935_0058812
1381 Ga0373927_1014949
1382 Ga0373925_0116542
1383 Ga0395899_0001865
1384 Ga0395899_0003333
1385 Ga0395899_0022136
1386 Ga0395899_0262892
1387 Ga0395900_0001624
1388 Ga0395900_0001654
1389 Ga0395900_0013701
1390 Ga0395900_0095779
1391 Ga0395900_0162564
1392 Ga0395900_0318078
1393 Ga0395900_0713559
1394 Ga0395900_0717186
1395 Ga0395900_0719741
1396 Ga0395898_0002949
1397 Ga0395898_0004457
1398 Ga0395898_0022781
1399 Ga0395898_0083183
1400 Ga0395898_0100183
1401 Ga0395898_0508534
1402 Ga0395905_0001805
1403 Ga0395905_0003172
1404 Ga0395905_0065628
1405 Ga0395905_0478449
1406 Ga0395905_0650416
1407 Ga0436364_0191800
1408 Ga0395901_0000936
1409 Ga0395901_0005009
1410 Ga0395901_0014323
1411 Ga0395901_0023480
1412 Ga0395901_0161871
1413 Ga0436365_1601760
1414 Ga0436363_0009593
1415 Ga0436363_0382645
1416 Ga0436363_0582477
1417 Ga0436362_0450971
1418 Ga0439465_0038660
1419 Ga0439448_0007010
1420 Ga0439432_068569
1421 Ga0439449_0066491
1422 Ga0439449_0224759
1423 Ga0439455_0002496
1424 Ga0439458_0081197
1425 Ga0439464_0029369
1426 Ga0450893_0031521
1427 Ga0451577_0133226
1428 Ga0466969_0035413
1429 Ga0466969_0058717
1430 Ga0466969_0148825
1431 Ga0466972_0162712
1432 Ga0466965_0130318
1433 Ga0466966_0000003
1434 Ga0466966_0002392
1435 Ga0466966_0017916
1436 Ga0466966_0183670
1437 Ga0466961_0022784
1438 Ga0466963_0020178
1439 Ga0466963_0342691
1440 Ga0466963_0508565
1441 Ga0453684_0829572
1442 Ga0466971_0105025
1443 Ga0466971_0151312
1444 Ga0466970_0010888
1445 Ga0466957_0007229
1446 Ga0466957_0115022
1447 Ga0466957_0165203
1448 Ga0466957_0298144
1449 Ga0466959_0013556
1450 Ga0466959_0026808
1451 Ga0466959_0173460
1452 Ga0466959_0245174
1453 Ga0466959_0349096
1454 Ga0451576_0179428
1455 Ga0466958_0033868
1456 Ga0466958_0100194
1457 Ga0466958_0333509
1458 Ga0466958_0546692
1459 Ga0466958_0614538
1460 Ga0466967_0027054
1461 Ga0466967_0283325
1462 Ga0495580_0085407
1463 Ga0495639_0402897
1464 Ga0495585_0111771
1465 Ga0495596_0030500
1466 Ga0495583_0181166
1467 Ga0495606_0086055
1468 Ga0495644_0317631
1469 Ga0495663_0005671
1470 Ga0495598_0011293
1471 Ga0495621_0011525
1472 Ga0495633_0006943
1473 Ga0495668_0057240
1474 Ga0495625_0141925
1475 Ga0495659_0009325
1476 Ga0495659_0107089
1477 Ga0495659_0155216
1478 Ga0495658_0016370
1479 Ga0495669_0034415
1480 Ga0495669_0053699
1481 Ga0495669_0141348
1482 Ga0495669_0142607
1483 Ga0495670_0063490
1484 Ga0495670_0129768
1485 Ga0495670_0227894
1486 Ga0495670_0344608
1487 Ga0495670_0361866
1488 Ga0495670_0467892
1489 Ga0495671_0193704
1490 Ga0495636_0019475
1491 Ga0495636_0034606
1492 Ga0495636_0393259
1493 Ga0495677_0014591
1494 Ga0495677_0063411
1495 Ga0495615_0034620
1496 Ga0495615_0035961
1497 Ga0495615_0051695
1498 Ga0496100_0047644
1499 Ga0496100_0070208
1500 Ga0496100_0330596
1501 Ga0496100_0347406
1502 Ga0496101_0023969
1503 Ga0496102_0003907
1504 Ga0496103_0045168
1505 Ga0496106_0004746
1506 Ga0496106_0165714
1507 Ga0496107_0017261
1508 Ga0496107_0017654
1509 Ga0496108_0147895
1510 Ga0496108_0196169
1511 Ga0496109_0102330
1512 Ga0496109_0115705
1513 Ga0496109_0806961
1514 Ga0496110_0008894
1515 Ga0496110_0207381
1516 Ga0496111_0122201
1517 Ga0496111_0122641
1518 Ga0496112_0002572
1519 Ga0496113_0072771
1520 Ga0496113_0329783
1521 Ga0496114_0011923
1522 Ga0496114_0051679
1523 Ga0496115_0041463
1524 Ga0496115_0240259
1525 Ga0496121_0169882
1526 Ga0496126_0350550
1527 Ga0501309_011144
1528 Ga0501309_037966
1529 Ga0501305_010576
1530 Ga0501307_023487
1531 Ga0501311_005502
1532 Ga0501313_038186
1533 Ga0501315_004455
1534 Ga0501316_002728
1535 Ga0501317_008979
1536 Ga0501318_000817
1537 Ga0501321_001351
1538 Ga0501321_010935
1539 Ga0501323_001069
1540 Ga0501323_035775
1541 Ga0501324_002615
1542 Ga0501336_002157
1543 Ga0501034_0425193
1544 Ga0501036_0199491
1545 Ga0501209_076416
1546 Ga0501217_008391
1547 Ga0501217_009914
1548 Ga0501223_028643
1549 Ga0501227_053392
1550 Ga0501233_039549
1551 Ga0501235_069953
1552 Ga0501242_038909
1553 Ga0501243_018964
1554 Ga0501249_016640
1555 Ga0501249_046817
1556 Ga0501249_134604
1557 Ga0501258_007630
1558 Ga0501260_017184
1559 Ga0501221_023165
1560 Ga0501221_023828
1561 Ga0501225_0006407
1562 Ga0501079_0538530
1563 Ga0501232_009484
1564 Ga0501262_009686
1565 Ga0501263_046542
1566 Ga0501263_069915
1567 Ga0501267_007295
1568 Ga0501267_027407
1569 Ga0501268_014058
1570 Ga0501272_002892
1571 Ga0501035_0000637
1572 Ga0501044_0351732
1573 nmdc:mga0k408_23588_c1
1574 nmdc:mga08y16_709643_c1
1575 Ga0500643_000004
1576 Ga0466962_0011886
1577 Ga0466962_0122401
1578 Ga0466962_0216230
1579 Ga0530510_0560726
1580 2643948847
1581 2882808213
1582 2885427585

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

91

166

0.97

PF00347

Ribosomal_L6

Ribosomal protein L6

11

83

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fn2-assembly1.cif.gz_H the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9638 1 173
7nhn-assembly1.cif.gz_K vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9545 9 174
5li0-assembly1.cif.gz_H 70s ribosome from staphylococcus aureus 0.9542 9 172
7nhn-assembly1.cif.gz_K vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9489 9 174
6yef-assembly1.cif.gz_H 70s initiation complex with assigned rrna modifications from staphylococcus aureus 0.9463 9 170
ID Description Score Start End Superfamily
3knmH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9391 84 169 3.90.930.12
af_Q25814_82_167_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9339 84 165 3.90.930.12
af_Q09865_118_210_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9334 84 176 3.90.930.12
4g5lH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9326 84 171 3.90.930.12
af_Q6AU10_7_103_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9309 87 178 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A2J6L7U4-F1-model_v4 deleted 0.9929 83 165
AF-A0A2J1D431-F1-model_v4 deleted 0.9905 75 169
AF-A0A1V4GKA1-F1-model_v4 deleted 0.9891 77 147
AF-A0A6A5L2Q1-F1-model_v4 deleted 0.9884 7 170
AF-A0A4P9I807-F1-model_v4 50S ribosomal protein L6 0.9861 9 150 GO:0002181
GO:0003735
GO:0019843
GO:0022625

Map