F480982
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 791 | 451 | 1582 | 210 |
Family's Representative Sequence
| Representative Sequence | 3300014969|Ga0157376_10300847|Ga0157376_103008472 |
| Length | 236 |
| Sequence | MACSPRARPAVPEERRHADNRAMSTLHHIANRTRRLPPLRVGVGGPVGSGKTTLVEMLCKAMRERYDLVVVTNDIYTKEDQRLLTVAGALEAERIMGVETGGCPHTAIREDASINLEAVDRMLEKFPNADIVFIESGGDNLAATFSPELSDLTIYVIDVAAGEKIPRKGGPGITKSDLFVINKTDLAPYVGANLDVMAADTKRMRGARPFVMSNLKTHDGLADVVKFIETKGMLVS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 7 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 69 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 70 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 71 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 84 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 99 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 115 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 116 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 117 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 120 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 121 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 122 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 186 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 192 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 194 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 195 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 197 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 198 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 199 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 200 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 201 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 202 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 205 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 206 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 207 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 208 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 209 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 211 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 212 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 213 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 216 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 218 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 219 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 220 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 221 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 222 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 223 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 224 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 225 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 226 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 231 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 236 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 237 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 240 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 241 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 242 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 245 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 246 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 247 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 248 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 249 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 250 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 251 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 252 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 253 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 254 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 255 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 256 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 257 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 263 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 264 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 265 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 266 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 267 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 268 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 269 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 270 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 271 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 272 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 273 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 274 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 275 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 276 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 277 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 278 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 279 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 324 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 325 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 326 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 328 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 329 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 330 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 331 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 332 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 333 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 334 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 335 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 336 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 337 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 338 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 339 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 352 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 355 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 356 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 357 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 358 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 359 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 368 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 371 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 374 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 375 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 376 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 377 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 378 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 379 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 380 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 381 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 382 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 383 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 384 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 385 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 386 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 387 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 388 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 389 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 391 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 392 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 393 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 394 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 395 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 396 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 397 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 398 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 399 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 400 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 401 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 402 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 403 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 404 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 405 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 406 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 407 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 408 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 409 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 410 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 411 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 412 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 413 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 414 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 415 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 416 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 417 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 418 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 419 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 420 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 421 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 422 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 423 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 424 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 425 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 426 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 427 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 428 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 429 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 430 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 431 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 432 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 433 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 434 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 435 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 436 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 437 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 438 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 439 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 440 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 441 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 442 | 8001522603 | Methylomicrobium sp. RS1 | Isolate | Unclassified |
| 443 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 444 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 445 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 446 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 447 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 448 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 449 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 450 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 451 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.29 |
| Metatranscriptomes | 0 |
| Isolates | 7.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.73 |
| Nodule | 1.64 |
| Rhizoplane | 3.03 |
| Rhizosphere | 65.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157376_10300847 | 3300014969 | Bacteria | 1518 |
| 2 | SwRhRL2b_contig_2783974 | 2162886007 | Bacteria | 2010 |
| 3 | JGI24735J21928_10019472 | 3300002067 | Bacteria | 2086 |
| 4 | JGI25153J46596_10012485 | 3300003215 | Bacteria | 3661 |
| 5 | JGI25160J50197_1001200 | 3300003354 | Bacteria | 13170 |
| 6 | JGI26145J50221_1007868 | 3300003371 | Bacteria | 910 |
| 7 | Ga0055539_1000240 | 3300003752 | Bacteria | 36494 |
| 8 | Ga0055533_1000103 | 3300003756 | Bacteria | 107860 |
| 9 | Ga0055525_1000928 | 3300003759 | Bacteria | 8265 |
| 10 | Ga0055526_1003050 | 3300003771 | Bacteria | 10883 |
| 11 | Ga0055530_10012719 | 3300003791 | Bacteria | 2916 |
| 12 | Ga0055530_10051163 | 3300003791 | Bacteria | 959 |
| 13 | Ga0055531_10000390 | 3300003794 | Bacteria | 42387 |
| 14 | Ga0058692_1002816 | 3300003856 | Bacteria | 5707 |
| 15 | Ga0065165_1000791 | 3300005262 | Bacteria | 42372 |
| 16 | Ga0065165_1001455 | 3300005262 | Bacteria | 25574 |
| 17 | Ga0065704_10002058 | 3300005289 | Bacteria | 11509 |
| 18 | Ga0065704_10077807 | 3300005289 | Bacteria | 4614 |
| 19 | Ga0070658_10224317 | 3300005327 | Bacteria | 1590 |
| 20 | Ga0070658_10271096 | 3300005327 | Bacteria | 1443 |
| 21 | Ga0070676_10008197 | 3300005328 | Bacteria | 5623 |
| 22 | Ga0070683_100022610 | 3300005329 | Bacteria | 5622 |
| 23 | Ga0070690_100166308 | 3300005330 | Bacteria | 1515 |
| 24 | Ga0070670_100024111 | 3300005331 | Bacteria | 5234 |
| 25 | Ga0070670_100090066 | 3300005331 | Bacteria | 2637 |
| 26 | Ga0070677_10025585 | 3300005333 | Bacteria | 2204 |
| 27 | Ga0070677_10060999 | 3300005333 | Bacteria | 1556 |
| 28 | Ga0068869_100656979 | 3300005334 | Bacteria | 890 |
| 29 | Ga0070682_100002901 | 3300005337 | Bacteria | 9515 |
| 30 | Ga0070689_100010287 | 3300005340 | Bacteria | 6668 |
| 31 | Ga0070689_100040016 | 3300005340 | Bacteria | 3592 |
| 32 | Ga0070661_100017322 | 3300005344 | Bacteria | 5110 |
| 33 | Ga0070692_10139728 | 3300005345 | Bacteria | 1370 |
| 34 | Ga0070668_100611455 | 3300005347 | Bacteria | 954 |
| 35 | Ga0070669_100143237 | 3300005353 | Bacteria | 1844 |
| 36 | Ga0070675_100020118 | 3300005354 | Bacteria | 5326 |
| 37 | Ga0070675_100030521 | 3300005354 | Bacteria | 4352 |
| 38 | Ga0070675_100066853 | 3300005354 | Bacteria | 2973 |
| 39 | Ga0070671_100014561 | 3300005355 | Bacteria | 6360 |
| 40 | Ga0070671_100039548 | 3300005355 | Bacteria | 3914 |
| 41 | Ga0070671_100059923 | 3300005355 | Bacteria | 3168 |
| 42 | Ga0070674_100009918 | 3300005356 | Bacteria | 5733 |
| 43 | Ga0070674_100367341 | 3300005356 | Bacteria | 1167 |
| 44 | Ga0070674_100437539 | 3300005356 | Bacteria | 1077 |
| 45 | Ga0070673_100006916 | 3300005364 | Bacteria | 7420 |
| 46 | Ga0070673_100197786 | 3300005364 | Bacteria | 1730 |
| 47 | Ga0070688_100319448 | 3300005365 | Bacteria | 1128 |
| 48 | Ga0070688_100406353 | 3300005365 | Bacteria | 1009 |
| 49 | Ga0070659_100026425 | 3300005366 | Bacteria | 4468 |
| 50 | Ga0070659_100657921 | 3300005366 | Bacteria | 904 |
| 51 | Ga0070667_100005361 | 3300005367 | Bacteria | 10710 |
| 52 | Ga0070667_100343716 | 3300005367 | Bacteria | 1350 |
| 53 | Ga0070667_100923990 | 3300005367 | Bacteria | 813 |
| 54 | Ga0070709_10433646 | 3300005434 | Bacteria | 987 |
| 55 | Ga0070714_100175896 | 3300005435 | Bacteria | 1945 |
| 56 | Ga0070714_100493235 | 3300005435 | Bacteria | 1167 |
| 57 | Ga0070714_100991413 | 3300005435 | Bacteria | 817 |
| 58 | Ga0070711_100062131 | 3300005439 | Bacteria | 2603 |
| 59 | Ga0070708_100161995 | 3300005445 | Bacteria | 2085 |
| 60 | Ga0070663_100006550 | 3300005455 | Bacteria | 7017 |
| 61 | Ga0070663_100206784 | 3300005455 | Bacteria | 1535 |
| 62 | Ga0070678_100591590 | 3300005456 | Bacteria | 989 |
| 63 | Ga0070662_100282844 | 3300005457 | Bacteria | 1343 |
| 64 | Ga0070681_10041779 | 3300005458 | Bacteria | 4597 |
| 65 | Ga0070681_10121927 | 3300005458 | Bacteria | 2541 |
| 66 | Ga0070681_10220109 | 3300005458 | Bacteria | 1813 |
| 67 | Ga0068867_100004166 | 3300005459 | Bacteria | 10173 |
| 68 | Ga0068867_100877485 | 3300005459 | Bacteria | 806 |
| 69 | Ga0070706_100032893 | 3300005467 | Bacteria | 4784 |
| 70 | Ga0070707_100059206 | 3300005468 | Bacteria | 3674 |
| 71 | Ga0070707_100153192 | 3300005468 | Bacteria | 2245 |
| 72 | Ga0070698_100040887 | 3300005471 | Bacteria | 4762 |
| 73 | Ga0070698_100321592 | 3300005471 | Bacteria | 1478 |
| 74 | Ga0070679_100214268 | 3300005530 | Bacteria | 1889 |
| 75 | Ga0070679_100287627 | 3300005530 | Bacteria | 1595 |
| 76 | Ga0070684_100021897 | 3300005535 | Bacteria | 5324 |
| 77 | Ga0070684_100681333 | 3300005535 | Bacteria | 958 |
| 78 | Ga0070697_100188949 | 3300005536 | Bacteria | 1748 |
| 79 | Ga0068853_100095434 | 3300005539 | Bacteria | 2622 |
| 80 | Ga0068853_100216637 | 3300005539 | Bacteria | 1747 |
| 81 | Ga0070672_100001714 | 3300005543 | Bacteria | 13688 |
| 82 | Ga0070672_100222147 | 3300005543 | Bacteria | 1585 |
| 83 | Ga0070672_100248109 | 3300005543 | Bacteria | 1499 |
| 84 | Ga0070672_100323332 | 3300005543 | Bacteria | 1311 |
| 85 | Ga0070665_100001160 | 3300005548 | Bacteria | 32371 |
| 86 | Ga0070665_100116464 | 3300005548 | Bacteria | 2675 |
| 87 | Ga0070665_100547140 | 3300005548 | Bacteria | 1170 |
| 88 | Ga0068855_100355520 | 3300005563 | Bacteria | 1613 |
| 89 | Ga0068855_100395977 | 3300005563 | Bacteria | 1514 |
| 90 | Ga0068857_100000005 | 3300005577 | Bacteria | 170248 |
| 91 | Ga0068857_100076664 | 3300005577 | Bacteria | 2982 |
| 92 | Ga0068854_100093824 | 3300005578 | Bacteria | 2238 |
| 93 | Ga0068854_100219094 | 3300005578 | Bacteria | 1505 |
| 94 | Ga0068856_100008321 | 3300005614 | Bacteria | 10107 |
| 95 | Ga0068852_100742228 | 3300005616 | Bacteria | 993 |
| 96 | Ga0068859_100024837 | 3300005617 | Bacteria | 6015 |
| 97 | Ga0068859_100649608 | 3300005617 | Bacteria | 1147 |
| 98 | Ga0068870_10259450 | 3300005840 | Bacteria | 1081 |
| 99 | Ga0068863_100214953 | 3300005841 | Bacteria | 1852 |
| 100 | Ga0068858_100004350 | 3300005842 | Bacteria | 13897 |
| 101 | Ga0068860_100239700 | 3300005843 | Bacteria | 1764 |
| 102 | Ga0081455_10000723 | 3300005937 | Bacteria | 42827 |
| 103 | Ga0081455_10051537 | 3300005937 | Bacteria | 3530 |
| 104 | Ga0081455_10276508 | 3300005937 | Bacteria | 1215 |
| 105 | Ga0081538_10033312 | 3300005981 | Bacteria | 3432 |
| 106 | Ga0070716_100101169 | 3300006173 | Bacteria | 1767 |
| 107 | Ga0070712_100029765 | 3300006175 | Bacteria | 3663 |
| 108 | Ga0070712_100166724 | 3300006175 | Bacteria | 1706 |
| 109 | Ga0075362_10011088 | 3300006177 | Bacteria | 3542 |
| 110 | Ga0075362_10011491 | 3300006177 | Bacteria | 3489 |
| 111 | Ga0075362_10171481 | 3300006177 | Bacteria | 1048 |
| 112 | Ga0075369_10000532 | 3300006186 | Bacteria | 12019 |
| 113 | Ga0075366_10006382 | 3300006195 | Bacteria | 6459 |
| 114 | Ga0075366_10014006 | 3300006195 | Bacteria | 4574 |
| 115 | Ga0075366_10193263 | 3300006195 | Bacteria | 1237 |
| 116 | Ga0075366_10195147 | 3300006195 | Bacteria | 1231 |
| 117 | Ga0075366_10222599 | 3300006195 | Bacteria | 1150 |
| 118 | Ga0075370_10002042 | 3300006353 | Bacteria | 9165 |
| 119 | Ga0075370_10096345 | 3300006353 | Bacteria | 1710 |
| 120 | Ga0075370_10129531 | 3300006353 | Bacteria | 1472 |
| 121 | Ga0068871_100089638 | 3300006358 | Bacteria | 2560 |
| 122 | Ga0075428_100140266 | 3300006844 | Bacteria | 2628 |
| 123 | Ga0075430_100037022 | 3300006846 | Bacteria | 4136 |
| 124 | Ga0075431_100098152 | 3300006847 | Bacteria | 3024 |
| 125 | Ga0075434_100468682 | 3300006871 | Bacteria | 1281 |
| 126 | Ga0075429_100002479 | 3300006880 | Bacteria | 15530 |
| 127 | Ga0075429_100368044 | 3300006880 | Bacteria | 1259 |
| 128 | Ga0068865_100059814 | 3300006881 | Bacteria | 2666 |
| 129 | Ga0075436_100169485 | 3300006914 | Bacteria | 1542 |
| 130 | Ga0097620_100024837 | 3300006931 | Bacteria | 6015 |
| 131 | Ga0097620_100649518 | 3300006931 | Bacteria | 1147 |
| 132 | Ga0097620_100912251 | 3300006931 | Bacteria | 963 |
| 133 | Ga0079104_1001696 | 3300006946 | Bacteria | 14094 |
| 134 | Ga0079104_1003541 | 3300006946 | Bacteria | 7185 |
| 135 | Ga0079104_1012559 | 3300006946 | Bacteria | 2654 |
| 136 | Ga0075435_100040874 | 3300007076 | Bacteria | 3705 |
| 137 | Ga0099795_10004776 | 3300007788 | Bacteria | 3532 |
| 138 | Ga0105251_10009864 | 3300009011 | Bacteria | 5596 |
| 139 | Ga0105251_10370928 | 3300009011 | Bacteria | 655 |
| 140 | Ga0105244_10041712 | 3300009036 | Bacteria | 2377 |
| 141 | Ga0105244_10044643 | 3300009036 | Bacteria | 2282 |
| 142 | Ga0105250_10000475 | 3300009092 | Bacteria | 28364 |
| 143 | Ga0105240_10105653 | 3300009093 | Bacteria | 3418 |
| 144 | Ga0105240_10153993 | 3300009093 | Bacteria | 2736 |
| 145 | Ga0105240_10175619 | 3300009093 | Bacteria | 2532 |
| 146 | Ga0105240_10450333 | 3300009093 | Bacteria | 1441 |
| 147 | Ga0111539_10246411 | 3300009094 | Bacteria | 2080 |
| 148 | Ga0105247_10180550 | 3300009101 | Bacteria | 1408 |
| 149 | Ga0114129_10452475 | 3300009147 | Bacteria | 1684 |
| 150 | Ga0105243_10127919 | 3300009148 | Bacteria | 2151 |
| 151 | Ga0105243_10165154 | 3300009148 | Bacteria | 1912 |
| 152 | Ga0105243_10590152 | 3300009148 | Bacteria | 1068 |
| 153 | Ga0105241_10561534 | 3300009174 | Bacteria | 1026 |
| 154 | Ga0105242_10455296 | 3300009176 | Bacteria | 1207 |
| 155 | Ga0105248_10000445 | 3300009177 | Bacteria | 46980 |
| 156 | Ga0105248_10076019 | 3300009177 | Bacteria | 3775 |
| 157 | Ga0105248_10144214 | 3300009177 | Bacteria | 2687 |
| 158 | Ga0105248_11203223 | 3300009177 | Bacteria | 857 |
| 159 | Ga0105237_10023936 | 3300009545 | Bacteria | 6250 |
| 160 | Ga0105237_10142234 | 3300009545 | Bacteria | 2393 |
| 161 | Ga0105237_11210506 | 3300009545 | Bacteria | 762 |
| 162 | Ga0105238_10164944 | 3300009551 | Bacteria | 2191 |
| 163 | Ga0105238_10334315 | 3300009551 | Bacteria | 1502 |
| 164 | Ga0105249_10677986 | 3300009553 | Bacteria | 1090 |
| 165 | Ga0105249_10727191 | 3300009553 | Bacteria | 1054 |
| 166 | Ga0105147_100451 | 3300009982 | Bacteria | 3415 |
| 167 | Ga0099796_10004450 | 3300010159 | Bacteria | 3390 |
| 168 | Ga0099796_10028260 | 3300010159 | Bacteria | 1799 |
| 169 | Ga0099796_10075849 | 3300010159 | Bacteria | 1223 |
| 170 | Ga0105239_10010809 | 3300010375 | Bacteria | 10197 |
| 171 | Ga0105239_10242080 | 3300010375 | Bacteria | 2025 |
| 172 | Ga0157373_10258816 | 3300013100 | Bacteria | 1231 |
| 173 | Ga0157371_10032095 | 3300013102 | Bacteria | 3780 |
| 174 | Ga0157371_10083223 | 3300013102 | Bacteria | 2266 |
| 175 | Ga0157371_10202180 | 3300013102 | Bacteria | 1424 |
| 176 | Ga0157370_10008752 | 3300013104 | Bacteria | 10884 |
| 177 | Ga0157370_10011595 | 3300013104 | Bacteria | 9202 |
| 178 | Ga0157370_10079648 | 3300013104 | Bacteria | 3085 |
| 179 | Ga0157370_10636769 | 3300013104 | Bacteria | 975 |
| 180 | Ga0157369_10025847 | 3300013105 | Bacteria | 6513 |
| 181 | Ga0157369_10082380 | 3300013105 | Bacteria | 3442 |
| 182 | Ga0157374_10044716 | 3300013296 | Bacteria | 4093 |
| 183 | Ga0157378_10936206 | 3300013297 | Bacteria | 898 |
| 184 | Ga0163162_10012108 | 3300013306 | Bacteria | 8417 |
| 185 | Ga0163162_10172537 | 3300013306 | Bacteria | 2287 |
| 186 | Ga0157372_11316155 | 3300013307 | Bacteria | 834 |
| 187 | Ga0157375_10016277 | 3300013308 | Bacteria | 6673 |
| 188 | Ga0163163_10469135 | 3300014325 | Bacteria | 1319 |
| 189 | Ga0157379_10003329 | 3300014968 | Bacteria | 13618 |
| 190 | Ga0182007_10019443 | 3300015262 | Bacteria | 2441 |
| 191 | Ga0182005_1144793 | 3300015265 | Bacteria | 688 |
| 192 | Ga0183366_1002 | 3300015679 | Bacteria | 791639 |
| 193 | Ga0183370_1002 | 3300015680 | Bacteria | 791639 |
| 194 | Ga0183369_1002 | 3300015685 | Bacteria | 791621 |
| 195 | Ga0183368_1005 | 3300015687 | Bacteria | 791621 |
| 196 | Ga0163161_10332874 | 3300017792 | Bacteria | 1203 |
| 197 | Ga0213872_10000093 | 3300021361 | Bacteria | 83513 |
| 198 | Ga0213872_10000490 | 3300021361 | Bacteria | 31612 |
| 199 | Ga0213872_10035775 | 3300021361 | Bacteria | 2270 |
| 200 | Ga0213875_10036528 | 3300021388 | Bacteria | 2317 |
| 201 | Ga0228598_1001530 | 3300024227 | Bacteria | 5068 |
| 202 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 203 | Ga0209672_104934 | 3300025228 | Bacteria | 2371 |
| 204 | Ga0209563_100141 | 3300025230 | Bacteria | 79513 |
| 205 | Ga0209677_100068 | 3300025253 | Bacteria | 146135 |
| 206 | Ga0209759_1000423 | 3300025256 | Bacteria | 51547 |
| 207 | Ga0209673_1008860 | 3300025273 | Bacteria | 4430 |
| 208 | Ga0209676_1000049 | 3300025292 | Bacteria | 403210 |
| 209 | Ga0209758_1000126 | 3300025297 | Bacteria | 189761 |
| 210 | Ga0209050_1000118 | 3300025298 | Bacteria | 202586 |
| 211 | Ga0209050_1002175 | 3300025298 | Bacteria | 17709 |
| 212 | Ga0209050_1007206 | 3300025298 | Bacteria | 6314 |
| 213 | Ga0207426_1006988 | 3300025302 | Bacteria | 4795 |
| 214 | Ga0209051_1012520 | 3300025303 | Bacteria | 4098 |
| 215 | Ga0209051_1028849 | 3300025303 | Bacteria | 2183 |
| 216 | Ga0209257_1000017 | 3300025304 | Bacteria | 866287 |
| 217 | Ga0209257_1081915 | 3300025304 | Bacteria | 826 |
| 218 | Ga0207696_1000102 | 3300025711 | Bacteria | 167962 |
| 219 | Ga0207655_1000050 | 3300025728 | Bacteria | 294923 |
| 220 | Ga0207713_1003234 | 3300025735 | Bacteria | 11245 |
| 221 | Ga0207713_1007592 | 3300025735 | Bacteria | 6363 |
| 222 | Ga0207713_1010008 | 3300025735 | Bacteria | 5289 |
| 223 | Ga0207713_1034261 | 3300025735 | Bacteria | 2208 |
| 224 | Ga0207713_1037724 | 3300025735 | Bacteria | 2058 |
| 225 | Ga0207713_1062235 | 3300025735 | Bacteria | 1416 |
| 226 | Ga0207682_10046815 | 3300025893 | Bacteria | 1778 |
| 227 | Ga0207682_10059042 | 3300025893 | Bacteria | 1602 |
| 228 | Ga0207692_10025699 | 3300025898 | Bacteria | 2754 |
| 229 | Ga0207688_10037219 | 3300025901 | Bacteria | 2698 |
| 230 | Ga0207688_10076491 | 3300025901 | Bacteria | 1906 |
| 231 | Ga0207647_10000214 | 3300025904 | Bacteria | 47271 |
| 232 | Ga0207699_10169778 | 3300025906 | Bacteria | 1459 |
| 233 | Ga0207699_10417052 | 3300025906 | Bacteria | 958 |
| 234 | Ga0207645_10003842 | 3300025907 | Bacteria | 11246 |
| 235 | Ga0207645_10008045 | 3300025907 | Bacteria | 7397 |
| 236 | Ga0207705_10298720 | 3300025909 | Bacteria | 1235 |
| 237 | Ga0207684_10367423 | 3300025910 | Bacteria | 1238 |
| 238 | Ga0207707_10045648 | 3300025912 | Bacteria | 3818 |
| 239 | Ga0207707_10323779 | 3300025912 | Bacteria | 1330 |
| 240 | Ga0207695_10295074 | 3300025913 | Bacteria | 1513 |
| 241 | Ga0207695_10748603 | 3300025913 | Bacteria | 857 |
| 242 | Ga0207693_10048621 | 3300025915 | Bacteria | 3330 |
| 243 | Ga0207693_10071974 | 3300025915 | Bacteria | 2706 |
| 244 | Ga0207693_10133085 | 3300025915 | Bacteria | 1954 |
| 245 | Ga0207663_10226097 | 3300025916 | Bacteria | 1364 |
| 246 | Ga0207660_10173914 | 3300025917 | Bacteria | 1668 |
| 247 | Ga0207657_10006963 | 3300025919 | Bacteria | 11647 |
| 248 | Ga0207657_10141589 | 3300025919 | Bacteria | 1965 |
| 249 | Ga0207649_10136089 | 3300025920 | Bacteria | 1675 |
| 250 | Ga0207652_10175672 | 3300025921 | Bacteria | 1923 |
| 251 | Ga0207694_10145346 | 3300025924 | Bacteria | 1909 |
| 252 | Ga0207650_10017828 | 3300025925 | Bacteria | 4974 |
| 253 | Ga0207650_10294106 | 3300025925 | Bacteria | 1325 |
| 254 | Ga0207659_10045359 | 3300025926 | Bacteria | 3099 |
| 255 | Ga0207659_10155103 | 3300025926 | Bacteria | 1792 |
| 256 | Ga0207687_10263955 | 3300025927 | Bacteria | 1374 |
| 257 | Ga0207687_10356245 | 3300025927 | Bacteria | 1193 |
| 258 | Ga0207700_10124520 | 3300025928 | Bacteria | 2095 |
| 259 | Ga0207700_10558911 | 3300025928 | Bacteria | 1016 |
| 260 | Ga0207664_10089110 | 3300025929 | Bacteria | 2526 |
| 261 | Ga0207664_10239628 | 3300025929 | Bacteria | 1579 |
| 262 | Ga0207644_10033227 | 3300025931 | Bacteria | 3603 |
| 263 | Ga0207644_10036754 | 3300025931 | Bacteria | 3440 |
| 264 | Ga0207644_10060190 | 3300025931 | Bacteria | 2748 |
| 265 | Ga0207690_10004649 | 3300025932 | Bacteria | 8119 |
| 266 | Ga0207690_10022726 | 3300025932 | Bacteria | 3905 |
| 267 | Ga0207690_10248754 | 3300025932 | Bacteria | 1372 |
| 268 | Ga0207690_10364671 | 3300025932 | Bacteria | 1145 |
| 269 | Ga0207706_10066449 | 3300025933 | Bacteria | 3173 |
| 270 | Ga0207706_10285918 | 3300025933 | Bacteria | 1438 |
| 271 | Ga0207709_10023791 | 3300025935 | Bacteria | 3490 |
| 272 | Ga0207709_10093838 | 3300025935 | Bacteria | 1968 |
| 273 | Ga0207670_10010092 | 3300025936 | Bacteria | 5422 |
| 274 | Ga0207670_10089062 | 3300025936 | Bacteria | 2178 |
| 275 | Ga0207670_10155224 | 3300025936 | Bacteria | 1703 |
| 276 | Ga0207669_10034282 | 3300025937 | Bacteria | 2875 |
| 277 | Ga0207669_10603336 | 3300025937 | Bacteria | 892 |
| 278 | Ga0207669_10695154 | 3300025937 | Bacteria | 835 |
| 279 | Ga0207704_10050758 | 3300025938 | Bacteria | 2504 |
| 280 | Ga0207691_10012265 | 3300025940 | Bacteria | 8216 |
| 281 | Ga0207691_10041907 | 3300025940 | Bacteria | 4223 |
| 282 | Ga0207691_10053770 | 3300025940 | Bacteria | 3675 |
| 283 | Ga0207711_10332058 | 3300025941 | Bacteria | 1406 |
| 284 | Ga0207661_10257693 | 3300025944 | Bacteria | 1553 |
| 285 | Ga0207661_10350052 | 3300025944 | Bacteria | 1333 |
| 286 | Ga0207661_10665332 | 3300025944 | Bacteria | 957 |
| 287 | Ga0207667_10154009 | 3300025949 | Bacteria | 2365 |
| 288 | Ga0207667_10351371 | 3300025949 | Bacteria | 1504 |
| 289 | Ga0207667_10535255 | 3300025949 | Bacteria | 1186 |
| 290 | Ga0207651_10004851 | 3300025960 | Bacteria | 6850 |
| 291 | Ga0207651_10460359 | 3300025960 | Bacteria | 1093 |
| 292 | Ga0207668_10665261 | 3300025972 | Bacteria | 913 |
| 293 | Ga0207640_10140243 | 3300025981 | Bacteria | 1761 |
| 294 | Ga0207658_10001854 | 3300025986 | Bacteria | 15830 |
| 295 | Ga0207658_10293172 | 3300025986 | Bacteria | 1399 |
| 296 | Ga0207677_10026511 | 3300026023 | Bacteria | 3637 |
| 297 | Ga0207703_10004753 | 3300026035 | Bacteria | 11078 |
| 298 | Ga0207703_11125195 | 3300026035 | Bacteria | 754 |
| 299 | Ga0207639_10203980 | 3300026041 | Bacteria | 1698 |
| 300 | Ga0207639_10295485 | 3300026041 | Bacteria | 1430 |
| 301 | Ga0207639_10833009 | 3300026041 | Bacteria | 861 |
| 302 | Ga0207678_10002276 | 3300026067 | Bacteria | 17378 |
| 303 | Ga0207678_10207607 | 3300026067 | Bacteria | 1675 |
| 304 | Ga0207702_10053116 | 3300026078 | Bacteria | 3430 |
| 305 | Ga0207702_10152927 | 3300026078 | Bacteria | 2100 |
| 306 | Ga0207641_10607502 | 3300026088 | Bacteria | 1071 |
| 307 | Ga0207648_10002295 | 3300026089 | Bacteria | 20666 |
| 308 | Ga0207648_10136083 | 3300026089 | Bacteria | 2164 |
| 309 | Ga0207674_10001229 | 3300026116 | Bacteria | 33433 |
| 310 | Ga0207674_10013681 | 3300026116 | Bacteria | 8989 |
| 311 | Ga0207674_10196505 | 3300026116 | Bacteria | 1967 |
| 312 | Ga0207675_100023354 | 3300026118 | Bacteria | 5751 |
| 313 | Ga0207683_10230825 | 3300026121 | Bacteria | 1688 |
| 314 | Ga0207698_10565938 | 3300026142 | Bacteria | 1116 |
| 315 | Ga0209281_1000283 | 3300027111 | Bacteria | 95533 |
| 316 | Ga0209281_1000308 | 3300027111 | Bacteria | 87362 |
| 317 | Ga0209281_1000994 | 3300027111 | Bacteria | 22409 |
| 318 | Ga0209281_1001423 | 3300027111 | Bacteria | 14254 |
| 319 | Ga0209371_1000013 | 3300027312 | Bacteria | 691516 |
| 320 | Ga0209371_1000770 | 3300027312 | Bacteria | 26613 |
| 321 | Ga0209974_10002757 | 3300027876 | Bacteria | 6372 |
| 322 | Ga0207428_10546467 | 3300027907 | Bacteria | 838 |
| 323 | Ga0268266_10001726 | 3300028379 | Bacteria | 25029 |
| 324 | Ga0268266_10044374 | 3300028379 | Bacteria | 3801 |
| 325 | Ga0268266_10235400 | 3300028379 | Bacteria | 1688 |
| 326 | Ga0268266_10516774 | 3300028379 | Bacteria | 1141 |
| 327 | Ga0265334_10009277 | 3300028573 | Bacteria | 4163 |
| 328 | Ga0265318_10007856 | 3300028577 | Bacteria | 4793 |
| 329 | Ga0265336_10000053 | 3300028666 | Bacteria | 113034 |
| 330 | Ga0307517_10000174 | 3300028786 | Bacteria | 105578 |
| 331 | Ga0307517_10108074 | 3300028786 | Bacteria | 2138 |
| 332 | Ga0307515_10001235 | 3300028794 | Bacteria | 58313 |
| 333 | Ga0307515_10004451 | 3300028794 | Bacteria | 29009 |
| 334 | Ga0307515_10132420 | 3300028794 | Bacteria | 2735 |
| 335 | Ga0307515_10162890 | 3300028794 | Bacteria | 2264 |
| 336 | Ga0307515_10246467 | 3300028794 | Bacteria | 1547 |
| 337 | Ga0265324_10000132 | 3300029957 | Bacteria | 58866 |
| 338 | Ga0268256_1000014 | 3300030500 | Bacteria | 691435 |
| 339 | Ga0268256_1000647 | 3300030500 | Bacteria | 26522 |
| 340 | Ga0307511_10094344 | 3300030521 | Bacteria | 2006 |
| 341 | Ga0307512_10046505 | 3300030522 | Bacteria | 3538 |
| 342 | Ga0307512_10184109 | 3300030522 | Bacteria | 1167 |
| 343 | Ga0265328_10020326 | 3300031239 | Bacteria | 2542 |
| 344 | Ga0265325_10030670 | 3300031241 | Bacteria | 2882 |
| 345 | Ga0265325_10035978 | 3300031241 | Bacteria | 2626 |
| 346 | Ga0265340_10001678 | 3300031247 | Bacteria | 12726 |
| 347 | Ga0265339_10011043 | 3300031249 | Bacteria | 5581 |
| 348 | Ga0265331_10006526 | 3300031250 | Bacteria | 6884 |
| 349 | Ga0265327_10000012 | 3300031251 | Bacteria | 530403 |
| 350 | Ga0265327_10003227 | 3300031251 | Bacteria | 15859 |
| 351 | Ga0265327_10228751 | 3300031251 | Bacteria | 834 |
| 352 | Ga0265316_10036333 | 3300031344 | Bacteria | 3984 |
| 353 | Ga0265316_10156124 | 3300031344 | Bacteria | 1708 |
| 354 | Ga0307513_10014799 | 3300031456 | Bacteria | 9489 |
| 355 | Ga0307513_10130230 | 3300031456 | Bacteria | 2463 |
| 356 | Ga0307513_10195449 | 3300031456 | Bacteria | 1869 |
| 357 | Ga0307509_10000225 | 3300031507 | Bacteria | 90913 |
| 358 | Ga0307509_10005996 | 3300031507 | Bacteria | 16595 |
| 359 | Ga0307509_10053865 | 3300031507 | Bacteria | 4286 |
| 360 | Ga0307509_10067974 | 3300031507 | Bacteria | 3730 |
| 361 | Ga0307408_100000010 | 3300031548 | Bacteria | 420048 |
| 362 | Ga0307408_100908838 | 3300031548 | Bacteria | 806 |
| 363 | Ga0265313_10123248 | 3300031595 | Bacteria | 1129 |
| 364 | Ga0307508_10000185 | 3300031616 | Bacteria | 75407 |
| 365 | Ga0307508_10001432 | 3300031616 | Bacteria | 26853 |
| 366 | Ga0307508_10002202 | 3300031616 | Bacteria | 20788 |
| 367 | Ga0307508_10003035 | 3300031616 | Bacteria | 17286 |
| 368 | Ga0307514_10049262 | 3300031649 | Bacteria | 3277 |
| 369 | Ga0307514_10143758 | 3300031649 | Bacteria | 1616 |
| 370 | Ga0316579_10277060 | 3300031691 | Bacteria | 811 |
| 371 | Ga0265314_10001531 | 3300031711 | Bacteria | 25492 |
| 372 | Ga0265314_10035008 | 3300031711 | Bacteria | 3663 |
| 373 | Ga0265314_10138293 | 3300031711 | Bacteria | 1510 |
| 374 | Ga0265342_10042951 | 3300031712 | Bacteria | 2729 |
| 375 | Ga0265342_10165792 | 3300031712 | Bacteria | 1219 |
| 376 | Ga0307516_10001572 | 3300031730 | Bacteria | 31438 |
| 377 | Ga0307516_10009757 | 3300031730 | Bacteria | 10650 |
| 378 | Ga0307516_10259861 | 3300031730 | Bacteria | 1427 |
| 379 | Ga0307405_10021739 | 3300031731 | Bacteria | 3612 |
| 380 | Ga0307405_10185701 | 3300031731 | Bacteria | 1497 |
| 381 | Ga0307413_10339359 | 3300031824 | Bacteria | 1155 |
| 382 | Ga0307407_10026323 | 3300031903 | Bacteria | 3078 |
| 383 | Ga0307409_100286400 | 3300031995 | Bacteria | 1526 |
| 384 | Ga0307416_100851412 | 3300032002 | Bacteria | 1010 |
| 385 | Ga0307507_10065803 | 3300033179 | Bacteria | 3329 |
| 386 | Ga0307510_10002036 | 3300033180 | Bacteria | 22846 |
| 387 | Ga0307510_10034205 | 3300033180 | Bacteria | 5694 |
| 388 | Ga0373948_0005315 | 3300034817 | Bacteria | 2081 |
| 389 | Ga0373926_0077703 | 3300035083 | Bacteria | 1225 |
| 390 | Ga0373928_0010732 | 3300035084 | Bacteria | 1803 |
| 391 | Ga0373940_0037180 | 3300035088 | Bacteria | 1324 |
| 392 | Ga0373923_0076552 | 3300035111 | Bacteria | 1445 |
| 393 | Ga0373932_0025863 | 3300035112 | Bacteria | 1593 |
| 394 | Ga0373936_0024437 | 3300035113 | Bacteria | 2359 |
| 395 | Ga0373939_0000036 | 3300035114 | Bacteria | 48825 |
| 396 | Ga0373954_0011225 | 3300035118 | Bacteria | 3966 |
| 397 | Ga0373956_0019348 | 3300035119 | Bacteria | 2886 |
| 398 | Ga0373943_0034564 | 3300035170 | Bacteria | 2412 |
| 399 | Ga0373943_0401850 | 3300035170 | Bacteria | 791 |
| 400 | Ga0373946_0084338 | 3300035171 | Bacteria | 1397 |
| 401 | Ga0373962_0007469 | 3300035242 | Bacteria | 2677 |
| 402 | Ga0316574_0538732 | 3300035398 | Bacteria | 725 |
| 403 | Ga0373931_0000268 | 3300035691 | Bacteria | 21952 |
| 404 | Ga0373931_0008787 | 3300035691 | Bacteria | 4806 |
| 405 | Ga0373931_0209948 | 3300035691 | Bacteria | 1167 |
| 406 | Ga0373935_0104638 | 3300035692 | Bacteria | 1871 |
| 407 | Ga0373927_0354282 | 3300035695 | Bacteria | 967 |
| 408 | Ga0373927_0477124 | 3300035695 | Bacteria | 824 |
| 409 | Ga0373933_0008201 | 3300035724 | Bacteria | 5702 |
| 410 | Ga0373947_0394835 | 3300035725 | Bacteria | 932 |
| 411 | Ga0373937_0003306 | 3300036401 | Bacteria | 13538 |
| 412 | Ga0373937_0023547 | 3300036401 | Bacteria | 5545 |
| 413 | Ga0373937_0214132 | 3300036401 | Bacteria | 1813 |
| 414 | Ga0373937_0325039 | 3300036401 | Bacteria | 1455 |
| 415 | Ga0373925_0027268 | 3300037068 | Bacteria | 4183 |
| 416 | Ga0373925_0096228 | 3300037068 | Bacteria | 2269 |
| 417 | Ga0373925_0418139 | 3300037068 | Bacteria | 1095 |
| 418 | Ga0395899_0002765 | 3300037312 | Bacteria | 14156 |
| 419 | Ga0395899_0014664 | 3300037312 | Bacteria | 5982 |
| 420 | Ga0395899_0076220 | 3300037312 | Bacteria | 2448 |
| 421 | Ga0395900_0008007 | 3300037418 | Bacteria | 10874 |
| 422 | Ga0395900_0015475 | 3300037418 | Bacteria | 7776 |
| 423 | Ga0395900_0083557 | 3300037418 | Bacteria | 3280 |
| 424 | Ga0395900_0139262 | 3300037418 | Bacteria | 2485 |
| 425 | Ga0395900_0173885 | 3300037418 | Bacteria | 2191 |
| 426 | Ga0395898_0006186 | 3300037466 | Bacteria | 12825 |
| 427 | Ga0395898_0039633 | 3300037466 | Bacteria | 4662 |
| 428 | Ga0395898_0148759 | 3300037466 | Bacteria | 2241 |
| 429 | Ga0395898_0171308 | 3300037466 | Bacteria | 2075 |
| 430 | Ga0395905_0000025 | 3300037471 | Bacteria | 317571 |
| 431 | Ga0395905_0005980 | 3300037471 | Bacteria | 12322 |
| 432 | Ga0395905_0008672 | 3300037471 | Bacteria | 10014 |
| 433 | Ga0395905_0030958 | 3300037471 | Bacteria | 5039 |
| 434 | Ga0395905_0050499 | 3300037471 | Bacteria | 3896 |
| 435 | Ga0395905_0059042 | 3300037471 | Bacteria | 3586 |
| 436 | Ga0395905_0069854 | 3300037471 | Bacteria | 3290 |
| 437 | Ga0395905_0079244 | 3300037471 | Bacteria | 3079 |
| 438 | Ga0395905_0504115 | 3300037471 | Bacteria | 1110 |
| 439 | Ga0395905_0719640 | 3300037471 | Bacteria | 900 |
| 440 | Ga0395905_0755081 | 3300037471 | Bacteria | 875 |
| 441 | Ga0436364_0492175 | 3300037853 | Bacteria | 5390 |
| 442 | Ga0436364_1360306 | 3300037853 | Bacteria | 823 |
| 443 | Ga0395901_0003336 | 3300038443 | Bacteria | 16173 |
| 444 | Ga0395901_0043746 | 3300038443 | Bacteria | 4644 |
| 445 | Ga0395901_0107006 | 3300038443 | Bacteria | 2935 |
| 446 | Ga0395901_0174821 | 3300038443 | Bacteria | 2252 |
| 447 | Ga0395901_0256096 | 3300038443 | Bacteria | 1822 |
| 448 | Ga0395901_0537969 | 3300038443 | Bacteria | 1185 |
| 449 | Ga0400490_19766 | 3300038726 | Bacteria | 6232 |
| 450 | Ga0436365_1030367 | 3300039437 | Bacteria | 1100 |
| 451 | Ga0436360_0103786 | 3300039438 | Bacteria | 1165 |
| 452 | Ga0436360_0283312 | 3300039438 | Bacteria | 912 |
| 453 | Ga0436360_0649612 | 3300039438 | Bacteria | 1424 |
| 454 | Ga0436360_0708127 | 3300039438 | Bacteria | 1073 |
| 455 | Ga0436361_0058641 | 3300039447 | Bacteria | 1416 |
| 456 | Ga0436361_0098550 | 3300039447 | Bacteria | 3504 |
| 457 | Ga0436361_0289802 | 3300039447 | Bacteria | 31851 |
| 458 | Ga0436361_0380155 | 3300039447 | Bacteria | 4492 |
| 459 | Ga0436361_0410668 | 3300039447 | Bacteria | 27008 |
| 460 | Ga0436361_0653184 | 3300039447 | Bacteria | 36949 |
| 461 | Ga0436361_0766328 | 3300039447 | Bacteria | 1810 |
| 462 | Ga0436361_1213797 | 3300039447 | Bacteria | 923 |
| 463 | Ga0436361_1214496 | 3300039447 | Bacteria | 9572 |
| 464 | Ga0436363_0288717 | 3300039450 | Bacteria | 839 |
| 465 | Ga0436362_1051954 | 3300039453 | Bacteria | 756 |
| 466 | Ga0439447_055633 | 3300041407 | Bacteria | 938 |
| 467 | Ga0451789_0173976 | 3300041443 | Bacteria | 1107 |
| 468 | Ga0451789_1258901 | 3300041443 | Bacteria | 871 |
| 469 | Ga0451791_1222017 | 3300041451 | Bacteria | 1335 |
| 470 | Ga0451793_1887844 | 3300041452 | Bacteria | 1504 |
| 471 | Ga0451798_0187906 | 3300041458 | Bacteria | 779 |
| 472 | Ga0451800_0997610 | 3300041459 | Bacteria | 1248 |
| 473 | Ga0451853_0292917 | 3300041512 | Bacteria | 3975 |
| 474 | Ga0439448_0044399 | 3300042005 | Bacteria | 1445 |
| 475 | Ga0439452_000141 | 3300042010 | Bacteria | 54325 |
| 476 | Ga0439452_000604 | 3300042010 | Bacteria | 18370 |
| 477 | Ga0450901_000116 | 3300042533 | Bacteria | 8723 |
| 478 | Ga0451577_0014637 | 3300042876 | Bacteria | 7309 |
| 479 | Ga0451577_0038258 | 3300042876 | Bacteria | 4315 |
| 480 | Ga0466969_0035833 | 3300044656 | Bacteria | 2508 |
| 481 | Ga0466977_0001317 | 3300044666 | Bacteria | 10077 |
| 482 | Ga0466981_0000001 | 3300044669 | Bacteria | 367980 |
| 483 | Ga0466966_0002026 | 3300044684 | Bacteria | 13155 |
| 484 | Ga0466966_0011911 | 3300044684 | Bacteria | 5764 |
| 485 | Ga0466961_0045147 | 3300044693 | Bacteria | 2820 |
| 486 | Ga0453684_0002411 | 3300044712 | Bacteria | 45566 |
| 487 | Ga0453684_0002552 | 3300044712 | Bacteria | 43755 |
| 488 | Ga0453684_0131908 | 3300044712 | Bacteria | 2997 |
| 489 | Ga0466971_0006284 | 3300044719 | Bacteria | 5159 |
| 490 | Ga0466968_0051102 | 3300044735 | Bacteria | 1765 |
| 491 | Ga0466970_0034701 | 3300044765 | Bacteria | 2672 |
| 492 | Ga0466959_0002381 | 3300045049 | Bacteria | 11985 |
| 493 | Ga0466959_0024159 | 3300045049 | Bacteria | 4500 |
| 494 | Ga0466959_0186178 | 3300045049 | Bacteria | 1450 |
| 495 | Ga0451576_0021714 | 3300045051 | Bacteria | 6971 |
| 496 | Ga0451576_0070312 | 3300045051 | Bacteria | 3643 |
| 497 | Ga0466958_0143808 | 3300045836 | Bacteria | 1502 |
| 498 | Ga0495592_0001312 | 3300046454 | Bacteria | 17260 |
| 499 | Ga0495591_010516 | 3300046458 | Bacteria | 3580 |
| 500 | Ga0495629_0062368 | 3300046459 | Bacteria | 2604 |
| 501 | Ga0495629_0429184 | 3300046459 | Bacteria | 896 |
| 502 | Ga0495638_0111379 | 3300046460 | Bacteria | 1626 |
| 503 | Ga0495638_0164268 | 3300046460 | Bacteria | 1278 |
| 504 | Ga0495638_0229829 | 3300046460 | Bacteria | 1032 |
| 505 | Ga0495651_0011915 | 3300046462 | Bacteria | 6690 |
| 506 | Ga0495653_0069116 | 3300046463 | Bacteria | 2647 |
| 507 | Ga0495650_0000040 | 3300046471 | Bacteria | 366254 |
| 508 | Ga0495662_0076309 | 3300046476 | Bacteria | 1627 |
| 509 | Ga0495583_0000159 | 3300046506 | Bacteria | 113627 |
| 510 | Ga0495606_0005971 | 3300046507 | Bacteria | 11423 |
| 511 | Ga0495608_0000180 | 3300046511 | Bacteria | 45181 |
| 512 | Ga0495620_0011609 | 3300046515 | Bacteria | 4587 |
| 513 | Ga0495628_0027713 | 3300046516 | Bacteria | 4605 |
| 514 | Ga0495628_0212603 | 3300046516 | Bacteria | 1454 |
| 515 | Ga0495630_0148899 | 3300046517 | Bacteria | 1781 |
| 516 | Ga0495630_0449750 | 3300046517 | Bacteria | 987 |
| 517 | Ga0495632_0004601 | 3300046519 | Bacteria | 9343 |
| 518 | Ga0495632_0012661 | 3300046519 | Bacteria | 4852 |
| 519 | Ga0495644_0024463 | 3300046523 | Bacteria | 2297 |
| 520 | Ga0495648_0057854 | 3300046524 | Bacteria | 2322 |
| 521 | Ga0495666_0126634 | 3300046526 | Bacteria | 1194 |
| 522 | Ga0495666_0136678 | 3300046526 | Bacteria | 1144 |
| 523 | Ga0495652_0004484 | 3300046529 | Bacteria | 13326 |
| 524 | Ga0495640_0011129 | 3300046533 | Bacteria | 6927 |
| 525 | Ga0495645_0114971 | 3300046543 | Bacteria | 1901 |
| 526 | Ga0495633_0003465 | 3300046558 | Bacteria | 10491 |
| 527 | Ga0495667_0006865 | 3300046559 | Bacteria | 7730 |
| 528 | Ga0495667_0012787 | 3300046559 | Bacteria | 5687 |
| 529 | Ga0495635_0002686 | 3300046663 | Bacteria | 12157 |
| 530 | Ga0495635_0095933 | 3300046663 | Bacteria | 2027 |
| 531 | Ga0495657_0017312 | 3300046675 | Bacteria | 5233 |
| 532 | Ga0495599_0066436 | 3300046678 | Bacteria | 2252 |
| 533 | Ga0495599_0272136 | 3300046678 | Bacteria | 1027 |
| 534 | Ga0495623_0014713 | 3300046679 | Bacteria | 5059 |
| 535 | Ga0495646_0253970 | 3300046680 | Bacteria | 941 |
| 536 | Ga0495658_0032612 | 3300046683 | Bacteria | 2846 |
| 537 | Ga0495624_0095731 | 3300046690 | Bacteria | 1830 |
| 538 | Ga0495671_0016703 | 3300046692 | Bacteria | 3915 |
| 539 | Ga0495671_0084130 | 3300046692 | Bacteria | 1559 |
| 540 | Ga0495649_0000760 | 3300046694 | Bacteria | 25925 |
| 541 | Ga0495649_0001240 | 3300046694 | Bacteria | 19630 |
| 542 | Ga0495649_0005881 | 3300046694 | Bacteria | 7705 |
| 543 | Ga0495589_0003499 | 3300046794 | Bacteria | 8497 |
| 544 | Ga0495600_0005529 | 3300046809 | Bacteria | 7625 |
| 545 | Ga0495604_0000241 | 3300047317 | Bacteria | 48922 |
| 546 | Ga0495674_0017966 | 3300047319 | Bacteria | 6583 |
| 547 | Ga0495674_0032889 | 3300047319 | Bacteria | 4701 |
| 548 | Ga0495674_0149045 | 3300047319 | Bacteria | 1962 |
| 549 | Ga0495672_0159004 | 3300047320 | Bacteria | 1164 |
| 550 | Ga0495676_0213093 | 3300047321 | Bacteria | 1335 |
| 551 | Ga0495680_0000994 | 3300047322 | Bacteria | 31554 |
| 552 | Ga0495679_004962 | 3300047446 | Bacteria | 6001 |
| 553 | Ga0495686_0004435 | 3300047472 | Bacteria | 11558 |
| 554 | Ga0495602_0010667 | 3300048088 | Bacteria | 9531 |
| 555 | Ga0495614_0251148 | 3300048089 | Bacteria | 809 |
| 556 | Ga0496101_0147970 | 3300048904 | Bacteria | 1794 |
| 557 | Ga0496102_0007894 | 3300048905 | Bacteria | 9094 |
| 558 | Ga0496104_0001702 | 3300048907 | Bacteria | 18996 |
| 559 | Ga0496104_0130603 | 3300048907 | Bacteria | 2413 |
| 560 | Ga0496104_0639924 | 3300048907 | Bacteria | 972 |
| 561 | Ga0496105_0054625 | 3300048908 | Bacteria | 3297 |
| 562 | Ga0496105_0226223 | 3300048908 | Bacteria | 1521 |
| 563 | Ga0496105_0379026 | 3300048908 | Bacteria | 1126 |
| 564 | Ga0496109_0460024 | 3300048912 | Bacteria | 1202 |
| 565 | Ga0496112_0031940 | 3300048915 | Bacteria | 5110 |
| 566 | Ga0496112_0037322 | 3300048915 | Bacteria | 4743 |
| 567 | Ga0496116_0001458 | 3300048919 | Bacteria | 26519 |
| 568 | Ga0496116_0009281 | 3300048919 | Bacteria | 8408 |
| 569 | Ga0496116_0026850 | 3300048919 | Bacteria | 4200 |
| 570 | Ga0496116_0045377 | 3300048919 | Bacteria | 2975 |
| 571 | Ga0496117_0008694 | 3300048920 | Bacteria | 9598 |
| 572 | Ga0496117_0016174 | 3300048920 | Bacteria | 6305 |
| 573 | Ga0496117_0112497 | 3300048920 | Bacteria | 1692 |
| 574 | Ga0496117_0128221 | 3300048920 | Bacteria | 1543 |
| 575 | Ga0496118_0002802 | 3300048921 | Bacteria | 22834 |
| 576 | Ga0496118_0022466 | 3300048921 | Bacteria | 5512 |
| 577 | Ga0496118_0035786 | 3300048921 | Bacteria | 4024 |
| 578 | Ga0496118_0038436 | 3300048921 | Bacteria | 3835 |
| 579 | Ga0496118_0040266 | 3300048921 | Bacteria | 3717 |
| 580 | Ga0496118_0073071 | 3300048921 | Bacteria | 2459 |
| 581 | Ga0496118_0153551 | 3300048921 | Bacteria | 1436 |
| 582 | Ga0496118_0215287 | 3300048921 | Bacteria | 1123 |
| 583 | Ga0496119_0000438 | 3300048922 | Bacteria | 57088 |
| 584 | Ga0496119_0006572 | 3300048922 | Bacteria | 10717 |
| 585 | Ga0496119_0009447 | 3300048922 | Bacteria | 8365 |
| 586 | Ga0496119_0009582 | 3300048922 | Bacteria | 8275 |
| 587 | Ga0496119_0020054 | 3300048922 | Bacteria | 4891 |
| 588 | Ga0496119_0093129 | 3300048922 | Bacteria | 1707 |
| 589 | Ga0496119_0185548 | 3300048922 | Bacteria | 1087 |
| 590 | Ga0496119_0196127 | 3300048922 | Bacteria | 1048 |
| 591 | Ga0496119_0205455 | 3300048922 | Bacteria | 1017 |
| 592 | Ga0496120_0006993 | 3300048923 | Bacteria | 8487 |
| 593 | Ga0496120_0015782 | 3300048923 | Bacteria | 4964 |
| 594 | Ga0496120_0017901 | 3300048923 | Bacteria | 4578 |
| 595 | Ga0496120_0035404 | 3300048923 | Bacteria | 2982 |
| 596 | Ga0496120_0076836 | 3300048923 | Bacteria | 1818 |
| 597 | Ga0496120_0107954 | 3300048923 | Bacteria | 1459 |
| 598 | Ga0496120_0109698 | 3300048923 | Bacteria | 1443 |
| 599 | Ga0496120_0286958 | 3300048923 | Bacteria | 758 |
| 600 | Ga0496121_0000729 | 3300048924 | Bacteria | 60664 |
| 601 | Ga0496121_0004852 | 3300048924 | Bacteria | 17688 |
| 602 | Ga0496121_0014724 | 3300048924 | Bacteria | 8265 |
| 603 | Ga0496121_0022172 | 3300048924 | Bacteria | 6178 |
| 604 | Ga0496121_0082677 | 3300048924 | Bacteria | 2537 |
| 605 | Ga0496121_0180201 | 3300048924 | Bacteria | 1525 |
| 606 | Ga0496121_0381877 | 3300048924 | Bacteria | 928 |
| 607 | Ga0496121_0405139 | 3300048924 | Bacteria | 892 |
| 608 | Ga0496121_0424121 | 3300048924 | Bacteria | 864 |
| 609 | Ga0496122_0008944 | 3300048925 | Bacteria | 10652 |
| 610 | Ga0496122_0025170 | 3300048925 | Bacteria | 5179 |
| 611 | Ga0496122_0059803 | 3300048925 | Bacteria | 2811 |
| 612 | Ga0496122_0120875 | 3300048925 | Bacteria | 1689 |
| 613 | Ga0496122_0127356 | 3300048925 | Bacteria | 1626 |
| 614 | Ga0496123_0020285 | 3300048926 | Bacteria | 5205 |
| 615 | Ga0496123_0024494 | 3300048926 | Bacteria | 4584 |
| 616 | Ga0496123_0040172 | 3300048926 | Bacteria | 3262 |
| 617 | Ga0496123_0051988 | 3300048926 | Bacteria | 2723 |
| 618 | Ga0496123_0062130 | 3300048926 | Bacteria | 2395 |
| 619 | Ga0496123_0074150 | 3300048926 | Bacteria | 2107 |
| 620 | Ga0496123_0287337 | 3300048926 | Bacteria | 791 |
| 621 | Ga0496123_0296620 | 3300048926 | Bacteria | 773 |
| 622 | Ga0496124_0000458 | 3300048927 | Bacteria | 70719 |
| 623 | Ga0496124_0000649 | 3300048927 | Bacteria | 57400 |
| 624 | Ga0496124_0004557 | 3300048927 | Bacteria | 16105 |
| 625 | Ga0496124_0043082 | 3300048927 | Bacteria | 3881 |
| 626 | Ga0496124_0109668 | 3300048927 | Bacteria | 2223 |
| 627 | Ga0496124_0115509 | 3300048927 | Bacteria | 2153 |
| 628 | Ga0496124_0122443 | 3300048927 | Bacteria | 2076 |
| 629 | Ga0496124_0157997 | 3300048927 | Bacteria | 1770 |
| 630 | Ga0496124_0178151 | 3300048927 | Bacteria | 1638 |
| 631 | Ga0496124_0524040 | 3300048927 | Bacteria | 789 |
| 632 | Ga0496124_0574994 | 3300048927 | Bacteria | 738 |
| 633 | Ga0496125_0000176 | 3300048928 | Bacteria | 140746 |
| 634 | Ga0496125_0000370 | 3300048928 | Bacteria | 84467 |
| 635 | Ga0496125_0000522 | 3300048928 | Bacteria | 66680 |
| 636 | Ga0496125_0004254 | 3300048928 | Bacteria | 16677 |
| 637 | Ga0496125_0035699 | 3300048928 | Bacteria | 4355 |
| 638 | Ga0496125_0039207 | 3300048928 | Bacteria | 4083 |
| 639 | Ga0496125_0188964 | 3300048928 | Bacteria | 1362 |
| 640 | Ga0496125_0189365 | 3300048928 | Bacteria | 1360 |
| 641 | Ga0496126_0000329 | 3300048929 | Bacteria | 101203 |
| 642 | Ga0496126_0006943 | 3300048929 | Bacteria | 12533 |
| 643 | Ga0496126_0023134 | 3300048929 | Bacteria | 6023 |
| 644 | Ga0496126_0036180 | 3300048929 | Bacteria | 4619 |
| 645 | Ga0496126_0038207 | 3300048929 | Bacteria | 4469 |
| 646 | Ga0496126_0085578 | 3300048929 | Bacteria | 2779 |
| 647 | Ga0496126_0216132 | 3300048929 | Bacteria | 1612 |
| 648 | Ga0496126_0254378 | 3300048929 | Bacteria | 1462 |
| 649 | Ga0496126_0332932 | 3300048929 | Bacteria | 1245 |
| 650 | Ga0496126_0772766 | 3300048929 | Bacteria | 739 |
| 651 | Ga0501031_0438289 | 3300049568 | Bacteria | 844 |
| 652 | Ga0501032_0274596 | 3300049569 | Bacteria | 1092 |
| 653 | Ga0501034_0000891 | 3300049571 | Bacteria | 43738 |
| 654 | Ga0501036_0043205 | 3300049572 | Bacteria | 3816 |
| 655 | Ga0501038_0832475 | 3300049574 | Bacteria | 684 |
| 656 | Ga0501039_0853863 | 3300049575 | Bacteria | 709 |
| 657 | Ga0501042_0167530 | 3300049578 | Bacteria | 1585 |
| 658 | Ga0501070_0458664 | 3300049586 | Bacteria | 1027 |
| 659 | Ga0501070_0717050 | 3300049586 | Bacteria | 790 |
| 660 | Ga0501071_0213511 | 3300049587 | Bacteria | 1451 |
| 661 | Ga0501072_0580051 | 3300049588 | Bacteria | 885 |
| 662 | Ga0501073_0005280 | 3300049589 | Bacteria | 9689 |
| 663 | Ga0501074_0164829 | 3300049590 | Bacteria | 1582 |
| 664 | Ga0501074_0279470 | 3300049590 | Bacteria | 1187 |
| 665 | Ga0501206_005345 | 3300049653 | Bacteria | 1652 |
| 666 | Ga0501080_0277255 | 3300049742 | Bacteria | 1525 |
| 667 | Ga0501081_0080810 | 3300049743 | Bacteria | 2276 |
| 668 | nmdc:mga03683_2170_c2 | 3300050489 | Bacteria | 4087 |
| 669 | nmdc:mga03n38_25584_c1 | 3300050490 | Bacteria | 2426 |
| 670 | nmdc:mga00v17_108561_c1 | 3300050491 | Bacteria | 1758 |
| 671 | nmdc:mga00v17_281313_c1 | 3300050491 | Bacteria | 1080 |
| 672 | nmdc:mga0k408_1297_c2 | 3300050493 | Bacteria | 9516 |
| 673 | nmdc:mga0k408_157438_c1 | 3300050493 | Bacteria | 1353 |
| 674 | nmdc:mga0k408_208903_c2 | 3300050493 | Bacteria | 793 |
| 675 | nmdc:mga0k408_6099_c1 | 3300050493 | Bacteria | 6422 |
| 676 | nmdc:mga07m45_183995_c1 | 3300050496 | Bacteria | 1215 |
| 677 | nmdc:mga07m45_278375_c1 | 3300050496 | Bacteria | 973 |
| 678 | nmdc:mga07m45_748_c1 | 3300050496 | Bacteria | 13891 |
| 679 | nmdc:mga05p37_296340_c1 | 3300050507 | Bacteria | 1923 |
| 680 | nmdc:mga05p37_441880_c1 | 3300050507 | Bacteria | 1508 |
| 681 | nmdc:mga05p37_645950_c1 | 3300050507 | Bacteria | 1186 |
| 682 | nmdc:mga05p37_942100_c1 | 3300050507 | Bacteria | 925 |
| 683 | nmdc:mga09592_2859_c1 | 3300050508 | Bacteria | 14008 |
| 684 | nmdc:mga0qj67_577334_c1 | 3300050509 | Bacteria | 900 |
| 685 | nmdc:mga0qj67_92402_c1 | 3300050509 | Bacteria | 2433 |
| 686 | nmdc:mga06r32_341153_c1 | 3300050510 | Bacteria | 1483 |
| 687 | nmdc:mga08y16_192145_c1 | 3300050511 | Bacteria | 2117 |
| 688 | nmdc:mga08y16_587640_c1 | 3300050511 | Bacteria | 1123 |
| 689 | nmdc:mga08y16_635362_c1 | 3300050511 | Bacteria | 1073 |
| 690 | nmdc:mga0n895_354078_c1 | 3300050512 | Bacteria | 1487 |
| 691 | nmdc:mga08x19_362063_c1 | 3300050514 | Bacteria | 1014 |
| 692 | nmdc:mga0a205_211457_c1 | 3300050515 | Bacteria | 1828 |
| 693 | nmdc:mga0sz30_20944_c1 | 3300050516 | Bacteria | 2642 |
| 694 | nmdc:mga0sz30_2490_c1 | 3300050516 | Bacteria | 5323 |
| 695 | Ga0495601_0001571 | 3300053077 | Bacteria | 12632 |
| 696 | Ga0495601_0002038 | 3300053077 | Bacteria | 11335 |
| 697 | Ga0495612_0000746 | 3300053078 | Bacteria | 13248 |
| 698 | Ga0500635_0000363 | 3300053080 | Bacteria | 14460 |
| 699 | Ga0495595_0000387 | 3300053084 | Bacteria | 16728 |
| 700 | Ga0495595_0057549 | 3300053084 | Bacteria | 1813 |
| 701 | Ga0495595_0430811 | 3300053084 | Bacteria | 670 |
| 702 | Ga0495619_0030742 | 3300053085 | Bacteria | 3476 |
| 703 | Ga0495619_0036207 | 3300053085 | Bacteria | 3212 |
| 704 | Ga0500578_0000079 | 3300053086 | Bacteria | 107137 |
| 705 | Ga0500643_008711 | 3300053087 | Bacteria | 3958 |
| 706 | Ga0500644_0001074 | 3300053088 | Bacteria | 8067 |
| 707 | Ga0500651_0092267 | 3300053093 | Bacteria | 1863 |
| 708 | Ga0500593_041066 | 3300053117 | Bacteria | 2067 |
| 709 | Ga0500594_0001408 | 3300053118 | Bacteria | 5221 |
| 710 | Ga0500594_0004863 | 3300053118 | Bacteria | 2970 |
| 711 | Ga0500595_000029 | 3300053119 | Bacteria | 122318 |
| 712 | Ga0500607_197285 | 3300053121 | Bacteria | 870 |
| 713 | Ga0500652_000624 | 3300053131 | Bacteria | 12146 |
| 714 | Ga0500652_107925 | 3300053131 | Bacteria | 1163 |
| 715 | Ga0500658_0006331 | 3300053134 | Bacteria | 4394 |
| 716 | Ga0500658_0017060 | 3300053134 | Bacteria | 2709 |
| 717 | Ga0500658_0067760 | 3300053134 | Bacteria | 1499 |
| 718 | Ga0500559_0000329 | 3300053136 | Bacteria | 35808 |
| 719 | Ga0500559_0050482 | 3300053136 | Bacteria | 1835 |
| 720 | Ga0500588_0006411 | 3300053146 | Bacteria | 2665 |
| 721 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 722 | Ga0500616_0001264 | 3300053153 | Bacteria | 25261 |
| 723 | Ga0500622_0000053 | 3300053156 | Bacteria | 145070 |
| 724 | Ga0500622_0007462 | 3300053156 | Bacteria | 6208 |
| 725 | Ga0500622_0093747 | 3300053156 | Bacteria | 1486 |
| 726 | Ga0500636_0015032 | 3300053177 | Bacteria | 4557 |
| 727 | Ga0500636_0070250 | 3300053177 | Bacteria | 2032 |
| 728 | Ga0500645_000614 | 3300053730 | Bacteria | 22818 |
| 729 | Ga0501082_0071314 | 3300060353 | Bacteria | 2992 |
| 730 | Ga0466962_0005900 | 3300061719 | Bacteria | 5884 |
| 731 | 2515679265 | 2515154122 | Bacteria | 8609520 |
| 732 | 2555247152 | 2554235231 | Bacteria | 5215788 |
| 733 | 2587728133 | 2585428057 | Bacteria | 6737412 |
| 734 | 2587731191 | 2585428058 | Bacteria | 6853932 |
| 735 | 2587759971 | 2585428062 | Bacteria | 6842168 |
| 736 | 2588289944 | 2588253510 | Bacteria | 6901809 |
| 737 | 2603644192 | 2602042047 | Bacteria | 4697674 |
| 738 | 2603701264 | 2602042066 | Bacteria | 4423871 |
| 739 | 2603704784 | 2602042067 | Bacteria | 4863713 |
| 740 | 2643742396 | 2643221544 | Bacteria | 5886209 |
| 741 | 2643933639 | 2643221585 | Bacteria | 5812563 |
| 742 | 2643972266 | 2643221592 | Bacteria | 6608788 |
| 743 | 2644141623 | 2643221625 | Bacteria | 6512927 |
| 744 | 2644222023 | 2643221639 | Bacteria | 6649903 |
| 745 | 2644257198 | 2643221646 | Bacteria | 6433402 |
| 746 | 2644275606 | 2643221648 | Bacteria | 6521465 |
| 747 | 2644302863 | 2643221654 | Bacteria | 5273570 |
| 748 | 2644315139 | 2643221656 | Bacteria | 5809961 |
| 749 | 2671104682 | 2667528172 | Bacteria | 5170840 |
| 750 | 2681997965 | 2681812866 | Bacteria | 4552357 |
| 751 | 2682008076 | 2681812869 | Bacteria | 5014465 |
| 752 | 2723875890 | 2721755763 | Bacteria | 4464185 |
| 753 | 2738819916 | 2738541296 | Bacteria | 7285013 |
| 754 | 2738832396 | 2738541298 | Bacteria | 7286732 |
| 755 | 2738873923 | 2738541306 | Bacteria | 7284992 |
| 756 | 2739055249 | 2738541337 | Bacteria | 6183410 |
| 757 | 2739185553 | 2738543002 | Bacteria | 7284546 |
| 758 | 2739220521 | 2738543008 | Bacteria | 7282815 |
| 759 | 2739349258 | 2738543031 | Bacteria | 5769731 |
| 760 | 2753857597 | 2751185917 | Bacteria | 4551186 |
| 761 | 2765590703 | 2765235842 | Bacteria | 4799256 |
| 762 | 2775540265 | 2775506706 | Bacteria | 4873073 |
| 763 | 2792841161 | 2791355137 | Bacteria | 9654227 |
| 764 | 2821120579 | 2821118458 | Bacteria | 4714306 |
| 765 | 2821444350 | 2821443989 | Bacteria | 7658172 |
| 766 | 2823376466 | 2823373977 | Bacteria | 4779415 |
| 767 | 2834641739 | 2834641062 | Bacteria | 5559922 |
| 768 | 2835312758 | 2835312727 | Bacteria | 7413381 |
| 769 | 2840883231 | 2840878972 | Bacteria | 5483153 |
| 770 | 2842779705 | 2842775625 | Bacteria | 5587290 |
| 771 | 2881102725 | 2881101125 | Bacteria | 4590519 |
| 772 | 2882461725 | 2882456835 | Bacteria | 6863978 |
| 773 | 2894027582 | 2894023352 | Bacteria | 5167372 |
| 774 | 2902683277 | 2902682994 | Bacteria | 8951596 |
| 775 | 2927836932 | 2927833300 | Bacteria | 4923934 |
| 776 | 2932424875 | 2932422444 | Bacteria | 4678430 |
| 777 | 2937543970 | 2937539931 | Bacteria | 4639830 |
| 778 | 2939576448 | 2939573065 | Bacteria | 4926053 |
| 779 | 2941533317 | 2941531003 | Bacteria | 7653939 |
| 780 | 2990710368 | 2990703756 | Bacteria | 7715990 |
| 781 | 642422891 | 641736151 | Bacteria | 7477263 |
| 782 | 8001525934 | 8001522603 | Bacteria | 4726425 |
| 783 | 8003402777 | 8003400568 | Bacteria | 5535898 |
| 784 | 8018223270 | 8018221730 | Bacteria | 4616064 |
| 785 | 8019560230 | 8019555841 | Bacteria | 9642137 |
| 786 | 8019570330 | 8019565922 | Bacteria | 9639779 |
| 787 | 8052497667 | 8052494512 | Bacteria | 5765634 |
| 788 | 8054931894 | 8054929484 | Bacteria | 5599761 |
| 789 | 8056123581 | 8056120720 | Bacteria | 5758328 |
| 790 | 8056140736 | 8056137416 | Bacteria | 6147080 |
| 791 | 8057308326 | 8057304971 | Bacteria | 4649742 |
| 792 | Ga0157376_10300847 | |||
| 793 | SwRhRL2b_contig_2783974 | |||
| 794 | JGI24735J21928_10019472 | |||
| 795 | JGI25153J46596_10012485 | |||
| 796 | JGI25160J50197_1001200 | |||
| 797 | JGI26145J50221_1007868 | |||
| 798 | Ga0055539_1000240 | |||
| 799 | Ga0055533_1000103 | |||
| 800 | Ga0055525_1000928 | |||
| 801 | Ga0055526_1003050 | |||
| 802 | Ga0055530_10012719 | |||
| 803 | Ga0055530_10051163 | |||
| 804 | Ga0055531_10000390 | |||
| 805 | Ga0058692_1002816 | |||
| 806 | Ga0065165_1000791 | |||
| 807 | Ga0065165_1001455 | |||
| 808 | Ga0065704_10002058 | |||
| 809 | Ga0065704_10077807 | |||
| 810 | Ga0070658_10224317 | |||
| 811 | Ga0070658_10271096 | |||
| 812 | Ga0070676_10008197 | |||
| 813 | Ga0070683_100022610 | |||
| 814 | Ga0070690_100166308 | |||
| 815 | Ga0070670_100024111 | |||
| 816 | Ga0070670_100090066 | |||
| 817 | Ga0070677_10025585 | |||
| 818 | Ga0070677_10060999 | |||
| 819 | Ga0068869_100656979 | |||
| 820 | Ga0070682_100002901 | |||
| 821 | Ga0070689_100010287 | |||
| 822 | Ga0070689_100040016 | |||
| 823 | Ga0070661_100017322 | |||
| 824 | Ga0070692_10139728 | |||
| 825 | Ga0070668_100611455 | |||
| 826 | Ga0070669_100143237 | |||
| 827 | Ga0070675_100020118 | |||
| 828 | Ga0070675_100030521 | |||
| 829 | Ga0070675_100066853 | |||
| 830 | Ga0070671_100014561 | |||
| 831 | Ga0070671_100039548 | |||
| 832 | Ga0070671_100059923 | |||
| 833 | Ga0070674_100009918 | |||
| 834 | Ga0070674_100367341 | |||
| 835 | Ga0070674_100437539 | |||
| 836 | Ga0070673_100006916 | |||
| 837 | Ga0070673_100197786 | |||
| 838 | Ga0070688_100319448 | |||
| 839 | Ga0070688_100406353 | |||
| 840 | Ga0070659_100026425 | |||
| 841 | Ga0070659_100657921 | |||
| 842 | Ga0070667_100005361 | |||
| 843 | Ga0070667_100343716 | |||
| 844 | Ga0070667_100923990 | |||
| 845 | Ga0070709_10433646 | |||
| 846 | Ga0070714_100175896 | |||
| 847 | Ga0070714_100493235 | |||
| 848 | Ga0070714_100991413 | |||
| 849 | Ga0070711_100062131 | |||
| 850 | Ga0070708_100161995 | |||
| 851 | Ga0070663_100006550 | |||
| 852 | Ga0070663_100206784 | |||
| 853 | Ga0070678_100591590 | |||
| 854 | Ga0070662_100282844 | |||
| 855 | Ga0070681_10041779 | |||
| 856 | Ga0070681_10121927 | |||
| 857 | Ga0070681_10220109 | |||
| 858 | Ga0068867_100004166 | |||
| 859 | Ga0068867_100877485 | |||
| 860 | Ga0070706_100032893 | |||
| 861 | Ga0070707_100059206 | |||
| 862 | Ga0070707_100153192 | |||
| 863 | Ga0070698_100040887 | |||
| 864 | Ga0070698_100321592 | |||
| 865 | Ga0070679_100214268 | |||
| 866 | Ga0070679_100287627 | |||
| 867 | Ga0070684_100021897 | |||
| 868 | Ga0070684_100681333 | |||
| 869 | Ga0070697_100188949 | |||
| 870 | Ga0068853_100095434 | |||
| 871 | Ga0068853_100216637 | |||
| 872 | Ga0070672_100001714 | |||
| 873 | Ga0070672_100222147 | |||
| 874 | Ga0070672_100248109 | |||
| 875 | Ga0070672_100323332 | |||
| 876 | Ga0070665_100001160 | |||
| 877 | Ga0070665_100116464 | |||
| 878 | Ga0070665_100547140 | |||
| 879 | Ga0068855_100355520 | |||
| 880 | Ga0068855_100395977 | |||
| 881 | Ga0068857_100000005 | |||
| 882 | Ga0068857_100076664 | |||
| 883 | Ga0068854_100093824 | |||
| 884 | Ga0068854_100219094 | |||
| 885 | Ga0068856_100008321 | |||
| 886 | Ga0068852_100742228 | |||
| 887 | Ga0068859_100024837 | |||
| 888 | Ga0068859_100649608 | |||
| 889 | Ga0068870_10259450 | |||
| 890 | Ga0068863_100214953 | |||
| 891 | Ga0068858_100004350 | |||
| 892 | Ga0068860_100239700 | |||
| 893 | Ga0081455_10000723 | |||
| 894 | Ga0081455_10051537 | |||
| 895 | Ga0081455_10276508 | |||
| 896 | Ga0081538_10033312 | |||
| 897 | Ga0070716_100101169 | |||
| 898 | Ga0070712_100029765 | |||
| 899 | Ga0070712_100166724 | |||
| 900 | Ga0075362_10011088 | |||
| 901 | Ga0075362_10011491 | |||
| 902 | Ga0075362_10171481 | |||
| 903 | Ga0075369_10000532 | |||
| 904 | Ga0075366_10006382 | |||
| 905 | Ga0075366_10014006 | |||
| 906 | Ga0075366_10193263 | |||
| 907 | Ga0075366_10195147 | |||
| 908 | Ga0075366_10222599 | |||
| 909 | Ga0075370_10002042 | |||
| 910 | Ga0075370_10096345 | |||
| 911 | Ga0075370_10129531 | |||
| 912 | Ga0068871_100089638 | |||
| 913 | Ga0075428_100140266 | |||
| 914 | Ga0075430_100037022 | |||
| 915 | Ga0075431_100098152 | |||
| 916 | Ga0075434_100468682 | |||
| 917 | Ga0075429_100002479 | |||
| 918 | Ga0075429_100368044 | |||
| 919 | Ga0068865_100059814 | |||
| 920 | Ga0075436_100169485 | |||
| 921 | Ga0097620_100024837 | |||
| 922 | Ga0097620_100649518 | |||
| 923 | Ga0097620_100912251 | |||
| 924 | Ga0079104_1001696 | |||
| 925 | Ga0079104_1003541 | |||
| 926 | Ga0079104_1012559 | |||
| 927 | Ga0075435_100040874 | |||
| 928 | Ga0099795_10004776 | |||
| 929 | Ga0105251_10009864 | |||
| 930 | Ga0105251_10370928 | |||
| 931 | Ga0105244_10041712 | |||
| 932 | Ga0105244_10044643 | |||
| 933 | Ga0105250_10000475 | |||
| 934 | Ga0105240_10105653 | |||
| 935 | Ga0105240_10153993 | |||
| 936 | Ga0105240_10175619 | |||
| 937 | Ga0105240_10450333 | |||
| 938 | Ga0111539_10246411 | |||
| 939 | Ga0105247_10180550 | |||
| 940 | Ga0114129_10452475 | |||
| 941 | Ga0105243_10127919 | |||
| 942 | Ga0105243_10165154 | |||
| 943 | Ga0105243_10590152 | |||
| 944 | Ga0105241_10561534 | |||
| 945 | Ga0105242_10455296 | |||
| 946 | Ga0105248_10000445 | |||
| 947 | Ga0105248_10076019 | |||
| 948 | Ga0105248_10144214 | |||
| 949 | Ga0105248_11203223 | |||
| 950 | Ga0105237_10023936 | |||
| 951 | Ga0105237_10142234 | |||
| 952 | Ga0105237_11210506 | |||
| 953 | Ga0105238_10164944 | |||
| 954 | Ga0105238_10334315 | |||
| 955 | Ga0105249_10677986 | |||
| 956 | Ga0105249_10727191 | |||
| 957 | Ga0105147_100451 | |||
| 958 | Ga0099796_10004450 | |||
| 959 | Ga0099796_10028260 | |||
| 960 | Ga0099796_10075849 | |||
| 961 | Ga0105239_10010809 | |||
| 962 | Ga0105239_10242080 | |||
| 963 | Ga0157373_10258816 | |||
| 964 | Ga0157371_10032095 | |||
| 965 | Ga0157371_10083223 | |||
| 966 | Ga0157371_10202180 | |||
| 967 | Ga0157370_10008752 | |||
| 968 | Ga0157370_10011595 | |||
| 969 | Ga0157370_10079648 | |||
| 970 | Ga0157370_10636769 | |||
| 971 | Ga0157369_10025847 | |||
| 972 | Ga0157369_10082380 | |||
| 973 | Ga0157374_10044716 | |||
| 974 | Ga0157378_10936206 | |||
| 975 | Ga0163162_10012108 | |||
| 976 | Ga0163162_10172537 | |||
| 977 | Ga0157372_11316155 | |||
| 978 | Ga0157375_10016277 | |||
| 979 | Ga0163163_10469135 | |||
| 980 | Ga0157379_10003329 | |||
| 981 | Ga0182007_10019443 | |||
| 982 | Ga0182005_1144793 | |||
| 983 | Ga0183366_1002 | |||
| 984 | Ga0183370_1002 | |||
| 985 | Ga0183369_1002 | |||
| 986 | Ga0183368_1005 | |||
| 987 | Ga0163161_10332874 | |||
| 988 | Ga0213872_10000093 | |||
| 989 | Ga0213872_10000490 | |||
| 990 | Ga0213872_10035775 | |||
| 991 | Ga0213875_10036528 | |||
| 992 | Ga0228598_1001530 | |||
| 993 | Ga0209674_100003 | |||
| 994 | Ga0209672_104934 | |||
| 995 | Ga0209563_100141 | |||
| 996 | Ga0209677_100068 | |||
| 997 | Ga0209759_1000423 | |||
| 998 | Ga0209673_1008860 | |||
| 999 | Ga0209676_1000049 | |||
| 1000 | Ga0209758_1000126 | |||
| 1001 | Ga0209050_1000118 | |||
| 1002 | Ga0209050_1002175 | |||
| 1003 | Ga0209050_1007206 | |||
| 1004 | Ga0207426_1006988 | |||
| 1005 | Ga0209051_1012520 | |||
| 1006 | Ga0209051_1028849 | |||
| 1007 | Ga0209257_1000017 | |||
| 1008 | Ga0209257_1081915 | |||
| 1009 | Ga0207696_1000102 | |||
| 1010 | Ga0207655_1000050 | |||
| 1011 | Ga0207713_1003234 | |||
| 1012 | Ga0207713_1007592 | |||
| 1013 | Ga0207713_1010008 | |||
| 1014 | Ga0207713_1034261 | |||
| 1015 | Ga0207713_1037724 | |||
| 1016 | Ga0207713_1062235 | |||
| 1017 | Ga0207682_10046815 | |||
| 1018 | Ga0207682_10059042 | |||
| 1019 | Ga0207692_10025699 | |||
| 1020 | Ga0207688_10037219 | |||
| 1021 | Ga0207688_10076491 | |||
| 1022 | Ga0207647_10000214 | |||
| 1023 | Ga0207699_10169778 | |||
| 1024 | Ga0207699_10417052 | |||
| 1025 | Ga0207645_10003842 | |||
| 1026 | Ga0207645_10008045 | |||
| 1027 | Ga0207705_10298720 | |||
| 1028 | Ga0207684_10367423 | |||
| 1029 | Ga0207707_10045648 | |||
| 1030 | Ga0207707_10323779 | |||
| 1031 | Ga0207695_10295074 | |||
| 1032 | Ga0207695_10748603 | |||
| 1033 | Ga0207693_10048621 | |||
| 1034 | Ga0207693_10071974 | |||
| 1035 | Ga0207693_10133085 | |||
| 1036 | Ga0207663_10226097 | |||
| 1037 | Ga0207660_10173914 | |||
| 1038 | Ga0207657_10006963 | |||
| 1039 | Ga0207657_10141589 | |||
| 1040 | Ga0207649_10136089 | |||
| 1041 | Ga0207652_10175672 | |||
| 1042 | Ga0207694_10145346 | |||
| 1043 | Ga0207650_10017828 | |||
| 1044 | Ga0207650_10294106 | |||
| 1045 | Ga0207659_10045359 | |||
| 1046 | Ga0207659_10155103 | |||
| 1047 | Ga0207687_10263955 | |||
| 1048 | Ga0207687_10356245 | |||
| 1049 | Ga0207700_10124520 | |||
| 1050 | Ga0207700_10558911 | |||
| 1051 | Ga0207664_10089110 | |||
| 1052 | Ga0207664_10239628 | |||
| 1053 | Ga0207644_10033227 | |||
| 1054 | Ga0207644_10036754 | |||
| 1055 | Ga0207644_10060190 | |||
| 1056 | Ga0207690_10004649 | |||
| 1057 | Ga0207690_10022726 | |||
| 1058 | Ga0207690_10248754 | |||
| 1059 | Ga0207690_10364671 | |||
| 1060 | Ga0207706_10066449 | |||
| 1061 | Ga0207706_10285918 | |||
| 1062 | Ga0207709_10023791 | |||
| 1063 | Ga0207709_10093838 | |||
| 1064 | Ga0207670_10010092 | |||
| 1065 | Ga0207670_10089062 | |||
| 1066 | Ga0207670_10155224 | |||
| 1067 | Ga0207669_10034282 | |||
| 1068 | Ga0207669_10603336 | |||
| 1069 | Ga0207669_10695154 | |||
| 1070 | Ga0207704_10050758 | |||
| 1071 | Ga0207691_10012265 | |||
| 1072 | Ga0207691_10041907 | |||
| 1073 | Ga0207691_10053770 | |||
| 1074 | Ga0207711_10332058 | |||
| 1075 | Ga0207661_10257693 | |||
| 1076 | Ga0207661_10350052 | |||
| 1077 | Ga0207661_10665332 | |||
| 1078 | Ga0207667_10154009 | |||
| 1079 | Ga0207667_10351371 | |||
| 1080 | Ga0207667_10535255 | |||
| 1081 | Ga0207651_10004851 | |||
| 1082 | Ga0207651_10460359 | |||
| 1083 | Ga0207668_10665261 | |||
| 1084 | Ga0207640_10140243 | |||
| 1085 | Ga0207658_10001854 | |||
| 1086 | Ga0207658_10293172 | |||
| 1087 | Ga0207677_10026511 | |||
| 1088 | Ga0207703_10004753 | |||
| 1089 | Ga0207703_11125195 | |||
| 1090 | Ga0207639_10203980 | |||
| 1091 | Ga0207639_10295485 | |||
| 1092 | Ga0207639_10833009 | |||
| 1093 | Ga0207678_10002276 | |||
| 1094 | Ga0207678_10207607 | |||
| 1095 | Ga0207702_10053116 | |||
| 1096 | Ga0207702_10152927 | |||
| 1097 | Ga0207641_10607502 | |||
| 1098 | Ga0207648_10002295 | |||
| 1099 | Ga0207648_10136083 | |||
| 1100 | Ga0207674_10001229 | |||
| 1101 | Ga0207674_10013681 | |||
| 1102 | Ga0207674_10196505 | |||
| 1103 | Ga0207675_100023354 | |||
| 1104 | Ga0207683_10230825 | |||
| 1105 | Ga0207698_10565938 | |||
| 1106 | Ga0209281_1000283 | |||
| 1107 | Ga0209281_1000308 | |||
| 1108 | Ga0209281_1000994 | |||
| 1109 | Ga0209281_1001423 | |||
| 1110 | Ga0209371_1000013 | |||
| 1111 | Ga0209371_1000770 | |||
| 1112 | Ga0209974_10002757 | |||
| 1113 | Ga0207428_10546467 | |||
| 1114 | Ga0268266_10001726 | |||
| 1115 | Ga0268266_10044374 | |||
| 1116 | Ga0268266_10235400 | |||
| 1117 | Ga0268266_10516774 | |||
| 1118 | Ga0265334_10009277 | |||
| 1119 | Ga0265318_10007856 | |||
| 1120 | Ga0265336_10000053 | |||
| 1121 | Ga0307517_10000174 | |||
| 1122 | Ga0307517_10108074 | |||
| 1123 | Ga0307515_10001235 | |||
| 1124 | Ga0307515_10004451 | |||
| 1125 | Ga0307515_10132420 | |||
| 1126 | Ga0307515_10162890 | |||
| 1127 | Ga0307515_10246467 | |||
| 1128 | Ga0265324_10000132 | |||
| 1129 | Ga0268256_1000014 | |||
| 1130 | Ga0268256_1000647 | |||
| 1131 | Ga0307511_10094344 | |||
| 1132 | Ga0307512_10046505 | |||
| 1133 | Ga0307512_10184109 | |||
| 1134 | Ga0265328_10020326 | |||
| 1135 | Ga0265325_10030670 | |||
| 1136 | Ga0265325_10035978 | |||
| 1137 | Ga0265340_10001678 | |||
| 1138 | Ga0265339_10011043 | |||
| 1139 | Ga0265331_10006526 | |||
| 1140 | Ga0265327_10000012 | |||
| 1141 | Ga0265327_10003227 | |||
| 1142 | Ga0265327_10228751 | |||
| 1143 | Ga0265316_10036333 | |||
| 1144 | Ga0265316_10156124 | |||
| 1145 | Ga0307513_10014799 | |||
| 1146 | Ga0307513_10130230 | |||
| 1147 | Ga0307513_10195449 | |||
| 1148 | Ga0307509_10000225 | |||
| 1149 | Ga0307509_10005996 | |||
| 1150 | Ga0307509_10053865 | |||
| 1151 | Ga0307509_10067974 | |||
| 1152 | Ga0307408_100000010 | |||
| 1153 | Ga0307408_100908838 | |||
| 1154 | Ga0265313_10123248 | |||
| 1155 | Ga0307508_10000185 | |||
| 1156 | Ga0307508_10001432 | |||
| 1157 | Ga0307508_10002202 | |||
| 1158 | Ga0307508_10003035 | |||
| 1159 | Ga0307514_10049262 | |||
| 1160 | Ga0307514_10143758 | |||
| 1161 | Ga0316579_10277060 | |||
| 1162 | Ga0265314_10001531 | |||
| 1163 | Ga0265314_10035008 | |||
| 1164 | Ga0265314_10138293 | |||
| 1165 | Ga0265342_10042951 | |||
| 1166 | Ga0265342_10165792 | |||
| 1167 | Ga0307516_10001572 | |||
| 1168 | Ga0307516_10009757 | |||
| 1169 | Ga0307516_10259861 | |||
| 1170 | Ga0307405_10021739 | |||
| 1171 | Ga0307405_10185701 | |||
| 1172 | Ga0307413_10339359 | |||
| 1173 | Ga0307407_10026323 | |||
| 1174 | Ga0307409_100286400 | |||
| 1175 | Ga0307416_100851412 | |||
| 1176 | Ga0307507_10065803 | |||
| 1177 | Ga0307510_10002036 | |||
| 1178 | Ga0307510_10034205 | |||
| 1179 | Ga0373948_0005315 | |||
| 1180 | Ga0373926_0077703 | |||
| 1181 | Ga0373928_0010732 | |||
| 1182 | Ga0373940_0037180 | |||
| 1183 | Ga0373923_0076552 | |||
| 1184 | Ga0373932_0025863 | |||
| 1185 | Ga0373936_0024437 | |||
| 1186 | Ga0373939_0000036 | |||
| 1187 | Ga0373954_0011225 | |||
| 1188 | Ga0373956_0019348 | |||
| 1189 | Ga0373943_0034564 | |||
| 1190 | Ga0373943_0401850 | |||
| 1191 | Ga0373946_0084338 | |||
| 1192 | Ga0373962_0007469 | |||
| 1193 | Ga0316574_0538732 | |||
| 1194 | Ga0373931_0000268 | |||
| 1195 | Ga0373931_0008787 | |||
| 1196 | Ga0373931_0209948 | |||
| 1197 | Ga0373935_0104638 | |||
| 1198 | Ga0373927_0354282 | |||
| 1199 | Ga0373927_0477124 | |||
| 1200 | Ga0373933_0008201 | |||
| 1201 | Ga0373947_0394835 | |||
| 1202 | Ga0373937_0003306 | |||
| 1203 | Ga0373937_0023547 | |||
| 1204 | Ga0373937_0214132 | |||
| 1205 | Ga0373937_0325039 | |||
| 1206 | Ga0373925_0027268 | |||
| 1207 | Ga0373925_0096228 | |||
| 1208 | Ga0373925_0418139 | |||
| 1209 | Ga0395899_0002765 | |||
| 1210 | Ga0395899_0014664 | |||
| 1211 | Ga0395899_0076220 | |||
| 1212 | Ga0395900_0008007 | |||
| 1213 | Ga0395900_0015475 | |||
| 1214 | Ga0395900_0083557 | |||
| 1215 | Ga0395900_0139262 | |||
| 1216 | Ga0395900_0173885 | |||
| 1217 | Ga0395898_0006186 | |||
| 1218 | Ga0395898_0039633 | |||
| 1219 | Ga0395898_0148759 | |||
| 1220 | Ga0395898_0171308 | |||
| 1221 | Ga0395905_0000025 | |||
| 1222 | Ga0395905_0005980 | |||
| 1223 | Ga0395905_0008672 | |||
| 1224 | Ga0395905_0030958 | |||
| 1225 | Ga0395905_0050499 | |||
| 1226 | Ga0395905_0059042 | |||
| 1227 | Ga0395905_0069854 | |||
| 1228 | Ga0395905_0079244 | |||
| 1229 | Ga0395905_0504115 | |||
| 1230 | Ga0395905_0719640 | |||
| 1231 | Ga0395905_0755081 | |||
| 1232 | Ga0436364_0492175 | |||
| 1233 | Ga0436364_1360306 | |||
| 1234 | Ga0395901_0003336 | |||
| 1235 | Ga0395901_0043746 | |||
| 1236 | Ga0395901_0107006 | |||
| 1237 | Ga0395901_0174821 | |||
| 1238 | Ga0395901_0256096 | |||
| 1239 | Ga0395901_0537969 | |||
| 1240 | Ga0400490_19766 | |||
| 1241 | Ga0436365_1030367 | |||
| 1242 | Ga0436360_0103786 | |||
| 1243 | Ga0436360_0283312 | |||
| 1244 | Ga0436360_0649612 | |||
| 1245 | Ga0436360_0708127 | |||
| 1246 | Ga0436361_0058641 | |||
| 1247 | Ga0436361_0098550 | |||
| 1248 | Ga0436361_0289802 | |||
| 1249 | Ga0436361_0380155 | |||
| 1250 | Ga0436361_0410668 | |||
| 1251 | Ga0436361_0653184 | |||
| 1252 | Ga0436361_0766328 | |||
| 1253 | Ga0436361_1213797 | |||
| 1254 | Ga0436361_1214496 | |||
| 1255 | Ga0436363_0288717 | |||
| 1256 | Ga0436362_1051954 | |||
| 1257 | Ga0439447_055633 | |||
| 1258 | Ga0451789_0173976 | |||
| 1259 | Ga0451789_1258901 | |||
| 1260 | Ga0451791_1222017 | |||
| 1261 | Ga0451793_1887844 | |||
| 1262 | Ga0451798_0187906 | |||
| 1263 | Ga0451800_0997610 | |||
| 1264 | Ga0451853_0292917 | |||
| 1265 | Ga0439448_0044399 | |||
| 1266 | Ga0439452_000141 | |||
| 1267 | Ga0439452_000604 | |||
| 1268 | Ga0450901_000116 | |||
| 1269 | Ga0451577_0014637 | |||
| 1270 | Ga0451577_0038258 | |||
| 1271 | Ga0466969_0035833 | |||
| 1272 | Ga0466977_0001317 | |||
| 1273 | Ga0466981_0000001 | |||
| 1274 | Ga0466966_0002026 | |||
| 1275 | Ga0466966_0011911 | |||
| 1276 | Ga0466961_0045147 | |||
| 1277 | Ga0453684_0002411 | |||
| 1278 | Ga0453684_0002552 | |||
| 1279 | Ga0453684_0131908 | |||
| 1280 | Ga0466971_0006284 | |||
| 1281 | Ga0466968_0051102 | |||
| 1282 | Ga0466970_0034701 | |||
| 1283 | Ga0466959_0002381 | |||
| 1284 | Ga0466959_0024159 | |||
| 1285 | Ga0466959_0186178 | |||
| 1286 | Ga0451576_0021714 | |||
| 1287 | Ga0451576_0070312 | |||
| 1288 | Ga0466958_0143808 | |||
| 1289 | Ga0495592_0001312 | |||
| 1290 | Ga0495591_010516 | |||
| 1291 | Ga0495629_0062368 | |||
| 1292 | Ga0495629_0429184 | |||
| 1293 | Ga0495638_0111379 | |||
| 1294 | Ga0495638_0164268 | |||
| 1295 | Ga0495638_0229829 | |||
| 1296 | Ga0495651_0011915 | |||
| 1297 | Ga0495653_0069116 | |||
| 1298 | Ga0495650_0000040 | |||
| 1299 | Ga0495662_0076309 | |||
| 1300 | Ga0495583_0000159 | |||
| 1301 | Ga0495606_0005971 | |||
| 1302 | Ga0495608_0000180 | |||
| 1303 | Ga0495620_0011609 | |||
| 1304 | Ga0495628_0027713 | |||
| 1305 | Ga0495628_0212603 | |||
| 1306 | Ga0495630_0148899 | |||
| 1307 | Ga0495630_0449750 | |||
| 1308 | Ga0495632_0004601 | |||
| 1309 | Ga0495632_0012661 | |||
| 1310 | Ga0495644_0024463 | |||
| 1311 | Ga0495648_0057854 | |||
| 1312 | Ga0495666_0126634 | |||
| 1313 | Ga0495666_0136678 | |||
| 1314 | Ga0495652_0004484 | |||
| 1315 | Ga0495640_0011129 | |||
| 1316 | Ga0495645_0114971 | |||
| 1317 | Ga0495633_0003465 | |||
| 1318 | Ga0495667_0006865 | |||
| 1319 | Ga0495667_0012787 | |||
| 1320 | Ga0495635_0002686 | |||
| 1321 | Ga0495635_0095933 | |||
| 1322 | Ga0495657_0017312 | |||
| 1323 | Ga0495599_0066436 | |||
| 1324 | Ga0495599_0272136 | |||
| 1325 | Ga0495623_0014713 | |||
| 1326 | Ga0495646_0253970 | |||
| 1327 | Ga0495658_0032612 | |||
| 1328 | Ga0495624_0095731 | |||
| 1329 | Ga0495671_0016703 | |||
| 1330 | Ga0495671_0084130 | |||
| 1331 | Ga0495649_0000760 | |||
| 1332 | Ga0495649_0001240 | |||
| 1333 | Ga0495649_0005881 | |||
| 1334 | Ga0495589_0003499 | |||
| 1335 | Ga0495600_0005529 | |||
| 1336 | Ga0495604_0000241 | |||
| 1337 | Ga0495674_0017966 | |||
| 1338 | Ga0495674_0032889 | |||
| 1339 | Ga0495674_0149045 | |||
| 1340 | Ga0495672_0159004 | |||
| 1341 | Ga0495676_0213093 | |||
| 1342 | Ga0495680_0000994 | |||
| 1343 | Ga0495679_004962 | |||
| 1344 | Ga0495686_0004435 | |||
| 1345 | Ga0495602_0010667 | |||
| 1346 | Ga0495614_0251148 | |||
| 1347 | Ga0496101_0147970 | |||
| 1348 | Ga0496102_0007894 | |||
| 1349 | Ga0496104_0001702 | |||
| 1350 | Ga0496104_0130603 | |||
| 1351 | Ga0496104_0639924 | |||
| 1352 | Ga0496105_0054625 | |||
| 1353 | Ga0496105_0226223 | |||
| 1354 | Ga0496105_0379026 | |||
| 1355 | Ga0496109_0460024 | |||
| 1356 | Ga0496112_0031940 | |||
| 1357 | Ga0496112_0037322 | |||
| 1358 | Ga0496116_0001458 | |||
| 1359 | Ga0496116_0009281 | |||
| 1360 | Ga0496116_0026850 | |||
| 1361 | Ga0496116_0045377 | |||
| 1362 | Ga0496117_0008694 | |||
| 1363 | Ga0496117_0016174 | |||
| 1364 | Ga0496117_0112497 | |||
| 1365 | Ga0496117_0128221 | |||
| 1366 | Ga0496118_0002802 | |||
| 1367 | Ga0496118_0022466 | |||
| 1368 | Ga0496118_0035786 | |||
| 1369 | Ga0496118_0038436 | |||
| 1370 | Ga0496118_0040266 | |||
| 1371 | Ga0496118_0073071 | |||
| 1372 | Ga0496118_0153551 | |||
| 1373 | Ga0496118_0215287 | |||
| 1374 | Ga0496119_0000438 | |||
| 1375 | Ga0496119_0006572 | |||
| 1376 | Ga0496119_0009447 | |||
| 1377 | Ga0496119_0009582 | |||
| 1378 | Ga0496119_0020054 | |||
| 1379 | Ga0496119_0093129 | |||
| 1380 | Ga0496119_0185548 | |||
| 1381 | Ga0496119_0196127 | |||
| 1382 | Ga0496119_0205455 | |||
| 1383 | Ga0496120_0006993 | |||
| 1384 | Ga0496120_0015782 | |||
| 1385 | Ga0496120_0017901 | |||
| 1386 | Ga0496120_0035404 | |||
| 1387 | Ga0496120_0076836 | |||
| 1388 | Ga0496120_0107954 | |||
| 1389 | Ga0496120_0109698 | |||
| 1390 | Ga0496120_0286958 | |||
| 1391 | Ga0496121_0000729 | |||
| 1392 | Ga0496121_0004852 | |||
| 1393 | Ga0496121_0014724 | |||
| 1394 | Ga0496121_0022172 | |||
| 1395 | Ga0496121_0082677 | |||
| 1396 | Ga0496121_0180201 | |||
| 1397 | Ga0496121_0381877 | |||
| 1398 | Ga0496121_0405139 | |||
| 1399 | Ga0496121_0424121 | |||
| 1400 | Ga0496122_0008944 | |||
| 1401 | Ga0496122_0025170 | |||
| 1402 | Ga0496122_0059803 | |||
| 1403 | Ga0496122_0120875 | |||
| 1404 | Ga0496122_0127356 | |||
| 1405 | Ga0496123_0020285 | |||
| 1406 | Ga0496123_0024494 | |||
| 1407 | Ga0496123_0040172 | |||
| 1408 | Ga0496123_0051988 | |||
| 1409 | Ga0496123_0062130 | |||
| 1410 | Ga0496123_0074150 | |||
| 1411 | Ga0496123_0287337 | |||
| 1412 | Ga0496123_0296620 | |||
| 1413 | Ga0496124_0000458 | |||
| 1414 | Ga0496124_0000649 | |||
| 1415 | Ga0496124_0004557 | |||
| 1416 | Ga0496124_0043082 | |||
| 1417 | Ga0496124_0109668 | |||
| 1418 | Ga0496124_0115509 | |||
| 1419 | Ga0496124_0122443 | |||
| 1420 | Ga0496124_0157997 | |||
| 1421 | Ga0496124_0178151 | |||
| 1422 | Ga0496124_0524040 | |||
| 1423 | Ga0496124_0574994 | |||
| 1424 | Ga0496125_0000176 | |||
| 1425 | Ga0496125_0000370 | |||
| 1426 | Ga0496125_0000522 | |||
| 1427 | Ga0496125_0004254 | |||
| 1428 | Ga0496125_0035699 | |||
| 1429 | Ga0496125_0039207 | |||
| 1430 | Ga0496125_0188964 | |||
| 1431 | Ga0496125_0189365 | |||
| 1432 | Ga0496126_0000329 | |||
| 1433 | Ga0496126_0006943 | |||
| 1434 | Ga0496126_0023134 | |||
| 1435 | Ga0496126_0036180 | |||
| 1436 | Ga0496126_0038207 | |||
| 1437 | Ga0496126_0085578 | |||
| 1438 | Ga0496126_0216132 | |||
| 1439 | Ga0496126_0254378 | |||
| 1440 | Ga0496126_0332932 | |||
| 1441 | Ga0496126_0772766 | |||
| 1442 | Ga0501031_0438289 | |||
| 1443 | Ga0501032_0274596 | |||
| 1444 | Ga0501034_0000891 | |||
| 1445 | Ga0501036_0043205 | |||
| 1446 | Ga0501038_0832475 | |||
| 1447 | Ga0501039_0853863 | |||
| 1448 | Ga0501042_0167530 | |||
| 1449 | Ga0501070_0458664 | |||
| 1450 | Ga0501070_0717050 | |||
| 1451 | Ga0501071_0213511 | |||
| 1452 | Ga0501072_0580051 | |||
| 1453 | Ga0501073_0005280 | |||
| 1454 | Ga0501074_0164829 | |||
| 1455 | Ga0501074_0279470 | |||
| 1456 | Ga0501206_005345 | |||
| 1457 | Ga0501080_0277255 | |||
| 1458 | Ga0501081_0080810 | |||
| 1459 | nmdc:mga03683_2170_c2 | |||
| 1460 | nmdc:mga03n38_25584_c1 | |||
| 1461 | nmdc:mga00v17_108561_c1 | |||
| 1462 | nmdc:mga00v17_281313_c1 | |||
| 1463 | nmdc:mga0k408_1297_c2 | |||
| 1464 | nmdc:mga0k408_157438_c1 | |||
| 1465 | nmdc:mga0k408_208903_c2 | |||
| 1466 | nmdc:mga0k408_6099_c1 | |||
| 1467 | nmdc:mga07m45_183995_c1 | |||
| 1468 | nmdc:mga07m45_278375_c1 | |||
| 1469 | nmdc:mga07m45_748_c1 | |||
| 1470 | nmdc:mga05p37_296340_c1 | |||
| 1471 | nmdc:mga05p37_441880_c1 | |||
| 1472 | nmdc:mga05p37_645950_c1 | |||
| 1473 | nmdc:mga05p37_942100_c1 | |||
| 1474 | nmdc:mga09592_2859_c1 | |||
| 1475 | nmdc:mga0qj67_577334_c1 | |||
| 1476 | nmdc:mga0qj67_92402_c1 | |||
| 1477 | nmdc:mga06r32_341153_c1 | |||
| 1478 | nmdc:mga08y16_192145_c1 | |||
| 1479 | nmdc:mga08y16_587640_c1 | |||
| 1480 | nmdc:mga08y16_635362_c1 | |||
| 1481 | nmdc:mga0n895_354078_c1 | |||
| 1482 | nmdc:mga08x19_362063_c1 | |||
| 1483 | nmdc:mga0a205_211457_c1 | |||
| 1484 | nmdc:mga0sz30_20944_c1 | |||
| 1485 | nmdc:mga0sz30_2490_c1 | |||
| 1486 | Ga0495601_0001571 | |||
| 1487 | Ga0495601_0002038 | |||
| 1488 | Ga0495612_0000746 | |||
| 1489 | Ga0500635_0000363 | |||
| 1490 | Ga0495595_0000387 | |||
| 1491 | Ga0495595_0057549 | |||
| 1492 | Ga0495595_0430811 | |||
| 1493 | Ga0495619_0030742 | |||
| 1494 | Ga0495619_0036207 | |||
| 1495 | Ga0500578_0000079 | |||
| 1496 | Ga0500643_008711 | |||
| 1497 | Ga0500644_0001074 | |||
| 1498 | Ga0500651_0092267 | |||
| 1499 | Ga0500593_041066 | |||
| 1500 | Ga0500594_0001408 | |||
| 1501 | Ga0500594_0004863 | |||
| 1502 | Ga0500595_000029 | |||
| 1503 | Ga0500607_197285 | |||
| 1504 | Ga0500652_000624 | |||
| 1505 | Ga0500652_107925 | |||
| 1506 | Ga0500658_0006331 | |||
| 1507 | Ga0500658_0017060 | |||
| 1508 | Ga0500658_0067760 | |||
| 1509 | Ga0500559_0000329 | |||
| 1510 | Ga0500559_0050482 | |||
| 1511 | Ga0500588_0006411 | |||
| 1512 | Ga0500616_0000006 | |||
| 1513 | Ga0500616_0001264 | |||
| 1514 | Ga0500622_0000053 | |||
| 1515 | Ga0500622_0007462 | |||
| 1516 | Ga0500622_0093747 | |||
| 1517 | Ga0500636_0015032 | |||
| 1518 | Ga0500636_0070250 | |||
| 1519 | Ga0500645_000614 | |||
| 1520 | Ga0501082_0071314 | |||
| 1521 | Ga0466962_0005900 | |||
| 1522 | 2515679265 | |||
| 1523 | 2555247152 | |||
| 1524 | 2587728133 | |||
| 1525 | 2587731191 | |||
| 1526 | 2587759971 | |||
| 1527 | 2588289944 | |||
| 1528 | 2603644192 | |||
| 1529 | 2603701264 | |||
| 1530 | 2603704784 | |||
| 1531 | 2643742396 | |||
| 1532 | 2643933639 | |||
| 1533 | 2643972266 | |||
| 1534 | 2644141623 | |||
| 1535 | 2644222023 | |||
| 1536 | 2644257198 | |||
| 1537 | 2644275606 | |||
| 1538 | 2644302863 | |||
| 1539 | 2644315139 | |||
| 1540 | 2671104682 | |||
| 1541 | 2681997965 | |||
| 1542 | 2682008076 | |||
| 1543 | 2723875890 | |||
| 1544 | 2738819916 | |||
| 1545 | 2738832396 | |||
| 1546 | 2738873923 | |||
| 1547 | 2739055249 | |||
| 1548 | 2739185553 | |||
| 1549 | 2739220521 | |||
| 1550 | 2739349258 | |||
| 1551 | 2753857597 | |||
| 1552 | 2765590703 | |||
| 1553 | 2775540265 | |||
| 1554 | 2792841161 | |||
| 1555 | 2821120579 | |||
| 1556 | 2821444350 | |||
| 1557 | 2823376466 | |||
| 1558 | 2834641739 | |||
| 1559 | 2835312758 | |||
| 1560 | 2840883231 | |||
| 1561 | 2842779705 | |||
| 1562 | 2881102725 | |||
| 1563 | 2882461725 | |||
| 1564 | 2894027582 | |||
| 1565 | 2902683277 | |||
| 1566 | 2927836932 | |||
| 1567 | 2932424875 | |||
| 1568 | 2937543970 | |||
| 1569 | 2939576448 | |||
| 1570 | 2941533317 | |||
| 1571 | 2990710368 | |||
| 1572 | 642422891 | |||
| 1573 | 8001525934 | |||
| 1574 | 8003402777 | |||
| 1575 | 8018223270 | |||
| 1576 | 8019560230 | |||
| 1577 | 8019570330 | |||
| 1578 | 8052497667 | |||
| 1579 | 8054931894 | |||
| 1580 | 8056123581 | |||
| 1581 | 8056140736 | |||
| 1582 | 8057308326 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xkt-assembly1.cif.gz_B | klebsiella pneumoniae ureg in complex with gmppnp and nickel | 0.9351 | 6 | 202 |
| 5xkt-assembly1.cif.gz_B | klebsiella pneumoniae ureg in complex with gmppnp and nickel | 0.9215 | 6 | 202 |
| 4hi0-assembly1.cif.gz_F | crystal structure of helicobacter pylori urease accessory protein uref/h/g complex | 0.9155 | 8 | 198 |
| 4hi0-assembly1.cif.gz_F | crystal structure of helicobacter pylori urease accessory protein uref/h/g complex | 0.8889 | 8 | 198 |
| 2hf9-assembly1.cif.gz_A | crystal structure of hypb from methanocaldococcus jannaschii in the triphosphate form | 0.856 | 6 | 200 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O64700_71_266_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9241 | 5 | 200 | 3.40.50.300 |
| af_O64700_71_266_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9151 | 5 | 200 | 3.40.50.300 |
| 2wsmA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.849 | 6 | 204 | 3.40.50.300 |
| af_P0AAN3_68_289_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8397 | 6 | 200 | 3.40.50.300 |
| 4lpsB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8211 | 6 | 200 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1Z988-F1-model_v4 | Urease accessory protein UreG | 0.9438 | 124 | 202 |
GO:0003924
GO:0005525 GO:0016151 GO:0043419 |
| AF-A0A830DDA0-F1-model_v4 | Urease accessory protein g | 0.9427 | 6 | 200 |
GO:0003924
GO:0005525 GO:0016151 GO:0043419 |
| AF-A0A7K4DRQ4-F1-model_v4 | Urease accessory protein UreG | 0.9408 | 118 | 203 |
GO:0003924
GO:0005525 GO:0016151 GO:0043419 |
| AF-A0A6N6PVF4-F1-model_v4 | Urease accessory protein UreG | 0.9397 | 114 | 200 |
GO:0003924
GO:0005525 GO:0016151 GO:0043419 |
| AF-A0A6A8FMF7-F1-model_v4 | Urease accessory protein UreG | 0.9377 | 123 | 198 |
GO:0003924
GO:0005525 GO:0016151 GO:0043419 |