F480982

General Info

Members Datasets Scaffolds Average Seq Length
791 451 1582 210

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10300847|Ga0157376_103008472
Length 236
Sequence MACSPRARPAVPEERRHADNRAMSTLHHIANRTRRLPPLRVGVGGPVGSGKTTLVEMLCKAMRERYDLVVVTNDIYTKEDQRLLTVAGALEAERIMGVETGGCPHTAIREDASINLEAVDRMLEKFPNADIVFIESGGDNLAATFSPELSDLTIYVIDVAAGEKIPRKGGPGITKSDLFVINKTDLAPYVGANLDVMAADTKRMRGARPFVMSNLKTHDGLADVVKFIETKGMLVS

Samples

Sample ID Description Type Environment
1 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
114 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
115 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
116 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
117 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
120 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
121 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
122 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
127 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
130 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
186 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
191 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
192 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
193 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
194 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
195 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
196 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
197 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
198 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
199 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
200 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
201 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
202 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
203 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
204 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
205 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
206 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
207 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
208 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
209 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
210 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
211 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
212 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
213 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
214 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
215 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
216 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
217 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
218 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
219 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
222 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
223 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
224 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
225 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
226 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
227 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
229 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
231 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
232 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
233 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
234 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
235 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
236 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
237 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
238 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
240 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
241 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
247 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
248 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
249 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
250 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
251 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
252 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
253 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
254 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
255 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
256 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
257 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
258 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
259 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
260 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
261 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
262 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
263 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
264 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
265 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
266 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
267 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
268 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
269 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
270 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
271 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
272 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
273 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
274 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
275 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
276 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
277 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
278 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
279 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
280 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
281 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
282 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
283 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
284 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
285 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
286 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
287 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
288 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
289 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
290 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
291 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
292 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
293 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
294 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
295 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
296 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
297 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
298 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
299 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
300 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
301 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
302 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
303 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
304 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
305 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
306 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
307 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
308 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
309 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
310 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
311 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
312 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
313 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
314 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
315 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
316 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
317 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
318 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
319 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
320 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
321 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
322 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
323 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
324 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
325 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
326 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
327 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
328 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
329 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
330 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
331 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
332 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
333 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
334 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
335 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
336 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
337 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
338 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
339 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
347 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
348 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
349 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
350 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
351 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
352 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
353 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
354 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
355 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
356 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
357 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
358 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
359 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
360 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
361 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
362 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
363 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
364 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
365 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
366 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
367 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
368 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
369 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
370 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
371 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
372 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
373 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
374 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
375 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
376 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
377 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
378 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
379 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
380 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
381 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
382 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
383 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
384 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
385 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
386 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
387 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
388 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
389 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
390 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
391 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
392 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
393 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
394 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
395 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
396 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
397 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
398 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
399 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
400 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
401 2643221585 Pelomonas sp. Root662 Isolate Unclassified
402 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
403 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
404 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
405 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
406 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
407 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
408 2643221656 Pelomonas sp. Root405 Isolate Unclassified
409 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
410 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
411 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
412 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
413 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
414 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
415 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
416 2738541337 Pelomonas sp. BT06 Isolate Unclassified
417 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
418 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
419 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
420 2751185917 Enterobacter sp. HK169 Isolate Unclassified
421 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
422 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
423 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
424 2821118458 Enterobacter asburiae 609 Isolate Unclassified
425 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
426 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
427 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
428 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
429 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
430 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
431 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
432 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
433 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
434 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
435 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
436 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
437 2937539931 Pantoea sp. LS15 Isolate Unclassified
438 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
439 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
440 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
441 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
442 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
443 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
444 8018221730 Enterobacter sp. CM29 Isolate Unclassified
445 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
446 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
447 8052494512 Pseudomonas putida LD6 Isolate Unclassified
448 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
449 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
450 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
451 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.29
Metatranscriptomes 0
Isolates 7.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.73
Nodule 1.64
Rhizoplane 3.03
Rhizosphere 65.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157376_10300847 3300014969 Bacteria 1518
2 SwRhRL2b_contig_2783974 2162886007 Bacteria 2010
3 JGI24735J21928_10019472 3300002067 Bacteria 2086
4 JGI25153J46596_10012485 3300003215 Bacteria 3661
5 JGI25160J50197_1001200 3300003354 Bacteria 13170
6 JGI26145J50221_1007868 3300003371 Bacteria 910
7 Ga0055539_1000240 3300003752 Bacteria 36494
8 Ga0055533_1000103 3300003756 Bacteria 107860
9 Ga0055525_1000928 3300003759 Bacteria 8265
10 Ga0055526_1003050 3300003771 Bacteria 10883
11 Ga0055530_10012719 3300003791 Bacteria 2916
12 Ga0055530_10051163 3300003791 Bacteria 959
13 Ga0055531_10000390 3300003794 Bacteria 42387
14 Ga0058692_1002816 3300003856 Bacteria 5707
15 Ga0065165_1000791 3300005262 Bacteria 42372
16 Ga0065165_1001455 3300005262 Bacteria 25574
17 Ga0065704_10002058 3300005289 Bacteria 11509
18 Ga0065704_10077807 3300005289 Bacteria 4614
19 Ga0070658_10224317 3300005327 Bacteria 1590
20 Ga0070658_10271096 3300005327 Bacteria 1443
21 Ga0070676_10008197 3300005328 Bacteria 5623
22 Ga0070683_100022610 3300005329 Bacteria 5622
23 Ga0070690_100166308 3300005330 Bacteria 1515
24 Ga0070670_100024111 3300005331 Bacteria 5234
25 Ga0070670_100090066 3300005331 Bacteria 2637
26 Ga0070677_10025585 3300005333 Bacteria 2204
27 Ga0070677_10060999 3300005333 Bacteria 1556
28 Ga0068869_100656979 3300005334 Bacteria 890
29 Ga0070682_100002901 3300005337 Bacteria 9515
30 Ga0070689_100010287 3300005340 Bacteria 6668
31 Ga0070689_100040016 3300005340 Bacteria 3592
32 Ga0070661_100017322 3300005344 Bacteria 5110
33 Ga0070692_10139728 3300005345 Bacteria 1370
34 Ga0070668_100611455 3300005347 Bacteria 954
35 Ga0070669_100143237 3300005353 Bacteria 1844
36 Ga0070675_100020118 3300005354 Bacteria 5326
37 Ga0070675_100030521 3300005354 Bacteria 4352
38 Ga0070675_100066853 3300005354 Bacteria 2973
39 Ga0070671_100014561 3300005355 Bacteria 6360
40 Ga0070671_100039548 3300005355 Bacteria 3914
41 Ga0070671_100059923 3300005355 Bacteria 3168
42 Ga0070674_100009918 3300005356 Bacteria 5733
43 Ga0070674_100367341 3300005356 Bacteria 1167
44 Ga0070674_100437539 3300005356 Bacteria 1077
45 Ga0070673_100006916 3300005364 Bacteria 7420
46 Ga0070673_100197786 3300005364 Bacteria 1730
47 Ga0070688_100319448 3300005365 Bacteria 1128
48 Ga0070688_100406353 3300005365 Bacteria 1009
49 Ga0070659_100026425 3300005366 Bacteria 4468
50 Ga0070659_100657921 3300005366 Bacteria 904
51 Ga0070667_100005361 3300005367 Bacteria 10710
52 Ga0070667_100343716 3300005367 Bacteria 1350
53 Ga0070667_100923990 3300005367 Bacteria 813
54 Ga0070709_10433646 3300005434 Bacteria 987
55 Ga0070714_100175896 3300005435 Bacteria 1945
56 Ga0070714_100493235 3300005435 Bacteria 1167
57 Ga0070714_100991413 3300005435 Bacteria 817
58 Ga0070711_100062131 3300005439 Bacteria 2603
59 Ga0070708_100161995 3300005445 Bacteria 2085
60 Ga0070663_100006550 3300005455 Bacteria 7017
61 Ga0070663_100206784 3300005455 Bacteria 1535
62 Ga0070678_100591590 3300005456 Bacteria 989
63 Ga0070662_100282844 3300005457 Bacteria 1343
64 Ga0070681_10041779 3300005458 Bacteria 4597
65 Ga0070681_10121927 3300005458 Bacteria 2541
66 Ga0070681_10220109 3300005458 Bacteria 1813
67 Ga0068867_100004166 3300005459 Bacteria 10173
68 Ga0068867_100877485 3300005459 Bacteria 806
69 Ga0070706_100032893 3300005467 Bacteria 4784
70 Ga0070707_100059206 3300005468 Bacteria 3674
71 Ga0070707_100153192 3300005468 Bacteria 2245
72 Ga0070698_100040887 3300005471 Bacteria 4762
73 Ga0070698_100321592 3300005471 Bacteria 1478
74 Ga0070679_100214268 3300005530 Bacteria 1889
75 Ga0070679_100287627 3300005530 Bacteria 1595
76 Ga0070684_100021897 3300005535 Bacteria 5324
77 Ga0070684_100681333 3300005535 Bacteria 958
78 Ga0070697_100188949 3300005536 Bacteria 1748
79 Ga0068853_100095434 3300005539 Bacteria 2622
80 Ga0068853_100216637 3300005539 Bacteria 1747
81 Ga0070672_100001714 3300005543 Bacteria 13688
82 Ga0070672_100222147 3300005543 Bacteria 1585
83 Ga0070672_100248109 3300005543 Bacteria 1499
84 Ga0070672_100323332 3300005543 Bacteria 1311
85 Ga0070665_100001160 3300005548 Bacteria 32371
86 Ga0070665_100116464 3300005548 Bacteria 2675
87 Ga0070665_100547140 3300005548 Bacteria 1170
88 Ga0068855_100355520 3300005563 Bacteria 1613
89 Ga0068855_100395977 3300005563 Bacteria 1514
90 Ga0068857_100000005 3300005577 Bacteria 170248
91 Ga0068857_100076664 3300005577 Bacteria 2982
92 Ga0068854_100093824 3300005578 Bacteria 2238
93 Ga0068854_100219094 3300005578 Bacteria 1505
94 Ga0068856_100008321 3300005614 Bacteria 10107
95 Ga0068852_100742228 3300005616 Bacteria 993
96 Ga0068859_100024837 3300005617 Bacteria 6015
97 Ga0068859_100649608 3300005617 Bacteria 1147
98 Ga0068870_10259450 3300005840 Bacteria 1081
99 Ga0068863_100214953 3300005841 Bacteria 1852
100 Ga0068858_100004350 3300005842 Bacteria 13897
101 Ga0068860_100239700 3300005843 Bacteria 1764
102 Ga0081455_10000723 3300005937 Bacteria 42827
103 Ga0081455_10051537 3300005937 Bacteria 3530
104 Ga0081455_10276508 3300005937 Bacteria 1215
105 Ga0081538_10033312 3300005981 Bacteria 3432
106 Ga0070716_100101169 3300006173 Bacteria 1767
107 Ga0070712_100029765 3300006175 Bacteria 3663
108 Ga0070712_100166724 3300006175 Bacteria 1706
109 Ga0075362_10011088 3300006177 Bacteria 3542
110 Ga0075362_10011491 3300006177 Bacteria 3489
111 Ga0075362_10171481 3300006177 Bacteria 1048
112 Ga0075369_10000532 3300006186 Bacteria 12019
113 Ga0075366_10006382 3300006195 Bacteria 6459
114 Ga0075366_10014006 3300006195 Bacteria 4574
115 Ga0075366_10193263 3300006195 Bacteria 1237
116 Ga0075366_10195147 3300006195 Bacteria 1231
117 Ga0075366_10222599 3300006195 Bacteria 1150
118 Ga0075370_10002042 3300006353 Bacteria 9165
119 Ga0075370_10096345 3300006353 Bacteria 1710
120 Ga0075370_10129531 3300006353 Bacteria 1472
121 Ga0068871_100089638 3300006358 Bacteria 2560
122 Ga0075428_100140266 3300006844 Bacteria 2628
123 Ga0075430_100037022 3300006846 Bacteria 4136
124 Ga0075431_100098152 3300006847 Bacteria 3024
125 Ga0075434_100468682 3300006871 Bacteria 1281
126 Ga0075429_100002479 3300006880 Bacteria 15530
127 Ga0075429_100368044 3300006880 Bacteria 1259
128 Ga0068865_100059814 3300006881 Bacteria 2666
129 Ga0075436_100169485 3300006914 Bacteria 1542
130 Ga0097620_100024837 3300006931 Bacteria 6015
131 Ga0097620_100649518 3300006931 Bacteria 1147
132 Ga0097620_100912251 3300006931 Bacteria 963
133 Ga0079104_1001696 3300006946 Bacteria 14094
134 Ga0079104_1003541 3300006946 Bacteria 7185
135 Ga0079104_1012559 3300006946 Bacteria 2654
136 Ga0075435_100040874 3300007076 Bacteria 3705
137 Ga0099795_10004776 3300007788 Bacteria 3532
138 Ga0105251_10009864 3300009011 Bacteria 5596
139 Ga0105251_10370928 3300009011 Bacteria 655
140 Ga0105244_10041712 3300009036 Bacteria 2377
141 Ga0105244_10044643 3300009036 Bacteria 2282
142 Ga0105250_10000475 3300009092 Bacteria 28364
143 Ga0105240_10105653 3300009093 Bacteria 3418
144 Ga0105240_10153993 3300009093 Bacteria 2736
145 Ga0105240_10175619 3300009093 Bacteria 2532
146 Ga0105240_10450333 3300009093 Bacteria 1441
147 Ga0111539_10246411 3300009094 Bacteria 2080
148 Ga0105247_10180550 3300009101 Bacteria 1408
149 Ga0114129_10452475 3300009147 Bacteria 1684
150 Ga0105243_10127919 3300009148 Bacteria 2151
151 Ga0105243_10165154 3300009148 Bacteria 1912
152 Ga0105243_10590152 3300009148 Bacteria 1068
153 Ga0105241_10561534 3300009174 Bacteria 1026
154 Ga0105242_10455296 3300009176 Bacteria 1207
155 Ga0105248_10000445 3300009177 Bacteria 46980
156 Ga0105248_10076019 3300009177 Bacteria 3775
157 Ga0105248_10144214 3300009177 Bacteria 2687
158 Ga0105248_11203223 3300009177 Bacteria 857
159 Ga0105237_10023936 3300009545 Bacteria 6250
160 Ga0105237_10142234 3300009545 Bacteria 2393
161 Ga0105237_11210506 3300009545 Bacteria 762
162 Ga0105238_10164944 3300009551 Bacteria 2191
163 Ga0105238_10334315 3300009551 Bacteria 1502
164 Ga0105249_10677986 3300009553 Bacteria 1090
165 Ga0105249_10727191 3300009553 Bacteria 1054
166 Ga0105147_100451 3300009982 Bacteria 3415
167 Ga0099796_10004450 3300010159 Bacteria 3390
168 Ga0099796_10028260 3300010159 Bacteria 1799
169 Ga0099796_10075849 3300010159 Bacteria 1223
170 Ga0105239_10010809 3300010375 Bacteria 10197
171 Ga0105239_10242080 3300010375 Bacteria 2025
172 Ga0157373_10258816 3300013100 Bacteria 1231
173 Ga0157371_10032095 3300013102 Bacteria 3780
174 Ga0157371_10083223 3300013102 Bacteria 2266
175 Ga0157371_10202180 3300013102 Bacteria 1424
176 Ga0157370_10008752 3300013104 Bacteria 10884
177 Ga0157370_10011595 3300013104 Bacteria 9202
178 Ga0157370_10079648 3300013104 Bacteria 3085
179 Ga0157370_10636769 3300013104 Bacteria 975
180 Ga0157369_10025847 3300013105 Bacteria 6513
181 Ga0157369_10082380 3300013105 Bacteria 3442
182 Ga0157374_10044716 3300013296 Bacteria 4093
183 Ga0157378_10936206 3300013297 Bacteria 898
184 Ga0163162_10012108 3300013306 Bacteria 8417
185 Ga0163162_10172537 3300013306 Bacteria 2287
186 Ga0157372_11316155 3300013307 Bacteria 834
187 Ga0157375_10016277 3300013308 Bacteria 6673
188 Ga0163163_10469135 3300014325 Bacteria 1319
189 Ga0157379_10003329 3300014968 Bacteria 13618
190 Ga0182007_10019443 3300015262 Bacteria 2441
191 Ga0182005_1144793 3300015265 Bacteria 688
192 Ga0183366_1002 3300015679 Bacteria 791639
193 Ga0183370_1002 3300015680 Bacteria 791639
194 Ga0183369_1002 3300015685 Bacteria 791621
195 Ga0183368_1005 3300015687 Bacteria 791621
196 Ga0163161_10332874 3300017792 Bacteria 1203
197 Ga0213872_10000093 3300021361 Bacteria 83513
198 Ga0213872_10000490 3300021361 Bacteria 31612
199 Ga0213872_10035775 3300021361 Bacteria 2270
200 Ga0213875_10036528 3300021388 Bacteria 2317
201 Ga0228598_1001530 3300024227 Bacteria 5068
202 Ga0209674_100003 3300025226 Bacteria 2196646
203 Ga0209672_104934 3300025228 Bacteria 2371
204 Ga0209563_100141 3300025230 Bacteria 79513
205 Ga0209677_100068 3300025253 Bacteria 146135
206 Ga0209759_1000423 3300025256 Bacteria 51547
207 Ga0209673_1008860 3300025273 Bacteria 4430
208 Ga0209676_1000049 3300025292 Bacteria 403210
209 Ga0209758_1000126 3300025297 Bacteria 189761
210 Ga0209050_1000118 3300025298 Bacteria 202586
211 Ga0209050_1002175 3300025298 Bacteria 17709
212 Ga0209050_1007206 3300025298 Bacteria 6314
213 Ga0207426_1006988 3300025302 Bacteria 4795
214 Ga0209051_1012520 3300025303 Bacteria 4098
215 Ga0209051_1028849 3300025303 Bacteria 2183
216 Ga0209257_1000017 3300025304 Bacteria 866287
217 Ga0209257_1081915 3300025304 Bacteria 826
218 Ga0207696_1000102 3300025711 Bacteria 167962
219 Ga0207655_1000050 3300025728 Bacteria 294923
220 Ga0207713_1003234 3300025735 Bacteria 11245
221 Ga0207713_1007592 3300025735 Bacteria 6363
222 Ga0207713_1010008 3300025735 Bacteria 5289
223 Ga0207713_1034261 3300025735 Bacteria 2208
224 Ga0207713_1037724 3300025735 Bacteria 2058
225 Ga0207713_1062235 3300025735 Bacteria 1416
226 Ga0207682_10046815 3300025893 Bacteria 1778
227 Ga0207682_10059042 3300025893 Bacteria 1602
228 Ga0207692_10025699 3300025898 Bacteria 2754
229 Ga0207688_10037219 3300025901 Bacteria 2698
230 Ga0207688_10076491 3300025901 Bacteria 1906
231 Ga0207647_10000214 3300025904 Bacteria 47271
232 Ga0207699_10169778 3300025906 Bacteria 1459
233 Ga0207699_10417052 3300025906 Bacteria 958
234 Ga0207645_10003842 3300025907 Bacteria 11246
235 Ga0207645_10008045 3300025907 Bacteria 7397
236 Ga0207705_10298720 3300025909 Bacteria 1235
237 Ga0207684_10367423 3300025910 Bacteria 1238
238 Ga0207707_10045648 3300025912 Bacteria 3818
239 Ga0207707_10323779 3300025912 Bacteria 1330
240 Ga0207695_10295074 3300025913 Bacteria 1513
241 Ga0207695_10748603 3300025913 Bacteria 857
242 Ga0207693_10048621 3300025915 Bacteria 3330
243 Ga0207693_10071974 3300025915 Bacteria 2706
244 Ga0207693_10133085 3300025915 Bacteria 1954
245 Ga0207663_10226097 3300025916 Bacteria 1364
246 Ga0207660_10173914 3300025917 Bacteria 1668
247 Ga0207657_10006963 3300025919 Bacteria 11647
248 Ga0207657_10141589 3300025919 Bacteria 1965
249 Ga0207649_10136089 3300025920 Bacteria 1675
250 Ga0207652_10175672 3300025921 Bacteria 1923
251 Ga0207694_10145346 3300025924 Bacteria 1909
252 Ga0207650_10017828 3300025925 Bacteria 4974
253 Ga0207650_10294106 3300025925 Bacteria 1325
254 Ga0207659_10045359 3300025926 Bacteria 3099
255 Ga0207659_10155103 3300025926 Bacteria 1792
256 Ga0207687_10263955 3300025927 Bacteria 1374
257 Ga0207687_10356245 3300025927 Bacteria 1193
258 Ga0207700_10124520 3300025928 Bacteria 2095
259 Ga0207700_10558911 3300025928 Bacteria 1016
260 Ga0207664_10089110 3300025929 Bacteria 2526
261 Ga0207664_10239628 3300025929 Bacteria 1579
262 Ga0207644_10033227 3300025931 Bacteria 3603
263 Ga0207644_10036754 3300025931 Bacteria 3440
264 Ga0207644_10060190 3300025931 Bacteria 2748
265 Ga0207690_10004649 3300025932 Bacteria 8119
266 Ga0207690_10022726 3300025932 Bacteria 3905
267 Ga0207690_10248754 3300025932 Bacteria 1372
268 Ga0207690_10364671 3300025932 Bacteria 1145
269 Ga0207706_10066449 3300025933 Bacteria 3173
270 Ga0207706_10285918 3300025933 Bacteria 1438
271 Ga0207709_10023791 3300025935 Bacteria 3490
272 Ga0207709_10093838 3300025935 Bacteria 1968
273 Ga0207670_10010092 3300025936 Bacteria 5422
274 Ga0207670_10089062 3300025936 Bacteria 2178
275 Ga0207670_10155224 3300025936 Bacteria 1703
276 Ga0207669_10034282 3300025937 Bacteria 2875
277 Ga0207669_10603336 3300025937 Bacteria 892
278 Ga0207669_10695154 3300025937 Bacteria 835
279 Ga0207704_10050758 3300025938 Bacteria 2504
280 Ga0207691_10012265 3300025940 Bacteria 8216
281 Ga0207691_10041907 3300025940 Bacteria 4223
282 Ga0207691_10053770 3300025940 Bacteria 3675
283 Ga0207711_10332058 3300025941 Bacteria 1406
284 Ga0207661_10257693 3300025944 Bacteria 1553
285 Ga0207661_10350052 3300025944 Bacteria 1333
286 Ga0207661_10665332 3300025944 Bacteria 957
287 Ga0207667_10154009 3300025949 Bacteria 2365
288 Ga0207667_10351371 3300025949 Bacteria 1504
289 Ga0207667_10535255 3300025949 Bacteria 1186
290 Ga0207651_10004851 3300025960 Bacteria 6850
291 Ga0207651_10460359 3300025960 Bacteria 1093
292 Ga0207668_10665261 3300025972 Bacteria 913
293 Ga0207640_10140243 3300025981 Bacteria 1761
294 Ga0207658_10001854 3300025986 Bacteria 15830
295 Ga0207658_10293172 3300025986 Bacteria 1399
296 Ga0207677_10026511 3300026023 Bacteria 3637
297 Ga0207703_10004753 3300026035 Bacteria 11078
298 Ga0207703_11125195 3300026035 Bacteria 754
299 Ga0207639_10203980 3300026041 Bacteria 1698
300 Ga0207639_10295485 3300026041 Bacteria 1430
301 Ga0207639_10833009 3300026041 Bacteria 861
302 Ga0207678_10002276 3300026067 Bacteria 17378
303 Ga0207678_10207607 3300026067 Bacteria 1675
304 Ga0207702_10053116 3300026078 Bacteria 3430
305 Ga0207702_10152927 3300026078 Bacteria 2100
306 Ga0207641_10607502 3300026088 Bacteria 1071
307 Ga0207648_10002295 3300026089 Bacteria 20666
308 Ga0207648_10136083 3300026089 Bacteria 2164
309 Ga0207674_10001229 3300026116 Bacteria 33433
310 Ga0207674_10013681 3300026116 Bacteria 8989
311 Ga0207674_10196505 3300026116 Bacteria 1967
312 Ga0207675_100023354 3300026118 Bacteria 5751
313 Ga0207683_10230825 3300026121 Bacteria 1688
314 Ga0207698_10565938 3300026142 Bacteria 1116
315 Ga0209281_1000283 3300027111 Bacteria 95533
316 Ga0209281_1000308 3300027111 Bacteria 87362
317 Ga0209281_1000994 3300027111 Bacteria 22409
318 Ga0209281_1001423 3300027111 Bacteria 14254
319 Ga0209371_1000013 3300027312 Bacteria 691516
320 Ga0209371_1000770 3300027312 Bacteria 26613
321 Ga0209974_10002757 3300027876 Bacteria 6372
322 Ga0207428_10546467 3300027907 Bacteria 838
323 Ga0268266_10001726 3300028379 Bacteria 25029
324 Ga0268266_10044374 3300028379 Bacteria 3801
325 Ga0268266_10235400 3300028379 Bacteria 1688
326 Ga0268266_10516774 3300028379 Bacteria 1141
327 Ga0265334_10009277 3300028573 Bacteria 4163
328 Ga0265318_10007856 3300028577 Bacteria 4793
329 Ga0265336_10000053 3300028666 Bacteria 113034
330 Ga0307517_10000174 3300028786 Bacteria 105578
331 Ga0307517_10108074 3300028786 Bacteria 2138
332 Ga0307515_10001235 3300028794 Bacteria 58313
333 Ga0307515_10004451 3300028794 Bacteria 29009
334 Ga0307515_10132420 3300028794 Bacteria 2735
335 Ga0307515_10162890 3300028794 Bacteria 2264
336 Ga0307515_10246467 3300028794 Bacteria 1547
337 Ga0265324_10000132 3300029957 Bacteria 58866
338 Ga0268256_1000014 3300030500 Bacteria 691435
339 Ga0268256_1000647 3300030500 Bacteria 26522
340 Ga0307511_10094344 3300030521 Bacteria 2006
341 Ga0307512_10046505 3300030522 Bacteria 3538
342 Ga0307512_10184109 3300030522 Bacteria 1167
343 Ga0265328_10020326 3300031239 Bacteria 2542
344 Ga0265325_10030670 3300031241 Bacteria 2882
345 Ga0265325_10035978 3300031241 Bacteria 2626
346 Ga0265340_10001678 3300031247 Bacteria 12726
347 Ga0265339_10011043 3300031249 Bacteria 5581
348 Ga0265331_10006526 3300031250 Bacteria 6884
349 Ga0265327_10000012 3300031251 Bacteria 530403
350 Ga0265327_10003227 3300031251 Bacteria 15859
351 Ga0265327_10228751 3300031251 Bacteria 834
352 Ga0265316_10036333 3300031344 Bacteria 3984
353 Ga0265316_10156124 3300031344 Bacteria 1708
354 Ga0307513_10014799 3300031456 Bacteria 9489
355 Ga0307513_10130230 3300031456 Bacteria 2463
356 Ga0307513_10195449 3300031456 Bacteria 1869
357 Ga0307509_10000225 3300031507 Bacteria 90913
358 Ga0307509_10005996 3300031507 Bacteria 16595
359 Ga0307509_10053865 3300031507 Bacteria 4286
360 Ga0307509_10067974 3300031507 Bacteria 3730
361 Ga0307408_100000010 3300031548 Bacteria 420048
362 Ga0307408_100908838 3300031548 Bacteria 806
363 Ga0265313_10123248 3300031595 Bacteria 1129
364 Ga0307508_10000185 3300031616 Bacteria 75407
365 Ga0307508_10001432 3300031616 Bacteria 26853
366 Ga0307508_10002202 3300031616 Bacteria 20788
367 Ga0307508_10003035 3300031616 Bacteria 17286
368 Ga0307514_10049262 3300031649 Bacteria 3277
369 Ga0307514_10143758 3300031649 Bacteria 1616
370 Ga0316579_10277060 3300031691 Bacteria 811
371 Ga0265314_10001531 3300031711 Bacteria 25492
372 Ga0265314_10035008 3300031711 Bacteria 3663
373 Ga0265314_10138293 3300031711 Bacteria 1510
374 Ga0265342_10042951 3300031712 Bacteria 2729
375 Ga0265342_10165792 3300031712 Bacteria 1219
376 Ga0307516_10001572 3300031730 Bacteria 31438
377 Ga0307516_10009757 3300031730 Bacteria 10650
378 Ga0307516_10259861 3300031730 Bacteria 1427
379 Ga0307405_10021739 3300031731 Bacteria 3612
380 Ga0307405_10185701 3300031731 Bacteria 1497
381 Ga0307413_10339359 3300031824 Bacteria 1155
382 Ga0307407_10026323 3300031903 Bacteria 3078
383 Ga0307409_100286400 3300031995 Bacteria 1526
384 Ga0307416_100851412 3300032002 Bacteria 1010
385 Ga0307507_10065803 3300033179 Bacteria 3329
386 Ga0307510_10002036 3300033180 Bacteria 22846
387 Ga0307510_10034205 3300033180 Bacteria 5694
388 Ga0373948_0005315 3300034817 Bacteria 2081
389 Ga0373926_0077703 3300035083 Bacteria 1225
390 Ga0373928_0010732 3300035084 Bacteria 1803
391 Ga0373940_0037180 3300035088 Bacteria 1324
392 Ga0373923_0076552 3300035111 Bacteria 1445
393 Ga0373932_0025863 3300035112 Bacteria 1593
394 Ga0373936_0024437 3300035113 Bacteria 2359
395 Ga0373939_0000036 3300035114 Bacteria 48825
396 Ga0373954_0011225 3300035118 Bacteria 3966
397 Ga0373956_0019348 3300035119 Bacteria 2886
398 Ga0373943_0034564 3300035170 Bacteria 2412
399 Ga0373943_0401850 3300035170 Bacteria 791
400 Ga0373946_0084338 3300035171 Bacteria 1397
401 Ga0373962_0007469 3300035242 Bacteria 2677
402 Ga0316574_0538732 3300035398 Bacteria 725
403 Ga0373931_0000268 3300035691 Bacteria 21952
404 Ga0373931_0008787 3300035691 Bacteria 4806
405 Ga0373931_0209948 3300035691 Bacteria 1167
406 Ga0373935_0104638 3300035692 Bacteria 1871
407 Ga0373927_0354282 3300035695 Bacteria 967
408 Ga0373927_0477124 3300035695 Bacteria 824
409 Ga0373933_0008201 3300035724 Bacteria 5702
410 Ga0373947_0394835 3300035725 Bacteria 932
411 Ga0373937_0003306 3300036401 Bacteria 13538
412 Ga0373937_0023547 3300036401 Bacteria 5545
413 Ga0373937_0214132 3300036401 Bacteria 1813
414 Ga0373937_0325039 3300036401 Bacteria 1455
415 Ga0373925_0027268 3300037068 Bacteria 4183
416 Ga0373925_0096228 3300037068 Bacteria 2269
417 Ga0373925_0418139 3300037068 Bacteria 1095
418 Ga0395899_0002765 3300037312 Bacteria 14156
419 Ga0395899_0014664 3300037312 Bacteria 5982
420 Ga0395899_0076220 3300037312 Bacteria 2448
421 Ga0395900_0008007 3300037418 Bacteria 10874
422 Ga0395900_0015475 3300037418 Bacteria 7776
423 Ga0395900_0083557 3300037418 Bacteria 3280
424 Ga0395900_0139262 3300037418 Bacteria 2485
425 Ga0395900_0173885 3300037418 Bacteria 2191
426 Ga0395898_0006186 3300037466 Bacteria 12825
427 Ga0395898_0039633 3300037466 Bacteria 4662
428 Ga0395898_0148759 3300037466 Bacteria 2241
429 Ga0395898_0171308 3300037466 Bacteria 2075
430 Ga0395905_0000025 3300037471 Bacteria 317571
431 Ga0395905_0005980 3300037471 Bacteria 12322
432 Ga0395905_0008672 3300037471 Bacteria 10014
433 Ga0395905_0030958 3300037471 Bacteria 5039
434 Ga0395905_0050499 3300037471 Bacteria 3896
435 Ga0395905_0059042 3300037471 Bacteria 3586
436 Ga0395905_0069854 3300037471 Bacteria 3290
437 Ga0395905_0079244 3300037471 Bacteria 3079
438 Ga0395905_0504115 3300037471 Bacteria 1110
439 Ga0395905_0719640 3300037471 Bacteria 900
440 Ga0395905_0755081 3300037471 Bacteria 875
441 Ga0436364_0492175 3300037853 Bacteria 5390
442 Ga0436364_1360306 3300037853 Bacteria 823
443 Ga0395901_0003336 3300038443 Bacteria 16173
444 Ga0395901_0043746 3300038443 Bacteria 4644
445 Ga0395901_0107006 3300038443 Bacteria 2935
446 Ga0395901_0174821 3300038443 Bacteria 2252
447 Ga0395901_0256096 3300038443 Bacteria 1822
448 Ga0395901_0537969 3300038443 Bacteria 1185
449 Ga0400490_19766 3300038726 Bacteria 6232
450 Ga0436365_1030367 3300039437 Bacteria 1100
451 Ga0436360_0103786 3300039438 Bacteria 1165
452 Ga0436360_0283312 3300039438 Bacteria 912
453 Ga0436360_0649612 3300039438 Bacteria 1424
454 Ga0436360_0708127 3300039438 Bacteria 1073
455 Ga0436361_0058641 3300039447 Bacteria 1416
456 Ga0436361_0098550 3300039447 Bacteria 3504
457 Ga0436361_0289802 3300039447 Bacteria 31851
458 Ga0436361_0380155 3300039447 Bacteria 4492
459 Ga0436361_0410668 3300039447 Bacteria 27008
460 Ga0436361_0653184 3300039447 Bacteria 36949
461 Ga0436361_0766328 3300039447 Bacteria 1810
462 Ga0436361_1213797 3300039447 Bacteria 923
463 Ga0436361_1214496 3300039447 Bacteria 9572
464 Ga0436363_0288717 3300039450 Bacteria 839
465 Ga0436362_1051954 3300039453 Bacteria 756
466 Ga0439447_055633 3300041407 Bacteria 938
467 Ga0451789_0173976 3300041443 Bacteria 1107
468 Ga0451789_1258901 3300041443 Bacteria 871
469 Ga0451791_1222017 3300041451 Bacteria 1335
470 Ga0451793_1887844 3300041452 Bacteria 1504
471 Ga0451798_0187906 3300041458 Bacteria 779
472 Ga0451800_0997610 3300041459 Bacteria 1248
473 Ga0451853_0292917 3300041512 Bacteria 3975
474 Ga0439448_0044399 3300042005 Bacteria 1445
475 Ga0439452_000141 3300042010 Bacteria 54325
476 Ga0439452_000604 3300042010 Bacteria 18370
477 Ga0450901_000116 3300042533 Bacteria 8723
478 Ga0451577_0014637 3300042876 Bacteria 7309
479 Ga0451577_0038258 3300042876 Bacteria 4315
480 Ga0466969_0035833 3300044656 Bacteria 2508
481 Ga0466977_0001317 3300044666 Bacteria 10077
482 Ga0466981_0000001 3300044669 Bacteria 367980
483 Ga0466966_0002026 3300044684 Bacteria 13155
484 Ga0466966_0011911 3300044684 Bacteria 5764
485 Ga0466961_0045147 3300044693 Bacteria 2820
486 Ga0453684_0002411 3300044712 Bacteria 45566
487 Ga0453684_0002552 3300044712 Bacteria 43755
488 Ga0453684_0131908 3300044712 Bacteria 2997
489 Ga0466971_0006284 3300044719 Bacteria 5159
490 Ga0466968_0051102 3300044735 Bacteria 1765
491 Ga0466970_0034701 3300044765 Bacteria 2672
492 Ga0466959_0002381 3300045049 Bacteria 11985
493 Ga0466959_0024159 3300045049 Bacteria 4500
494 Ga0466959_0186178 3300045049 Bacteria 1450
495 Ga0451576_0021714 3300045051 Bacteria 6971
496 Ga0451576_0070312 3300045051 Bacteria 3643
497 Ga0466958_0143808 3300045836 Bacteria 1502
498 Ga0495592_0001312 3300046454 Bacteria 17260
499 Ga0495591_010516 3300046458 Bacteria 3580
500 Ga0495629_0062368 3300046459 Bacteria 2604
501 Ga0495629_0429184 3300046459 Bacteria 896
502 Ga0495638_0111379 3300046460 Bacteria 1626
503 Ga0495638_0164268 3300046460 Bacteria 1278
504 Ga0495638_0229829 3300046460 Bacteria 1032
505 Ga0495651_0011915 3300046462 Bacteria 6690
506 Ga0495653_0069116 3300046463 Bacteria 2647
507 Ga0495650_0000040 3300046471 Bacteria 366254
508 Ga0495662_0076309 3300046476 Bacteria 1627
509 Ga0495583_0000159 3300046506 Bacteria 113627
510 Ga0495606_0005971 3300046507 Bacteria 11423
511 Ga0495608_0000180 3300046511 Bacteria 45181
512 Ga0495620_0011609 3300046515 Bacteria 4587
513 Ga0495628_0027713 3300046516 Bacteria 4605
514 Ga0495628_0212603 3300046516 Bacteria 1454
515 Ga0495630_0148899 3300046517 Bacteria 1781
516 Ga0495630_0449750 3300046517 Bacteria 987
517 Ga0495632_0004601 3300046519 Bacteria 9343
518 Ga0495632_0012661 3300046519 Bacteria 4852
519 Ga0495644_0024463 3300046523 Bacteria 2297
520 Ga0495648_0057854 3300046524 Bacteria 2322
521 Ga0495666_0126634 3300046526 Bacteria 1194
522 Ga0495666_0136678 3300046526 Bacteria 1144
523 Ga0495652_0004484 3300046529 Bacteria 13326
524 Ga0495640_0011129 3300046533 Bacteria 6927
525 Ga0495645_0114971 3300046543 Bacteria 1901
526 Ga0495633_0003465 3300046558 Bacteria 10491
527 Ga0495667_0006865 3300046559 Bacteria 7730
528 Ga0495667_0012787 3300046559 Bacteria 5687
529 Ga0495635_0002686 3300046663 Bacteria 12157
530 Ga0495635_0095933 3300046663 Bacteria 2027
531 Ga0495657_0017312 3300046675 Bacteria 5233
532 Ga0495599_0066436 3300046678 Bacteria 2252
533 Ga0495599_0272136 3300046678 Bacteria 1027
534 Ga0495623_0014713 3300046679 Bacteria 5059
535 Ga0495646_0253970 3300046680 Bacteria 941
536 Ga0495658_0032612 3300046683 Bacteria 2846
537 Ga0495624_0095731 3300046690 Bacteria 1830
538 Ga0495671_0016703 3300046692 Bacteria 3915
539 Ga0495671_0084130 3300046692 Bacteria 1559
540 Ga0495649_0000760 3300046694 Bacteria 25925
541 Ga0495649_0001240 3300046694 Bacteria 19630
542 Ga0495649_0005881 3300046694 Bacteria 7705
543 Ga0495589_0003499 3300046794 Bacteria 8497
544 Ga0495600_0005529 3300046809 Bacteria 7625
545 Ga0495604_0000241 3300047317 Bacteria 48922
546 Ga0495674_0017966 3300047319 Bacteria 6583
547 Ga0495674_0032889 3300047319 Bacteria 4701
548 Ga0495674_0149045 3300047319 Bacteria 1962
549 Ga0495672_0159004 3300047320 Bacteria 1164
550 Ga0495676_0213093 3300047321 Bacteria 1335
551 Ga0495680_0000994 3300047322 Bacteria 31554
552 Ga0495679_004962 3300047446 Bacteria 6001
553 Ga0495686_0004435 3300047472 Bacteria 11558
554 Ga0495602_0010667 3300048088 Bacteria 9531
555 Ga0495614_0251148 3300048089 Bacteria 809
556 Ga0496101_0147970 3300048904 Bacteria 1794
557 Ga0496102_0007894 3300048905 Bacteria 9094
558 Ga0496104_0001702 3300048907 Bacteria 18996
559 Ga0496104_0130603 3300048907 Bacteria 2413
560 Ga0496104_0639924 3300048907 Bacteria 972
561 Ga0496105_0054625 3300048908 Bacteria 3297
562 Ga0496105_0226223 3300048908 Bacteria 1521
563 Ga0496105_0379026 3300048908 Bacteria 1126
564 Ga0496109_0460024 3300048912 Bacteria 1202
565 Ga0496112_0031940 3300048915 Bacteria 5110
566 Ga0496112_0037322 3300048915 Bacteria 4743
567 Ga0496116_0001458 3300048919 Bacteria 26519
568 Ga0496116_0009281 3300048919 Bacteria 8408
569 Ga0496116_0026850 3300048919 Bacteria 4200
570 Ga0496116_0045377 3300048919 Bacteria 2975
571 Ga0496117_0008694 3300048920 Bacteria 9598
572 Ga0496117_0016174 3300048920 Bacteria 6305
573 Ga0496117_0112497 3300048920 Bacteria 1692
574 Ga0496117_0128221 3300048920 Bacteria 1543
575 Ga0496118_0002802 3300048921 Bacteria 22834
576 Ga0496118_0022466 3300048921 Bacteria 5512
577 Ga0496118_0035786 3300048921 Bacteria 4024
578 Ga0496118_0038436 3300048921 Bacteria 3835
579 Ga0496118_0040266 3300048921 Bacteria 3717
580 Ga0496118_0073071 3300048921 Bacteria 2459
581 Ga0496118_0153551 3300048921 Bacteria 1436
582 Ga0496118_0215287 3300048921 Bacteria 1123
583 Ga0496119_0000438 3300048922 Bacteria 57088
584 Ga0496119_0006572 3300048922 Bacteria 10717
585 Ga0496119_0009447 3300048922 Bacteria 8365
586 Ga0496119_0009582 3300048922 Bacteria 8275
587 Ga0496119_0020054 3300048922 Bacteria 4891
588 Ga0496119_0093129 3300048922 Bacteria 1707
589 Ga0496119_0185548 3300048922 Bacteria 1087
590 Ga0496119_0196127 3300048922 Bacteria 1048
591 Ga0496119_0205455 3300048922 Bacteria 1017
592 Ga0496120_0006993 3300048923 Bacteria 8487
593 Ga0496120_0015782 3300048923 Bacteria 4964
594 Ga0496120_0017901 3300048923 Bacteria 4578
595 Ga0496120_0035404 3300048923 Bacteria 2982
596 Ga0496120_0076836 3300048923 Bacteria 1818
597 Ga0496120_0107954 3300048923 Bacteria 1459
598 Ga0496120_0109698 3300048923 Bacteria 1443
599 Ga0496120_0286958 3300048923 Bacteria 758
600 Ga0496121_0000729 3300048924 Bacteria 60664
601 Ga0496121_0004852 3300048924 Bacteria 17688
602 Ga0496121_0014724 3300048924 Bacteria 8265
603 Ga0496121_0022172 3300048924 Bacteria 6178
604 Ga0496121_0082677 3300048924 Bacteria 2537
605 Ga0496121_0180201 3300048924 Bacteria 1525
606 Ga0496121_0381877 3300048924 Bacteria 928
607 Ga0496121_0405139 3300048924 Bacteria 892
608 Ga0496121_0424121 3300048924 Bacteria 864
609 Ga0496122_0008944 3300048925 Bacteria 10652
610 Ga0496122_0025170 3300048925 Bacteria 5179
611 Ga0496122_0059803 3300048925 Bacteria 2811
612 Ga0496122_0120875 3300048925 Bacteria 1689
613 Ga0496122_0127356 3300048925 Bacteria 1626
614 Ga0496123_0020285 3300048926 Bacteria 5205
615 Ga0496123_0024494 3300048926 Bacteria 4584
616 Ga0496123_0040172 3300048926 Bacteria 3262
617 Ga0496123_0051988 3300048926 Bacteria 2723
618 Ga0496123_0062130 3300048926 Bacteria 2395
619 Ga0496123_0074150 3300048926 Bacteria 2107
620 Ga0496123_0287337 3300048926 Bacteria 791
621 Ga0496123_0296620 3300048926 Bacteria 773
622 Ga0496124_0000458 3300048927 Bacteria 70719
623 Ga0496124_0000649 3300048927 Bacteria 57400
624 Ga0496124_0004557 3300048927 Bacteria 16105
625 Ga0496124_0043082 3300048927 Bacteria 3881
626 Ga0496124_0109668 3300048927 Bacteria 2223
627 Ga0496124_0115509 3300048927 Bacteria 2153
628 Ga0496124_0122443 3300048927 Bacteria 2076
629 Ga0496124_0157997 3300048927 Bacteria 1770
630 Ga0496124_0178151 3300048927 Bacteria 1638
631 Ga0496124_0524040 3300048927 Bacteria 789
632 Ga0496124_0574994 3300048927 Bacteria 738
633 Ga0496125_0000176 3300048928 Bacteria 140746
634 Ga0496125_0000370 3300048928 Bacteria 84467
635 Ga0496125_0000522 3300048928 Bacteria 66680
636 Ga0496125_0004254 3300048928 Bacteria 16677
637 Ga0496125_0035699 3300048928 Bacteria 4355
638 Ga0496125_0039207 3300048928 Bacteria 4083
639 Ga0496125_0188964 3300048928 Bacteria 1362
640 Ga0496125_0189365 3300048928 Bacteria 1360
641 Ga0496126_0000329 3300048929 Bacteria 101203
642 Ga0496126_0006943 3300048929 Bacteria 12533
643 Ga0496126_0023134 3300048929 Bacteria 6023
644 Ga0496126_0036180 3300048929 Bacteria 4619
645 Ga0496126_0038207 3300048929 Bacteria 4469
646 Ga0496126_0085578 3300048929 Bacteria 2779
647 Ga0496126_0216132 3300048929 Bacteria 1612
648 Ga0496126_0254378 3300048929 Bacteria 1462
649 Ga0496126_0332932 3300048929 Bacteria 1245
650 Ga0496126_0772766 3300048929 Bacteria 739
651 Ga0501031_0438289 3300049568 Bacteria 844
652 Ga0501032_0274596 3300049569 Bacteria 1092
653 Ga0501034_0000891 3300049571 Bacteria 43738
654 Ga0501036_0043205 3300049572 Bacteria 3816
655 Ga0501038_0832475 3300049574 Bacteria 684
656 Ga0501039_0853863 3300049575 Bacteria 709
657 Ga0501042_0167530 3300049578 Bacteria 1585
658 Ga0501070_0458664 3300049586 Bacteria 1027
659 Ga0501070_0717050 3300049586 Bacteria 790
660 Ga0501071_0213511 3300049587 Bacteria 1451
661 Ga0501072_0580051 3300049588 Bacteria 885
662 Ga0501073_0005280 3300049589 Bacteria 9689
663 Ga0501074_0164829 3300049590 Bacteria 1582
664 Ga0501074_0279470 3300049590 Bacteria 1187
665 Ga0501206_005345 3300049653 Bacteria 1652
666 Ga0501080_0277255 3300049742 Bacteria 1525
667 Ga0501081_0080810 3300049743 Bacteria 2276
668 nmdc:mga03683_2170_c2 3300050489 Bacteria 4087
669 nmdc:mga03n38_25584_c1 3300050490 Bacteria 2426
670 nmdc:mga00v17_108561_c1 3300050491 Bacteria 1758
671 nmdc:mga00v17_281313_c1 3300050491 Bacteria 1080
672 nmdc:mga0k408_1297_c2 3300050493 Bacteria 9516
673 nmdc:mga0k408_157438_c1 3300050493 Bacteria 1353
674 nmdc:mga0k408_208903_c2 3300050493 Bacteria 793
675 nmdc:mga0k408_6099_c1 3300050493 Bacteria 6422
676 nmdc:mga07m45_183995_c1 3300050496 Bacteria 1215
677 nmdc:mga07m45_278375_c1 3300050496 Bacteria 973
678 nmdc:mga07m45_748_c1 3300050496 Bacteria 13891
679 nmdc:mga05p37_296340_c1 3300050507 Bacteria 1923
680 nmdc:mga05p37_441880_c1 3300050507 Bacteria 1508
681 nmdc:mga05p37_645950_c1 3300050507 Bacteria 1186
682 nmdc:mga05p37_942100_c1 3300050507 Bacteria 925
683 nmdc:mga09592_2859_c1 3300050508 Bacteria 14008
684 nmdc:mga0qj67_577334_c1 3300050509 Bacteria 900
685 nmdc:mga0qj67_92402_c1 3300050509 Bacteria 2433
686 nmdc:mga06r32_341153_c1 3300050510 Bacteria 1483
687 nmdc:mga08y16_192145_c1 3300050511 Bacteria 2117
688 nmdc:mga08y16_587640_c1 3300050511 Bacteria 1123
689 nmdc:mga08y16_635362_c1 3300050511 Bacteria 1073
690 nmdc:mga0n895_354078_c1 3300050512 Bacteria 1487
691 nmdc:mga08x19_362063_c1 3300050514 Bacteria 1014
692 nmdc:mga0a205_211457_c1 3300050515 Bacteria 1828
693 nmdc:mga0sz30_20944_c1 3300050516 Bacteria 2642
694 nmdc:mga0sz30_2490_c1 3300050516 Bacteria 5323
695 Ga0495601_0001571 3300053077 Bacteria 12632
696 Ga0495601_0002038 3300053077 Bacteria 11335
697 Ga0495612_0000746 3300053078 Bacteria 13248
698 Ga0500635_0000363 3300053080 Bacteria 14460
699 Ga0495595_0000387 3300053084 Bacteria 16728
700 Ga0495595_0057549 3300053084 Bacteria 1813
701 Ga0495595_0430811 3300053084 Bacteria 670
702 Ga0495619_0030742 3300053085 Bacteria 3476
703 Ga0495619_0036207 3300053085 Bacteria 3212
704 Ga0500578_0000079 3300053086 Bacteria 107137
705 Ga0500643_008711 3300053087 Bacteria 3958
706 Ga0500644_0001074 3300053088 Bacteria 8067
707 Ga0500651_0092267 3300053093 Bacteria 1863
708 Ga0500593_041066 3300053117 Bacteria 2067
709 Ga0500594_0001408 3300053118 Bacteria 5221
710 Ga0500594_0004863 3300053118 Bacteria 2970
711 Ga0500595_000029 3300053119 Bacteria 122318
712 Ga0500607_197285 3300053121 Bacteria 870
713 Ga0500652_000624 3300053131 Bacteria 12146
714 Ga0500652_107925 3300053131 Bacteria 1163
715 Ga0500658_0006331 3300053134 Bacteria 4394
716 Ga0500658_0017060 3300053134 Bacteria 2709
717 Ga0500658_0067760 3300053134 Bacteria 1499
718 Ga0500559_0000329 3300053136 Bacteria 35808
719 Ga0500559_0050482 3300053136 Bacteria 1835
720 Ga0500588_0006411 3300053146 Bacteria 2665
721 Ga0500616_0000006 3300053153 Bacteria 944738
722 Ga0500616_0001264 3300053153 Bacteria 25261
723 Ga0500622_0000053 3300053156 Bacteria 145070
724 Ga0500622_0007462 3300053156 Bacteria 6208
725 Ga0500622_0093747 3300053156 Bacteria 1486
726 Ga0500636_0015032 3300053177 Bacteria 4557
727 Ga0500636_0070250 3300053177 Bacteria 2032
728 Ga0500645_000614 3300053730 Bacteria 22818
729 Ga0501082_0071314 3300060353 Bacteria 2992
730 Ga0466962_0005900 3300061719 Bacteria 5884
731 2515679265 2515154122 Bacteria 8609520
732 2555247152 2554235231 Bacteria 5215788
733 2587728133 2585428057 Bacteria 6737412
734 2587731191 2585428058 Bacteria 6853932
735 2587759971 2585428062 Bacteria 6842168
736 2588289944 2588253510 Bacteria 6901809
737 2603644192 2602042047 Bacteria 4697674
738 2603701264 2602042066 Bacteria 4423871
739 2603704784 2602042067 Bacteria 4863713
740 2643742396 2643221544 Bacteria 5886209
741 2643933639 2643221585 Bacteria 5812563
742 2643972266 2643221592 Bacteria 6608788
743 2644141623 2643221625 Bacteria 6512927
744 2644222023 2643221639 Bacteria 6649903
745 2644257198 2643221646 Bacteria 6433402
746 2644275606 2643221648 Bacteria 6521465
747 2644302863 2643221654 Bacteria 5273570
748 2644315139 2643221656 Bacteria 5809961
749 2671104682 2667528172 Bacteria 5170840
750 2681997965 2681812866 Bacteria 4552357
751 2682008076 2681812869 Bacteria 5014465
752 2723875890 2721755763 Bacteria 4464185
753 2738819916 2738541296 Bacteria 7285013
754 2738832396 2738541298 Bacteria 7286732
755 2738873923 2738541306 Bacteria 7284992
756 2739055249 2738541337 Bacteria 6183410
757 2739185553 2738543002 Bacteria 7284546
758 2739220521 2738543008 Bacteria 7282815
759 2739349258 2738543031 Bacteria 5769731
760 2753857597 2751185917 Bacteria 4551186
761 2765590703 2765235842 Bacteria 4799256
762 2775540265 2775506706 Bacteria 4873073
763 2792841161 2791355137 Bacteria 9654227
764 2821120579 2821118458 Bacteria 4714306
765 2821444350 2821443989 Bacteria 7658172
766 2823376466 2823373977 Bacteria 4779415
767 2834641739 2834641062 Bacteria 5559922
768 2835312758 2835312727 Bacteria 7413381
769 2840883231 2840878972 Bacteria 5483153
770 2842779705 2842775625 Bacteria 5587290
771 2881102725 2881101125 Bacteria 4590519
772 2882461725 2882456835 Bacteria 6863978
773 2894027582 2894023352 Bacteria 5167372
774 2902683277 2902682994 Bacteria 8951596
775 2927836932 2927833300 Bacteria 4923934
776 2932424875 2932422444 Bacteria 4678430
777 2937543970 2937539931 Bacteria 4639830
778 2939576448 2939573065 Bacteria 4926053
779 2941533317 2941531003 Bacteria 7653939
780 2990710368 2990703756 Bacteria 7715990
781 642422891 641736151 Bacteria 7477263
782 8001525934 8001522603 Bacteria 4726425
783 8003402777 8003400568 Bacteria 5535898
784 8018223270 8018221730 Bacteria 4616064
785 8019560230 8019555841 Bacteria 9642137
786 8019570330 8019565922 Bacteria 9639779
787 8052497667 8052494512 Bacteria 5765634
788 8054931894 8054929484 Bacteria 5599761
789 8056123581 8056120720 Bacteria 5758328
790 8056140736 8056137416 Bacteria 6147080
791 8057308326 8057304971 Bacteria 4649742
792 Ga0157376_10300847
793 SwRhRL2b_contig_2783974
794 JGI24735J21928_10019472
795 JGI25153J46596_10012485
796 JGI25160J50197_1001200
797 JGI26145J50221_1007868
798 Ga0055539_1000240
799 Ga0055533_1000103
800 Ga0055525_1000928
801 Ga0055526_1003050
802 Ga0055530_10012719
803 Ga0055530_10051163
804 Ga0055531_10000390
805 Ga0058692_1002816
806 Ga0065165_1000791
807 Ga0065165_1001455
808 Ga0065704_10002058
809 Ga0065704_10077807
810 Ga0070658_10224317
811 Ga0070658_10271096
812 Ga0070676_10008197
813 Ga0070683_100022610
814 Ga0070690_100166308
815 Ga0070670_100024111
816 Ga0070670_100090066
817 Ga0070677_10025585
818 Ga0070677_10060999
819 Ga0068869_100656979
820 Ga0070682_100002901
821 Ga0070689_100010287
822 Ga0070689_100040016
823 Ga0070661_100017322
824 Ga0070692_10139728
825 Ga0070668_100611455
826 Ga0070669_100143237
827 Ga0070675_100020118
828 Ga0070675_100030521
829 Ga0070675_100066853
830 Ga0070671_100014561
831 Ga0070671_100039548
832 Ga0070671_100059923
833 Ga0070674_100009918
834 Ga0070674_100367341
835 Ga0070674_100437539
836 Ga0070673_100006916
837 Ga0070673_100197786
838 Ga0070688_100319448
839 Ga0070688_100406353
840 Ga0070659_100026425
841 Ga0070659_100657921
842 Ga0070667_100005361
843 Ga0070667_100343716
844 Ga0070667_100923990
845 Ga0070709_10433646
846 Ga0070714_100175896
847 Ga0070714_100493235
848 Ga0070714_100991413
849 Ga0070711_100062131
850 Ga0070708_100161995
851 Ga0070663_100006550
852 Ga0070663_100206784
853 Ga0070678_100591590
854 Ga0070662_100282844
855 Ga0070681_10041779
856 Ga0070681_10121927
857 Ga0070681_10220109
858 Ga0068867_100004166
859 Ga0068867_100877485
860 Ga0070706_100032893
861 Ga0070707_100059206
862 Ga0070707_100153192
863 Ga0070698_100040887
864 Ga0070698_100321592
865 Ga0070679_100214268
866 Ga0070679_100287627
867 Ga0070684_100021897
868 Ga0070684_100681333
869 Ga0070697_100188949
870 Ga0068853_100095434
871 Ga0068853_100216637
872 Ga0070672_100001714
873 Ga0070672_100222147
874 Ga0070672_100248109
875 Ga0070672_100323332
876 Ga0070665_100001160
877 Ga0070665_100116464
878 Ga0070665_100547140
879 Ga0068855_100355520
880 Ga0068855_100395977
881 Ga0068857_100000005
882 Ga0068857_100076664
883 Ga0068854_100093824
884 Ga0068854_100219094
885 Ga0068856_100008321
886 Ga0068852_100742228
887 Ga0068859_100024837
888 Ga0068859_100649608
889 Ga0068870_10259450
890 Ga0068863_100214953
891 Ga0068858_100004350
892 Ga0068860_100239700
893 Ga0081455_10000723
894 Ga0081455_10051537
895 Ga0081455_10276508
896 Ga0081538_10033312
897 Ga0070716_100101169
898 Ga0070712_100029765
899 Ga0070712_100166724
900 Ga0075362_10011088
901 Ga0075362_10011491
902 Ga0075362_10171481
903 Ga0075369_10000532
904 Ga0075366_10006382
905 Ga0075366_10014006
906 Ga0075366_10193263
907 Ga0075366_10195147
908 Ga0075366_10222599
909 Ga0075370_10002042
910 Ga0075370_10096345
911 Ga0075370_10129531
912 Ga0068871_100089638
913 Ga0075428_100140266
914 Ga0075430_100037022
915 Ga0075431_100098152
916 Ga0075434_100468682
917 Ga0075429_100002479
918 Ga0075429_100368044
919 Ga0068865_100059814
920 Ga0075436_100169485
921 Ga0097620_100024837
922 Ga0097620_100649518
923 Ga0097620_100912251
924 Ga0079104_1001696
925 Ga0079104_1003541
926 Ga0079104_1012559
927 Ga0075435_100040874
928 Ga0099795_10004776
929 Ga0105251_10009864
930 Ga0105251_10370928
931 Ga0105244_10041712
932 Ga0105244_10044643
933 Ga0105250_10000475
934 Ga0105240_10105653
935 Ga0105240_10153993
936 Ga0105240_10175619
937 Ga0105240_10450333
938 Ga0111539_10246411
939 Ga0105247_10180550
940 Ga0114129_10452475
941 Ga0105243_10127919
942 Ga0105243_10165154
943 Ga0105243_10590152
944 Ga0105241_10561534
945 Ga0105242_10455296
946 Ga0105248_10000445
947 Ga0105248_10076019
948 Ga0105248_10144214
949 Ga0105248_11203223
950 Ga0105237_10023936
951 Ga0105237_10142234
952 Ga0105237_11210506
953 Ga0105238_10164944
954 Ga0105238_10334315
955 Ga0105249_10677986
956 Ga0105249_10727191
957 Ga0105147_100451
958 Ga0099796_10004450
959 Ga0099796_10028260
960 Ga0099796_10075849
961 Ga0105239_10010809
962 Ga0105239_10242080
963 Ga0157373_10258816
964 Ga0157371_10032095
965 Ga0157371_10083223
966 Ga0157371_10202180
967 Ga0157370_10008752
968 Ga0157370_10011595
969 Ga0157370_10079648
970 Ga0157370_10636769
971 Ga0157369_10025847
972 Ga0157369_10082380
973 Ga0157374_10044716
974 Ga0157378_10936206
975 Ga0163162_10012108
976 Ga0163162_10172537
977 Ga0157372_11316155
978 Ga0157375_10016277
979 Ga0163163_10469135
980 Ga0157379_10003329
981 Ga0182007_10019443
982 Ga0182005_1144793
983 Ga0183366_1002
984 Ga0183370_1002
985 Ga0183369_1002
986 Ga0183368_1005
987 Ga0163161_10332874
988 Ga0213872_10000093
989 Ga0213872_10000490
990 Ga0213872_10035775
991 Ga0213875_10036528
992 Ga0228598_1001530
993 Ga0209674_100003
994 Ga0209672_104934
995 Ga0209563_100141
996 Ga0209677_100068
997 Ga0209759_1000423
998 Ga0209673_1008860
999 Ga0209676_1000049
1000 Ga0209758_1000126
1001 Ga0209050_1000118
1002 Ga0209050_1002175
1003 Ga0209050_1007206
1004 Ga0207426_1006988
1005 Ga0209051_1012520
1006 Ga0209051_1028849
1007 Ga0209257_1000017
1008 Ga0209257_1081915
1009 Ga0207696_1000102
1010 Ga0207655_1000050
1011 Ga0207713_1003234
1012 Ga0207713_1007592
1013 Ga0207713_1010008
1014 Ga0207713_1034261
1015 Ga0207713_1037724
1016 Ga0207713_1062235
1017 Ga0207682_10046815
1018 Ga0207682_10059042
1019 Ga0207692_10025699
1020 Ga0207688_10037219
1021 Ga0207688_10076491
1022 Ga0207647_10000214
1023 Ga0207699_10169778
1024 Ga0207699_10417052
1025 Ga0207645_10003842
1026 Ga0207645_10008045
1027 Ga0207705_10298720
1028 Ga0207684_10367423
1029 Ga0207707_10045648
1030 Ga0207707_10323779
1031 Ga0207695_10295074
1032 Ga0207695_10748603
1033 Ga0207693_10048621
1034 Ga0207693_10071974
1035 Ga0207693_10133085
1036 Ga0207663_10226097
1037 Ga0207660_10173914
1038 Ga0207657_10006963
1039 Ga0207657_10141589
1040 Ga0207649_10136089
1041 Ga0207652_10175672
1042 Ga0207694_10145346
1043 Ga0207650_10017828
1044 Ga0207650_10294106
1045 Ga0207659_10045359
1046 Ga0207659_10155103
1047 Ga0207687_10263955
1048 Ga0207687_10356245
1049 Ga0207700_10124520
1050 Ga0207700_10558911
1051 Ga0207664_10089110
1052 Ga0207664_10239628
1053 Ga0207644_10033227
1054 Ga0207644_10036754
1055 Ga0207644_10060190
1056 Ga0207690_10004649
1057 Ga0207690_10022726
1058 Ga0207690_10248754
1059 Ga0207690_10364671
1060 Ga0207706_10066449
1061 Ga0207706_10285918
1062 Ga0207709_10023791
1063 Ga0207709_10093838
1064 Ga0207670_10010092
1065 Ga0207670_10089062
1066 Ga0207670_10155224
1067 Ga0207669_10034282
1068 Ga0207669_10603336
1069 Ga0207669_10695154
1070 Ga0207704_10050758
1071 Ga0207691_10012265
1072 Ga0207691_10041907
1073 Ga0207691_10053770
1074 Ga0207711_10332058
1075 Ga0207661_10257693
1076 Ga0207661_10350052
1077 Ga0207661_10665332
1078 Ga0207667_10154009
1079 Ga0207667_10351371
1080 Ga0207667_10535255
1081 Ga0207651_10004851
1082 Ga0207651_10460359
1083 Ga0207668_10665261
1084 Ga0207640_10140243
1085 Ga0207658_10001854
1086 Ga0207658_10293172
1087 Ga0207677_10026511
1088 Ga0207703_10004753
1089 Ga0207703_11125195
1090 Ga0207639_10203980
1091 Ga0207639_10295485
1092 Ga0207639_10833009
1093 Ga0207678_10002276
1094 Ga0207678_10207607
1095 Ga0207702_10053116
1096 Ga0207702_10152927
1097 Ga0207641_10607502
1098 Ga0207648_10002295
1099 Ga0207648_10136083
1100 Ga0207674_10001229
1101 Ga0207674_10013681
1102 Ga0207674_10196505
1103 Ga0207675_100023354
1104 Ga0207683_10230825
1105 Ga0207698_10565938
1106 Ga0209281_1000283
1107 Ga0209281_1000308
1108 Ga0209281_1000994
1109 Ga0209281_1001423
1110 Ga0209371_1000013
1111 Ga0209371_1000770
1112 Ga0209974_10002757
1113 Ga0207428_10546467
1114 Ga0268266_10001726
1115 Ga0268266_10044374
1116 Ga0268266_10235400
1117 Ga0268266_10516774
1118 Ga0265334_10009277
1119 Ga0265318_10007856
1120 Ga0265336_10000053
1121 Ga0307517_10000174
1122 Ga0307517_10108074
1123 Ga0307515_10001235
1124 Ga0307515_10004451
1125 Ga0307515_10132420
1126 Ga0307515_10162890
1127 Ga0307515_10246467
1128 Ga0265324_10000132
1129 Ga0268256_1000014
1130 Ga0268256_1000647
1131 Ga0307511_10094344
1132 Ga0307512_10046505
1133 Ga0307512_10184109
1134 Ga0265328_10020326
1135 Ga0265325_10030670
1136 Ga0265325_10035978
1137 Ga0265340_10001678
1138 Ga0265339_10011043
1139 Ga0265331_10006526
1140 Ga0265327_10000012
1141 Ga0265327_10003227
1142 Ga0265327_10228751
1143 Ga0265316_10036333
1144 Ga0265316_10156124
1145 Ga0307513_10014799
1146 Ga0307513_10130230
1147 Ga0307513_10195449
1148 Ga0307509_10000225
1149 Ga0307509_10005996
1150 Ga0307509_10053865
1151 Ga0307509_10067974
1152 Ga0307408_100000010
1153 Ga0307408_100908838
1154 Ga0265313_10123248
1155 Ga0307508_10000185
1156 Ga0307508_10001432
1157 Ga0307508_10002202
1158 Ga0307508_10003035
1159 Ga0307514_10049262
1160 Ga0307514_10143758
1161 Ga0316579_10277060
1162 Ga0265314_10001531
1163 Ga0265314_10035008
1164 Ga0265314_10138293
1165 Ga0265342_10042951
1166 Ga0265342_10165792
1167 Ga0307516_10001572
1168 Ga0307516_10009757
1169 Ga0307516_10259861
1170 Ga0307405_10021739
1171 Ga0307405_10185701
1172 Ga0307413_10339359
1173 Ga0307407_10026323
1174 Ga0307409_100286400
1175 Ga0307416_100851412
1176 Ga0307507_10065803
1177 Ga0307510_10002036
1178 Ga0307510_10034205
1179 Ga0373948_0005315
1180 Ga0373926_0077703
1181 Ga0373928_0010732
1182 Ga0373940_0037180
1183 Ga0373923_0076552
1184 Ga0373932_0025863
1185 Ga0373936_0024437
1186 Ga0373939_0000036
1187 Ga0373954_0011225
1188 Ga0373956_0019348
1189 Ga0373943_0034564
1190 Ga0373943_0401850
1191 Ga0373946_0084338
1192 Ga0373962_0007469
1193 Ga0316574_0538732
1194 Ga0373931_0000268
1195 Ga0373931_0008787
1196 Ga0373931_0209948
1197 Ga0373935_0104638
1198 Ga0373927_0354282
1199 Ga0373927_0477124
1200 Ga0373933_0008201
1201 Ga0373947_0394835
1202 Ga0373937_0003306
1203 Ga0373937_0023547
1204 Ga0373937_0214132
1205 Ga0373937_0325039
1206 Ga0373925_0027268
1207 Ga0373925_0096228
1208 Ga0373925_0418139
1209 Ga0395899_0002765
1210 Ga0395899_0014664
1211 Ga0395899_0076220
1212 Ga0395900_0008007
1213 Ga0395900_0015475
1214 Ga0395900_0083557
1215 Ga0395900_0139262
1216 Ga0395900_0173885
1217 Ga0395898_0006186
1218 Ga0395898_0039633
1219 Ga0395898_0148759
1220 Ga0395898_0171308
1221 Ga0395905_0000025
1222 Ga0395905_0005980
1223 Ga0395905_0008672
1224 Ga0395905_0030958
1225 Ga0395905_0050499
1226 Ga0395905_0059042
1227 Ga0395905_0069854
1228 Ga0395905_0079244
1229 Ga0395905_0504115
1230 Ga0395905_0719640
1231 Ga0395905_0755081
1232 Ga0436364_0492175
1233 Ga0436364_1360306
1234 Ga0395901_0003336
1235 Ga0395901_0043746
1236 Ga0395901_0107006
1237 Ga0395901_0174821
1238 Ga0395901_0256096
1239 Ga0395901_0537969
1240 Ga0400490_19766
1241 Ga0436365_1030367
1242 Ga0436360_0103786
1243 Ga0436360_0283312
1244 Ga0436360_0649612
1245 Ga0436360_0708127
1246 Ga0436361_0058641
1247 Ga0436361_0098550
1248 Ga0436361_0289802
1249 Ga0436361_0380155
1250 Ga0436361_0410668
1251 Ga0436361_0653184
1252 Ga0436361_0766328
1253 Ga0436361_1213797
1254 Ga0436361_1214496
1255 Ga0436363_0288717
1256 Ga0436362_1051954
1257 Ga0439447_055633
1258 Ga0451789_0173976
1259 Ga0451789_1258901
1260 Ga0451791_1222017
1261 Ga0451793_1887844
1262 Ga0451798_0187906
1263 Ga0451800_0997610
1264 Ga0451853_0292917
1265 Ga0439448_0044399
1266 Ga0439452_000141
1267 Ga0439452_000604
1268 Ga0450901_000116
1269 Ga0451577_0014637
1270 Ga0451577_0038258
1271 Ga0466969_0035833
1272 Ga0466977_0001317
1273 Ga0466981_0000001
1274 Ga0466966_0002026
1275 Ga0466966_0011911
1276 Ga0466961_0045147
1277 Ga0453684_0002411
1278 Ga0453684_0002552
1279 Ga0453684_0131908
1280 Ga0466971_0006284
1281 Ga0466968_0051102
1282 Ga0466970_0034701
1283 Ga0466959_0002381
1284 Ga0466959_0024159
1285 Ga0466959_0186178
1286 Ga0451576_0021714
1287 Ga0451576_0070312
1288 Ga0466958_0143808
1289 Ga0495592_0001312
1290 Ga0495591_010516
1291 Ga0495629_0062368
1292 Ga0495629_0429184
1293 Ga0495638_0111379
1294 Ga0495638_0164268
1295 Ga0495638_0229829
1296 Ga0495651_0011915
1297 Ga0495653_0069116
1298 Ga0495650_0000040
1299 Ga0495662_0076309
1300 Ga0495583_0000159
1301 Ga0495606_0005971
1302 Ga0495608_0000180
1303 Ga0495620_0011609
1304 Ga0495628_0027713
1305 Ga0495628_0212603
1306 Ga0495630_0148899
1307 Ga0495630_0449750
1308 Ga0495632_0004601
1309 Ga0495632_0012661
1310 Ga0495644_0024463
1311 Ga0495648_0057854
1312 Ga0495666_0126634
1313 Ga0495666_0136678
1314 Ga0495652_0004484
1315 Ga0495640_0011129
1316 Ga0495645_0114971
1317 Ga0495633_0003465
1318 Ga0495667_0006865
1319 Ga0495667_0012787
1320 Ga0495635_0002686
1321 Ga0495635_0095933
1322 Ga0495657_0017312
1323 Ga0495599_0066436
1324 Ga0495599_0272136
1325 Ga0495623_0014713
1326 Ga0495646_0253970
1327 Ga0495658_0032612
1328 Ga0495624_0095731
1329 Ga0495671_0016703
1330 Ga0495671_0084130
1331 Ga0495649_0000760
1332 Ga0495649_0001240
1333 Ga0495649_0005881
1334 Ga0495589_0003499
1335 Ga0495600_0005529
1336 Ga0495604_0000241
1337 Ga0495674_0017966
1338 Ga0495674_0032889
1339 Ga0495674_0149045
1340 Ga0495672_0159004
1341 Ga0495676_0213093
1342 Ga0495680_0000994
1343 Ga0495679_004962
1344 Ga0495686_0004435
1345 Ga0495602_0010667
1346 Ga0495614_0251148
1347 Ga0496101_0147970
1348 Ga0496102_0007894
1349 Ga0496104_0001702
1350 Ga0496104_0130603
1351 Ga0496104_0639924
1352 Ga0496105_0054625
1353 Ga0496105_0226223
1354 Ga0496105_0379026
1355 Ga0496109_0460024
1356 Ga0496112_0031940
1357 Ga0496112_0037322
1358 Ga0496116_0001458
1359 Ga0496116_0009281
1360 Ga0496116_0026850
1361 Ga0496116_0045377
1362 Ga0496117_0008694
1363 Ga0496117_0016174
1364 Ga0496117_0112497
1365 Ga0496117_0128221
1366 Ga0496118_0002802
1367 Ga0496118_0022466
1368 Ga0496118_0035786
1369 Ga0496118_0038436
1370 Ga0496118_0040266
1371 Ga0496118_0073071
1372 Ga0496118_0153551
1373 Ga0496118_0215287
1374 Ga0496119_0000438
1375 Ga0496119_0006572
1376 Ga0496119_0009447
1377 Ga0496119_0009582
1378 Ga0496119_0020054
1379 Ga0496119_0093129
1380 Ga0496119_0185548
1381 Ga0496119_0196127
1382 Ga0496119_0205455
1383 Ga0496120_0006993
1384 Ga0496120_0015782
1385 Ga0496120_0017901
1386 Ga0496120_0035404
1387 Ga0496120_0076836
1388 Ga0496120_0107954
1389 Ga0496120_0109698
1390 Ga0496120_0286958
1391 Ga0496121_0000729
1392 Ga0496121_0004852
1393 Ga0496121_0014724
1394 Ga0496121_0022172
1395 Ga0496121_0082677
1396 Ga0496121_0180201
1397 Ga0496121_0381877
1398 Ga0496121_0405139
1399 Ga0496121_0424121
1400 Ga0496122_0008944
1401 Ga0496122_0025170
1402 Ga0496122_0059803
1403 Ga0496122_0120875
1404 Ga0496122_0127356
1405 Ga0496123_0020285
1406 Ga0496123_0024494
1407 Ga0496123_0040172
1408 Ga0496123_0051988
1409 Ga0496123_0062130
1410 Ga0496123_0074150
1411 Ga0496123_0287337
1412 Ga0496123_0296620
1413 Ga0496124_0000458
1414 Ga0496124_0000649
1415 Ga0496124_0004557
1416 Ga0496124_0043082
1417 Ga0496124_0109668
1418 Ga0496124_0115509
1419 Ga0496124_0122443
1420 Ga0496124_0157997
1421 Ga0496124_0178151
1422 Ga0496124_0524040
1423 Ga0496124_0574994
1424 Ga0496125_0000176
1425 Ga0496125_0000370
1426 Ga0496125_0000522
1427 Ga0496125_0004254
1428 Ga0496125_0035699
1429 Ga0496125_0039207
1430 Ga0496125_0188964
1431 Ga0496125_0189365
1432 Ga0496126_0000329
1433 Ga0496126_0006943
1434 Ga0496126_0023134
1435 Ga0496126_0036180
1436 Ga0496126_0038207
1437 Ga0496126_0085578
1438 Ga0496126_0216132
1439 Ga0496126_0254378
1440 Ga0496126_0332932
1441 Ga0496126_0772766
1442 Ga0501031_0438289
1443 Ga0501032_0274596
1444 Ga0501034_0000891
1445 Ga0501036_0043205
1446 Ga0501038_0832475
1447 Ga0501039_0853863
1448 Ga0501042_0167530
1449 Ga0501070_0458664
1450 Ga0501070_0717050
1451 Ga0501071_0213511
1452 Ga0501072_0580051
1453 Ga0501073_0005280
1454 Ga0501074_0164829
1455 Ga0501074_0279470
1456 Ga0501206_005345
1457 Ga0501080_0277255
1458 Ga0501081_0080810
1459 nmdc:mga03683_2170_c2
1460 nmdc:mga03n38_25584_c1
1461 nmdc:mga00v17_108561_c1
1462 nmdc:mga00v17_281313_c1
1463 nmdc:mga0k408_1297_c2
1464 nmdc:mga0k408_157438_c1
1465 nmdc:mga0k408_208903_c2
1466 nmdc:mga0k408_6099_c1
1467 nmdc:mga07m45_183995_c1
1468 nmdc:mga07m45_278375_c1
1469 nmdc:mga07m45_748_c1
1470 nmdc:mga05p37_296340_c1
1471 nmdc:mga05p37_441880_c1
1472 nmdc:mga05p37_645950_c1
1473 nmdc:mga05p37_942100_c1
1474 nmdc:mga09592_2859_c1
1475 nmdc:mga0qj67_577334_c1
1476 nmdc:mga0qj67_92402_c1
1477 nmdc:mga06r32_341153_c1
1478 nmdc:mga08y16_192145_c1
1479 nmdc:mga08y16_587640_c1
1480 nmdc:mga08y16_635362_c1
1481 nmdc:mga0n895_354078_c1
1482 nmdc:mga08x19_362063_c1
1483 nmdc:mga0a205_211457_c1
1484 nmdc:mga0sz30_20944_c1
1485 nmdc:mga0sz30_2490_c1
1486 Ga0495601_0001571
1487 Ga0495601_0002038
1488 Ga0495612_0000746
1489 Ga0500635_0000363
1490 Ga0495595_0000387
1491 Ga0495595_0057549
1492 Ga0495595_0430811
1493 Ga0495619_0030742
1494 Ga0495619_0036207
1495 Ga0500578_0000079
1496 Ga0500643_008711
1497 Ga0500644_0001074
1498 Ga0500651_0092267
1499 Ga0500593_041066
1500 Ga0500594_0001408
1501 Ga0500594_0004863
1502 Ga0500595_000029
1503 Ga0500607_197285
1504 Ga0500652_000624
1505 Ga0500652_107925
1506 Ga0500658_0006331
1507 Ga0500658_0017060
1508 Ga0500658_0067760
1509 Ga0500559_0000329
1510 Ga0500559_0050482
1511 Ga0500588_0006411
1512 Ga0500616_0000006
1513 Ga0500616_0001264
1514 Ga0500622_0000053
1515 Ga0500622_0007462
1516 Ga0500622_0093747
1517 Ga0500636_0015032
1518 Ga0500636_0070250
1519 Ga0500645_000614
1520 Ga0501082_0071314
1521 Ga0466962_0005900
1522 2515679265
1523 2555247152
1524 2587728133
1525 2587731191
1526 2587759971
1527 2588289944
1528 2603644192
1529 2603701264
1530 2603704784
1531 2643742396
1532 2643933639
1533 2643972266
1534 2644141623
1535 2644222023
1536 2644257198
1537 2644275606
1538 2644302863
1539 2644315139
1540 2671104682
1541 2681997965
1542 2682008076
1543 2723875890
1544 2738819916
1545 2738832396
1546 2738873923
1547 2739055249
1548 2739185553
1549 2739220521
1550 2739349258
1551 2753857597
1552 2765590703
1553 2775540265
1554 2792841161
1555 2821120579
1556 2821444350
1557 2823376466
1558 2834641739
1559 2835312758
1560 2840883231
1561 2842779705
1562 2881102725
1563 2882461725
1564 2894027582
1565 2902683277
1566 2927836932
1567 2932424875
1568 2937543970
1569 2939576448
1570 2941533317
1571 2990710368
1572 642422891
1573 8001525934
1574 8003402777
1575 8018223270
1576 8019560230
1577 8019570330
1578 8052497667
1579 8054931894
1580 8056123581
1581 8056140736
1582 8057308326

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02492

cobW

CobW/HypB/UreG, nucleotide-binding domain

39

212

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xkt-assembly1.cif.gz_B klebsiella pneumoniae ureg in complex with gmppnp and nickel 0.9351 6 202
5xkt-assembly1.cif.gz_B klebsiella pneumoniae ureg in complex with gmppnp and nickel 0.9215 6 202
4hi0-assembly1.cif.gz_F crystal structure of helicobacter pylori urease accessory protein uref/h/g complex 0.9155 8 198
4hi0-assembly1.cif.gz_F crystal structure of helicobacter pylori urease accessory protein uref/h/g complex 0.8889 8 198
2hf9-assembly1.cif.gz_A crystal structure of hypb from methanocaldococcus jannaschii in the triphosphate form 0.856 6 200
ID Description Score Start End Superfamily
af_O64700_71_266_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9241 5 200 3.40.50.300
af_O64700_71_266_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9151 5 200 3.40.50.300
2wsmA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.849 6 204 3.40.50.300
af_P0AAN3_68_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8397 6 200 3.40.50.300
4lpsB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8211 6 200 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3C1Z988-F1-model_v4 Urease accessory protein UreG 0.9438 124 202 GO:0003924
GO:0005525
GO:0016151
GO:0043419
AF-A0A830DDA0-F1-model_v4 Urease accessory protein g 0.9427 6 200 GO:0003924
GO:0005525
GO:0016151
GO:0043419
AF-A0A7K4DRQ4-F1-model_v4 Urease accessory protein UreG 0.9408 118 203 GO:0003924
GO:0005525
GO:0016151
GO:0043419
AF-A0A6N6PVF4-F1-model_v4 Urease accessory protein UreG 0.9397 114 200 GO:0003924
GO:0005525
GO:0016151
GO:0043419
AF-A0A6A8FMF7-F1-model_v4 Urease accessory protein UreG 0.9377 123 198 GO:0003924
GO:0005525
GO:0016151
GO:0043419

Map