F481012

General Info

Members Datasets Scaffolds Average Seq Length
792 264 1584 232

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10098438|Ga0070709_100984383
Length 226
Sequence MREIVFDTETTGLNPLGGDRMVEIGCIEIINRVETGRHFHAYFYPEREMPFEAEMVHGLTNAFLSDKPLFAEKAEELIENASFDFGFLNHELERCGRPGVPMSRMVDTLTLARSRHPGAKHSLDALCMRFGIDRSHRVKHGALLDAQLLAQVYVELTGGRQIGLGLVADAGTISVAQSTGPIIIRERRPPRPHAPLAEELERHRAFIAKLVNPIWERFAPHHQGVG

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
162 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
163 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
164 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
182 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
184 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
191 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
200 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
201 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
202 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
203 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
204 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
205 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
206 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
207 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
213 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
214 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
215 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
216 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
217 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
218 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
219 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
220 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
221 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
222 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
223 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
224 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
242 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
246 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
247 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
248 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
251 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
252 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
253 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
254 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
255 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
256 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
257 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
258 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
259 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
260 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
261 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
262 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
263 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
264 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 0
Rhizoplane 2.78
Rhizosphere 95.2
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10098438 3300005434 Bacteria 1944
2 JGI24736J21556_1000066 3300001904 Bacteria 17179
3 JGI24736J21556_1000114 3300001904 Bacteria 13747
4 JGI24741J21665_1003089 3300001915 Bacteria 4095
5 JGI24740J21852_10004210 3300001979 Bacteria 6212
6 JGI24739J22299_10008994 3300001989 Bacteria 3728
7 JGI24737J22298_10001822 3300001990 Bacteria 7629
8 JGI24735J21928_10009963 3300002067 Bacteria 3043
9 JGI24735J21928_10025273 3300002067 Bacteria 1793
10 JGI24745J21846_1005029 3300002073 Bacteria 1431
11 JGI24738J21930_10000704 3300002075 Bacteria 9639
12 Ga0065715_10000565 3300005293 Bacteria 10505
13 Ga0065715_10166590 3300005293 Bacteria 1557
14 Ga0070658_10000177 3300005327 Bacteria 56043
15 Ga0070658_10030017 3300005327 Bacteria 4368
16 Ga0070658_10055314 3300005327 Bacteria 3224
17 Ga0070658_10060673 3300005327 Bacteria 3080
18 Ga0070658_10076279 3300005327 Bacteria 2749
19 Ga0070658_10770909 3300005327 Bacteria 835
20 Ga0070676_10042193 3300005328 Bacteria 2648
21 Ga0070676_10050997 3300005328 Bacteria 2428
22 Ga0070676_10069490 3300005328 Bacteria 2111
23 Ga0070676_10113685 3300005328 Bacteria 1689
24 Ga0070683_100002630 3300005329 Bacteria 14354
25 Ga0070683_100004360 3300005329 Bacteria 11644
26 Ga0070683_100010738 3300005329 Bacteria 7878
27 Ga0070683_100036480 3300005329 Bacteria 4498
28 Ga0070683_100040449 3300005329 Bacteria 4287
29 Ga0070670_100007610 3300005331 Bacteria 9199
30 Ga0070670_100014078 3300005331 Bacteria 6862
31 Ga0070670_100064639 3300005331 Bacteria 3139
32 Ga0070670_100075622 3300005331 Bacteria 2893
33 Ga0070677_10005158 3300005333 Bacteria 4293
34 Ga0070677_10121833 3300005333 Bacteria 1179
35 Ga0068869_100153426 3300005334 Bacteria 1788
36 Ga0070666_10000205 3300005335 Bacteria 40586
37 Ga0070666_10002806 3300005335 Bacteria 10520
38 Ga0070666_10200552 3300005335 Bacteria 1404
39 Ga0070682_100032930 3300005337 Bacteria 3146
40 Ga0068868_100001585 3300005338 Bacteria 15507
41 Ga0068868_100382456 3300005338 Bacteria 1211
42 Ga0068868_100512449 3300005338 Bacteria 1052
43 Ga0070660_100000065 3300005339 Bacteria 61999
44 Ga0070660_100005580 3300005339 Bacteria 8722
45 Ga0070660_100030157 3300005339 Bacteria 4067
46 Ga0070660_100056680 3300005339 Bacteria 3032
47 Ga0070660_100056812 3300005339 Bacteria 3029
48 Ga0070660_100272161 3300005339 Bacteria 1384
49 Ga0070660_100382842 3300005339 Bacteria 1161
50 Ga0070689_100138728 3300005340 Bacteria 1954
51 Ga0070689_100207404 3300005340 Bacteria 1603
52 Ga0070691_10044907 3300005341 Bacteria 2096
53 Ga0070661_100000084 3300005344 Bacteria 74971
54 Ga0070661_100007237 3300005344 Bacteria 7654
55 Ga0070661_100013518 3300005344 Bacteria 5732
56 Ga0070661_100015630 3300005344 Bacteria 5357
57 Ga0070661_100059608 3300005344 Bacteria 2800
58 Ga0070661_100073642 3300005344 Bacteria 2515
59 Ga0070661_100136002 3300005344 Bacteria 1849
60 Ga0070661_100224446 3300005344 Bacteria 1442
61 Ga0070692_10003068 3300005345 Bacteria 6675
62 Ga0070692_10017116 3300005345 Bacteria 3460
63 Ga0070668_100007118 3300005347 Bacteria 8289
64 Ga0070668_100251930 3300005347 Bacteria 1466
65 Ga0070669_100005425 3300005353 Bacteria 9200
66 Ga0070669_100036160 3300005353 Bacteria 3577
67 Ga0070669_100117379 3300005353 Bacteria 2026
68 Ga0070669_100125866 3300005353 Bacteria 1961
69 Ga0070675_100005450 3300005354 Bacteria 9731
70 Ga0070675_100016431 3300005354 Bacteria 5874
71 Ga0070675_100063724 3300005354 Bacteria 3048
72 Ga0070675_100184831 3300005354 Bacteria 1803
73 Ga0070671_100005160 3300005355 Bacteria 10397
74 Ga0070671_100011633 3300005355 Bacteria 7077
75 Ga0070671_100022991 3300005355 Bacteria 5094
76 Ga0070671_100034473 3300005355 Bacteria 4190
77 Ga0070671_100039621 3300005355 Bacteria 3911
78 Ga0070671_100072955 3300005355 Bacteria 2867
79 Ga0070674_100009250 3300005356 Bacteria 5897
80 Ga0070674_100076178 3300005356 Bacteria 2384
81 Ga0070673_100000376 3300005364 Bacteria 23364
82 Ga0070673_100003783 3300005364 Bacteria 9492
83 Ga0070673_100019485 3300005364 Bacteria 4870
84 Ga0070673_100173546 3300005364 Bacteria 1841
85 Ga0070659_100001520 3300005366 Bacteria 16726
86 Ga0070659_100056006 3300005366 Bacteria 3108
87 Ga0070659_100090297 3300005366 Bacteria 2455
88 Ga0070659_100120609 3300005366 Bacteria 2123
89 Ga0070659_100278025 3300005366 Bacteria 1392
90 Ga0070667_100001373 3300005367 Bacteria 21792
91 Ga0070667_100003791 3300005367 Bacteria 12860
92 Ga0070667_100005308 3300005367 Bacteria 10765
93 Ga0070667_100119477 3300005367 Bacteria 2292
94 Ga0070667_100125820 3300005367 Bacteria 2233
95 Ga0070667_100712950 3300005367 Bacteria 929
96 Ga0070714_100020576 3300005435 Bacteria 5391
97 Ga0070714_100046589 3300005435 Bacteria 3679
98 Ga0070713_100255994 3300005436 Bacteria 1598
99 Ga0070700_100008201 3300005441 Bacteria 5684
100 Ga0070663_100001477 3300005455 Bacteria 12918
101 Ga0070663_100006039 3300005455 Bacteria 7248
102 Ga0070663_100081532 3300005455 Bacteria 2378
103 Ga0070663_100086544 3300005455 Bacteria 2314
104 Ga0070663_100130633 3300005455 Bacteria 1907
105 Ga0070678_100000919 3300005456 Bacteria 15133
106 Ga0070678_100039998 3300005456 Bacteria 3314
107 Ga0070678_100062596 3300005456 Bacteria 2748
108 Ga0070678_100593207 3300005456 Bacteria 988
109 Ga0070662_100000017 3300005457 Bacteria 105478
110 Ga0070662_100000350 3300005457 Bacteria 27678
111 Ga0070662_100200557 3300005457 Bacteria 1583
112 Ga0070681_10276098 3300005458 Bacteria 1592
113 Ga0070681_10277224 3300005458 Bacteria 1588
114 Ga0070681_10498269 3300005458 Bacteria 1131
115 Ga0068867_100017538 3300005459 Bacteria 5084
116 Ga0068867_100364543 3300005459 Bacteria 1209
117 Ga0070679_100551324 3300005530 Bacteria 1096
118 Ga0070684_100015289 3300005535 Bacteria 6245
119 Ga0070684_100020259 3300005535 Bacteria 5517
120 Ga0070684_100042518 3300005535 Bacteria 3923
121 Ga0068853_100000703 3300005539 Bacteria 23188
122 Ga0068853_100008841 3300005539 Bacteria 8102
123 Ga0068853_100061639 3300005539 Bacteria 3245
124 Ga0068853_100149179 3300005539 Bacteria 2104
125 Ga0068853_100157526 3300005539 Bacteria 2047
126 Ga0068853_100169151 3300005539 Bacteria 1977
127 Ga0068853_100830510 3300005539 Bacteria 886
128 Ga0070672_100001101 3300005543 Bacteria 16486
129 Ga0070672_100004066 3300005543 Bacteria 9547
130 Ga0070672_100107798 3300005543 Bacteria 2267
131 Ga0070695_100248198 3300005545 Bacteria 1294
132 Ga0070696_100385711 3300005546 Bacteria 1093
133 Ga0070693_100009123 3300005547 Bacteria 4924
134 Ga0070693_100520703 3300005547 Bacteria 847
135 Ga0070665_100005491 3300005548 Bacteria 13062
136 Ga0070665_100009518 3300005548 Bacteria 9828
137 Ga0070665_100124648 3300005548 Bacteria 2578
138 Ga0070665_100300473 3300005548 Bacteria 1608
139 Ga0070665_100301553 3300005548 Bacteria 1605
140 Ga0068855_100000194 3300005563 Bacteria 78505
141 Ga0068855_100108475 3300005563 Bacteria 3189
142 Ga0068855_100298274 3300005563 Bacteria 1785
143 Ga0068855_100310890 3300005563 Bacteria 1743
144 Ga0068855_100433979 3300005563 Bacteria 1435
145 Ga0068855_100617221 3300005563 Bacteria 1168
146 Ga0068855_100977069 3300005563 Bacteria 891
147 Ga0070664_100000098 3300005564 Bacteria 55907
148 Ga0070664_100005544 3300005564 Bacteria 10133
149 Ga0070664_100006436 3300005564 Bacteria 9475
150 Ga0070664_100022619 3300005564 Bacteria 5183
151 Ga0070664_100040999 3300005564 Bacteria 3905
152 Ga0070664_100097212 3300005564 Bacteria 2556
153 Ga0070664_100397886 3300005564 Bacteria 1259
154 Ga0068857_100032846 3300005577 Bacteria 4587
155 Ga0068857_100056063 3300005577 Bacteria 3497
156 Ga0068857_100073498 3300005577 Bacteria 3046
157 Ga0068857_100509632 3300005577 Bacteria 1130
158 Ga0068854_100002764 3300005578 Bacteria 10898
159 Ga0068854_100003023 3300005578 Bacteria 10451
160 Ga0068854_100014664 3300005578 Bacteria 5170
161 Ga0068854_100025478 3300005578 Bacteria 4059
162 Ga0068854_100041472 3300005578 Bacteria 3252
163 Ga0068854_100071312 3300005578 Bacteria 2541
164 Ga0068856_100000098 3300005614 Bacteria 83221
165 Ga0068856_100027857 3300005614 Bacteria 5512
166 Ga0068856_100054691 3300005614 Bacteria 3938
167 Ga0068856_100474565 3300005614 Bacteria 1272
168 Ga0068852_100000440 3300005616 Bacteria 27519
169 Ga0068852_100006849 3300005616 Bacteria 8280
170 Ga0068852_100031098 3300005616 Bacteria 4401
171 Ga0068852_100062797 3300005616 Bacteria 3232
172 Ga0068852_100068109 3300005616 Bacteria 3114
173 Ga0068852_100166314 3300005616 Bacteria 2064
174 Ga0068852_100318068 3300005616 Bacteria 1511
175 Ga0068859_100001231 3300005617 Bacteria 26157
176 Ga0068859_100005659 3300005617 Bacteria 12722
177 Ga0068859_100010321 3300005617 Bacteria 9401
178 Ga0068859_100030121 3300005617 Bacteria 5445
179 Ga0068864_100000145 3300005618 Bacteria 68040
180 Ga0068864_100000953 3300005618 Bacteria 24235
181 Ga0068864_100010591 3300005618 Bacteria 7624
182 Ga0068866_10124001 3300005718 Bacteria 1460
183 Ga0068861_100304065 3300005719 Bacteria 1383
184 Ga0068870_10011657 3300005840 Bacteria 4085
185 Ga0068863_100000027 3300005841 Bacteria 181884
186 Ga0068863_100002810 3300005841 Bacteria 17249
187 Ga0068863_100003718 3300005841 Bacteria 15092
188 Ga0068863_100008708 3300005841 Bacteria 9912
189 Ga0068863_100467445 3300005841 Bacteria 1239
190 Ga0068858_100000268 3300005842 Bacteria 55747
191 Ga0068858_100000695 3300005842 Bacteria 35157
192 Ga0068858_100003129 3300005842 Bacteria 16562
193 Ga0068858_100009018 3300005842 Bacteria 9539
194 Ga0068858_100032317 3300005842 Bacteria 4861
195 Ga0068858_100115549 3300005842 Bacteria 2508
196 Ga0068860_100000391 3300005843 Bacteria 57332
197 Ga0068860_100020638 3300005843 Bacteria 6382
198 Ga0068860_100064679 3300005843 Bacteria 3474
199 Ga0068862_100000014 3300005844 Bacteria 251552
200 Ga0068862_100007629 3300005844 Bacteria 8958
201 Ga0068862_100011300 3300005844 Bacteria 7372
202 Ga0068862_100011857 3300005844 Bacteria 7198
203 Ga0068862_100044826 3300005844 Bacteria 3773
204 Ga0070717_10082997 3300006028 Bacteria 2694
205 Ga0070716_100115373 3300006173 Bacteria 1671
206 Ga0070712_100270517 3300006175 Bacteria 1365
207 Ga0097621_100132707 3300006237 Bacteria 2121
208 Ga0097621_100153930 3300006237 Bacteria 1973
209 Ga0097621_100352120 3300006237 Bacteria 1310
210 Ga0097621_100361544 3300006237 Bacteria 1293
211 Ga0075370_10005349 3300006353 Bacteria 6370
212 Ga0068871_100069014 3300006358 Unclassified 2902
213 Ga0068871_100244330 3300006358 Bacteria 1562
214 Ga0068871_100259245 3300006358 Bacteria 1516
215 Ga0068865_100647686 3300006881 Bacteria 898
216 Ga0097620_100001231 3300006931 Bacteria 26157
217 Ga0097620_100005660 3300006931 Bacteria 12722
218 Ga0097620_100010321 3300006931 Bacteria 9401
219 Ga0097620_100023168 3300006931 Bacteria 6229
220 Ga0097620_100030122 3300006931 Bacteria 5445
221 Ga0105250_10017407 3300009092 Bacteria 2922
222 Ga0105240_10012132 3300009093 Bacteria 11930
223 Ga0105240_10045839 3300009093 Bacteria 5545
224 Ga0105240_10105813 3300009093 Bacteria 3414
225 Ga0105245_10042402 3300009098 Bacteria 4061
226 Ga0105247_10003692 3300009101 Bacteria 9932
227 Ga0105243_10131029 3300009148 Bacteria 2127
228 Ga0105241_10022968 3300009174 Bacteria 4625
229 Ga0105248_10000184 3300009177 Bacteria 72728
230 Ga0105248_10000390 3300009177 Bacteria 50573
231 Ga0105248_10000444 3300009177 Bacteria 47003
232 Ga0105248_10001388 3300009177 Bacteria 26986
233 Ga0105248_10009540 3300009177 Bacteria 10681
234 Ga0105248_10021785 3300009177 Bacteria 7102
235 Ga0105248_10509186 3300009177 Bacteria 1357
236 Ga0105237_10016649 3300009545 Bacteria 7635
237 Ga0105238_10027588 3300009551 Bacteria 5787
238 Ga0105238_10031317 3300009551 Bacteria 5413
239 Ga0105238_10039780 3300009551 Bacteria 4767
240 Ga0105249_10000002 3300009553 Bacteria 376207
241 Ga0105249_10001466 3300009553 Bacteria 20693
242 Ga0105249_10046397 3300009553 Bacteria 3954
243 Ga0105249_10089940 3300009553 Bacteria 2870
244 Ga0105239_10195634 3300010375 Bacteria 2264
245 Ga0157373_10007297 3300013100 Bacteria 8232
246 Ga0157373_10019148 3300013100 Bacteria 4984
247 Ga0157373_10025832 3300013100 Bacteria 4246
248 Ga0157373_10098826 3300013100 Bacteria 2054
249 Ga0157371_10002003 3300013102 Bacteria 20140
250 Ga0157371_10012251 3300013102 Bacteria 6566
251 Ga0157371_10017812 3300013102 Bacteria 5267
252 Ga0157371_10025908 3300013102 Bacteria 4267
253 Ga0157371_10069359 3300013102 Bacteria 2496
254 Ga0157371_10078646 3300013102 Bacteria 2336
255 Ga0157371_10095601 3300013102 Bacteria 2105
256 Ga0157371_10099573 3300013102 Bacteria 2061
257 Ga0157371_10136844 3300013102 Bacteria 1744
258 Ga0157371_10197177 3300013102 Bacteria 1443
259 Ga0157371_10208569 3300013102 Bacteria 1402
260 Ga0157371_10604169 3300013102 Bacteria 816
261 Ga0157370_10018639 3300013104 Bacteria 6977
262 Ga0157370_10029172 3300013104 Bacteria 5419
263 Ga0157370_10088851 3300013104 Bacteria 2902
264 Ga0157370_10146539 3300013104 Bacteria 2198
265 Ga0157370_10208742 3300013104 Bacteria 1810
266 Ga0157369_10000043 3300013105 Bacteria 180713
267 Ga0157369_10011088 3300013105 Bacteria 10254
268 Ga0157369_10050600 3300013105 Bacteria 4499
269 Ga0157369_10164786 3300013105 Bacteria 2338
270 Ga0157369_10223324 3300013105 Bacteria 1971
271 Ga0157369_10299393 3300013105 Bacteria 1673
272 Ga0157369_10372078 3300013105 Bacteria 1483
273 Ga0157369_10565593 3300013105 Bacteria 1175
274 Ga0157369_10726542 3300013105 Bacteria 1022
275 Ga0157374_10002141 3300013296 Bacteria 16638
276 Ga0157374_10005411 3300013296 Bacteria 10726
277 Ga0157374_10056025 3300013296 Bacteria 3680
278 Ga0157378_10027473 3300013297 Bacteria 5022
279 Ga0157378_10043077 3300013297 Bacteria 4007
280 Ga0157378_10087449 3300013297 Bacteria 2827
281 Ga0157378_10131937 3300013297 Bacteria 2313
282 Ga0163162_10002668 3300013306 Bacteria 16918
283 Ga0163162_10010851 3300013306 Bacteria 8866
284 Ga0163162_10025560 3300013306 Bacteria 5836
285 Ga0163162_10080689 3300013306 Bacteria 3322
286 Ga0163162_10145637 3300013306 Bacteria 2485
287 Ga0157372_10040729 3300013307 Bacteria 5133
288 Ga0157372_10160734 3300013307 Bacteria 2596
289 Ga0157372_10195058 3300013307 Bacteria 2346
290 Ga0157372_10565954 3300013307 Bacteria 1325
291 Ga0157372_10565955 3300013307 Bacteria 1325
292 Ga0157375_10000709 3300013308 Bacteria 29414
293 Ga0157375_10073585 3300013308 Bacteria 3436
294 Ga0157375_10602527 3300013308 Bacteria 1258
295 Ga0163163_10000131 3300014325 Bacteria 76809
296 Ga0163163_10000169 3300014325 Bacteria 68481
297 Ga0163163_10001864 3300014325 Bacteria 17807
298 Ga0163163_10123122 3300014325 Bacteria 2629
299 Ga0157380_10003743 3300014326 Bacteria 10460
300 Ga0157380_10013753 3300014326 Bacteria 5909
301 Ga0157380_10363241 3300014326 Bacteria 1359
302 Ga0157379_10002480 3300014968 Bacteria 15449
303 Ga0157379_10072765 3300014968 Bacteria 3076
304 Ga0163161_10002075 3300017792 Bacteria 14527
305 Ga0163161_10017590 3300017792 Bacteria 5005
306 Ga0209257_1011481 3300025304 Bacteria 4259
307 Ga0207697_10001895 3300025315 Bacteria 11159
308 Ga0207697_10003663 3300025315 Bacteria 7527
309 Ga0207697_10020945 3300025315 Bacteria 2677
310 Ga0207656_10016654 3300025321 Bacteria 2865
311 Ga0207682_10000923 3300025893 Bacteria 13618
312 Ga0207682_10002958 3300025893 Bacteria 7457
313 Ga0207682_10146431 3300025893 Bacteria 1063
314 Ga0207642_10156191 3300025899 Bacteria 1220
315 Ga0207710_10001762 3300025900 Bacteria 10446
316 Ga0207688_10001410 3300025901 Bacteria 12534
317 Ga0207688_10012090 3300025901 Bacteria 4695
318 Ga0207680_10000773 3300025903 Bacteria 15110
319 Ga0207680_10004223 3300025903 Bacteria 6801
320 Ga0207680_10307194 3300025903 Bacteria 1106
321 Ga0207647_10001558 3300025904 Bacteria 17625
322 Ga0207647_10001741 3300025904 Bacteria 16680
323 Ga0207647_10002702 3300025904 Bacteria 13390
324 Ga0207647_10024301 3300025904 Bacteria 3997
325 Ga0207647_10080968 3300025904 Bacteria 1946
326 Ga0207647_10086117 3300025904 Bacteria 1878
327 Ga0207645_10020408 3300025907 Bacteria 4337
328 Ga0207645_10041026 3300025907 Bacteria 2964
329 Ga0207645_10074916 3300025907 Bacteria 2167
330 Ga0207643_10014049 3300025908 Bacteria 4346
331 Ga0207643_10014539 3300025908 Bacteria 4279
332 Ga0207705_10000033 3300025909 Bacteria 223997
333 Ga0207705_10000137 3300025909 Bacteria 79174
334 Ga0207705_10026528 3300025909 Bacteria 4132
335 Ga0207705_10029445 3300025909 Bacteria 3914
336 Ga0207705_10039655 3300025909 Bacteria 3376
337 Ga0207705_10228182 3300025909 Bacteria 1416
338 Ga0207705_10313718 3300025909 Bacteria 1204
339 Ga0207654_10143916 3300025911 Bacteria 1523
340 Ga0207707_10332381 3300025912 Bacteria 1311
341 Ga0207707_10429724 3300025912 Bacteria 1131
342 Ga0207695_10004868 3300025913 Bacteria 18117
343 Ga0207695_10009667 3300025913 Bacteria 11881
344 Ga0207695_10015000 3300025913 Bacteria 9142
345 Ga0207695_10109640 3300025913 Bacteria 2742
346 Ga0207671_10031351 3300025914 Bacteria 3961
347 Ga0207693_10120832 3300025915 Bacteria 2057
348 Ga0207660_10042494 3300025917 Bacteria 3191
349 Ga0207660_10203210 3300025917 Bacteria 1548
350 Ga0207660_10207722 3300025917 Bacteria 1532
351 Ga0207657_10000508 3300025919 Bacteria 41139
352 Ga0207657_10011576 3300025919 Bacteria 8751
353 Ga0207657_10012396 3300025919 Bacteria 8423
354 Ga0207657_10018979 3300025919 Bacteria 6544
355 Ga0207657_10047588 3300025919 Bacteria 3748
356 Ga0207657_10052117 3300025919 Bacteria 3553
357 Ga0207657_10071420 3300025919 Bacteria 2940
358 Ga0207657_10337718 3300025919 Bacteria 1189
359 Ga0207649_10000186 3300025920 Bacteria 50868
360 Ga0207649_10000737 3300025920 Bacteria 21468
361 Ga0207649_10004832 3300025920 Bacteria 7285
362 Ga0207649_10010259 3300025920 Bacteria 5142
363 Ga0207649_10019101 3300025920 Bacteria 3913
364 Ga0207649_10040201 3300025920 Bacteria 2841
365 Ga0207649_10344647 3300025920 Bacteria 1101
366 Ga0207652_10170400 3300025921 Bacteria 1953
367 Ga0207681_10001743 3300025923 Bacteria 13962
368 Ga0207681_10014834 3300025923 Bacteria 4853
369 Ga0207681_10030797 3300025923 Bacteria 3500
370 Ga0207681_10162280 3300025923 Bacteria 1686
371 Ga0207681_10469491 3300025923 Bacteria 1026
372 Ga0207694_10017707 3300025924 Bacteria 5385
373 Ga0207694_10048271 3300025924 Bacteria 3294
374 Ga0207694_10078157 3300025924 Bacteria 2593
375 Ga0207650_10003361 3300025925 Bacteria 11007
376 Ga0207650_10054914 3300025925 Bacteria 2956
377 Ga0207650_10069691 3300025925 Bacteria 2642
378 Ga0207650_10168456 3300025925 Bacteria 1740
379 Ga0207650_10236162 3300025925 Bacteria 1476
380 Ga0207659_10016247 3300025926 Bacteria 4840
381 Ga0207659_10030808 3300025926 Bacteria 3667
382 Ga0207659_10067735 3300025926 Bacteria 2594
383 Ga0207687_10113697 3300025927 Bacteria 2014
384 Ga0207700_10320486 3300025928 Bacteria 1343
385 Ga0207664_10049541 3300025929 Bacteria 3307
386 Ga0207644_10000111 3300025931 Bacteria 60737
387 Ga0207644_10006549 3300025931 Bacteria 7589
388 Ga0207644_10020946 3300025931 Bacteria 4450
389 Ga0207644_10023264 3300025931 Bacteria 4242
390 Ga0207644_10162201 3300025931 Bacteria 1738
391 Ga0207644_10235809 3300025931 Bacteria 1455
392 Ga0207690_10000108 3300025932 Bacteria 67599
393 Ga0207690_10044417 3300025932 Bacteria 2929
394 Ga0207690_10049401 3300025932 Bacteria 2804
395 Ga0207690_10166930 3300025932 Bacteria 1646
396 Ga0207690_10499985 3300025932 Bacteria 983
397 Ga0207690_10512602 3300025932 Bacteria 971
398 Ga0207706_10000276 3300025933 Bacteria 55889
399 Ga0207706_10000514 3300025933 Bacteria 41167
400 Ga0207706_10001018 3300025933 Bacteria 28609
401 Ga0207706_10047462 3300025933 Bacteria 3799
402 Ga0207706_10099945 3300025933 Bacteria 2552
403 Ga0207706_10400451 3300025933 Bacteria 1190
404 Ga0207706_10435473 3300025933 Bacteria 1135
405 Ga0207670_10038785 3300025936 Bacteria 3114
406 Ga0207669_10002765 3300025937 Bacteria 7524
407 Ga0207669_10008335 3300025937 Bacteria 4859
408 Ga0207704_10603433 3300025938 Bacteria 899
409 Ga0207665_10056891 3300025939 Bacteria 2641
410 Ga0207691_10002752 3300025940 Bacteria 17143
411 Ga0207691_10014857 3300025940 Bacteria 7421
412 Ga0207691_10074127 3300025940 Bacteria 3070
413 Ga0207691_10218948 3300025940 Bacteria 1651
414 Ga0207691_10423090 3300025940 Bacteria 1135
415 Ga0207711_10000105 3300025941 Bacteria 90036
416 Ga0207711_10000190 3300025941 Bacteria 65723
417 Ga0207711_10000413 3300025941 Bacteria 45274
418 Ga0207711_10003775 3300025941 Bacteria 13046
419 Ga0207711_10005548 3300025941 Bacteria 10667
420 Ga0207711_10012443 3300025941 Bacteria 7072
421 Ga0207711_10038564 3300025941 Bacteria 4063
422 Ga0207689_10112929 3300025942 Bacteria 2233
423 Ga0207689_10553909 3300025942 Bacteria 966
424 Ga0207661_10007968 3300025944 Bacteria 7551
425 Ga0207661_10022512 3300025944 Bacteria 4748
426 Ga0207661_10034436 3300025944 Bacteria 3938
427 Ga0207661_10075835 3300025944 Bacteria 2760
428 Ga0207661_10098825 3300025944 Bacteria 2446
429 Ga0207661_10535680 3300025944 Bacteria 1072
430 Ga0207679_10000114 3300025945 Bacteria 64628
431 Ga0207679_10038365 3300025945 Bacteria 3412
432 Ga0207679_10046008 3300025945 Bacteria 3160
433 Ga0207679_10168309 3300025945 Bacteria 1801
434 Ga0207679_10196899 3300025945 Bacteria 1680
435 Ga0207679_10237995 3300025945 Bacteria 1541
436 Ga0207667_10016322 3300025949 Bacteria 8393
437 Ga0207667_10081978 3300025949 Bacteria 3342
438 Ga0207667_10103076 3300025949 Bacteria 2943
439 Ga0207667_10206083 3300025949 Bacteria 2016
440 Ga0207667_10259417 3300025949 Bacteria 1777
441 Ga0207667_10351088 3300025949 Bacteria 1504
442 Ga0207667_10456820 3300025949 Bacteria 1298
443 Ga0207651_10001938 3300025960 Bacteria 9718
444 Ga0207651_10108775 3300025960 Bacteria 2075
445 Ga0207651_10172892 3300025960 Bacteria 1705
446 Ga0207651_10176249 3300025960 Bacteria 1691
447 Ga0207712_10000002 3300025961 Bacteria 706628
448 Ga0207712_10008274 3300025961 Bacteria 6575
449 Ga0207712_10027059 3300025961 Bacteria 3826
450 Ga0207712_10067825 3300025961 Bacteria 2554
451 Ga0207668_10000054 3300025972 Bacteria 95426
452 Ga0207668_10002327 3300025972 Bacteria 11097
453 Ga0207668_10048063 3300025972 Bacteria 2926
454 Ga0207640_10000473 3300025981 Bacteria 24521
455 Ga0207640_10006878 3300025981 Bacteria 6255
456 Ga0207640_10103670 3300025981 Bacteria 2000
457 Ga0207640_10116885 3300025981 Bacteria 1902
458 Ga0207658_10002159 3300025986 Bacteria 14623
459 Ga0207658_10005799 3300025986 Bacteria 8453
460 Ga0207658_10012692 3300025986 Bacteria 5754
461 Ga0207658_10023849 3300025986 Bacteria 4274
462 Ga0207658_10164207 3300025986 Bacteria 1822
463 Ga0207658_10352231 3300025986 Bacteria 1282
464 Ga0207658_10711025 3300025986 Bacteria 908
465 Ga0207677_10000600 3300026023 Bacteria 22226
466 Ga0207677_10067922 3300026023 Bacteria 2499
467 Ga0207703_10000139 3300026035 Bacteria 86495
468 Ga0207703_10000461 3300026035 Bacteria 42797
469 Ga0207703_10004673 3300026035 Bacteria 11183
470 Ga0207703_10005508 3300026035 Bacteria 10174
471 Ga0207639_10000139 3300026041 Bacteria 54240
472 Ga0207639_10003170 3300026041 Bacteria 11066
473 Ga0207639_10045291 3300026041 Bacteria 3312
474 Ga0207639_10119521 3300026041 Bacteria 2163
475 Ga0207639_10176839 3300026041 Bacteria 1812
476 Ga0207678_10000746 3300026067 Bacteria 29716
477 Ga0207678_10005368 3300026067 Bacteria 11477
478 Ga0207678_10006212 3300026067 Bacteria 10615
479 Ga0207678_10019046 3300026067 Bacteria 6028
480 Ga0207678_10023972 3300026067 Bacteria 5334
481 Ga0207708_10069128 3300026075 Bacteria 2703
482 Ga0207708_10240255 3300026075 Bacteria 1457
483 Ga0207702_10001266 3300026078 Bacteria 25382
484 Ga0207702_10012719 3300026078 Bacteria 7003
485 Ga0207702_10013935 3300026078 Bacteria 6679
486 Ga0207702_10021319 3300026078 Bacteria 5363
487 Ga0207702_10586832 3300026078 Bacteria 1093
488 Ga0207702_10712039 3300026078 Bacteria 990
489 Ga0207641_10000045 3300026088 Bacteria 181882
490 Ga0207641_10000172 3300026088 Bacteria 90549
491 Ga0207641_10004364 3300026088 Bacteria 12251
492 Ga0207648_10003539 3300026089 Bacteria 16337
493 Ga0207648_10015998 3300026089 Bacteria 6874
494 Ga0207648_10075650 3300026089 Bacteria 2935
495 Ga0207676_10000072 3300026095 Bacteria 101978
496 Ga0207676_10002758 3300026095 Bacteria 12490
497 Ga0207676_10156502 3300026095 Bacteria 1969
498 Ga0207674_10013020 3300026116 Bacteria 9267
499 Ga0207674_10063263 3300026116 Bacteria 3735
500 Ga0207674_10078211 3300026116 Bacteria 3313
501 Ga0207674_10109713 3300026116 Bacteria 2735
502 Ga0207675_100001317 3300026118 Bacteria 24894
503 Ga0207675_100222537 3300026118 Bacteria 1819
504 Ga0207683_10002199 3300026121 Bacteria 17148
505 Ga0207683_10013394 3300026121 Bacteria 6992
506 Ga0207683_10044948 3300026121 Bacteria 3862
507 Ga0207683_10565818 3300026121 Bacteria 1051
508 Ga0207698_10000598 3300026142 Bacteria 21116
509 Ga0207698_10005864 3300026142 Bacteria 7634
510 Ga0207698_10009468 3300026142 Bacteria 6215
511 Ga0207698_10029422 3300026142 Bacteria 3934
512 Ga0207698_10058247 3300026142 Bacteria 2993
513 Ga0207698_10152943 3300026142 Bacteria 2005
514 Ga0207698_10265868 3300026142 Bacteria 1578
515 Ga0207698_10320895 3300026142 Bacteria 1450
516 Ga0209983_1004501 3300027665 Bacteria 2928
517 Ga0209974_10000990 3300027876 Bacteria 9987
518 Ga0209974_10009484 3300027876 Bacteria 3305
519 Ga0268266_10027905 3300028379 Bacteria 4801
520 Ga0268266_10033207 3300028379 Bacteria 4388
521 Ga0268266_10100141 3300028379 Bacteria 2552
522 Ga0268265_10000607 3300028380 Bacteria 35893
523 Ga0268265_10006136 3300028380 Bacteria 8153
524 Ga0268265_10013973 3300028380 Bacteria 5467
525 Ga0268265_10040240 3300028380 Bacteria 3451
526 Ga0268265_10182082 3300028380 Bacteria 1806
527 Ga0268264_10000634 3300028381 Bacteria 41826
528 Ga0268264_10001019 3300028381 Bacteria 28201
529 Ga0268264_10002547 3300028381 Bacteria 15981
530 Ga0268264_10058285 3300028381 Bacteria 3233
531 Ga0307517_10044322 3300028786 Bacteria 4709
532 Ga0307517_10127210 3300028786 Bacteria 1853
533 Ga0316176_1173477 3300030732 Bacteria 1859
534 Ga0316180_1092407 3300030736 Bacteria 2435
535 Ga0316183_1194200 3300030742 Bacteria 1074
536 Ga0316181_1010522 3300030744 Bacteria 1798
537 Ga0307513_10059999 3300031456 Bacteria 4035
538 Ga0307513_10472561 3300031456 Bacteria 975
539 Ga0307408_100015250 3300031548 Bacteria 5116
540 Ga0307408_100051378 3300031548 Bacteria 2969
541 Ga0307408_100080102 3300031548 Bacteria 2438
542 Ga0307408_100091772 3300031548 Bacteria 2294
543 Ga0307408_100267624 3300031548 Bacteria 1417
544 Ga0307408_100390827 3300031548 Bacteria 1192
545 Ga0307516_10144543 3300031730 Bacteria 2145
546 Ga0307405_10013101 3300031731 Bacteria 4414
547 Ga0307405_10029271 3300031731 Bacteria 3218
548 Ga0307405_10083236 3300031731 Bacteria 2097
549 Ga0307405_10130318 3300031731 Bacteria 1736
550 Ga0307405_10344640 3300031731 Bacteria 1147
551 Ga0307405_10390249 3300031731 Bacteria 1087
552 Ga0307405_10560111 3300031731 Bacteria 926
553 Ga0307413_10006953 3300031824 Bacteria 5211
554 Ga0307413_10023067 3300031824 Bacteria 3367
555 Ga0307413_10045729 3300031824 Bacteria 2597
556 Ga0307413_10156956 3300031824 Unclassified 1593
557 Ga0307410_10001524 3300031852 Bacteria 10547
558 Ga0307410_10002541 3300031852 Bacteria 8833
559 Ga0307410_10006594 3300031852 Bacteria 6277
560 Ga0307410_10010566 3300031852 Bacteria 5237
561 Ga0307410_10013709 3300031852 Bacteria 4740
562 Ga0307410_10036358 3300031852 Bacteria 3206
563 Ga0307410_10043909 3300031852 Bacteria 2965
564 Ga0307410_10045613 3300031852 Bacteria 2920
565 Ga0307410_10252144 3300031852 Bacteria 1372
566 Ga0307406_10033272 3300031901 Bacteria 3154
567 Ga0307406_10062485 3300031901 Bacteria 2409
568 Ga0307406_10094667 3300031901 Bacteria 2019
569 Ga0307406_10097014 3300031901 Bacteria 1998
570 Ga0307406_10146347 3300031901 Bacteria 1679
571 Ga0307406_10256624 3300031901 Bacteria 1320
572 Ga0307406_10265174 3300031901 Bacteria 1302
573 Ga0307406_10300007 3300031901 Bacteria 1234
574 Ga0307406_10320637 3300031901 Bacteria 1198
575 Ga0307406_10525807 3300031901 Bacteria 963
576 Ga0307407_10029956 3300031903 Bacteria 2929
577 Ga0307407_10033216 3300031903 Bacteria 2813
578 Ga0307407_10044587 3300031903 Bacteria 2501
579 Ga0307407_10061890 3300031903 Bacteria 2190
580 Ga0307407_10083516 3300031903 Bacteria 1938
581 Ga0307407_10122908 3300031903 Bacteria 1648
582 Ga0307407_10254322 3300031903 Bacteria 1205
583 Ga0307407_10397299 3300031903 Bacteria 988
584 Ga0307407_10413640 3300031903 Bacteria 970
585 Ga0307412_10002333 3300031911 Bacteria 10511
586 Ga0307412_10003753 3300031911 Bacteria 8444
587 Ga0307412_10019090 3300031911 Bacteria 4141
588 Ga0307412_10056498 3300031911 Bacteria 2616
589 Ga0307412_10083089 3300031911 Bacteria 2219
590 Ga0307412_10086981 3300031911 Bacteria 2176
591 Ga0307412_10170101 3300031911 Bacteria 1628
592 Ga0307412_10234602 3300031911 Bacteria 1415
593 Ga0307412_10315531 3300031911 Bacteria 1241
594 Ga0307412_10566532 3300031911 Bacteria 956
595 Ga0307409_100009382 3300031995 Bacteria 6008
596 Ga0307409_100016968 3300031995 Bacteria 4837
597 Ga0307409_100060305 3300031995 Bacteria 2958
598 Ga0307409_100065443 3300031995 Bacteria 2860
599 Ga0307409_100183528 3300031995 Bacteria 1854
600 Ga0307409_100203812 3300031995 Bacteria 1772
601 Ga0307409_100311378 3300031995 Bacteria 1469
602 Ga0307409_100391245 3300031995 Bacteria 1325
603 Ga0307409_100429147 3300031995 Bacteria 1270
604 Ga0307409_100644293 3300031995 Bacteria 1052
605 Ga0307409_100822869 3300031995 Bacteria 938
606 Ga0307409_100841948 3300031995 Bacteria 927
607 Ga0307416_100010569 3300032002 Bacteria 6105
608 Ga0307416_100043317 3300032002 Bacteria 3523
609 Ga0307416_100089815 3300032002 Bacteria 2632
610 Ga0307416_100169717 3300032002 Bacteria 2029
611 Ga0307416_100181893 3300032002 Bacteria 1971
612 Ga0307416_100259842 3300032002 Bacteria 1696
613 Ga0307416_100311078 3300032002 Bacteria 1572
614 Ga0307416_100346287 3300032002 Bacteria 1501
615 Ga0307416_100535007 3300032002 Bacteria 1242
616 Ga0307414_10007424 3300032004 Bacteria 6157
617 Ga0307414_10074392 3300032004 Bacteria 2461
618 Ga0307414_10077437 3300032004 Bacteria 2420
619 Ga0307414_10087767 3300032004 Bacteria 2300
620 Ga0307414_10109184 3300032004 Bacteria 2101
621 Ga0307414_10112369 3300032004 Bacteria 2076
622 Ga0307414_10144491 3300032004 Bacteria 1867
623 Ga0307414_10174172 3300032004 Bacteria 1723
624 Ga0307414_10188003 3300032004 Bacteria 1668
625 Ga0307414_10238242 3300032004 Bacteria 1504
626 Ga0307414_10766675 3300032004 Bacteria 878
627 Ga0307411_10000518 3300032005 Bacteria 13563
628 Ga0307411_10005481 3300032005 Bacteria 6239
629 Ga0307411_10024776 3300032005 Bacteria 3582
630 Ga0307411_10032304 3300032005 Bacteria 3232
631 Ga0307411_10033608 3300032005 Bacteria 3183
632 Ga0307411_10046369 3300032005 Bacteria 2801
633 Ga0307411_10058003 3300032005 Bacteria 2560
634 Ga0307411_10081614 3300032005 Bacteria 2227
635 Ga0307411_10086504 3300032005 Bacteria 2174
636 Ga0307411_10100317 3300032005 Bacteria 2045
637 Ga0307411_10111180 3300032005 Bacteria 1961
638 Ga0307411_10257057 3300032005 Unclassified 1377
639 Ga0307415_100000171 3300032126 Bacteria 28816
640 Ga0307415_100059574 3300032126 Bacteria 2634
641 Ga0307415_100091983 3300032126 Bacteria 2198
642 Ga0307415_100147335 3300032126 Bacteria 1807
643 Ga0307415_100306690 3300032126 Bacteria 1317
644 Ga0316583_10006180 3300032133 Bacteria 4308
645 Ga0307510_10000369 3300033180 Bacteria 42647
646 Ga0373958_0048274 3300034819 Bacteria 892
647 Ga0373923_0163279 3300035111 Bacteria 1017
648 Ga0373939_0059072 3300035114 Bacteria 1215
649 Ga0373957_0011847 3300035120 Bacteria 2922
650 Ga0373955_0017940 3300035172 Bacteria 3510
651 Ga0373931_0010139 3300035691 Bacteria 4522
652 Ga0373935_0025073 3300035692 Bacteria 3674
653 Ga0373933_0055688 3300035724 Bacteria 2373
654 Ga0373937_0033405 3300036401 Bacteria 4672
655 Ga0316582_0015227 3300036647 Bacteria 4390
656 Ga0316582_0216777 3300036647 Bacteria 1308
657 Ga0316584_0634968 3300036712 Bacteria 737
658 Ga0373925_0634660 3300037068 Bacteria 880
659 Ga0395899_0000129 3300037312 Bacteria 118043
660 Ga0395899_0002708 3300037312 Bacteria 14288
661 Ga0395899_0014549 3300037312 Bacteria 6008
662 Ga0395899_0049098 3300037312 Bacteria 3137
663 Ga0395899_0075048 3300037312 Bacteria 2469
664 Ga0395899_0137130 3300037312 Bacteria 1743
665 Ga0395900_0000468 3300037418 Bacteria 57784
666 Ga0395900_0008602 3300037418 Bacteria 10487
667 Ga0395900_0010815 3300037418 Bacteria 9336
668 Ga0395900_0014984 3300037418 Bacteria 7901
669 Ga0395900_0021957 3300037418 Bacteria 6526
670 Ga0395900_0023328 3300037418 Bacteria 6332
671 Ga0395900_0024082 3300037418 Bacteria 6230
672 Ga0395900_0036992 3300037418 Bacteria 5032
673 Ga0395900_0077876 3300037418 Bacteria 3406
674 Ga0395900_0078105 3300037418 Bacteria 3401
675 Ga0395900_0107872 3300037418 Bacteria 2860
676 Ga0395900_0327208 3300037418 Bacteria 1511
677 Ga0395900_0481325 3300037418 Bacteria 1194
678 Ga0395898_0018728 3300037466 Bacteria 7057
679 Ga0395898_0026615 3300037466 Bacteria 5817
680 Ga0395898_0030537 3300037466 Bacteria 5392
681 Ga0395898_0031474 3300037466 Bacteria 5300
682 Ga0395898_0037775 3300037466 Bacteria 4788
683 Ga0395898_0147662 3300037466 Bacteria 2250
684 Ga0395898_0149228 3300037466 Bacteria 2237
685 Ga0395898_0324907 3300037466 Bacteria 1467
686 Ga0395898_0580358 3300037466 Bacteria 1063
687 Ga0395898_0844297 3300037466 Bacteria 855
688 Ga0395905_0000232 3300037471 Bacteria 84233
689 Ga0395905_0002796 3300037471 Bacteria 19111
690 Ga0395905_0015679 3300037471 Bacteria 7199
691 Ga0395905_0026630 3300037471 Bacteria 5451
692 Ga0395905_0048085 3300037471 Bacteria 3998
693 Ga0395905_0051277 3300037471 Bacteria 3864
694 Ga0395905_0071242 3300037471 Bacteria 3259
695 Ga0395905_0129687 3300037471 Bacteria 2371
696 Ga0316581_0045622 3300037588 Bacteria 1339
697 Ga0395901_0000031 3300038443 Bacteria 241733
698 Ga0395901_0000131 3300038443 Bacteria 96504
699 Ga0395901_0008693 3300038443 Bacteria 10262
700 Ga0395901_0024121 3300038443 Bacteria 6239
701 Ga0395901_0042467 3300038443 Bacteria 4714
702 Ga0395901_0062053 3300038443 Bacteria 3889
703 Ga0395901_0066469 3300038443 Bacteria 3755
704 Ga0395901_0093494 3300038443 Bacteria 3148
705 Ga0395901_0141388 3300038443 Bacteria 2529
706 Ga0395901_0177005 3300038443 Bacteria 2237
707 Ga0395901_0202297 3300038443 Bacteria 2082
708 Ga0395901_0389393 3300038443 Bacteria 1433
709 Ga0439431_0042236 3300041997 Bacteria 1164
710 Ga0439443_016330 3300042003 Bacteria 1133
711 Ga0450920_007031 3300042122 Bacteria 2033
712 Ga0439464_0000427 3300042439 Bacteria 8288
713 Ga0466966_0000021 3300044684 Bacteria 116714
714 Ga0466966_0033906 3300044684 Bacteria 3304
715 Ga0466966_0096905 3300044684 Bacteria 1827
716 Ga0466961_0026586 3300044693 Bacteria 3719
717 Ga0466961_0082147 3300044693 Bacteria 2039
718 Ga0466963_0036592 3300044694 Bacteria 3202
719 Ga0466964_0034342 3300044706 Bacteria 2024
720 Ga0466971_0013190 3300044719 Bacteria 3626
721 Ga0466957_0017966 3300044842 Bacteria 4147
722 Ga0466959_0108427 3300045049 Bacteria 1984
723 Ga0466958_0003833 3300045836 Bacteria 7857
724 Ga0466967_0018938 3300045976 Bacteria 5522
725 Ga0466967_0058953 3300045976 Bacteria 3395
726 Ga0495638_0097754 3300046460 Bacteria 1760
727 Ga0495650_0031267 3300046471 Bacteria 2398
728 Ga0495584_0124321 3300046491 Bacteria 1307
729 Ga0495637_0073734 3300046520 Bacteria 1372
730 Ga0495648_0013722 3300046524 Bacteria 5972
731 Ga0495648_0038706 3300046524 Bacteria 3045
732 Ga0495642_0008044 3300046528 Bacteria 4034
733 Ga0495598_0181488 3300046537 Bacteria 751
734 Ga0495668_0002012 3300046616 Bacteria 17752
735 Ga0495659_0015361 3300046664 Bacteria 2516
736 Ga0495669_0003949 3300046684 Bacteria 6106
737 Ga0495669_0115754 3300046684 Bacteria 1254
738 Ga0495670_0008719 3300046691 Bacteria 4991
739 Ga0495670_0014736 3300046691 Bacteria 3847
740 Ga0495670_0089531 3300046691 Bacteria 1574
741 Ga0495660_0218412 3300046810 Bacteria 900
742 Ga0495677_0003219 3300047445 Bacteria 6369
743 Ga0495602_0054509 3300048088 Bacteria 3529
744 Ga0496100_0544496 3300048903 Bacteria 897
745 Ga0496101_0041166 3300048904 Bacteria 3293
746 Ga0496101_0136335 3300048904 Bacteria 1868
747 Ga0496102_0007003 3300048905 Bacteria 9626
748 Ga0496102_0273733 3300048905 Bacteria 1592
749 Ga0496103_0016842 3300048906 Bacteria 4365
750 Ga0496106_0386033 3300048909 Bacteria 1125
751 Ga0496107_0010812 3300048910 Bacteria 6350
752 Ga0496108_0243655 3300048911 Bacteria 1564
753 Ga0496108_0291198 3300048911 Bacteria 1421
754 Ga0496109_0037244 3300048912 Bacteria 4395
755 Ga0496109_0154762 3300048912 Bacteria 2147
756 Ga0496109_0295348 3300048912 Bacteria 1528
757 Ga0496110_0004899 3300048913 Bacteria 10445
758 Ga0496110_0010491 3300048913 Bacteria 7540
759 Ga0496111_0001883 3300048914 Bacteria 12409
760 Ga0496111_0049638 3300048914 Bacteria 3026
761 Ga0496112_0565932 3300048915 Bacteria 1070
762 Ga0496113_0002116 3300048916 Bacteria 11451
763 Ga0496114_0262924 3300048917 Bacteria 1519
764 Ga0496115_0008793 3300048918 Bacteria 7482
765 Ga0496125_0198494 3300048928 Bacteria 1316
766 Ga0501292_012493 3300049515 Bacteria 1296
767 Ga0501298_007399 3300049521 Bacteria 1820
768 Ga0501070_0166768 3300049586 Bacteria 1815
769 Ga0501071_0071606 3300049587 Bacteria 2528
770 Ga0501235_017511 3300049669 Bacteria 1585
771 Ga0501243_009778 3300049675 Bacteria 1492
772 Ga0501249_004088 3300049679 Bacteria 2952
773 Ga0501225_0042682 3300049705 Bacteria 1253
774 Ga0501080_0371850 3300049742 Bacteria 1289
775 Ga0501263_002294 3300049760 Bacteria 1934
776 Ga0501266_011983 3300049763 Bacteria 1115
777 Ga0501268_006179 3300049765 Bacteria 1748
778 Ga0501268_010692 3300049765 Bacteria 1434
779 Ga0501272_008243 3300049769 Bacteria 1141
780 Ga0501273_018358 3300049770 Bacteria 930
781 Ga0501280_000314 3300049776 Bacteria 12170
782 Ga0500643_000096 3300053087 Bacteria 92125
783 Ga0500643_001035 3300053087 Bacteria 16912
784 Ga0500646_0125306 3300053090 Bacteria 830
785 Ga0500647_0008473 3300053091 Bacteria 4464
786 Ga0500618_006614 3300053125 Bacteria 3384
787 Ga0500658_0000032 3300053134 Bacteria 90863
788 Ga0500636_0136298 3300053177 Bacteria 1363
789 Ga0466962_0077696 3300061719 Bacteria 1587
790 Ga0466962_0202747 3300061719 Bacteria 969
791 2585261820 2582581305 Bacteria 4895574
792 2600203099 2599185354 Bacteria 4398675
793 Ga0070709_10098438
794 JGI24736J21556_1000066
795 JGI24736J21556_1000114
796 JGI24741J21665_1003089
797 JGI24740J21852_10004210
798 JGI24739J22299_10008994
799 JGI24737J22298_10001822
800 JGI24735J21928_10009963
801 JGI24735J21928_10025273
802 JGI24745J21846_1005029
803 JGI24738J21930_10000704
804 Ga0065715_10000565
805 Ga0065715_10166590
806 Ga0070658_10000177
807 Ga0070658_10030017
808 Ga0070658_10055314
809 Ga0070658_10060673
810 Ga0070658_10076279
811 Ga0070658_10770909
812 Ga0070676_10042193
813 Ga0070676_10050997
814 Ga0070676_10069490
815 Ga0070676_10113685
816 Ga0070683_100002630
817 Ga0070683_100004360
818 Ga0070683_100010738
819 Ga0070683_100036480
820 Ga0070683_100040449
821 Ga0070670_100007610
822 Ga0070670_100014078
823 Ga0070670_100064639
824 Ga0070670_100075622
825 Ga0070677_10005158
826 Ga0070677_10121833
827 Ga0068869_100153426
828 Ga0070666_10000205
829 Ga0070666_10002806
830 Ga0070666_10200552
831 Ga0070682_100032930
832 Ga0068868_100001585
833 Ga0068868_100382456
834 Ga0068868_100512449
835 Ga0070660_100000065
836 Ga0070660_100005580
837 Ga0070660_100030157
838 Ga0070660_100056680
839 Ga0070660_100056812
840 Ga0070660_100272161
841 Ga0070660_100382842
842 Ga0070689_100138728
843 Ga0070689_100207404
844 Ga0070691_10044907
845 Ga0070661_100000084
846 Ga0070661_100007237
847 Ga0070661_100013518
848 Ga0070661_100015630
849 Ga0070661_100059608
850 Ga0070661_100073642
851 Ga0070661_100136002
852 Ga0070661_100224446
853 Ga0070692_10003068
854 Ga0070692_10017116
855 Ga0070668_100007118
856 Ga0070668_100251930
857 Ga0070669_100005425
858 Ga0070669_100036160
859 Ga0070669_100117379
860 Ga0070669_100125866
861 Ga0070675_100005450
862 Ga0070675_100016431
863 Ga0070675_100063724
864 Ga0070675_100184831
865 Ga0070671_100005160
866 Ga0070671_100011633
867 Ga0070671_100022991
868 Ga0070671_100034473
869 Ga0070671_100039621
870 Ga0070671_100072955
871 Ga0070674_100009250
872 Ga0070674_100076178
873 Ga0070673_100000376
874 Ga0070673_100003783
875 Ga0070673_100019485
876 Ga0070673_100173546
877 Ga0070659_100001520
878 Ga0070659_100056006
879 Ga0070659_100090297
880 Ga0070659_100120609
881 Ga0070659_100278025
882 Ga0070667_100001373
883 Ga0070667_100003791
884 Ga0070667_100005308
885 Ga0070667_100119477
886 Ga0070667_100125820
887 Ga0070667_100712950
888 Ga0070714_100020576
889 Ga0070714_100046589
890 Ga0070713_100255994
891 Ga0070700_100008201
892 Ga0070663_100001477
893 Ga0070663_100006039
894 Ga0070663_100081532
895 Ga0070663_100086544
896 Ga0070663_100130633
897 Ga0070678_100000919
898 Ga0070678_100039998
899 Ga0070678_100062596
900 Ga0070678_100593207
901 Ga0070662_100000017
902 Ga0070662_100000350
903 Ga0070662_100200557
904 Ga0070681_10276098
905 Ga0070681_10277224
906 Ga0070681_10498269
907 Ga0068867_100017538
908 Ga0068867_100364543
909 Ga0070679_100551324
910 Ga0070684_100015289
911 Ga0070684_100020259
912 Ga0070684_100042518
913 Ga0068853_100000703
914 Ga0068853_100008841
915 Ga0068853_100061639
916 Ga0068853_100149179
917 Ga0068853_100157526
918 Ga0068853_100169151
919 Ga0068853_100830510
920 Ga0070672_100001101
921 Ga0070672_100004066
922 Ga0070672_100107798
923 Ga0070695_100248198
924 Ga0070696_100385711
925 Ga0070693_100009123
926 Ga0070693_100520703
927 Ga0070665_100005491
928 Ga0070665_100009518
929 Ga0070665_100124648
930 Ga0070665_100300473
931 Ga0070665_100301553
932 Ga0068855_100000194
933 Ga0068855_100108475
934 Ga0068855_100298274
935 Ga0068855_100310890
936 Ga0068855_100433979
937 Ga0068855_100617221
938 Ga0068855_100977069
939 Ga0070664_100000098
940 Ga0070664_100005544
941 Ga0070664_100006436
942 Ga0070664_100022619
943 Ga0070664_100040999
944 Ga0070664_100097212
945 Ga0070664_100397886
946 Ga0068857_100032846
947 Ga0068857_100056063
948 Ga0068857_100073498
949 Ga0068857_100509632
950 Ga0068854_100002764
951 Ga0068854_100003023
952 Ga0068854_100014664
953 Ga0068854_100025478
954 Ga0068854_100041472
955 Ga0068854_100071312
956 Ga0068856_100000098
957 Ga0068856_100027857
958 Ga0068856_100054691
959 Ga0068856_100474565
960 Ga0068852_100000440
961 Ga0068852_100006849
962 Ga0068852_100031098
963 Ga0068852_100062797
964 Ga0068852_100068109
965 Ga0068852_100166314
966 Ga0068852_100318068
967 Ga0068859_100001231
968 Ga0068859_100005659
969 Ga0068859_100010321
970 Ga0068859_100030121
971 Ga0068864_100000145
972 Ga0068864_100000953
973 Ga0068864_100010591
974 Ga0068866_10124001
975 Ga0068861_100304065
976 Ga0068870_10011657
977 Ga0068863_100000027
978 Ga0068863_100002810
979 Ga0068863_100003718
980 Ga0068863_100008708
981 Ga0068863_100467445
982 Ga0068858_100000268
983 Ga0068858_100000695
984 Ga0068858_100003129
985 Ga0068858_100009018
986 Ga0068858_100032317
987 Ga0068858_100115549
988 Ga0068860_100000391
989 Ga0068860_100020638
990 Ga0068860_100064679
991 Ga0068862_100000014
992 Ga0068862_100007629
993 Ga0068862_100011300
994 Ga0068862_100011857
995 Ga0068862_100044826
996 Ga0070717_10082997
997 Ga0070716_100115373
998 Ga0070712_100270517
999 Ga0097621_100132707
1000 Ga0097621_100153930
1001 Ga0097621_100352120
1002 Ga0097621_100361544
1003 Ga0075370_10005349
1004 Ga0068871_100069014
1005 Ga0068871_100244330
1006 Ga0068871_100259245
1007 Ga0068865_100647686
1008 Ga0097620_100001231
1009 Ga0097620_100005660
1010 Ga0097620_100010321
1011 Ga0097620_100023168
1012 Ga0097620_100030122
1013 Ga0105250_10017407
1014 Ga0105240_10012132
1015 Ga0105240_10045839
1016 Ga0105240_10105813
1017 Ga0105245_10042402
1018 Ga0105247_10003692
1019 Ga0105243_10131029
1020 Ga0105241_10022968
1021 Ga0105248_10000184
1022 Ga0105248_10000390
1023 Ga0105248_10000444
1024 Ga0105248_10001388
1025 Ga0105248_10009540
1026 Ga0105248_10021785
1027 Ga0105248_10509186
1028 Ga0105237_10016649
1029 Ga0105238_10027588
1030 Ga0105238_10031317
1031 Ga0105238_10039780
1032 Ga0105249_10000002
1033 Ga0105249_10001466
1034 Ga0105249_10046397
1035 Ga0105249_10089940
1036 Ga0105239_10195634
1037 Ga0157373_10007297
1038 Ga0157373_10019148
1039 Ga0157373_10025832
1040 Ga0157373_10098826
1041 Ga0157371_10002003
1042 Ga0157371_10012251
1043 Ga0157371_10017812
1044 Ga0157371_10025908
1045 Ga0157371_10069359
1046 Ga0157371_10078646
1047 Ga0157371_10095601
1048 Ga0157371_10099573
1049 Ga0157371_10136844
1050 Ga0157371_10197177
1051 Ga0157371_10208569
1052 Ga0157371_10604169
1053 Ga0157370_10018639
1054 Ga0157370_10029172
1055 Ga0157370_10088851
1056 Ga0157370_10146539
1057 Ga0157370_10208742
1058 Ga0157369_10000043
1059 Ga0157369_10011088
1060 Ga0157369_10050600
1061 Ga0157369_10164786
1062 Ga0157369_10223324
1063 Ga0157369_10299393
1064 Ga0157369_10372078
1065 Ga0157369_10565593
1066 Ga0157369_10726542
1067 Ga0157374_10002141
1068 Ga0157374_10005411
1069 Ga0157374_10056025
1070 Ga0157378_10027473
1071 Ga0157378_10043077
1072 Ga0157378_10087449
1073 Ga0157378_10131937
1074 Ga0163162_10002668
1075 Ga0163162_10010851
1076 Ga0163162_10025560
1077 Ga0163162_10080689
1078 Ga0163162_10145637
1079 Ga0157372_10040729
1080 Ga0157372_10160734
1081 Ga0157372_10195058
1082 Ga0157372_10565954
1083 Ga0157372_10565955
1084 Ga0157375_10000709
1085 Ga0157375_10073585
1086 Ga0157375_10602527
1087 Ga0163163_10000131
1088 Ga0163163_10000169
1089 Ga0163163_10001864
1090 Ga0163163_10123122
1091 Ga0157380_10003743
1092 Ga0157380_10013753
1093 Ga0157380_10363241
1094 Ga0157379_10002480
1095 Ga0157379_10072765
1096 Ga0163161_10002075
1097 Ga0163161_10017590
1098 Ga0209257_1011481
1099 Ga0207697_10001895
1100 Ga0207697_10003663
1101 Ga0207697_10020945
1102 Ga0207656_10016654
1103 Ga0207682_10000923
1104 Ga0207682_10002958
1105 Ga0207682_10146431
1106 Ga0207642_10156191
1107 Ga0207710_10001762
1108 Ga0207688_10001410
1109 Ga0207688_10012090
1110 Ga0207680_10000773
1111 Ga0207680_10004223
1112 Ga0207680_10307194
1113 Ga0207647_10001558
1114 Ga0207647_10001741
1115 Ga0207647_10002702
1116 Ga0207647_10024301
1117 Ga0207647_10080968
1118 Ga0207647_10086117
1119 Ga0207645_10020408
1120 Ga0207645_10041026
1121 Ga0207645_10074916
1122 Ga0207643_10014049
1123 Ga0207643_10014539
1124 Ga0207705_10000033
1125 Ga0207705_10000137
1126 Ga0207705_10026528
1127 Ga0207705_10029445
1128 Ga0207705_10039655
1129 Ga0207705_10228182
1130 Ga0207705_10313718
1131 Ga0207654_10143916
1132 Ga0207707_10332381
1133 Ga0207707_10429724
1134 Ga0207695_10004868
1135 Ga0207695_10009667
1136 Ga0207695_10015000
1137 Ga0207695_10109640
1138 Ga0207671_10031351
1139 Ga0207693_10120832
1140 Ga0207660_10042494
1141 Ga0207660_10203210
1142 Ga0207660_10207722
1143 Ga0207657_10000508
1144 Ga0207657_10011576
1145 Ga0207657_10012396
1146 Ga0207657_10018979
1147 Ga0207657_10047588
1148 Ga0207657_10052117
1149 Ga0207657_10071420
1150 Ga0207657_10337718
1151 Ga0207649_10000186
1152 Ga0207649_10000737
1153 Ga0207649_10004832
1154 Ga0207649_10010259
1155 Ga0207649_10019101
1156 Ga0207649_10040201
1157 Ga0207649_10344647
1158 Ga0207652_10170400
1159 Ga0207681_10001743
1160 Ga0207681_10014834
1161 Ga0207681_10030797
1162 Ga0207681_10162280
1163 Ga0207681_10469491
1164 Ga0207694_10017707
1165 Ga0207694_10048271
1166 Ga0207694_10078157
1167 Ga0207650_10003361
1168 Ga0207650_10054914
1169 Ga0207650_10069691
1170 Ga0207650_10168456
1171 Ga0207650_10236162
1172 Ga0207659_10016247
1173 Ga0207659_10030808
1174 Ga0207659_10067735
1175 Ga0207687_10113697
1176 Ga0207700_10320486
1177 Ga0207664_10049541
1178 Ga0207644_10000111
1179 Ga0207644_10006549
1180 Ga0207644_10020946
1181 Ga0207644_10023264
1182 Ga0207644_10162201
1183 Ga0207644_10235809
1184 Ga0207690_10000108
1185 Ga0207690_10044417
1186 Ga0207690_10049401
1187 Ga0207690_10166930
1188 Ga0207690_10499985
1189 Ga0207690_10512602
1190 Ga0207706_10000276
1191 Ga0207706_10000514
1192 Ga0207706_10001018
1193 Ga0207706_10047462
1194 Ga0207706_10099945
1195 Ga0207706_10400451
1196 Ga0207706_10435473
1197 Ga0207670_10038785
1198 Ga0207669_10002765
1199 Ga0207669_10008335
1200 Ga0207704_10603433
1201 Ga0207665_10056891
1202 Ga0207691_10002752
1203 Ga0207691_10014857
1204 Ga0207691_10074127
1205 Ga0207691_10218948
1206 Ga0207691_10423090
1207 Ga0207711_10000105
1208 Ga0207711_10000190
1209 Ga0207711_10000413
1210 Ga0207711_10003775
1211 Ga0207711_10005548
1212 Ga0207711_10012443
1213 Ga0207711_10038564
1214 Ga0207689_10112929
1215 Ga0207689_10553909
1216 Ga0207661_10007968
1217 Ga0207661_10022512
1218 Ga0207661_10034436
1219 Ga0207661_10075835
1220 Ga0207661_10098825
1221 Ga0207661_10535680
1222 Ga0207679_10000114
1223 Ga0207679_10038365
1224 Ga0207679_10046008
1225 Ga0207679_10168309
1226 Ga0207679_10196899
1227 Ga0207679_10237995
1228 Ga0207667_10016322
1229 Ga0207667_10081978
1230 Ga0207667_10103076
1231 Ga0207667_10206083
1232 Ga0207667_10259417
1233 Ga0207667_10351088
1234 Ga0207667_10456820
1235 Ga0207651_10001938
1236 Ga0207651_10108775
1237 Ga0207651_10172892
1238 Ga0207651_10176249
1239 Ga0207712_10000002
1240 Ga0207712_10008274
1241 Ga0207712_10027059
1242 Ga0207712_10067825
1243 Ga0207668_10000054
1244 Ga0207668_10002327
1245 Ga0207668_10048063
1246 Ga0207640_10000473
1247 Ga0207640_10006878
1248 Ga0207640_10103670
1249 Ga0207640_10116885
1250 Ga0207658_10002159
1251 Ga0207658_10005799
1252 Ga0207658_10012692
1253 Ga0207658_10023849
1254 Ga0207658_10164207
1255 Ga0207658_10352231
1256 Ga0207658_10711025
1257 Ga0207677_10000600
1258 Ga0207677_10067922
1259 Ga0207703_10000139
1260 Ga0207703_10000461
1261 Ga0207703_10004673
1262 Ga0207703_10005508
1263 Ga0207639_10000139
1264 Ga0207639_10003170
1265 Ga0207639_10045291
1266 Ga0207639_10119521
1267 Ga0207639_10176839
1268 Ga0207678_10000746
1269 Ga0207678_10005368
1270 Ga0207678_10006212
1271 Ga0207678_10019046
1272 Ga0207678_10023972
1273 Ga0207708_10069128
1274 Ga0207708_10240255
1275 Ga0207702_10001266
1276 Ga0207702_10012719
1277 Ga0207702_10013935
1278 Ga0207702_10021319
1279 Ga0207702_10586832
1280 Ga0207702_10712039
1281 Ga0207641_10000045
1282 Ga0207641_10000172
1283 Ga0207641_10004364
1284 Ga0207648_10003539
1285 Ga0207648_10015998
1286 Ga0207648_10075650
1287 Ga0207676_10000072
1288 Ga0207676_10002758
1289 Ga0207676_10156502
1290 Ga0207674_10013020
1291 Ga0207674_10063263
1292 Ga0207674_10078211
1293 Ga0207674_10109713
1294 Ga0207675_100001317
1295 Ga0207675_100222537
1296 Ga0207683_10002199
1297 Ga0207683_10013394
1298 Ga0207683_10044948
1299 Ga0207683_10565818
1300 Ga0207698_10000598
1301 Ga0207698_10005864
1302 Ga0207698_10009468
1303 Ga0207698_10029422
1304 Ga0207698_10058247
1305 Ga0207698_10152943
1306 Ga0207698_10265868
1307 Ga0207698_10320895
1308 Ga0209983_1004501
1309 Ga0209974_10000990
1310 Ga0209974_10009484
1311 Ga0268266_10027905
1312 Ga0268266_10033207
1313 Ga0268266_10100141
1314 Ga0268265_10000607
1315 Ga0268265_10006136
1316 Ga0268265_10013973
1317 Ga0268265_10040240
1318 Ga0268265_10182082
1319 Ga0268264_10000634
1320 Ga0268264_10001019
1321 Ga0268264_10002547
1322 Ga0268264_10058285
1323 Ga0307517_10044322
1324 Ga0307517_10127210
1325 Ga0316176_1173477
1326 Ga0316180_1092407
1327 Ga0316183_1194200
1328 Ga0316181_1010522
1329 Ga0307513_10059999
1330 Ga0307513_10472561
1331 Ga0307408_100015250
1332 Ga0307408_100051378
1333 Ga0307408_100080102
1334 Ga0307408_100091772
1335 Ga0307408_100267624
1336 Ga0307408_100390827
1337 Ga0307516_10144543
1338 Ga0307405_10013101
1339 Ga0307405_10029271
1340 Ga0307405_10083236
1341 Ga0307405_10130318
1342 Ga0307405_10344640
1343 Ga0307405_10390249
1344 Ga0307405_10560111
1345 Ga0307413_10006953
1346 Ga0307413_10023067
1347 Ga0307413_10045729
1348 Ga0307413_10156956
1349 Ga0307410_10001524
1350 Ga0307410_10002541
1351 Ga0307410_10006594
1352 Ga0307410_10010566
1353 Ga0307410_10013709
1354 Ga0307410_10036358
1355 Ga0307410_10043909
1356 Ga0307410_10045613
1357 Ga0307410_10252144
1358 Ga0307406_10033272
1359 Ga0307406_10062485
1360 Ga0307406_10094667
1361 Ga0307406_10097014
1362 Ga0307406_10146347
1363 Ga0307406_10256624
1364 Ga0307406_10265174
1365 Ga0307406_10300007
1366 Ga0307406_10320637
1367 Ga0307406_10525807
1368 Ga0307407_10029956
1369 Ga0307407_10033216
1370 Ga0307407_10044587
1371 Ga0307407_10061890
1372 Ga0307407_10083516
1373 Ga0307407_10122908
1374 Ga0307407_10254322
1375 Ga0307407_10397299
1376 Ga0307407_10413640
1377 Ga0307412_10002333
1378 Ga0307412_10003753
1379 Ga0307412_10019090
1380 Ga0307412_10056498
1381 Ga0307412_10083089
1382 Ga0307412_10086981
1383 Ga0307412_10170101
1384 Ga0307412_10234602
1385 Ga0307412_10315531
1386 Ga0307412_10566532
1387 Ga0307409_100009382
1388 Ga0307409_100016968
1389 Ga0307409_100060305
1390 Ga0307409_100065443
1391 Ga0307409_100183528
1392 Ga0307409_100203812
1393 Ga0307409_100311378
1394 Ga0307409_100391245
1395 Ga0307409_100429147
1396 Ga0307409_100644293
1397 Ga0307409_100822869
1398 Ga0307409_100841948
1399 Ga0307416_100010569
1400 Ga0307416_100043317
1401 Ga0307416_100089815
1402 Ga0307416_100169717
1403 Ga0307416_100181893
1404 Ga0307416_100259842
1405 Ga0307416_100311078
1406 Ga0307416_100346287
1407 Ga0307416_100535007
1408 Ga0307414_10007424
1409 Ga0307414_10074392
1410 Ga0307414_10077437
1411 Ga0307414_10087767
1412 Ga0307414_10109184
1413 Ga0307414_10112369
1414 Ga0307414_10144491
1415 Ga0307414_10174172
1416 Ga0307414_10188003
1417 Ga0307414_10238242
1418 Ga0307414_10766675
1419 Ga0307411_10000518
1420 Ga0307411_10005481
1421 Ga0307411_10024776
1422 Ga0307411_10032304
1423 Ga0307411_10033608
1424 Ga0307411_10046369
1425 Ga0307411_10058003
1426 Ga0307411_10081614
1427 Ga0307411_10086504
1428 Ga0307411_10100317
1429 Ga0307411_10111180
1430 Ga0307411_10257057
1431 Ga0307415_100000171
1432 Ga0307415_100059574
1433 Ga0307415_100091983
1434 Ga0307415_100147335
1435 Ga0307415_100306690
1436 Ga0316583_10006180
1437 Ga0307510_10000369
1438 Ga0373958_0048274
1439 Ga0373923_0163279
1440 Ga0373939_0059072
1441 Ga0373957_0011847
1442 Ga0373955_0017940
1443 Ga0373931_0010139
1444 Ga0373935_0025073
1445 Ga0373933_0055688
1446 Ga0373937_0033405
1447 Ga0316582_0015227
1448 Ga0316582_0216777
1449 Ga0316584_0634968
1450 Ga0373925_0634660
1451 Ga0395899_0000129
1452 Ga0395899_0002708
1453 Ga0395899_0014549
1454 Ga0395899_0049098
1455 Ga0395899_0075048
1456 Ga0395899_0137130
1457 Ga0395900_0000468
1458 Ga0395900_0008602
1459 Ga0395900_0010815
1460 Ga0395900_0014984
1461 Ga0395900_0021957
1462 Ga0395900_0023328
1463 Ga0395900_0024082
1464 Ga0395900_0036992
1465 Ga0395900_0077876
1466 Ga0395900_0078105
1467 Ga0395900_0107872
1468 Ga0395900_0327208
1469 Ga0395900_0481325
1470 Ga0395898_0018728
1471 Ga0395898_0026615
1472 Ga0395898_0030537
1473 Ga0395898_0031474
1474 Ga0395898_0037775
1475 Ga0395898_0147662
1476 Ga0395898_0149228
1477 Ga0395898_0324907
1478 Ga0395898_0580358
1479 Ga0395898_0844297
1480 Ga0395905_0000232
1481 Ga0395905_0002796
1482 Ga0395905_0015679
1483 Ga0395905_0026630
1484 Ga0395905_0048085
1485 Ga0395905_0051277
1486 Ga0395905_0071242
1487 Ga0395905_0129687
1488 Ga0316581_0045622
1489 Ga0395901_0000031
1490 Ga0395901_0000131
1491 Ga0395901_0008693
1492 Ga0395901_0024121
1493 Ga0395901_0042467
1494 Ga0395901_0062053
1495 Ga0395901_0066469
1496 Ga0395901_0093494
1497 Ga0395901_0141388
1498 Ga0395901_0177005
1499 Ga0395901_0202297
1500 Ga0395901_0389393
1501 Ga0439431_0042236
1502 Ga0439443_016330
1503 Ga0450920_007031
1504 Ga0439464_0000427
1505 Ga0466966_0000021
1506 Ga0466966_0033906
1507 Ga0466966_0096905
1508 Ga0466961_0026586
1509 Ga0466961_0082147
1510 Ga0466963_0036592
1511 Ga0466964_0034342
1512 Ga0466971_0013190
1513 Ga0466957_0017966
1514 Ga0466959_0108427
1515 Ga0466958_0003833
1516 Ga0466967_0018938
1517 Ga0466967_0058953
1518 Ga0495638_0097754
1519 Ga0495650_0031267
1520 Ga0495584_0124321
1521 Ga0495637_0073734
1522 Ga0495648_0013722
1523 Ga0495648_0038706
1524 Ga0495642_0008044
1525 Ga0495598_0181488
1526 Ga0495668_0002012
1527 Ga0495659_0015361
1528 Ga0495669_0003949
1529 Ga0495669_0115754
1530 Ga0495670_0008719
1531 Ga0495670_0014736
1532 Ga0495670_0089531
1533 Ga0495660_0218412
1534 Ga0495677_0003219
1535 Ga0495602_0054509
1536 Ga0496100_0544496
1537 Ga0496101_0041166
1538 Ga0496101_0136335
1539 Ga0496102_0007003
1540 Ga0496102_0273733
1541 Ga0496103_0016842
1542 Ga0496106_0386033
1543 Ga0496107_0010812
1544 Ga0496108_0243655
1545 Ga0496108_0291198
1546 Ga0496109_0037244
1547 Ga0496109_0154762
1548 Ga0496109_0295348
1549 Ga0496110_0004899
1550 Ga0496110_0010491
1551 Ga0496111_0001883
1552 Ga0496111_0049638
1553 Ga0496112_0565932
1554 Ga0496113_0002116
1555 Ga0496114_0262924
1556 Ga0496115_0008793
1557 Ga0496125_0198494
1558 Ga0501292_012493
1559 Ga0501298_007399
1560 Ga0501070_0166768
1561 Ga0501071_0071606
1562 Ga0501235_017511
1563 Ga0501243_009778
1564 Ga0501249_004088
1565 Ga0501225_0042682
1566 Ga0501080_0371850
1567 Ga0501263_002294
1568 Ga0501266_011983
1569 Ga0501268_006179
1570 Ga0501268_010692
1571 Ga0501272_008243
1572 Ga0501273_018358
1573 Ga0501280_000314
1574 Ga0500643_000096
1575 Ga0500643_001035
1576 Ga0500646_0125306
1577 Ga0500647_0008473
1578 Ga0500618_006614
1579 Ga0500658_0000032
1580 Ga0500636_0136298
1581 Ga0466962_0077696
1582 Ga0466962_0202747
1583 2585261820
1584 2600203099

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00929

RNase_T

Exonuclease

4

153

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j53-assembly1.cif.gz_A structure of the n-terminal exonuclease domain of the epsilon subunit of e.coli dna polymerase iii at ph 8.5 0.9582 3 168
2ido-assembly1.cif.gz_A structure of the e. coli pol iii epsilon-hot proofreading complex 0.9347 1 168
1j53-assembly1.cif.gz_A structure of the n-terminal exonuclease domain of the epsilon subunit of e.coli dna polymerase iii at ph 8.5 0.9101 3 168
2ido-assembly1.cif.gz_A structure of the e. coli pol iii epsilon-hot proofreading complex 0.9084 1 168
8h2f-assembly1.cif.gz_A crystal structure of dnaq domain in complex witn tmp of streptococcus thermophilus strain dgcc 7710 0.8997 2 169
ID Description Score Start End Superfamily
1j54A00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9575 3 168 3.30.420.10
af_B0G161_292_467_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9544 2 166 3.30.420.10
af_Q2G1Z8_409_554_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.932 1 138 3.30.420.10
af_Q2FYH5_2_169_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9303 1 169 3.30.420.10
af_Q4E271_32_219_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.925 36 168 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A3B9EG13-F1-model_v4 DNA polymerase III subunit epsilon (EC 2.7.7.7) 0.9943 1 154 GO:0003677
GO:0003887
GO:0005829
GO:0008408
GO:0045004
AF-A0A3B8QYK5-F1-model_v4 DNA polymerase III subunit epsilon 0.9917 1 86 GO:0003677
GO:0003887
GO:0005829
GO:0008408
GO:0045004
AF-A0A455U836-F1-model_v4 Exonuclease domain-containing protein 0.9903 1 80 GO:0003676
GO:0005829
GO:0008408
GO:0016779
GO:0045004
AF-A0A3C1BQI7-F1-model_v4 DNA polymerase III subunit epsilon (EC 2.7.7.7) 0.9897 1 142 GO:0003677
GO:0003887
GO:0005829
GO:0008408
GO:0045004
AF-A0A4Q2LD84-F1-model_v4 deleted 0.9889 12 105

Map