F481015

General Info

Members Datasets Scaffolds Average Seq Length
792 324 762 323

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100024159|Ga0070698_1000241594
Length 375
Sequence MITRGPEGELTGRRAQRMPCCEPRRPGFHLDGGPLGDPRSGESRRDGWRLGAMRYLSTVPGKQISKIGLGTWQFGSREWGYGSQYADEVAQAIVGRAVELGVTLFDTAEIYGFGRSERILGQALGENRESVFLATKIFPVLPVAPVVEQRAVASANRLGVRRLDLYQVHQANPLVRDGTIMRGMRALQRVGLVGEVGVSNYSLQRWRAAEDALGSPVLSNQVPYSLVARAPEQDLLPYASSHGRLVLAYSPLAQGLLSGRYHPGNRPANRVRAANPLFLPENLERAGELLAVLDEVAAAHSATPAQIALAWVIHHPAVAAIPGASSVEQLERNVAAAEIDLTEDQYQALADAAARFRPLTGPAVFPRLARARFGR

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2527291627 Frankia casuarinae Thr Isolate Nodule
3 2527291629 Frankia sp. BMG5.23 Isolate Nodule
4 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
5 2576861822 Frankia sp. CeD Isolate Nodule
6 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
7 2619618881 Frankia sp. ACN1ag Isolate Unclassified
8 2619619003 Frankia sp. CpI1-P Isolate Nodule
9 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
10 2626541554 Frankia sp. AvcI.1 Isolate Nodule
11 2684623036 Frankia sp. CgIM4 Isolate Nodule
12 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
13 2710264753 Frankia sp. KB5 Isolate Nodule
14 2773857924 Frankia sp. CgIS1 Isolate Nodule
15 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
16 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
17 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
18 2858868258 Micromonospora sp. MH33 Isolate Unclassified
19 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
20 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
21 2902582711 Micromonospora sp. AP08 Isolate Unclassified
22 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
23 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
24 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
103 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
104 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
120 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
173 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
176 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
188 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
189 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
190 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
191 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
192 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
193 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
194 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
195 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
196 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
197 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
198 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
202 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
203 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
204 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
205 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
206 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
207 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
212 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
224 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
225 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
226 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
227 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
228 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
229 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
230 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
231 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
234 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
237 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
238 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
239 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
240 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
241 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
242 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
246 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
250 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
254 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
255 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
256 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
257 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
258 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
259 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
260 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
261 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
262 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
263 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
264 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
265 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
266 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
267 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
268 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
269 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
270 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
271 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
272 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
275 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
276 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
277 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
278 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
279 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
280 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
281 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
282 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
283 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
288 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
289 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
290 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
293 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
294 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
295 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
296 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
297 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
298 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
299 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
300 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
301 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
302 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
303 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
304 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
305 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
306 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
307 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
308 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
309 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
310 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
311 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
312 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
313 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
314 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
315 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
316 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
317 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
318 637000116 Frankia casuarinae CcI3 Isolate Nodule
319 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
320 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
321 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
322 8054920844 Frankia tisae Agncl-8 Isolate Nodule
323 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
324 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.33
Metatranscriptomes 0.88
Isolates 3.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 1.77
Rhizoplane 4.42
Rhizosphere 89.77
Stem 0
Stem Tuber 0
Unclassified 4.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10014316 3300003659 Bacteria 1720
2 Ga0070658_10307055 3300005327 Bacteria 1353
3 Ga0070683_100054857 3300005329 Bacteria 3696
4 Ga0070683_100228010 3300005329 Bacteria 1771
5 Ga0070683_100389592 3300005329 Bacteria 1328
6 Ga0070690_100058556 3300005330 Bacteria 2474
7 Ga0070690_100148548 3300005330 Bacteria 1597
8 Ga0070670_100065443 3300005331 Bacteria 3119
9 Ga0068869_100019345 3300005334 Bacteria 4650
10 Ga0068869_100106552 3300005334 Bacteria 2127
11 Ga0070666_10025892 3300005335 Bacteria 3827
12 Ga0070666_10238081 3300005335 Bacteria 1287
13 Ga0070680_100011567 3300005336 Bacteria 6832
14 Ga0068868_100119303 3300005338 Bacteria 2150
15 Ga0068868_100262683 3300005338 Bacteria 1456
16 Ga0068868_100263811 3300005338 Bacteria 1453
17 Ga0070689_100020282 3300005340 Bacteria 4930
18 Ga0070661_100083340 3300005344 Bacteria 2361
19 Ga0070668_100019088 3300005347 Bacteria 5154
20 Ga0070668_100106358 3300005347 Bacteria 2229
21 Ga0070668_100129291 3300005347 Bacteria 2026
22 Ga0070668_100316061 3300005347 Bacteria 1313
23 Ga0070669_100114824 3300005353 Bacteria 2047
24 Ga0070675_100039028 3300005354 Bacteria 3872
25 Ga0070671_100156235 3300005355 Bacteria 1927
26 Ga0070671_100180201 3300005355 Bacteria 1788
27 Ga0070674_100152178 3300005356 Bacteria 1747
28 Ga0070674_100182536 3300005356 Bacteria 1608
29 Ga0070673_100026254 3300005364 Bacteria 4300
30 Ga0070673_100197168 3300005364 Bacteria 1732
31 Ga0070688_100034873 3300005365 Bacteria 3052
32 Ga0070659_100039455 3300005366 Bacteria 3686
33 Ga0070709_10003910 3300005434 Bacteria 8036
34 Ga0070709_10009428 3300005434 Bacteria 5386
35 Ga0070709_10026945 3300005434 Bacteria 3412
36 Ga0070709_10133540 3300005434 Bacteria 1697
37 Ga0070714_100037540 3300005435 Bacteria 4071
38 Ga0070714_100062696 3300005435 Bacteria 3195
39 Ga0070714_100190821 3300005435 Bacteria 1870
40 Ga0070714_100274580 3300005435 Bacteria 1564
41 Ga0070713_100082165 3300005436 Bacteria 2750
42 Ga0070713_100190692 3300005436 Bacteria 1847
43 Ga0070713_100226420 3300005436 Bacteria 1698
44 Ga0070710_10000904 3300005437 Bacteria 14218
45 Ga0070710_10004883 3300005437 Bacteria 6344
46 Ga0070710_10028861 3300005437 Bacteria 2971
47 Ga0070710_10064110 3300005437 Bacteria 2101
48 Ga0070710_10068837 3300005437 Bacteria 2035
49 Ga0070710_10122688 3300005437 Bacteria 1574
50 Ga0070710_10134454 3300005437 Bacteria 1511
51 Ga0070711_100009717 3300005439 Bacteria 5926
52 Ga0070711_100034966 3300005439 Bacteria 3355
53 Ga0070711_100257822 3300005439 Bacteria 1371
54 Ga0070708_100016030 3300005445 Bacteria 6207
55 Ga0070708_100033029 3300005445 Bacteria 4494
56 Ga0070708_100039435 3300005445 Bacteria 4132
57 Ga0070708_100217362 3300005445 Bacteria 1792
58 Ga0070663_100034948 3300005455 Bacteria 3484
59 Ga0070663_100129676 3300005455 Bacteria 1913
60 Ga0070662_100046033 3300005457 Bacteria 3133
61 Ga0070681_10285530 3300005458 Bacteria 1561
62 Ga0070685_10015905 3300005466 Bacteria 4002
63 Ga0070685_10027294 3300005466 Bacteria 3155
64 Ga0070685_10064927 3300005466 Bacteria 2147
65 Ga0070706_100000304 3300005467 Bacteria 59524
66 Ga0070706_100001944 3300005467 Bacteria 21302
67 Ga0070706_100012966 3300005467 Bacteria 7714
68 Ga0070706_100014928 3300005467 Bacteria 7175
69 Ga0070706_100025734 3300005467 Bacteria 5415
70 Ga0070706_100027455 3300005467 Bacteria 5239
71 Ga0070706_100108556 3300005467 Bacteria 2582
72 Ga0070707_100000391 3300005468 Bacteria 43195
73 Ga0070707_100001468 3300005468 Bacteria 23083
74 Ga0070707_100007741 3300005468 Bacteria 9980
75 Ga0070707_100073623 3300005468 Bacteria 3294
76 Ga0070707_100079896 3300005468 Bacteria 3157
77 Ga0070707_100136364 3300005468 Bacteria 2387
78 Ga0070707_100138827 3300005468 Bacteria 2365
79 Ga0070707_100362920 3300005468 Bacteria 1407
80 Ga0070698_100000459 3300005471 Bacteria 43224
81 Ga0070698_100002351 3300005471 Bacteria 20891
82 Ga0070698_100002430 3300005471 Bacteria 20529
83 Ga0070698_100009462 3300005471 Bacteria 10440
84 Ga0070698_100020690 3300005471 Bacteria 6899
85 Ga0070698_100024159 3300005471 Bacteria 6342
86 Ga0070698_100030237 3300005471 Bacteria 5617
87 Ga0070698_100051342 3300005471 Bacteria 4200
88 Ga0070698_100428454 3300005471 Bacteria 1257
89 Ga0070699_100006444 3300005518 Bacteria 10222
90 Ga0070699_100011087 3300005518 Bacteria 7792
91 Ga0070699_100058356 3300005518 Bacteria 3343
92 Ga0070679_100094804 3300005530 Bacteria 2972
93 Ga0070679_100168529 3300005530 Bacteria 2163
94 Ga0070684_100087998 3300005535 Bacteria 2759
95 Ga0070684_100159388 3300005535 Bacteria 2046
96 Ga0070684_100166004 3300005535 Bacteria 2004
97 Ga0070697_100013155 3300005536 Bacteria 6488
98 Ga0068853_100052780 3300005539 Bacteria 3501
99 Ga0070672_100171136 3300005543 Bacteria 1806
100 Ga0070686_100004561 3300005544 Bacteria 7643
101 Ga0070695_100227929 3300005545 Bacteria 1346
102 Ga0070665_100011840 3300005548 Bacteria 8812
103 Ga0070664_100042165 3300005564 Bacteria 3852
104 Ga0070664_100073571 3300005564 Bacteria 2932
105 Ga0068857_100102439 3300005577 Bacteria 2570
106 Ga0068857_100181637 3300005577 Bacteria 1915
107 Ga0068854_100043970 3300005578 Bacteria 3168
108 Ga0068856_100005337 3300005614 Bacteria 12684
109 Ga0068856_100530009 3300005614 Bacteria 1199
110 Ga0070702_100065487 3300005615 Bacteria 2129
111 Ga0068852_100015035 3300005616 Bacteria 5984
112 Ga0068859_100131592 3300005617 Bacteria 2573
113 Ga0068859_100233854 3300005617 Bacteria 1926
114 Ga0068864_100138350 3300005618 Bacteria 2194
115 Ga0068861_100197437 3300005719 Bacteria 1686
116 Ga0068861_100278119 3300005719 Bacteria 1440
117 Ga0068851_10034145 3300005834 Bacteria 2538
118 Ga0068870_10034090 3300005840 Bacteria 2603
119 Ga0068863_100128422 3300005841 Bacteria 2419
120 Ga0068863_100228187 3300005841 Bacteria 1795
121 Ga0068858_100051466 3300005842 Bacteria 3810
122 Ga0068858_100135762 3300005842 Bacteria 2308
123 Ga0068858_100346033 3300005842 Bacteria 1423
124 Ga0068860_100003227 3300005843 Bacteria 16817
125 Ga0068862_100053879 3300005844 Bacteria 3444
126 Ga0081540_1003217 3300005983 Bacteria 13015
127 Ga0081540_1027577 3300005983 Bacteria 3213
128 Ga0081540_1098164 3300005983 Bacteria 1269
129 Ga0070717_10000957 3300006028 Bacteria 19238
130 Ga0070717_10017635 3300006028 Bacteria 5558
131 Ga0070717_10083684 3300006028 Bacteria 2683
132 Ga0070717_10152460 3300006028 Bacteria 2000
133 Ga0070717_10169117 3300006028 Bacteria 1900
134 Ga0070715_10036415 3300006163 Bacteria 2029
135 Ga0070716_100003216 3300006173 Bacteria 7661
136 Ga0070716_100003549 3300006173 Bacteria 7362
137 Ga0070716_100055349 3300006173 Bacteria 2270
138 Ga0070716_100101853 3300006173 Bacteria 1762
139 Ga0070716_100102300 3300006173 Bacteria 1759
140 Ga0070712_100019088 3300006175 Bacteria 4464
141 Ga0070712_100054704 3300006175 Bacteria 2791
142 Ga0075428_100000006 3300006844 Bacteria 288592
143 Ga0075428_100400953 3300006844 Bacteria 1470
144 Ga0075433_10132296 3300006852 Bacteria 2216
145 Ga0075433_10171303 3300006852 Bacteria 1932
146 Ga0075434_100008309 3300006871 Bacteria 9642
147 Ga0075434_100199751 3300006871 Bacteria 2019
148 Ga0075436_100042128 3300006914 Bacteria 3148
149 Ga0075436_100098745 3300006914 Bacteria 2032
150 Ga0075436_100114690 3300006914 Bacteria 1881
151 Ga0097620_100131585 3300006931 Bacteria 2573
152 Ga0097620_100233858 3300006931 Bacteria 1926
153 Ga0075435_100003093 3300007076 Bacteria 11237
154 Ga0075435_100022570 3300007076 Bacteria 4855
155 Ga0075435_100074672 3300007076 Bacteria 2774
156 Ga0105240_10246813 3300009093 Bacteria 2067
157 Ga0111539_10058886 3300009094 Bacteria 4556
158 Ga0105245_10125987 3300009098 Bacteria 2398
159 Ga0105247_10000653 3300009101 Bacteria 27504
160 Ga0105247_10057860 3300009101 Bacteria 2397
161 Ga0114129_10001706 3300009147 Bacteria 29983
162 Ga0114129_10216275 3300009147 Bacteria 2588
163 Ga0114129_10272082 3300009147 Bacteria 2266
164 Ga0105243_10192998 3300009148 Bacteria 1780
165 Ga0105241_10049814 3300009174 Bacteria 3191
166 Ga0105241_10194998 3300009174 Bacteria 1688
167 Ga0105248_10002051 3300009177 Bacteria 22313
168 Ga0105248_10199453 3300009177 Bacteria 2254
169 Ga0105248_10262019 3300009177 Bacteria 1946
170 Ga0105237_10038697 3300009545 Bacteria 4816
171 Ga0105237_10110865 3300009545 Bacteria 2736
172 Ga0105238_10164015 3300009551 Bacteria 2198
173 Ga0105238_10352983 3300009551 Bacteria 1460
174 Ga0105249_10129973 3300009553 Bacteria 2403
175 Ga0157340_1001763 3300012473 Bacteria 1037
176 Ga0157343_1000704 3300012488 Bacteria 1425
177 Ga0157342_1000128 3300012507 Bacteria 3705
178 Ga0157373_10188795 3300013100 Bacteria 1452
179 Ga0157371_10031125 3300013102 Bacteria 3844
180 Ga0157374_10119354 3300013296 Bacteria 2544
181 Ga0157378_10118292 3300013297 Bacteria 2439
182 Ga0163162_10118115 3300013306 Bacteria 2754
183 Ga0157372_10331052 3300013307 Bacteria 1773
184 Ga0157375_10075052 3300013308 Bacteria 3405
185 Ga0157375_10110925 3300013308 Bacteria 2841
186 Ga0157375_10306487 3300013308 Bacteria 1752
187 Ga0163163_10036129 3300014325 Bacteria 4797
188 Ga0163163_10490122 3300014325 Bacteria 1290
189 Ga0157380_10327205 3300014326 Bacteria 1424
190 Ga0157377_10052086 3300014745 Bacteria 2310
191 Ga0157379_10014328 3300014968 Bacteria 6957
192 Ga0157379_10052116 3300014968 Bacteria 3654
193 Ga0157379_10090891 3300014968 Bacteria 2739
194 Ga0163161_10048989 3300017792 Bacteria 3052
195 Ga0197907_10234494 3300020069 Bacteria 1394
196 Ga0197907_10862487 3300020069 Bacteria 2277
197 Ga0206356_11175517 3300020070 Bacteria 1410
198 Ga0206355_1300986 3300020076 Bacteria 1053
199 Ga0206350_11006390 3300020080 Bacteria 1162
200 Ga0213876_10025033 3300021384 Bacteria 3151
201 Ga0224712_10037192 3300022467 Bacteria 1810
202 Ga0224712_10043681 3300022467 Bacteria 1705
203 Ga0224572_1001884 3300024225 Bacteria 3244
204 Ga0224572_1004440 3300024225 Bacteria 2439
205 Ga0207656_10026789 3300025321 Bacteria 2353
206 Ga0207653_10006120 3300025885 Bacteria 3751
207 Ga0207692_10032663 3300025898 Bacteria 2503
208 Ga0207692_10141376 3300025898 Bacteria 1369
209 Ga0207710_10000427 3300025900 Bacteria 27512
210 Ga0207710_10008820 3300025900 Bacteria 4245
211 Ga0207688_10004929 3300025901 Bacteria 7267
212 Ga0207688_10030605 3300025901 Bacteria 2969
213 Ga0207688_10030693 3300025901 Bacteria 2964
214 Ga0207688_10049544 3300025901 Bacteria 2348
215 Ga0207647_10106216 3300025904 Bacteria 1663
216 Ga0207685_10002433 3300025905 Bacteria 4266
217 Ga0207699_10010354 3300025906 Bacteria 4677
218 Ga0207699_10015551 3300025906 Bacteria 3955
219 Ga0207699_10016061 3300025906 Bacteria 3906
220 Ga0207699_10028211 3300025906 Bacteria 3117
221 Ga0207699_10031439 3300025906 Bacteria 2980
222 Ga0207699_10111121 3300025906 Bacteria 1756
223 Ga0207699_10144210 3300025906 Bacteria 1568
224 Ga0207699_10187716 3300025906 Bacteria 1393
225 Ga0207643_10004651 3300025908 Bacteria 7371
226 Ga0207643_10024555 3300025908 Bacteria 3326
227 Ga0207643_10142162 3300025908 Bacteria 1434
228 Ga0207643_10181117 3300025908 Bacteria 1275
229 Ga0207705_10195211 3300025909 Bacteria 1532
230 Ga0207684_10017737 3300025910 Bacteria 6106
231 Ga0207684_10020340 3300025910 Bacteria 5671
232 Ga0207684_10035311 3300025910 Bacteria 4245
233 Ga0207684_10061221 3300025910 Bacteria 3197
234 Ga0207684_10066624 3300025910 Bacteria 3059
235 Ga0207684_10127084 3300025910 Bacteria 2188
236 Ga0207684_10354144 3300025910 Bacteria 1263
237 Ga0207693_10015973 3300025915 Bacteria 6010
238 Ga0207693_10018028 3300025915 Bacteria 5627
239 Ga0207693_10064440 3300025915 Bacteria 2871
240 Ga0207693_10114512 3300025915 Bacteria 2116
241 Ga0207693_10125228 3300025915 Bacteria 2019
242 Ga0207693_10140956 3300025915 Bacteria 1896
243 Ga0207663_10084094 3300025916 Bacteria 2092
244 Ga0207663_10091482 3300025916 Bacteria 2020
245 Ga0207663_10146629 3300025916 Bacteria 1651
246 Ga0207663_10200169 3300025916 Bacteria 1440
247 Ga0207663_10253087 3300025916 Bacteria 1297
248 Ga0207662_10005260 3300025918 Bacteria 6874
249 Ga0207657_10010213 3300025919 Bacteria 9377
250 Ga0207657_10042914 3300025919 Bacteria 3987
251 Ga0207657_10175370 3300025919 Bacteria 1735
252 Ga0207646_10000721 3300025922 Bacteria 42920
253 Ga0207646_10005267 3300025922 Bacteria 13639
254 Ga0207646_10011465 3300025922 Bacteria 8586
255 Ga0207646_10012021 3300025922 Bacteria 8343
256 Ga0207646_10012951 3300025922 Bacteria 7994
257 Ga0207646_10054928 3300025922 Bacteria 3562
258 Ga0207646_10072294 3300025922 Bacteria 3081
259 Ga0207646_10119409 3300025922 Bacteria 2368
260 Ga0207681_10203370 3300025923 Bacteria 1522
261 Ga0207694_10173720 3300025924 Bacteria 1745
262 Ga0207650_10061064 3300025925 Bacteria 2813
263 Ga0207687_10274042 3300025927 Bacteria 1350
264 Ga0207700_10006097 3300025928 Bacteria 7263
265 Ga0207700_10074764 3300025928 Bacteria 2623
266 Ga0207700_10119208 3300025928 Bacteria 2137
267 Ga0207700_10120314 3300025928 Bacteria 2128
268 Ga0207700_10145907 3300025928 Bacteria 1950
269 Ga0207664_10014557 3300025929 Bacteria 5685
270 Ga0207664_10048722 3300025929 Bacteria 3333
271 Ga0207664_10080519 3300025929 Bacteria 2647
272 Ga0207664_10148383 3300025929 Bacteria 1990
273 Ga0207664_10186580 3300025929 Bacteria 1783
274 Ga0207664_10191406 3300025929 Bacteria 1761
275 Ga0207664_10210754 3300025929 Bacteria 1681
276 Ga0207664_10276052 3300025929 Bacteria 1474
277 Ga0207644_10066237 3300025931 Bacteria 2629
278 Ga0207644_10089250 3300025931 Bacteria 2294
279 Ga0207644_10145591 3300025931 Bacteria 1829
280 Ga0207690_10257544 3300025932 Bacteria 1350
281 Ga0207706_10036934 3300025933 Bacteria 4339
282 Ga0207706_10071616 3300025933 Bacteria 3049
283 Ga0207686_10024646 3300025934 Bacteria 3489
284 Ga0207709_10071177 3300025935 Bacteria 2207
285 Ga0207670_10368777 3300025936 Bacteria 1141
286 Ga0207704_10038422 3300025938 Bacteria 2776
287 Ga0207665_10007909 3300025939 Bacteria 7025
288 Ga0207665_10008012 3300025939 Bacteria 6969
289 Ga0207665_10011477 3300025939 Bacteria 5819
290 Ga0207665_10013277 3300025939 Bacteria 5415
291 Ga0207665_10132730 3300025939 Bacteria 1769
292 Ga0207665_10146339 3300025939 Bacteria 1689
293 Ga0207665_10177369 3300025939 Bacteria 1542
294 Ga0207691_10038381 3300025940 Bacteria 4433
295 Ga0207691_10052809 3300025940 Bacteria 3711
296 Ga0207711_10012631 3300025941 Bacteria 7013
297 Ga0207711_10265108 3300025941 Bacteria 1580
298 Ga0207689_10013895 3300025942 Bacteria 6858
299 Ga0207689_10065141 3300025942 Bacteria 2997
300 Ga0207661_10047456 3300025944 Bacteria 3410
301 Ga0207668_10029215 3300025972 Bacteria 3612
302 Ga0207668_10100081 3300025972 Bacteria 2152
303 Ga0207640_10060440 3300025981 Bacteria 2505
304 Ga0207640_10123878 3300025981 Bacteria 1857
305 Ga0207678_10013076 3300026067 Bacteria 7282
306 Ga0207678_10045539 3300026067 Bacteria 3794
307 Ga0207678_10078837 3300026067 Bacteria 2821
308 Ga0207678_10124754 3300026067 Bacteria 2197
309 Ga0207708_10030437 3300026075 Bacteria 4092
310 Ga0207708_10052090 3300026075 Bacteria 3118
311 Ga0207708_10155506 3300026075 Bacteria 1803
312 Ga0207641_10081544 3300026088 Bacteria 2809
313 Ga0207641_10111024 3300026088 Bacteria 2431
314 Ga0207641_10111644 3300026088 Bacteria 2424
315 Ga0207648_10044613 3300026089 Bacteria 3890
316 Ga0207676_10233246 3300026095 Bacteria 1646
317 Ga0207676_10322364 3300026095 Bacteria 1419
318 Ga0207674_10019026 3300026116 Bacteria 7442
319 Ga0207675_100025028 3300026118 Bacteria 5555
320 Ga0207675_100069866 3300026118 Bacteria 3282
321 Ga0207675_100357494 3300026118 Bacteria 1432
322 Ga0207683_10014371 3300026121 Bacteria 6744
323 Ga0207683_10052998 3300026121 Bacteria 3555
324 Ga0207683_10081019 3300026121 Bacteria 2880
325 Ga0207428_10238015 3300027907 Bacteria 1361
326 Ga0268266_10113261 3300028379 Bacteria 2405
327 Ga0268266_10364858 3300028379 Bacteria 1360
328 Ga0268265_10182176 3300028380 Bacteria 1806
329 Ga0268264_10009372 3300028381 Bacteria 8103
330 Ga0265324_10006155 3300029957 Bacteria 5059
331 Ga0265320_10006561 3300031240 Bacteria 7321
332 Ga0265325_10177202 3300031241 Bacteria 994
333 Ga0265329_10009577 3300031242 Bacteria 3602
334 Ga0265331_10030462 3300031250 Bacteria 2686
335 Ga0265316_10112549 3300031344 Bacteria 2060
336 Ga0265316_10135504 3300031344 Bacteria 1853
337 Ga0307408_100033730 3300031548 Bacteria 3579
338 Ga0265314_10021773 3300031711 Bacteria 4922
339 Ga0307405_10242280 3300031731 Bacteria 1336
340 Ga0307413_10028882 3300031824 Bacteria 3096
341 Ga0307410_10318765 3300031852 Bacteria 1232
342 Ga0307406_10021130 3300031901 Bacteria 3846
343 Ga0307406_10319316 3300031901 Bacteria 1201
344 Ga0307416_100440234 3300032002 Bacteria 1353
345 Ga0307416_100442983 3300032002 Bacteria 1349
346 Ga0307411_10174750 3300032005 Bacteria 1624
347 Ga0307415_100435911 3300032126 Bacteria 1129
348 Ga0373930_0009124 3300034816 Bacteria 1749
349 Ga0373930_0012284 3300034816 Bacteria 1560
350 Ga0373950_0009047 3300034818 Bacteria 1580
351 Ga0373958_0008127 3300034819 Bacteria 1692
352 Ga0373926_0002888 3300035083 Bacteria 5505
353 Ga0373926_0005963 3300035083 Bacteria 4032
354 Ga0373928_0013853 3300035084 Bacteria 1622
355 Ga0373929_0008200 3300035085 Bacteria 1924
356 Ga0373934_0000004 3300035086 Bacteria 87334
357 Ga0373934_0011407 3300035086 Bacteria 3343
358 Ga0373934_0096560 3300035086 Bacteria 1193
359 Ga0373940_0007051 3300035088 Bacteria 2522
360 Ga0373944_0000349 3300035089 Bacteria 10418
361 Ga0373944_0002650 3300035089 Bacteria 4560
362 Ga0373949_0018718 3300035090 Bacteria 1572
363 Ga0373951_0007194 3300035091 Bacteria 2532
364 Ga0373923_0002644 3300035111 Bacteria 5563
365 Ga0373923_0020460 3300035111 Bacteria 2571
366 Ga0373923_0035992 3300035111 Bacteria 2018
367 Ga0373923_0044907 3300035111 Bacteria 1833
368 Ga0373932_0031955 3300035112 Bacteria 1469
369 Ga0373936_0000220 3300035113 Bacteria 18777
370 Ga0373936_0001068 3300035113 Bacteria 9812
371 Ga0373936_0002061 3300035113 Bacteria 7452
372 Ga0373936_0012695 3300035113 Bacteria 3208
373 Ga0373936_0015154 3300035113 Bacteria 2952
374 Ga0373936_0019841 3300035113 Bacteria 2607
375 Ga0373941_0021056 3300035115 Bacteria 1835
376 Ga0373945_0000244 3300035116 Bacteria 15102
377 Ga0373945_0015334 3300035116 Bacteria 2577
378 Ga0373945_0032384 3300035116 Bacteria 1852
379 Ga0373953_0002744 3300035117 Bacteria 5349
380 Ga0373953_0017686 3300035117 Bacteria 2625
381 Ga0373954_0002885 3300035118 Bacteria 7254
382 Ga0373954_0013444 3300035118 Bacteria 3647
383 Ga0373954_0036710 3300035118 Bacteria 2275
384 Ga0373954_0129349 3300035118 Bacteria 1229
385 Ga0373956_0000601 3300035119 Bacteria 14759
386 Ga0373956_0005179 3300035119 Bacteria 5221
387 Ga0373956_0005238 3300035119 Bacteria 5191
388 Ga0373956_0029995 3300035119 Bacteria 2374
389 Ga0373957_0001123 3300035120 Bacteria 7102
390 Ga0373957_0011856 3300035120 Bacteria 2920
391 Ga0373957_0021174 3300035120 Bacteria 2305
392 Ga0373960_0003322 3300035121 Bacteria 3641
393 Ga0373943_0000328 3300035170 Bacteria 19825
394 Ga0373943_0145201 3300035170 Bacteria 1281
395 Ga0373946_0000075 3300035171 Bacteria 26757
396 Ga0373946_0005982 3300035171 Bacteria 4411
397 Ga0373955_0000025 3300035172 Bacteria 58341
398 Ga0373955_0002512 3300035172 Bacteria 8015
399 Ga0373955_0003650 3300035172 Bacteria 6775
400 Ga0373955_0019498 3300035172 Bacteria 3391
401 Ga0373955_0079252 3300035172 Bacteria 1852
402 Ga0373955_0233813 3300035172 Bacteria 1100
403 Ga0373961_0050359 3300035241 Bacteria 1233
404 Ga0373924_0001226 3300035410 Bacteria 8220
405 Ga0373924_0002268 3300035410 Bacteria 6452
406 Ga0373924_0007457 3300035410 Bacteria 3950
407 Ga0373924_0010732 3300035410 Bacteria 3388
408 Ga0373924_0013650 3300035410 Bacteria 3055
409 Ga0373924_0068951 3300035410 Bacteria 1489
410 Ga0373931_0052813 3300035691 Bacteria 2168
411 Ga0373931_0139516 3300035691 Bacteria 1402
412 Ga0373935_0030952 3300035692 Bacteria 3317
413 Ga0373935_0033784 3300035692 Bacteria 3185
414 Ga0373935_0054162 3300035692 Bacteria 2553
415 Ga0373935_0108878 3300035692 Bacteria 1837
416 Ga0373935_0149137 3300035692 Bacteria 1585
417 Ga0373927_0001015 3300035695 Bacteria 21352
418 Ga0373927_0021392 3300035695 Bacteria 4239
419 Ga0373927_0053558 3300035695 Bacteria 2610
420 Ga0373933_0000119 3300035724 Bacteria 51009
421 Ga0373933_0004173 3300035724 Bacteria 7959
422 Ga0373933_0024733 3300035724 Bacteria 3438
423 Ga0373933_0064226 3300035724 Bacteria 2220
424 Ga0373933_0088685 3300035724 Bacteria 1906
425 Ga0373933_0090983 3300035724 Bacteria 1882
426 Ga0373933_0105029 3300035724 Bacteria 1756
427 Ga0373947_0004111 3300035725 Bacteria 8555
428 Ga0373947_0043076 3300035725 Bacteria 2696
429 Ga0373947_0043587 3300035725 Bacteria 2680
430 Ga0373947_0044624 3300035725 Bacteria 2650
431 Ga0373937_0000306 3300036401 Bacteria 46226
432 Ga0373937_0010502 3300036401 Bacteria 8085
433 Ga0373937_0020026 3300036401 Bacteria 5992
434 Ga0373937_0089479 3300036401 Bacteria 2850
435 Ga0373937_0104712 3300036401 Bacteria 2628
436 Ga0373937_0188091 3300036401 Bacteria 1939
437 Ga0373925_0002044 3300037068 Bacteria 16633
438 Ga0373925_0014178 3300037068 Bacteria 5767
439 Ga0373925_0022145 3300037068 Bacteria 4633
440 Ga0373925_0051372 3300037068 Bacteria 3077
441 Ga0373925_0063822 3300037068 Bacteria 2772
442 Ga0436364_0684862 3300037853 Bacteria 1652
443 Ga0436364_1223233 3300037853 Bacteria 42179
444 Ga0436364_1508755 3300037853 Bacteria 3504
445 Ga0395901_0000675 3300038443 Bacteria 39208
446 Ga0436365_1284536 3300039437 Bacteria 1831
447 Ga0436365_1434212 3300039437 Bacteria 3747
448 Ga0436365_1763233 3300039437 Bacteria 4979
449 Ga0436360_1310721 3300039438 Bacteria 1560
450 Ga0436361_0791607 3300039447 Bacteria 1615
451 Ga0436363_0349552 3300039450 Bacteria 2693
452 Ga0436362_0617347 3300039453 Bacteria 6593
453 Ga0466972_0029415 3300044658 Bacteria 2704
454 Ga0466965_0001449 3300044683 Bacteria 9580
455 Ga0466966_0041819 3300044684 Bacteria 2944
456 Ga0466963_0140320 3300044694 Bacteria 1674
457 Ga0466963_0243266 3300044694 Bacteria 1262
458 Ga0466970_0038436 3300044765 Bacteria 2538
459 Ga0466970_0068404 3300044765 Bacteria 1908
460 Ga0466957_0140776 3300044842 Bacteria 1554
461 Ga0466960_0000278 3300044901 Bacteria 17801
462 Ga0466960_0067955 3300044901 Bacteria 1767
463 Ga0466959_0092827 3300045049 Bacteria 2167
464 Ga0466959_0160212 3300045049 Bacteria 1582
465 Ga0466967_0007489 3300045976 Bacteria 7880
466 Ga0466967_0058535 3300045976 Bacteria 3406
467 Ga0466967_0143573 3300045976 Bacteria 2225
468 Ga0466967_0161677 3300045976 Bacteria 2102
469 Ga0466967_0168385 3300045976 Bacteria 2060
470 Ga0495592_0000200 3300046454 Bacteria 51023
471 Ga0495592_0029712 3300046454 Bacteria 4137
472 Ga0495592_0041720 3300046454 Bacteria 3438
473 Ga0495592_0068761 3300046454 Bacteria 2584
474 Ga0495603_0018166 3300046455 Bacteria 4254
475 Ga0495629_0001817 3300046459 Bacteria 16723
476 Ga0495629_0002479 3300046459 Bacteria 14154
477 Ga0495641_0004811 3300046461 Bacteria 9388
478 Ga0495641_0009894 3300046461 Bacteria 5611
479 Ga0495641_0022070 3300046461 Bacteria 3190
480 Ga0495641_0036940 3300046461 Bacteria 2292
481 Ga0495641_0038424 3300046461 Bacteria 2236
482 Ga0495651_0000151 3300046462 Bacteria 51025
483 Ga0495651_0001835 3300046462 Bacteria 16403
484 Ga0495651_0009665 3300046462 Bacteria 7416
485 Ga0495651_0013256 3300046462 Bacteria 6375
486 Ga0495651_0025398 3300046462 Bacteria 4611
487 Ga0495651_0060843 3300046462 Bacteria 2891
488 Ga0495651_0073989 3300046462 Bacteria 2585
489 Ga0495651_0128320 3300046462 Bacteria 1854
490 Ga0495653_0006911 3300046463 Bacteria 9323
491 Ga0495653_0010666 3300046463 Bacteria 7523
492 Ga0495653_0015770 3300046463 Bacteria 6160
493 Ga0495653_0041530 3300046463 Bacteria 3589
494 Ga0495653_0080141 3300046463 Bacteria 2416
495 Ga0495650_0050918 3300046471 Bacteria 1709
496 Ga0495580_0003452 3300046472 Bacteria 13458
497 Ga0495580_0012452 3300046472 Bacteria 6520
498 Ga0495582_0007220 3300046473 Bacteria 6162
499 Ga0495582_0029206 3300046473 Bacteria 3026
500 Ga0495639_0001194 3300046475 Bacteria 11725
501 Ga0495639_0034631 3300046475 Bacteria 2259
502 Ga0495639_0036443 3300046475 Bacteria 2203
503 Ga0495662_0000398 3300046476 Bacteria 19448
504 Ga0495662_0005224 3300046476 Bacteria 6509
505 Ga0495662_0027735 3300046476 Bacteria 2736
506 Ga0495662_0050165 3300046476 Bacteria 2014
507 Ga0495664_0000170 3300046477 Bacteria 31859
508 Ga0495664_0143157 3300046477 Bacteria 1449
509 Ga0495664_0201046 3300046477 Bacteria 1207
510 Ga0495594_0059990 3300046499 Bacteria 2104
511 Ga0495608_0000147 3300046511 Bacteria 50943
512 Ga0495608_0001781 3300046511 Bacteria 15382
513 Ga0495608_0007778 3300046511 Bacteria 7549
514 Ga0495608_0018624 3300046511 Bacteria 4786
515 Ga0495608_0040793 3300046511 Bacteria 3108
516 Ga0495608_0051155 3300046511 Bacteria 2739
517 Ga0495608_0057961 3300046511 Bacteria 2554
518 Ga0495608_0063909 3300046511 Bacteria 2413
519 Ga0495618_0004682 3300046514 Bacteria 8368
520 Ga0495618_0010066 3300046514 Bacteria 5719
521 Ga0495618_0026716 3300046514 Bacteria 3591
522 Ga0495618_0038593 3300046514 Bacteria 3002
523 Ga0495618_0128046 3300046514 Bacteria 1625
524 Ga0495618_0134190 3300046514 Bacteria 1584
525 Ga0495628_0000753 3300046516 Bacteria 29919
526 Ga0495628_0023071 3300046516 Bacteria 5108
527 Ga0495628_0034053 3300046516 Bacteria 4101
528 Ga0495628_0074588 3300046516 Bacteria 2642
529 Ga0495628_0117409 3300046516 Bacteria 2043
530 Ga0495628_0149645 3300046516 Bacteria 1779
531 Ga0495628_0166989 3300046516 Bacteria 1670
532 Ga0495630_0003733 3300046517 Bacteria 10620
533 Ga0495630_0003909 3300046517 Bacteria 10416
534 Ga0495630_0010026 3300046517 Bacteria 6824
535 Ga0495630_0023818 3300046517 Bacteria 4525
536 Ga0495666_0000939 3300046526 Bacteria 13683
537 Ga0495666_0016616 3300046526 Bacteria 3665
538 Ga0495652_0000276 3300046529 Bacteria 60614
539 Ga0495652_0011993 3300046529 Bacteria 7834
540 Ga0495652_0029193 3300046529 Bacteria 4845
541 Ga0495652_0088918 3300046529 Bacteria 2530
542 Ga0495652_0183517 3300046529 Bacteria 1603
543 Ga0495665_0002626 3300046531 Bacteria 9692
544 Ga0495665_0004314 3300046531 Bacteria 7682
545 Ga0495665_0004598 3300046531 Bacteria 7446
546 Ga0495665_0011845 3300046531 Bacteria 4722
547 Ga0495665_0033780 3300046531 Bacteria 2735
548 Ga0495640_0010262 3300046533 Bacteria 7248
549 Ga0495640_0025492 3300046533 Bacteria 4287
550 Ga0495640_0028266 3300046533 Bacteria 4038
551 Ga0495640_0033054 3300046533 Bacteria 3678
552 Ga0495640_0074594 3300046533 Bacteria 2268
553 Ga0495640_0124688 3300046533 Bacteria 1671
554 Ga0495586_0008699 3300046535 Bacteria 5405
555 Ga0495586_0014824 3300046535 Bacteria 4142
556 Ga0495586_0018638 3300046535 Bacteria 3695
557 Ga0495587_0000045 3300046536 Bacteria 108362
558 Ga0495587_0003044 3300046536 Bacteria 11199
559 Ga0495587_0017474 3300046536 Bacteria 4455
560 Ga0495587_0055643 3300046536 Bacteria 2329
561 Ga0495587_0089957 3300046536 Bacteria 1773
562 Ga0495645_0008023 3300046543 Bacteria 7351
563 Ga0495645_0010953 3300046543 Bacteria 6367
564 Ga0495645_0055998 3300046543 Bacteria 2863
565 Ga0495645_0069753 3300046543 Bacteria 2537
566 Ga0495667_0000051 3300046559 Bacteria 109277
567 Ga0495667_0003213 3300046559 Bacteria 10957
568 Ga0495667_0008153 3300046559 Bacteria 7108
569 Ga0495667_0009637 3300046559 Bacteria 6547
570 Ga0495667_0019737 3300046559 Bacteria 4548
571 Ga0495667_0038149 3300046559 Bacteria 3200
572 Ga0495667_0059364 3300046559 Bacteria 2510
573 Ga0495667_0065057 3300046559 Bacteria 2385
574 Ga0495634_0005420 3300046642 Bacteria 9821
575 Ga0495634_0014722 3300046642 Bacteria 5629
576 Ga0495634_0014943 3300046642 Bacteria 5582
577 Ga0495634_0089820 3300046642 Bacteria 1996
578 Ga0495635_0006037 3300046663 Bacteria 8445
579 Ga0495635_0006196 3300046663 Bacteria 8335
580 Ga0495635_0031178 3300046663 Bacteria 3703
581 Ga0495635_0035952 3300046663 Bacteria 3434
582 Ga0495635_0036304 3300046663 Bacteria 3416
583 Ga0495635_0068783 3300046663 Bacteria 2428
584 Ga0495635_0096216 3300046663 Bacteria 2024
585 Ga0495635_0191623 3300046663 Bacteria 1388
586 Ga0495657_0000044 3300046675 Bacteria 108383
587 Ga0495657_0006495 3300046675 Bacteria 9141
588 Ga0495657_0007455 3300046675 Bacteria 8453
589 Ga0495657_0017348 3300046675 Bacteria 5227
590 Ga0495657_0018258 3300046675 Bacteria 5081
591 Ga0495657_0046655 3300046675 Bacteria 2932
592 Ga0495657_0141935 3300046675 Bacteria 1496
593 Ga0495599_0000101 3300046678 Bacteria 60499
594 Ga0495599_0014227 3300046678 Bacteria 4925
595 Ga0495599_0025541 3300046678 Bacteria 3698
596 Ga0495599_0026352 3300046678 Bacteria 3642
597 Ga0495599_0095464 3300046678 Bacteria 1854
598 Ga0495599_0122805 3300046678 Bacteria 1614
599 Ga0495599_0172506 3300046678 Bacteria 1334
600 Ga0495599_0235241 3300046678 Bacteria 1118
601 Ga0495599_0248122 3300046678 Bacteria 1084
602 Ga0495623_0001529 3300046679 Bacteria 15620
603 Ga0495623_0007854 3300046679 Bacteria 6938
604 Ga0495623_0010798 3300046679 Bacteria 5912
605 Ga0495646_0004595 3300046680 Bacteria 8701
606 Ga0495646_0006309 3300046680 Bacteria 7523
607 Ga0495646_0060322 3300046680 Bacteria 2262
608 Ga0495646_0082479 3300046680 Bacteria 1871
609 Ga0495646_0122619 3300046680 Bacteria 1469
610 Ga0495647_0004707 3300046681 Bacteria 4451
611 Ga0495658_0001230 3300046683 Bacteria 13450
612 Ga0495658_0003103 3300046683 Bacteria 8305
613 Ga0495658_0009091 3300046683 Bacteria 4940
614 Ga0495613_0018718 3300046689 Bacteria 5164
615 Ga0495613_0018898 3300046689 Bacteria 5133
616 Ga0495624_0012799 3300046690 Bacteria 5728
617 Ga0495624_0021657 3300046690 Bacteria 4260
618 Ga0495624_0030650 3300046690 Bacteria 3501
619 Ga0495624_0038097 3300046690 Bacteria 3090
620 Ga0495624_0070078 3300046690 Bacteria 2183
621 Ga0495600_0002019 3300046809 Bacteria 11414
622 Ga0495600_0003438 3300046809 Bacteria 9308
623 Ga0495600_0009486 3300046809 Bacteria 6016
624 Ga0495600_0020118 3300046809 Bacteria 4269
625 Ga0495600_0028588 3300046809 Bacteria 3607
626 Ga0495600_0063964 3300046809 Bacteria 2404
627 Ga0495600_0084737 3300046809 Bacteria 2068
628 Ga0495600_0235223 3300046809 Bacteria 1168
629 Ga0495581_0002552 3300047315 Bacteria 10335
630 Ga0495581_0003056 3300047315 Bacteria 9582
631 Ga0495581_0004566 3300047315 Bacteria 8001
632 Ga0495581_0008812 3300047315 Bacteria 5839
633 Ga0495581_0019126 3300047315 Bacteria 3976
634 Ga0495604_0000046 3300047317 Bacteria 110553
635 Ga0495604_0002188 3300047317 Bacteria 15682
636 Ga0495604_0008319 3300047317 Bacteria 8204
637 Ga0495604_0010113 3300047317 Bacteria 7474
638 Ga0495604_0024752 3300047317 Bacteria 4789
639 Ga0495604_0064366 3300047317 Bacteria 2794
640 Ga0495604_0080912 3300047317 Bacteria 2433
641 Ga0495604_0110212 3300047317 Bacteria 2008
642 Ga0495674_0002355 3300047319 Bacteria 18525
643 Ga0495674_0013056 3300047319 Bacteria 7818
644 Ga0495674_0036791 3300047319 Bacteria 4402
645 Ga0495674_0048295 3300047319 Bacteria 3766
646 Ga0495674_0051728 3300047319 Bacteria 3620
647 Ga0495674_0237211 3300047319 Bacteria 1504
648 Ga0495674_0269650 3300047319 Bacteria 1397
649 Ga0495676_0011421 3300047321 Bacteria 8017
650 Ga0495676_0045228 3300047321 Bacteria 3585
651 Ga0495680_0000108 3300047322 Bacteria 77095
652 Ga0495680_0001141 3300047322 Bacteria 29263
653 Ga0495680_0010102 3300047322 Bacteria 8440
654 Ga0495680_0011952 3300047322 Bacteria 7662
655 Ga0495680_0038937 3300047322 Bacteria 3796
656 Ga0495680_0048420 3300047322 Bacteria 3337
657 Ga0495680_0116620 3300047322 Bacteria 1974
658 Ga0495680_0238994 3300047322 Bacteria 1291
659 Ga0495675_0000119 3300047444 Bacteria 57079
660 Ga0495675_0039220 3300047444 Bacteria 3016
661 Ga0495684_0002594 3300047471 Bacteria 14368
662 Ga0495684_0005128 3300047471 Bacteria 10221
663 Ga0495684_0006104 3300047471 Bacteria 9375
664 Ga0495684_0010060 3300047471 Bacteria 7311
665 Ga0495684_0020457 3300047471 Bacteria 5100
666 Ga0495684_0058809 3300047471 Bacteria 2927
667 Ga0495684_0073968 3300047471 Bacteria 2588
668 Ga0495684_0145479 3300047471 Bacteria 1775
669 Ga0495684_0188075 3300047471 Bacteria 1528
670 Ga0495593_0004694 3300047673 Bacteria 8127
671 Ga0495593_0008869 3300047673 Bacteria 5835
672 Ga0495593_0052120 3300047673 Bacteria 2163
673 Ga0495602_0000167 3300048088 Bacteria 61216
674 Ga0495602_0034111 3300048088 Bacteria 4765
675 Ga0495602_0044948 3300048088 Bacteria 4001
676 Ga0495602_0065731 3300048088 Bacteria 3128
677 Ga0495602_0098847 3300048088 Bacteria 2400
678 Ga0495602_0212290 3300048088 Bacteria 1468
679 Ga0495602_0229833 3300048088 Bacteria 1394
680 Ga0495614_0022151 3300048089 Bacteria 2743
681 Ga0496100_0100777 3300048903 Bacteria 1990
682 Ga0496100_0115773 3300048903 Bacteria 1870
683 Ga0496101_0088556 3300048904 Bacteria 2299
684 Ga0496101_0091124 3300048904 Bacteria 2268
685 Ga0496101_0108107 3300048904 Bacteria 2090
686 Ga0496101_0127464 3300048904 Bacteria 1930
687 Ga0496102_0000147 3300048905 Bacteria 96295
688 Ga0496102_0147343 3300048905 Bacteria 2210
689 Ga0496103_0000261 3300048906 Bacteria 50634
690 Ga0496103_0068858 3300048906 Bacteria 2211
691 Ga0496104_0001309 3300048907 Bacteria 21482
692 Ga0496104_0102892 3300048907 Bacteria 2736
693 Ga0496105_0045715 3300048908 Bacteria 3613
694 Ga0496106_0012056 3300048909 Bacteria 6378
695 Ga0496106_0279793 3300048909 Bacteria 1337
696 Ga0496107_0091730 3300048910 Bacteria 2221
697 Ga0496108_0042972 3300048911 Bacteria 3774
698 Ga0496108_0063912 3300048911 Bacteria 3100
699 Ga0496108_0099244 3300048911 Bacteria 2482
700 Ga0496108_0246669 3300048911 Bacteria 1553
701 Ga0496109_0028955 3300048912 Bacteria 4959
702 Ga0496109_0072212 3300048912 Bacteria 3170
703 Ga0496109_0082139 3300048912 Bacteria 2969
704 Ga0496110_0064629 3300048913 Bacteria 3234
705 Ga0496110_0120957 3300048913 Bacteria 2358
706 Ga0496110_0177955 3300048913 Bacteria 1931
707 Ga0496111_0038261 3300048914 Bacteria 3437
708 Ga0496112_0018864 3300048915 Bacteria 6498
709 Ga0496112_0032245 3300048915 Bacteria 5087
710 Ga0496113_0023422 3300048916 Bacteria 4378
711 Ga0496113_0412306 3300048916 Bacteria 1085
712 Ga0496114_0008833 3300048917 Bacteria 7987
713 Ga0496115_0063797 3300048918 Bacteria 2972
714 Ga0496115_0067725 3300048918 Bacteria 2888
715 Ga0496116_0000425 3300048919 Bacteria 59407
716 Ga0496117_0000274 3300048920 Bacteria 96150
717 Ga0496118_0000602 3300048921 Bacteria 59438
718 Ga0496119_0001483 3300048922 Bacteria 28127
719 Ga0496119_0002434 3300048922 Bacteria 20442
720 Ga0496120_0001510 3300048923 Bacteria 27511
721 Ga0496120_0004006 3300048923 Bacteria 12796
722 Ga0496121_0005158 3300048924 Bacteria 16971
723 Ga0496124_0021894 3300048927 Bacteria 5879
724 Ga0496125_0118334 3300048928 Bacteria 1897
725 Ga0496126_0000419 3300048929 Bacteria 85931
726 Ga0501042_0029142 3300049578 Bacteria 3893
727 nmdc:mga05p37_15523_c1 3300050507 Bacteria 9156
728 nmdc:mga08y16_224495_c1 3300050511 Bacteria 1944
729 nmdc:mga08y16_284172_c1 3300050511 Bacteria 1706
730 nmdc:mga0n895_16343_c1 3300050512 Bacteria 6805
731 nmdc:mga0n895_211522_c1 3300050512 Bacteria 1970
732 nmdc:mga0n895_226944_c1 3300050512 Bacteria 1896
733 nmdc:mga0n895_336011_c1 3300050512 Bacteria 1530
734 nmdc:mga0n895_343739_c1 3300050512 Bacteria 1511
735 nmdc:mga0n895_40648_c1 3300050512 Bacteria 4518
736 nmdc:mga0n895_53056_c1 3300050512 Bacteria 3982
737 nmdc:mga0rr50_19140_c1 3300050513 Bacteria 4614
738 nmdc:mga0rr50_3711_c1 3300050513 Bacteria 8847
739 nmdc:mga0rr50_38836_c1 3300050513 Bacteria 3449
740 nmdc:mga08x19_134478_c1 3300050514 Bacteria 1666
741 nmdc:mga08x19_54296_c1 3300050514 Bacteria 2579
742 nmdc:mga0a205_144637_c1 3300050515 Bacteria 2277
743 nmdc:mga0a205_182263_c1 3300050515 Bacteria 1994
744 nmdc:mga0a205_210299_c1 3300050515 Bacteria 1834
745 nmdc:mga0a205_29022_c1 3300050515 Bacteria 5293
746 Ga0495601_0011723 3300053077 Bacteria 5254
747 Ga0495601_0038761 3300053077 Bacteria 2980
748 Ga0495601_0061268 3300053077 Bacteria 2388
749 Ga0495601_0121297 3300053077 Bacteria 1698
750 Ga0495601_0303107 3300053077 Bacteria 1040
751 Ga0495612_0046026 3300053078 Bacteria 1786
752 Ga0495612_0085489 3300053078 Bacteria 1330
753 Ga0495612_0090150 3300053078 Bacteria 1297
754 Ga0495612_0091550 3300053078 Bacteria 1288
755 Ga0495595_0000441 3300053084 Bacteria 15723
756 Ga0495595_0025916 3300053084 Bacteria 2601
757 Ga0495595_0027744 3300053084 Bacteria 2524
758 Ga0495619_0001376 3300053085 Bacteria 16004
759 Ga0495619_0025529 3300053085 Bacteria 3795
760 Ga0495619_0051096 3300053085 Bacteria 2731
761 Ga0495619_0054587 3300053085 Bacteria 2645
762 Ga0495619_0197827 3300053085 Unclassified 1391

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032126 Ga0307415_100435911 Ga0307415_1004359112 260
2 3300038443 Ga0395901_0000675 Ga0395901_0000675_29836_30825 285
3 3300037853 Ga0436364_0684862 Ga0436364_0684862_122_1105 298
4 3300006028 Ga0070717_10152460 Ga0070717_101524602 299
5 3300005530 Ga0070679_100168529 Ga0070679_1001685292 300
6 3300005614 Ga0068856_100530009 Ga0068856_1005300092 300
7 3300005840 Ga0068870_10034090 Ga0068870_100340903 300
8 3300005841 Ga0068863_100228187 Ga0068863_1002281872 300
9 3300005842 Ga0068858_100346033 Ga0068858_1003460332 300
10 3300009174 Ga0105241_10049814 Ga0105241_100498144 300
11 3300025908 Ga0207643_10004651 Ga0207643_100046516 300
12 3300005329 Ga0070683_100228010 Ga0070683_1002280102 302
13 3300005535 Ga0070684_100087998 Ga0070684_1000879983 302
14 3300009551 Ga0105238_10352983 Ga0105238_103529832 302
15 3300025919 Ga0207657_10175370 Ga0207657_101753701 302
16 3300025944 Ga0207661_10047456 Ga0207661_100474562 302
17 3300025981 Ga0207640_10060440 Ga0207640_100604403 302
18 3300031344 Ga0265316_10112549 Ga0265316_101125491 304
19 3300046559 Ga0495667_0038149 Ga0495667_0038149_2224_3174 305
20 3300046559 Ga0495667_0059364 Ga0495667_0059364_554_1630 305
21 3300035111 Ga0373923_0020460 Ga0373923_0020460_172_1233 306
22 3300035120 Ga0373957_0021174 Ga0373957_0021174_1158_2234 306
23 3300035410 Ga0373924_0007457 Ga0373924_0007457_1403_2464 306
24 3300036401 Ga0373937_0104712 Ga0373937_0104712_72_1133 306
25 3300046529 Ga0495652_0088918 Ga0495652_0088918_19_1080 306
26 3300047322 Ga0495680_0116620 Ga0495680_0116620_848_1924 306
27 3300047471 Ga0495684_0005128 Ga0495684_0005128_5850_6926 306
28 3300053085 Ga0495619_0054587 Ga0495619_0054587_436_1512 306
29 3300005471 Ga0070698_100002430 Ga0070698_10000243016 307
30 3300035724 Ga0373933_0024733 Ga0373933_0024733_2200_3261 307
31 3300044658 Ga0466972_0029415 Ga0466972_0029415_770_1750 307
32 3300044683 Ga0466965_0001449 Ga0466965_0001449_826_1806 307
33 3300044765 Ga0466970_0038436 Ga0466970_0038436_1055_2035 307
34 3300044901 Ga0466960_0000278 Ga0466960_0000278_1567_2547 307
35 3300045976 Ga0466967_0143573 Ga0466967_0143573_995_1975 307
36 3300046678 Ga0495599_0172506 Ga0495599_0172506_271_1203 307
37 3300005434 Ga0070709_10009428 Ga0070709_100094283 308
38 3300005437 Ga0070710_10004883 Ga0070710_100048833 308
39 3300005445 Ga0070708_100039435 Ga0070708_1000394353 308
40 3300005467 Ga0070706_100012966 Ga0070706_1000129665 308
41 3300005471 Ga0070698_100020690 Ga0070698_1000206902 308
42 3300005536 Ga0070697_100013155 Ga0070697_1000131553 308
43 3300006028 Ga0070717_10083684 Ga0070717_100836842 308
44 3300006173 Ga0070716_100102300 Ga0070716_1001023002 308
45 3300025906 Ga0207699_10031439 Ga0207699_100314392 308
46 3300025910 Ga0207684_10017737 Ga0207684_100177374 308
47 3300025922 Ga0207646_10012951 Ga0207646_100129511 308
48 3300025939 Ga0207665_10132730 Ga0207665_101327302 308
49 3300029957 Ga0265324_10006155 Ga0265324_100061554 308
50 3300031240 Ga0265320_10006561 Ga0265320_100065618 308
51 3300031241 Ga0265325_10177202 Ga0265325_101772021 308
52 3300031242 Ga0265329_10009577 Ga0265329_100095777 308
53 3300031250 Ga0265331_10030462 Ga0265331_100304625 308
54 3300031344 Ga0265316_10135504 Ga0265316_101355042 308
55 3300031711 Ga0265314_10021773 Ga0265314_100217737 308
56 3300035113 Ga0373936_0015154 Ga0373936_0015154_1445_2521 308
57 3300035117 Ga0373953_0002744 Ga0373953_0002744_460_1521 308
58 3300035172 Ga0373955_0002512 Ga0373955_0002512_3606_4667 308
59 3300035692 Ga0373935_0054162 Ga0373935_0054162_115_1176 308
60 3300046476 Ga0495662_0027735 Ga0495662_0027735_655_1731 308
61 3300046533 Ga0495640_0010262 Ga0495640_0010262_734_1810 308
62 3300046642 Ga0495634_0014943 Ga0495634_0014943_3754_4830 308
63 3300046663 Ga0495635_0035952 Ga0495635_0035952_1676_2752 308
64 3300046680 Ga0495646_0006309 Ga0495646_0006309_4064_5125 308
65 3300047319 Ga0495674_0237211 Ga0495674_0237211_492_1424 308
66 3300045976 Ga0466967_0007489 Ga0466967_0007489_4810_5799 310
67 3300039438 Ga0436360_1310721 Ga0436360_1310721_379_1317 311
68 3300039447 Ga0436361_0791607 Ga0436361_0791607_187_1125 311
69 3300039453 Ga0436362_0617347 Ga0436362_0617347_5432_6370 311
70 3300025929 Ga0207664_10276052 Ga0207664_102760522 314
71 3300046511 Ga0495608_0007778 Ga0495608_0007778_4789_5769 315
72 3300047317 Ga0495604_0080912 Ga0495604_0080912_1003_1983 315
73 3300053084 Ga0495595_0025916 Ga0495595_0025916_920_1900 315
74 3300053085 Ga0495619_0197827 Ga0495619_0197827_177_1157 315
75 iso_pu_bacteria 2818991318 2819428681 315
76 iso_pu_bacteria 2915358134 2915361906 315
77 iso_pu_bacteria 8054472261 8054477316 315
78 3300005434 Ga0070709_10003910 Ga0070709_100039101 316
79 3300005437 Ga0070710_10000904 Ga0070710_1000090413 316
80 3300005437 Ga0070710_10064110 Ga0070710_100641103 316
81 3300005437 Ga0070710_10134454 Ga0070710_101344542 316
82 3300005439 Ga0070711_100009717 Ga0070711_1000097171 316
83 3300005439 Ga0070711_100257822 Ga0070711_1002578222 316
84 3300005445 Ga0070708_100016030 Ga0070708_1000160306 316
85 3300005467 Ga0070706_100108556 Ga0070706_1001085562 316
86 3300005468 Ga0070707_100001468 Ga0070707_10000146817 316
87 3300005468 Ga0070707_100079896 Ga0070707_1000798962 316
88 3300005471 Ga0070698_100002351 Ga0070698_10000235120 316
89 3300005518 Ga0070699_100011087 Ga0070699_1000110875 316
90 3300005535 Ga0070684_100166004 Ga0070684_1001660042 316
91 3300006028 Ga0070717_10017635 Ga0070717_100176352 316
92 3300006173 Ga0070716_100003549 Ga0070716_1000035494 316
93 3300006175 Ga0070712_100019088 Ga0070712_1000190884 316
94 3300024225 Ga0224572_1001884 Ga0224572_10018843 316
95 3300025906 Ga0207699_10010354 Ga0207699_100103541 316
96 3300025910 Ga0207684_10066624 Ga0207684_100666242 316
97 3300025915 Ga0207693_10125228 Ga0207693_101252282 316
98 3300025916 Ga0207663_10253087 Ga0207663_102530871 316
99 3300025922 Ga0207646_10005267 Ga0207646_100052673 316
100 3300025922 Ga0207646_10012021 Ga0207646_100120214 316
101 3300025928 Ga0207700_10006097 Ga0207700_100060975 316
102 3300025929 Ga0207664_10048722 Ga0207664_100487224 316
103 3300025929 Ga0207664_10080519 Ga0207664_100805192 316
104 3300035083 Ga0373926_0005963 Ga0373926_0005963_1498_2475 316
105 3300035086 Ga0373934_0000004 Ga0373934_0000004_18378_19370 316
106 3300035089 Ga0373944_0002650 Ga0373944_0002650_3093_4070 316
107 3300035113 Ga0373936_0000220 Ga0373936_0000220_2989_3966 316
108 3300035113 Ga0373936_0012695 Ga0373936_0012695_79_1071 316
109 3300035116 Ga0373945_0000244 Ga0373945_0000244_10970_11947 316
110 3300035117 Ga0373953_0017686 Ga0373953_0017686_236_1228 316
111 3300035118 Ga0373954_0002885 Ga0373954_0002885_4890_5882 316
112 3300035119 Ga0373956_0000601 Ga0373956_0000601_6129_7121 316
113 3300035120 Ga0373957_0001123 Ga0373957_0001123_261_1253 316
114 3300035170 Ga0373943_0000328 Ga0373943_0000328_1823_2800 316
115 3300035171 Ga0373946_0000075 Ga0373946_0000075_25673_26650 316
116 3300035172 Ga0373955_0000025 Ga0373955_0000025_35319_36311 316
117 3300035172 Ga0373955_0233813 Ga0373955_0233813_112_1089 316
118 3300035410 Ga0373924_0010732 Ga0373924_0010732_190_1182 316
119 3300035692 Ga0373935_0108878 Ga0373935_0108878_273_1265 316
120 3300035695 Ga0373927_0001015 Ga0373927_0001015_5981_6958 316
121 3300035724 Ga0373933_0000119 Ga0373933_0000119_22022_23014 316
122 3300036401 Ga0373937_0000306 Ga0373937_0000306_23197_24189 316
123 3300037068 Ga0373925_0014178 Ga0373925_0014178_2421_3398 316
124 3300046454 Ga0495592_0000200 Ga0495592_0000200_22041_23033 316
125 3300046461 Ga0495641_0038424 Ga0495641_0038424_848_1825 316
126 3300046462 Ga0495651_0000151 Ga0495651_0000151_27996_28988 316
127 3300046462 Ga0495651_0013256 Ga0495651_0013256_3365_4342 316
128 3300046463 Ga0495653_0006911 Ga0495653_0006911_2926_3918 316
129 3300046475 Ga0495639_0034631 Ga0495639_0034631_149_1126 316
130 3300046476 Ga0495662_0005224 Ga0495662_0005224_667_1644 316
131 3300046477 Ga0495664_0000170 Ga0495664_0000170_27164_28141 316
132 3300046511 Ga0495608_0000147 Ga0495608_0000147_27961_28953 316
133 3300046511 Ga0495608_0057961 Ga0495608_0057961_310_1287 316
134 3300046514 Ga0495618_0004682 Ga0495618_0004682_6058_7035 316
135 3300046516 Ga0495628_0000753 Ga0495628_0000753_22756_23748 316
136 3300046516 Ga0495628_0149645 Ga0495628_0149645_538_1509 316
137 3300046516 Ga0495628_0166989 Ga0495628_0166989_383_1360 316
138 3300046517 Ga0495630_0003909 Ga0495630_0003909_8873_9850 316
139 3300046529 Ga0495652_0000276 Ga0495652_0000276_37585_38577 316
140 3300046531 Ga0495665_0011845 Ga0495665_0011845_495_1472 316
141 3300046536 Ga0495587_0000045 Ga0495587_0000045_21088_22080 316
142 3300046543 Ga0495645_0055998 Ga0495645_0055998_684_1655 316
143 3300046559 Ga0495667_0000051 Ga0495667_0000051_22015_23007 316
144 3300046642 Ga0495634_0089820 Ga0495634_0089820_700_1677 316
145 3300046663 Ga0495635_0006196 Ga0495635_0006196_3331_4308 316
146 3300046663 Ga0495635_0096216 Ga0495635_0096216_866_1858 316
147 3300046675 Ga0495657_0000044 Ga0495657_0000044_21111_22103 316
148 3300046675 Ga0495657_0018258 Ga0495657_0018258_319_1296 316
149 3300046678 Ga0495599_0000101 Ga0495599_0000101_37467_38459 316
150 3300046678 Ga0495599_0025541 Ga0495599_0025541_115_1092 316
151 3300046679 Ga0495623_0001529 Ga0495623_0001529_8469_9461 316
152 3300046680 Ga0495646_0060322 Ga0495646_0060322_1086_2078 316
153 3300046690 Ga0495624_0030650 Ga0495624_0030650_1843_2820 316
154 3300046809 Ga0495600_0003438 Ga0495600_0003438_7039_8031 316
155 3300047317 Ga0495604_0000046 Ga0495604_0000046_22021_23013 316
156 3300047319 Ga0495674_0002355 Ga0495674_0002355_10421_11398 316
157 3300047321 Ga0495676_0045228 Ga0495676_0045228_1363_2340 316
158 3300047322 Ga0495680_0000108 Ga0495680_0000108_22042_23034 316
159 3300047322 Ga0495680_0011952 Ga0495680_0011952_408_1385 316
160 3300047444 Ga0495675_0000119 Ga0495675_0000119_54021_55013 316
161 3300047471 Ga0495684_0002594 Ga0495684_0002594_1045_2022 316
162 3300048088 Ga0495602_0000167 Ga0495602_0000167_6207_7199 316
163 3300050512 nmdc:mga0n895_336011_c1 nmdc:mga0n895_336011_c1_334_1404 316
164 3300053078 Ga0495612_0085489 Ga0495612_0085489_19_996 316
165 3300053084 Ga0495595_0000441 Ga0495595_0000441_8555_9547 316
166 3300005467 Ga0070706_100027455 Ga0070706_1000274553 317
167 3300005468 Ga0070707_100000391 Ga0070707_10000039126 317
168 3300005471 Ga0070698_100000459 Ga0070698_10000045926 317
169 3300025910 Ga0207684_10020340 Ga0207684_100203403 317
170 3300025922 Ga0207646_10000721 Ga0207646_1000072123 317
171 3300035086 Ga0373934_0011407 Ga0373934_0011407_162_1154 317
172 3300035724 Ga0373933_0064226 Ga0373933_0064226_702_1694 317
173 3300037068 Ga0373925_0063822 Ga0373925_0063822_584_1576 317
174 3300046462 Ga0495651_0060843 Ga0495651_0060843_1668_2660 317
175 3300046463 Ga0495653_0015770 Ga0495653_0015770_1392_2384 317
176 3300046511 Ga0495608_0018624 Ga0495608_0018624_2922_3914 317
177 3300046529 Ga0495652_0183517 Ga0495652_0183517_454_1446 317
178 3300046536 Ga0495587_0089957 Ga0495587_0089957_607_1599 317
179 3300046559 Ga0495667_0009637 Ga0495667_0009637_5356_6348 317
180 3300046663 Ga0495635_0068783 Ga0495635_0068783_541_1533 317
181 3300046809 Ga0495600_0063964 Ga0495600_0063964_916_1908 317
182 3300047319 Ga0495674_0269650 Ga0495674_0269650_133_1125 317
183 3300047471 Ga0495684_0145479 Ga0495684_0145479_651_1643 317
184 3300048916 Ga0496113_0412306 Ga0496113_0412306_68_1045 317
185 3300005347 Ga0070668_100106358 Ga0070668_1001063582 318
186 3300005548 Ga0070665_100011840 Ga0070665_1000118402 318
187 3300005841 Ga0068863_100128422 Ga0068863_1001284222 318
188 3300005843 Ga0068860_100003227 Ga0068860_10000322721 318
189 3300014968 Ga0157379_10014328 Ga0157379_100143283 318
190 3300025906 Ga0207699_10144210 Ga0207699_101442102 318
191 3300025915 Ga0207693_10018028 Ga0207693_100180282 318
192 3300025916 Ga0207663_10200169 Ga0207663_102001692 318
193 3300025929 Ga0207664_10148383 Ga0207664_101483832 318
194 3300025931 Ga0207644_10066237 Ga0207644_100662372 318
195 3300025939 Ga0207665_10146339 Ga0207665_101463392 318
196 3300025972 Ga0207668_10100081 Ga0207668_101000812 318
197 3300026088 Ga0207641_10111644 Ga0207641_101116442 318
198 3300028379 Ga0268266_10113261 Ga0268266_101132612 318
199 3300028381 Ga0268264_10009372 Ga0268264_100093725 318
200 3300035410 Ga0373924_0013650 Ga0373924_0013650_418_1395 318
201 3300045976 Ga0466967_0161677 Ga0466967_0161677_880_1857 318
202 3300046533 Ga0495640_0124688 Ga0495640_0124688_53_1045 318
203 3300047315 Ga0495581_0019126 Ga0495581_0019126_2985_3962 318
204 3300047317 Ga0495604_0024752 Ga0495604_0024752_3720_4712 318
205 3300048088 Ga0495602_0044948 Ga0495602_0044948_2151_3143 318
206 3300048904 Ga0496101_0108107 Ga0496101_0108107_681_1658 318
207 3300048905 Ga0496102_0000147 Ga0496102_0000147_48783_49760 318
208 3300048906 Ga0496103_0000261 Ga0496103_0000261_3163_4140 318
209 3300048907 Ga0496104_0102892 Ga0496104_0102892_1386_2363 318
210 3300048908 Ga0496105_0045715 Ga0496105_0045715_2129_3106 318
211 3300048913 Ga0496110_0177955 Ga0496110_0177955_449_1426 318
212 3300048919 Ga0496116_0000425 Ga0496116_0000425_11948_12925 318
213 3300048920 Ga0496117_0000274 Ga0496117_0000274_83226_84203 318
214 3300048921 Ga0496118_0000602 Ga0496118_0000602_11948_12925 318
215 3300048922 Ga0496119_0002434 Ga0496119_0002434_7325_8302 318
216 3300048923 Ga0496120_0004006 Ga0496120_0004006_11366_12343 318
217 3300048924 Ga0496121_0005158 Ga0496121_0005158_11934_12911 318
218 3300048927 Ga0496124_0021894 Ga0496124_0021894_2786_3763 318
219 3300048928 Ga0496125_0118334 Ga0496125_0118334_888_1865 318
220 3300048929 Ga0496126_0000419 Ga0496126_0000419_48341_49318 318
221 iso_pu_bacteria 2501939600 2501944684 318
222 iso_pu_bacteria 2622736626 2623586825 318
223 iso_pu_bacteria 2626541554 2626637038 318
224 iso_pu_bacteria 2687453743 2689989899 318
225 iso_pu_bacteria 2831935698 2831938353 318
226 iso_pu_bacteria 2832004796 2832006443 318
227 iso_pu_bacteria 2858868258 2858872291 318
228 iso_pu_bacteria 2866065130 2866065601 318
229 iso_pu_bacteria 2867507094 2867511155 318
230 iso_pu_bacteria 2902582711 2902585539 318
231 iso_pu_bacteria 8003856774 8003859845 318
232 iso_pu_bacteria 8055412473 8055413433 318
233 3300031548 Ga0307408_100033730 Ga0307408_1000337303 319
234 3300031731 Ga0307405_10242280 Ga0307405_102422802 319
235 3300031852 Ga0307410_10318765 Ga0307410_103187652 319
236 3300031901 Ga0307406_10021130 Ga0307406_100211302 319
237 3300031901 Ga0307406_10319316 Ga0307406_103193162 319
238 3300032002 Ga0307416_100440234 Ga0307416_1004402342 319
239 3300032002 Ga0307416_100442983 Ga0307416_1004429832 319
240 3300039450 Ga0436363_0349552 Ga0436363_0349552_75_1040 319
241 3300045049 Ga0466959_0092827 Ga0466959_0092827_489_1457 319
242 iso_pu_bacteria 2527291627 2528204734 319
243 iso_pu_bacteria 2527291629 2528214750 319
244 iso_pu_bacteria 2546825537 2546949698 319
245 iso_pu_bacteria 2576861822 2579750602 319
246 iso_pu_bacteria 2579778521 2579856964 319
247 iso_pu_bacteria 2619618881 2619858276 319
248 iso_pu_bacteria 2619619003 2620352879 319
249 iso_pu_bacteria 2684623036 2686544519 319
250 iso_pu_bacteria 2710264753 2710602894 319
251 iso_pu_bacteria 2773857924 2774867850 319
252 iso_pu_bacteria 637000116 637880226 319
253 iso_pu_bacteria 8054913762 8054915940 319
254 iso_pu_bacteria 8054920844 8054926375 319
255 3300005327 Ga0070658_10307055 Ga0070658_103070551 320
256 3300005338 Ga0068868_100263811 Ga0068868_1002638111 320
257 3300005347 Ga0070668_100316061 Ga0070668_1003160611 320
258 3300005435 Ga0070714_100037540 Ga0070714_1000375403 320
259 3300005435 Ga0070714_100190821 Ga0070714_1001908211 320
260 3300005436 Ga0070713_100190692 Ga0070713_1001906922 320
261 3300005577 Ga0068857_100181637 Ga0068857_1001816372 320
262 3300006871 Ga0075434_100199751 Ga0075434_1001997512 320
263 3300009098 Ga0105245_10125987 Ga0105245_101259873 320
264 3300009147 Ga0114129_10272082 Ga0114129_102720822 320
265 3300013308 Ga0157375_10075052 Ga0157375_100750523 320
266 3300014326 Ga0157380_10327205 Ga0157380_103272052 320
267 3300025901 Ga0207688_10030693 Ga0207688_100306933 320
268 3300025908 Ga0207643_10142162 Ga0207643_101421621 320
269 3300025915 Ga0207693_10140956 Ga0207693_101409562 320
270 3300025927 Ga0207687_10274042 Ga0207687_102740422 320
271 3300025928 Ga0207700_10119208 Ga0207700_101192082 320
272 3300025932 Ga0207690_10257544 Ga0207690_102575442 320
273 3300025936 Ga0207670_10368777 Ga0207670_103687771 320
274 3300026067 Ga0207678_10124754 Ga0207678_101247542 320
275 3300026075 Ga0207708_10155506 Ga0207708_101555062 320
276 3300028379 Ga0268266_10364858 Ga0268266_103648582 320
277 3300044694 Ga0466963_0140320 Ga0466963_0140320_13_981 320
278 3300045976 Ga0466967_0168385 Ga0466967_0168385_248_1216 320
279 3300046678 Ga0495599_0235241 Ga0495599_0235241_29_1096 320
280 3300048911 Ga0496108_0063912 Ga0496108_0063912_1459_2436 320
281 3300048912 Ga0496109_0072212 Ga0496109_0072212_755_1732 320
282 3300050511 nmdc:mga08y16_284172_c1 nmdc:mga08y16_284172_c1_97_1077 320
283 3300050512 nmdc:mga0n895_343739_c1 nmdc:mga0n895_343739_c1_365_1435 320
284 3300050512 nmdc:mga0n895_53056_c1 nmdc:mga0n895_53056_c1_1341_2387 320
285 3300005329 Ga0070683_100054857 Ga0070683_1000548572 321
286 3300005330 Ga0070690_100148548 Ga0070690_1001485481 321
287 3300005331 Ga0070670_100065443 Ga0070670_1000654432 321
288 3300005334 Ga0068869_100019345 Ga0068869_1000193453 321
289 3300005335 Ga0070666_10238081 Ga0070666_102380811 321
290 3300005338 Ga0068868_100119303 Ga0068868_1001193032 321
291 3300005347 Ga0070668_100019088 Ga0070668_1000190885 321
292 3300005353 Ga0070669_100114824 Ga0070669_1001148242 321
293 3300005354 Ga0070675_100039028 Ga0070675_1000390282 321
294 3300005355 Ga0070671_100156235 Ga0070671_1001562352 321
295 3300005356 Ga0070674_100182536 Ga0070674_1001825362 321
296 3300005364 Ga0070673_100197168 Ga0070673_1001971681 321
297 3300005366 Ga0070659_100039455 Ga0070659_1000394553 321
298 3300005455 Ga0070663_100034948 Ga0070663_1000349482 321
299 3300005457 Ga0070662_100046033 Ga0070662_1000460332 321
300 3300005466 Ga0070685_10015905 Ga0070685_100159052 321
301 3300005466 Ga0070685_10064927 Ga0070685_100649272 321
302 3300005535 Ga0070684_100159388 Ga0070684_1001593882 321
303 3300005543 Ga0070672_100171136 Ga0070672_1001711362 321
304 3300005564 Ga0070664_100073571 Ga0070664_1000735712 321
305 3300005578 Ga0068854_100043970 Ga0068854_1000439703 321
306 3300005616 Ga0068852_100015035 Ga0068852_1000150358 321
307 3300005617 Ga0068859_100233854 Ga0068859_1002338542 321
308 3300005618 Ga0068864_100138350 Ga0068864_1001383502 321
309 3300005842 Ga0068858_100051466 Ga0068858_1000514663 321
310 3300005844 Ga0068862_100053879 Ga0068862_1000538793 321
311 3300006844 Ga0075428_100000006 Ga0075428_10000000629 321
312 3300006931 Ga0097620_100233858 Ga0097620_1002338582 321
313 3300009094 Ga0111539_10058886 Ga0111539_100588862 321
314 3300009101 Ga0105247_10057860 Ga0105247_100578602 321
315 3300009148 Ga0105243_10192998 Ga0105243_101929982 321
316 3300009545 Ga0105237_10038697 Ga0105237_100386972 321
317 3300013296 Ga0157374_10119354 Ga0157374_101193542 321
318 3300013306 Ga0163162_10118115 Ga0163162_101181152 321
319 3300013307 Ga0157372_10331052 Ga0157372_103310522 321
320 3300013308 Ga0157375_10110925 Ga0157375_101109254 321
321 3300014325 Ga0163163_10490122 Ga0163163_104901221 321
322 3300014968 Ga0157379_10052116 Ga0157379_100521164 321
323 3300021384 Ga0213876_10025033 Ga0213876_100250332 321
324 3300025900 Ga0207710_10008820 Ga0207710_100088207 321
325 3300025901 Ga0207688_10030605 Ga0207688_100306052 321
326 3300025901 Ga0207688_10049544 Ga0207688_100495441 321
327 3300025904 Ga0207647_10106216 Ga0207647_101062162 321
328 3300025908 Ga0207643_10181117 Ga0207643_101811171 321
329 3300025909 Ga0207705_10195211 Ga0207705_101952112 321
330 3300025919 Ga0207657_10042914 Ga0207657_100429143 321
331 3300025923 Ga0207681_10203370 Ga0207681_102033702 321
332 3300025925 Ga0207650_10061064 Ga0207650_100610642 321
333 3300025933 Ga0207706_10036934 Ga0207706_100369344 321
334 3300025935 Ga0207709_10071177 Ga0207709_100711772 321
335 3300025940 Ga0207691_10052809 Ga0207691_100528093 321
336 3300025942 Ga0207689_10065141 Ga0207689_100651412 321
337 3300025972 Ga0207668_10029215 Ga0207668_100292153 321
338 3300025981 Ga0207640_10123878 Ga0207640_101238782 321
339 3300026067 Ga0207678_10045539 Ga0207678_100455392 321
340 3300026067 Ga0207678_10078837 Ga0207678_100788372 321
341 3300026075 Ga0207708_10030437 Ga0207708_100304376 321
342 3300026089 Ga0207648_10044613 Ga0207648_100446134 321
343 3300026118 Ga0207675_100069866 Ga0207675_1000698662 321
344 3300026121 Ga0207683_10052998 Ga0207683_100529983 321
345 3300027907 Ga0207428_10238015 Ga0207428_102380152 321
346 3300031824 Ga0307413_10028882 Ga0307413_100288823 321
347 3300032005 Ga0307411_10174750 Ga0307411_101747502 321
348 3300039437 Ga0436365_1763233 Ga0436365_1763233_2437_3408 321
349 3300044684 Ga0466966_0041819 Ga0466966_0041819_698_1663 321
350 3300044694 Ga0466963_0243266 Ga0466963_0243266_15_1004 321
351 3300044765 Ga0466970_0068404 Ga0466970_0068404_104_1093 321
352 3300044842 Ga0466957_0140776 Ga0466957_0140776_216_1205 321
353 3300044901 Ga0466960_0067955 Ga0466960_0067955_651_1640 321
354 3300045049 Ga0466959_0160212 Ga0466959_0160212_300_1265 321
355 3300045976 Ga0466967_0058535 Ga0466967_0058535_1788_2777 321
356 3300046516 Ga0495628_0074588 Ga0495628_0074588_1123_2091 321
357 3300048088 Ga0495602_0229833 Ga0495602_0229833_14_1060 321
358 3300048903 Ga0496100_0115773 Ga0496100_0115773_225_1196 321
359 3300048909 Ga0496106_0279793 Ga0496106_0279793_208_1179 321
360 3300048911 Ga0496108_0099244 Ga0496108_0099244_1365_2357 321
361 3300048911 Ga0496108_0246669 Ga0496108_0246669_131_1102 321
362 3300050511 nmdc:mga08y16_224495_c1 nmdc:mga08y16_224495_c1_170_1141 321
363 3300005468 Ga0070707_100362920 Ga0070707_1003629202 322
364 3300039437 Ga0436365_1284536 Ga0436365_1284536_504_1472 322
365 3300039437 Ga0436365_1434212 Ga0436365_1434212_2681_3649 322
366 3300046471 Ga0495650_0050918 Ga0495650_0050918_37_1017 322
367 iso_pu_bacteria 2996221748 2996227357 322
368 iso_pu_bacteria 8055157932 8055160796 322
369 3300003659 JGI25404J52841_10014316 JGI25404J52841_100143162 323
370 3300005329 Ga0070683_100389592 Ga0070683_1003895921 323
371 3300005330 Ga0070690_100058556 Ga0070690_1000585563 323
372 3300005334 Ga0068869_100106552 Ga0068869_1001065523 323
373 3300005335 Ga0070666_10025892 Ga0070666_100258925 323
374 3300005336 Ga0070680_100011567 Ga0070680_1000115673 323
375 3300005338 Ga0068868_100262683 Ga0068868_1002626832 323
376 3300005340 Ga0070689_100020282 Ga0070689_1000202824 323
377 3300005344 Ga0070661_100083340 Ga0070661_1000833403 323
378 3300005347 Ga0070668_100129291 Ga0070668_1001292912 323
379 3300005355 Ga0070671_100180201 Ga0070671_1001802012 323
380 3300005356 Ga0070674_100152178 Ga0070674_1001521782 323
381 3300005364 Ga0070673_100026254 Ga0070673_1000262545 323
382 3300005365 Ga0070688_100034873 Ga0070688_1000348731 323
383 3300005434 Ga0070709_10026945 Ga0070709_100269453 323
384 3300005434 Ga0070709_10133540 Ga0070709_101335402 323
385 3300005435 Ga0070714_100062696 Ga0070714_1000626961 323
386 3300005435 Ga0070714_100274580 Ga0070714_1002745801 323
387 3300005436 Ga0070713_100082165 Ga0070713_1000821652 323
388 3300005436 Ga0070713_100226420 Ga0070713_1002264202 323
389 3300005437 Ga0070710_10028861 Ga0070710_100288614 323
390 3300005437 Ga0070710_10068837 Ga0070710_100688371 323
391 3300005437 Ga0070710_10122688 Ga0070710_101226881 323
392 3300005439 Ga0070711_100034966 Ga0070711_1000349664 323
393 3300005445 Ga0070708_100033029 Ga0070708_1000330293 323
394 3300005445 Ga0070708_100217362 Ga0070708_1002173622 323
395 3300005455 Ga0070663_100129676 Ga0070663_1001296762 323
396 3300005458 Ga0070681_10285530 Ga0070681_102855302 323
397 3300005466 Ga0070685_10027294 Ga0070685_100272942 323
398 3300005467 Ga0070706_100000304 Ga0070706_10000030427 323
399 3300005467 Ga0070706_100001944 Ga0070706_1000019449 323
400 3300005467 Ga0070706_100014928 Ga0070706_1000149287 323
401 3300005467 Ga0070706_100025734 Ga0070706_1000257344 323
402 3300005468 Ga0070707_100007741 Ga0070707_1000077417 323
403 3300005468 Ga0070707_100073623 Ga0070707_1000736232 323
404 3300005468 Ga0070707_100136364 Ga0070707_1001363643 323
405 3300005468 Ga0070707_100138827 Ga0070707_1001388272 323
406 3300005471 Ga0070698_100009462 Ga0070698_1000094628 323
407 3300005471 Ga0070698_100024159 Ga0070698_1000241594 323
408 3300005471 Ga0070698_100030237 Ga0070698_1000302374 323
409 3300005471 Ga0070698_100051342 Ga0070698_1000513424 323
410 3300005471 Ga0070698_100428454 Ga0070698_1004284541 323
411 3300005518 Ga0070699_100006444 Ga0070699_1000064445 323
412 3300005518 Ga0070699_100058356 Ga0070699_1000583562 323
413 3300005530 Ga0070679_100094804 Ga0070679_1000948044 323
414 3300005539 Ga0068853_100052780 Ga0068853_1000527804 323
415 3300005544 Ga0070686_100004561 Ga0070686_1000045615 323
416 3300005545 Ga0070695_100227929 Ga0070695_1002279291 323
417 3300005564 Ga0070664_100042165 Ga0070664_1000421655 323
418 3300005577 Ga0068857_100102439 Ga0068857_1001024393 323
419 3300005614 Ga0068856_100005337 Ga0068856_10000533712 323
420 3300005615 Ga0070702_100065487 Ga0070702_1000654872 323
421 3300005617 Ga0068859_100131592 Ga0068859_1001315923 323
422 3300005719 Ga0068861_100197437 Ga0068861_1001974372 323
423 3300005719 Ga0068861_100278119 Ga0068861_1002781192 323
424 3300005834 Ga0068851_10034145 Ga0068851_100341453 323
425 3300005842 Ga0068858_100135762 Ga0068858_1001357622 323
426 3300005983 Ga0081540_1003217 Ga0081540_10032176 323
427 3300005983 Ga0081540_1027577 Ga0081540_10275773 323
428 3300005983 Ga0081540_1098164 Ga0081540_10981641 323
429 3300006028 Ga0070717_10000957 Ga0070717_1000095713 323
430 3300006028 Ga0070717_10169117 Ga0070717_101691172 323
431 3300006163 Ga0070715_10036415 Ga0070715_100364152 323
432 3300006173 Ga0070716_100003216 Ga0070716_1000032164 323
433 3300006173 Ga0070716_100055349 Ga0070716_1000553493 323
434 3300006173 Ga0070716_100101853 Ga0070716_1001018532 323
435 3300006175 Ga0070712_100054704 Ga0070712_1000547044 323
436 3300006844 Ga0075428_100400953 Ga0075428_1004009532 323
437 3300006852 Ga0075433_10132296 Ga0075433_101322962 323
438 3300006852 Ga0075433_10171303 Ga0075433_101713032 323
439 3300006871 Ga0075434_100008309 Ga0075434_1000083097 323
440 3300006914 Ga0075436_100042128 Ga0075436_1000421284 323
441 3300006914 Ga0075436_100098745 Ga0075436_1000987453 323
442 3300006914 Ga0075436_100114690 Ga0075436_1001146902 323
443 3300006931 Ga0097620_100131585 Ga0097620_1001315853 323
444 3300007076 Ga0075435_100003093 Ga0075435_10000309312 323
445 3300007076 Ga0075435_100022570 Ga0075435_1000225706 323
446 3300007076 Ga0075435_100074672 Ga0075435_1000746723 323
447 3300009093 Ga0105240_10246813 Ga0105240_102468133 323
448 3300009101 Ga0105247_10000653 Ga0105247_100006538 323
449 3300009147 Ga0114129_10001706 Ga0114129_100017068 323
450 3300009147 Ga0114129_10216275 Ga0114129_102162752 323
451 3300009174 Ga0105241_10194998 Ga0105241_101949982 323
452 3300009177 Ga0105248_10002051 Ga0105248_100020515 323
453 3300009177 Ga0105248_10199453 Ga0105248_101994532 323
454 3300009177 Ga0105248_10262019 Ga0105248_102620192 323
455 3300009545 Ga0105237_10110865 Ga0105237_101108651 323
456 3300009551 Ga0105238_10164015 Ga0105238_101640153 323
457 3300009553 Ga0105249_10129973 Ga0105249_101299733 323
458 3300012473 Ga0157340_1001763 Ga0157340_10017631 323
459 3300012488 Ga0157343_1000704 Ga0157343_10007042 323
460 3300012507 Ga0157342_1000128 Ga0157342_10001284 323
461 3300013100 Ga0157373_10188795 Ga0157373_101887952 323
462 3300013102 Ga0157371_10031125 Ga0157371_100311254 323
463 3300013297 Ga0157378_10118292 Ga0157378_101182923 323
464 3300013308 Ga0157375_10306487 Ga0157375_103064872 323
465 3300014325 Ga0163163_10036129 Ga0163163_100361292 323
466 3300014745 Ga0157377_10052086 Ga0157377_100520862 323
467 3300014968 Ga0157379_10090891 Ga0157379_100908912 323
468 3300017792 Ga0163161_10048989 Ga0163161_100489894 323
469 3300020069 Ga0197907_10234494 Ga0197907_102344942 323
470 3300020069 Ga0197907_10862487 Ga0197907_108624872 323
471 3300020070 Ga0206356_11175517 Ga0206356_111755172 323
472 3300020076 Ga0206355_1300986 Ga0206355_13009861 323
473 3300020080 Ga0206350_11006390 Ga0206350_110063901 323
474 3300022467 Ga0224712_10037192 Ga0224712_100371922 323
475 3300022467 Ga0224712_10043681 Ga0224712_100436811 323
476 3300024225 Ga0224572_1004440 Ga0224572_10044402 323
477 3300025321 Ga0207656_10026789 Ga0207656_100267893 323
478 3300025885 Ga0207653_10006120 Ga0207653_100061204 323
479 3300025898 Ga0207692_10032663 Ga0207692_100326633 323
480 3300025898 Ga0207692_10141376 Ga0207692_101413762 323
481 3300025900 Ga0207710_10000427 Ga0207710_100004278 323
482 3300025901 Ga0207688_10004929 Ga0207688_100049292 323
483 3300025905 Ga0207685_10002433 Ga0207685_100024334 323
484 3300025906 Ga0207699_10015551 Ga0207699_100155515 323
485 3300025906 Ga0207699_10016061 Ga0207699_100160611 323
486 3300025906 Ga0207699_10028211 Ga0207699_100282113 323
487 3300025906 Ga0207699_10111121 Ga0207699_101111212 323
488 3300025906 Ga0207699_10187716 Ga0207699_101877162 323
489 3300025908 Ga0207643_10024555 Ga0207643_100245551 323
490 3300025910 Ga0207684_10035311 Ga0207684_100353114 323
491 3300025910 Ga0207684_10061221 Ga0207684_100612212 323
492 3300025910 Ga0207684_10127084 Ga0207684_101270842 323
493 3300025910 Ga0207684_10354144 Ga0207684_103541441 323
494 3300025915 Ga0207693_10015973 Ga0207693_100159735 323
495 3300025915 Ga0207693_10064440 Ga0207693_100644402 323
496 3300025915 Ga0207693_10114512 Ga0207693_101145122 323
497 3300025916 Ga0207663_10084094 Ga0207663_100840943 323
498 3300025916 Ga0207663_10091482 Ga0207663_100914822 323
499 3300025916 Ga0207663_10146629 Ga0207663_101466291 323
500 3300025918 Ga0207662_10005260 Ga0207662_100052604 323
501 3300025919 Ga0207657_10010213 Ga0207657_100102136 323
502 3300025922 Ga0207646_10011465 Ga0207646_100114656 323
503 3300025922 Ga0207646_10054928 Ga0207646_100549281 323
504 3300025922 Ga0207646_10072294 Ga0207646_100722942 323
505 3300025922 Ga0207646_10119409 Ga0207646_101194092 323
506 3300025924 Ga0207694_10173720 Ga0207694_101737201 323
507 3300025928 Ga0207700_10074764 Ga0207700_100747642 323
508 3300025928 Ga0207700_10120314 Ga0207700_101203141 323
509 3300025928 Ga0207700_10145907 Ga0207700_101459072 323
510 3300025929 Ga0207664_10014557 Ga0207664_100145572 323
511 3300025929 Ga0207664_10186580 Ga0207664_101865802 323
512 3300025929 Ga0207664_10191406 Ga0207664_101914062 323
513 3300025929 Ga0207664_10210754 Ga0207664_102107542 323
514 3300025931 Ga0207644_10089250 Ga0207644_100892503 323
515 3300025931 Ga0207644_10145591 Ga0207644_101455912 323
516 3300025933 Ga0207706_10071616 Ga0207706_100716162 323
517 3300025934 Ga0207686_10024646 Ga0207686_100246464 323
518 3300025938 Ga0207704_10038422 Ga0207704_100384224 323
519 3300025939 Ga0207665_10007909 Ga0207665_100079095 323
520 3300025939 Ga0207665_10008012 Ga0207665_100080128 323
521 3300025939 Ga0207665_10011477 Ga0207665_100114774 323
522 3300025939 Ga0207665_10013277 Ga0207665_100132776 323
523 3300025939 Ga0207665_10177369 Ga0207665_101773691 323
524 3300025940 Ga0207691_10038381 Ga0207691_100383814 323
525 3300025941 Ga0207711_10012631 Ga0207711_100126314 323
526 3300025941 Ga0207711_10265108 Ga0207711_102651081 323
527 3300025942 Ga0207689_10013895 Ga0207689_100138956 323
528 3300026067 Ga0207678_10013076 Ga0207678_100130767 323
529 3300026075 Ga0207708_10052090 Ga0207708_100520904 323
530 3300026088 Ga0207641_10081544 Ga0207641_100815443 323
531 3300026088 Ga0207641_10111024 Ga0207641_101110242 323
532 3300026095 Ga0207676_10233246 Ga0207676_102332461 323
533 3300026095 Ga0207676_10322364 Ga0207676_103223641 323
534 3300026116 Ga0207674_10019026 Ga0207674_100190265 323
535 3300026118 Ga0207675_100025028 Ga0207675_1000250286 323
536 3300026118 Ga0207675_100357494 Ga0207675_1003574942 323
537 3300026121 Ga0207683_10014371 Ga0207683_100143714 323
538 3300026121 Ga0207683_10081019 Ga0207683_100810194 323
539 3300028380 Ga0268265_10182176 Ga0268265_101821762 323
540 3300034816 Ga0373930_0009124 Ga0373930_0009124_209_1180 323
541 3300034816 Ga0373930_0012284 Ga0373930_0012284_298_1269 323
542 3300034818 Ga0373950_0009047 Ga0373950_0009047_488_1459 323
543 3300034819 Ga0373958_0008127 Ga0373958_0008127_173_1144 323
544 3300035083 Ga0373926_0002888 Ga0373926_0002888_2040_3011 323
545 3300035084 Ga0373928_0013853 Ga0373928_0013853_172_1143 323
546 3300035085 Ga0373929_0008200 Ga0373929_0008200_941_1912 323
547 3300035086 Ga0373934_0096560 Ga0373934_0096560_171_1142 323
548 3300035088 Ga0373940_0007051 Ga0373940_0007051_951_1922 323
549 3300035089 Ga0373944_0000349 Ga0373944_0000349_2415_3386 323
550 3300035090 Ga0373949_0018718 Ga0373949_0018718_287_1258 323
551 3300035091 Ga0373951_0007194 Ga0373951_0007194_122_1093 323
552 3300035111 Ga0373923_0002644 Ga0373923_0002644_750_1721 323
553 3300035111 Ga0373923_0035992 Ga0373923_0035992_911_1882 323
554 3300035111 Ga0373923_0044907 Ga0373923_0044907_691_1662 323
555 3300035112 Ga0373932_0031955 Ga0373932_0031955_411_1382 323
556 3300035113 Ga0373936_0001068 Ga0373936_0001068_4795_5766 323
557 3300035113 Ga0373936_0002061 Ga0373936_0002061_2334_3305 323
558 3300035113 Ga0373936_0019841 Ga0373936_0019841_1571_2542 323
559 3300035115 Ga0373941_0021056 Ga0373941_0021056_782_1753 323
560 3300035116 Ga0373945_0015334 Ga0373945_0015334_476_1447 323
561 3300035116 Ga0373945_0032384 Ga0373945_0032384_120_1097 323
562 3300035118 Ga0373954_0013444 Ga0373954_0013444_1825_2796 323
563 3300035118 Ga0373954_0036710 Ga0373954_0036710_778_1749 323
564 3300035118 Ga0373954_0129349 Ga0373954_0129349_235_1206 323
565 3300035119 Ga0373956_0005179 Ga0373956_0005179_1101_2072 323
566 3300035119 Ga0373956_0005238 Ga0373956_0005238_2006_2977 323
567 3300035119 Ga0373956_0029995 Ga0373956_0029995_821_1792 323
568 3300035120 Ga0373957_0011856 Ga0373957_0011856_923_1894 323
569 3300035121 Ga0373960_0003322 Ga0373960_0003322_1823_2794 323
570 3300035170 Ga0373943_0145201 Ga0373943_0145201_209_1180 323
571 3300035171 Ga0373946_0005982 Ga0373946_0005982_3140_4111 323
572 3300035172 Ga0373955_0003650 Ga0373955_0003650_1414_2385 323
573 3300035172 Ga0373955_0019498 Ga0373955_0019498_2183_3154 323
574 3300035172 Ga0373955_0079252 Ga0373955_0079252_501_1472 323
575 3300035241 Ga0373961_0050359 Ga0373961_0050359_42_1013 323
576 3300035410 Ga0373924_0001226 Ga0373924_0001226_2083_3054 323
577 3300035410 Ga0373924_0002268 Ga0373924_0002268_2162_3133 323
578 3300035410 Ga0373924_0068951 Ga0373924_0068951_465_1436 323
579 3300035691 Ga0373931_0052813 Ga0373931_0052813_577_1548 323
580 3300035691 Ga0373931_0139516 Ga0373931_0139516_60_1031 323
581 3300035692 Ga0373935_0030952 Ga0373935_0030952_222_1193 323
582 3300035692 Ga0373935_0033784 Ga0373935_0033784_2172_3143 323
583 3300035692 Ga0373935_0149137 Ga0373935_0149137_440_1411 323
584 3300035695 Ga0373927_0021392 Ga0373927_0021392_2354_3325 323
585 3300035695 Ga0373927_0053558 Ga0373927_0053558_1115_2086 323
586 3300035724 Ga0373933_0004173 Ga0373933_0004173_5305_6276 323
587 3300035724 Ga0373933_0088685 Ga0373933_0088685_208_1179 323
588 3300035724 Ga0373933_0090983 Ga0373933_0090983_872_1843 323
589 3300035724 Ga0373933_0105029 Ga0373933_0105029_709_1680 323
590 3300035725 Ga0373947_0004111 Ga0373947_0004111_5142_6113 323
591 3300035725 Ga0373947_0043076 Ga0373947_0043076_117_1088 323
592 3300035725 Ga0373947_0043587 Ga0373947_0043587_1166_2137 323
593 3300035725 Ga0373947_0044624 Ga0373947_0044624_291_1262 323
594 3300036401 Ga0373937_0010502 Ga0373937_0010502_3536_4507 323
595 3300036401 Ga0373937_0020026 Ga0373937_0020026_4389_5360 323
596 3300036401 Ga0373937_0089479 Ga0373937_0089479_1800_2771 323
597 3300036401 Ga0373937_0188091 Ga0373937_0188091_857_1828 323
598 3300037068 Ga0373925_0002044 Ga0373925_0002044_13137_14108 323
599 3300037068 Ga0373925_0022145 Ga0373925_0022145_343_1314 323
600 3300037068 Ga0373925_0051372 Ga0373925_0051372_1875_2846 323
601 3300037853 Ga0436364_1223233 Ga0436364_1223233_31055_32044 323
602 3300037853 Ga0436364_1508755 Ga0436364_1508755_316_1287 323
603 3300046454 Ga0495592_0029712 Ga0495592_0029712_2869_3840 323
604 3300046454 Ga0495592_0041720 Ga0495592_0041720_1807_2778 323
605 3300046454 Ga0495592_0068761 Ga0495592_0068761_182_1153 323
606 3300046455 Ga0495603_0018166 Ga0495603_0018166_2864_3835 323
607 3300046459 Ga0495629_0001817 Ga0495629_0001817_8326_9297 323
608 3300046459 Ga0495629_0002479 Ga0495629_0002479_7912_8883 323
609 3300046461 Ga0495641_0004811 Ga0495641_0004811_4942_5913 323
610 3300046461 Ga0495641_0009894 Ga0495641_0009894_751_1722 323
611 3300046461 Ga0495641_0022070 Ga0495641_0022070_1208_2179 323
612 3300046461 Ga0495641_0036940 Ga0495641_0036940_383_1354 323
613 3300046462 Ga0495651_0001835 Ga0495651_0001835_1979_2950 323
614 3300046462 Ga0495651_0009665 Ga0495651_0009665_2658_3629 323
615 3300046462 Ga0495651_0025398 Ga0495651_0025398_409_1380 323
616 3300046462 Ga0495651_0073989 Ga0495651_0073989_1193_2164 323
617 3300046462 Ga0495651_0128320 Ga0495651_0128320_528_1499 323
618 3300046463 Ga0495653_0010666 Ga0495653_0010666_844_1815 323
619 3300046463 Ga0495653_0041530 Ga0495653_0041530_1187_2158 323
620 3300046463 Ga0495653_0080141 Ga0495653_0080141_470_1441 323
621 3300046472 Ga0495580_0003452 Ga0495580_0003452_4832_5803 323
622 3300046472 Ga0495580_0012452 Ga0495580_0012452_653_1624 323
623 3300046473 Ga0495582_0007220 Ga0495582_0007220_3742_4713 323
624 3300046473 Ga0495582_0029206 Ga0495582_0029206_902_1873 323
625 3300046475 Ga0495639_0001194 Ga0495639_0001194_3353_4324 323
626 3300046475 Ga0495639_0036443 Ga0495639_0036443_756_1727 323
627 3300046476 Ga0495662_0000398 Ga0495662_0000398_10910_11881 323
628 3300046476 Ga0495662_0050165 Ga0495662_0050165_210_1181 323
629 3300046477 Ga0495664_0143157 Ga0495664_0143157_188_1159 323
630 3300046477 Ga0495664_0201046 Ga0495664_0201046_148_1128 323
631 3300046499 Ga0495594_0059990 Ga0495594_0059990_428_1399 323
632 3300046511 Ga0495608_0001781 Ga0495608_0001781_13325_14296 323
633 3300046511 Ga0495608_0040793 Ga0495608_0040793_552_1523 323
634 3300046511 Ga0495608_0051155 Ga0495608_0051155_913_1884 323
635 3300046511 Ga0495608_0063909 Ga0495608_0063909_584_1555 323
636 3300046514 Ga0495618_0010066 Ga0495618_0010066_2253_3224 323
637 3300046514 Ga0495618_0026716 Ga0495618_0026716_2361_3332 323
638 3300046514 Ga0495618_0038593 Ga0495618_0038593_1807_2778 323
639 3300046514 Ga0495618_0128046 Ga0495618_0128046_529_1500 323
640 3300046514 Ga0495618_0134190 Ga0495618_0134190_165_1136 323
641 3300046516 Ga0495628_0023071 Ga0495628_0023071_792_1763 323
642 3300046516 Ga0495628_0034053 Ga0495628_0034053_352_1323 323
643 3300046516 Ga0495628_0117409 Ga0495628_0117409_746_1717 323
644 3300046517 Ga0495630_0003733 Ga0495630_0003733_6067_7038 323
645 3300046517 Ga0495630_0010026 Ga0495630_0010026_3729_4700 323
646 3300046517 Ga0495630_0023818 Ga0495630_0023818_2311_3282 323
647 3300046526 Ga0495666_0000939 Ga0495666_0000939_12336_13307 323
648 3300046526 Ga0495666_0016616 Ga0495666_0016616_1869_2840 323
649 3300046529 Ga0495652_0011993 Ga0495652_0011993_3424_4395 323
650 3300046529 Ga0495652_0029193 Ga0495652_0029193_2443_3414 323
651 3300046531 Ga0495665_0002626 Ga0495665_0002626_5460_6431 323
652 3300046531 Ga0495665_0004314 Ga0495665_0004314_1222_2193 323
653 3300046531 Ga0495665_0004598 Ga0495665_0004598_2227_3198 323
654 3300046531 Ga0495665_0033780 Ga0495665_0033780_1235_2206 323
655 3300046533 Ga0495640_0025492 Ga0495640_0025492_1458_2429 323
656 3300046533 Ga0495640_0028266 Ga0495640_0028266_756_1727 323
657 3300046533 Ga0495640_0033054 Ga0495640_0033054_2125_3096 323
658 3300046533 Ga0495640_0074594 Ga0495640_0074594_455_1426 323
659 3300046535 Ga0495586_0008699 Ga0495586_0008699_1697_2668 323
660 3300046535 Ga0495586_0014824 Ga0495586_0014824_2520_3491 323
661 3300046535 Ga0495586_0018638 Ga0495586_0018638_2679_3650 323
662 3300046536 Ga0495587_0003044 Ga0495587_0003044_9994_10965 323
663 3300046536 Ga0495587_0017474 Ga0495587_0017474_3115_4086 323
664 3300046536 Ga0495587_0055643 Ga0495587_0055643_608_1579 323
665 3300046543 Ga0495645_0008023 Ga0495645_0008023_2849_3820 323
666 3300046543 Ga0495645_0010953 Ga0495645_0010953_4311_5282 323
667 3300046543 Ga0495645_0069753 Ga0495645_0069753_1191_2162 323
668 3300046559 Ga0495667_0003213 Ga0495667_0003213_590_1561 323
669 3300046559 Ga0495667_0008153 Ga0495667_0008153_4930_5901 323
670 3300046559 Ga0495667_0019737 Ga0495667_0019737_2443_3414 323
671 3300046559 Ga0495667_0065057 Ga0495667_0065057_335_1306 323
672 3300046642 Ga0495634_0005420 Ga0495634_0005420_4601_5572 323
673 3300046642 Ga0495634_0014722 Ga0495634_0014722_4367_5338 323
674 3300046663 Ga0495635_0006037 Ga0495635_0006037_822_1793 323
675 3300046663 Ga0495635_0031178 Ga0495635_0031178_1977_2948 323
676 3300046663 Ga0495635_0036304 Ga0495635_0036304_889_1860 323
677 3300046663 Ga0495635_0191623 Ga0495635_0191623_147_1118 323
678 3300046675 Ga0495657_0006495 Ga0495657_0006495_3340_4311 323
679 3300046675 Ga0495657_0007455 Ga0495657_0007455_5468_6439 323
680 3300046675 Ga0495657_0017348 Ga0495657_0017348_2825_3796 323
681 3300046675 Ga0495657_0046655 Ga0495657_0046655_1027_1998 323
682 3300046675 Ga0495657_0141935 Ga0495657_0141935_76_1047 323
683 3300046678 Ga0495599_0014227 Ga0495599_0014227_2895_3866 323
684 3300046678 Ga0495599_0026352 Ga0495599_0026352_352_1323 323
685 3300046678 Ga0495599_0095464 Ga0495599_0095464_528_1499 323
686 3300046678 Ga0495599_0122805 Ga0495599_0122805_624_1595 323
687 3300046678 Ga0495599_0248122 Ga0495599_0248122_103_1074 323
688 3300046679 Ga0495623_0007854 Ga0495623_0007854_4144_5115 323
689 3300046679 Ga0495623_0010798 Ga0495623_0010798_4320_5291 323
690 3300046680 Ga0495646_0004595 Ga0495646_0004595_2077_3048 323
691 3300046680 Ga0495646_0082479 Ga0495646_0082479_84_1055 323
692 3300046680 Ga0495646_0122619 Ga0495646_0122619_468_1439 323
693 3300046681 Ga0495647_0004707 Ga0495647_0004707_2064_3035 323
694 3300046683 Ga0495658_0001230 Ga0495658_0001230_6825_7796 323
695 3300046683 Ga0495658_0003103 Ga0495658_0003103_7030_8001 323
696 3300046683 Ga0495658_0009091 Ga0495658_0009091_930_1901 323
697 3300046689 Ga0495613_0018718 Ga0495613_0018718_4129_5100 323
698 3300046689 Ga0495613_0018898 Ga0495613_0018898_715_1686 323
699 3300046690 Ga0495624_0012799 Ga0495624_0012799_2496_3467 323
700 3300046690 Ga0495624_0021657 Ga0495624_0021657_2204_3175 323
701 3300046690 Ga0495624_0038097 Ga0495624_0038097_1129_2100 323
702 3300046690 Ga0495624_0070078 Ga0495624_0070078_567_1538 323
703 3300046809 Ga0495600_0002019 Ga0495600_0002019_9967_10938 323
704 3300046809 Ga0495600_0009486 Ga0495600_0009486_4174_5145 323
705 3300046809 Ga0495600_0020118 Ga0495600_0020118_2183_3154 323
706 3300046809 Ga0495600_0028588 Ga0495600_0028588_352_1323 323
707 3300046809 Ga0495600_0084737 Ga0495600_0084737_750_1721 323
708 3300046809 Ga0495600_0235223 Ga0495600_0235223_60_1031 323
709 3300047315 Ga0495581_0002552 Ga0495581_0002552_2401_3372 323
710 3300047315 Ga0495581_0003056 Ga0495581_0003056_6865_7836 323
711 3300047315 Ga0495581_0004566 Ga0495581_0004566_3583_4554 323
712 3300047315 Ga0495581_0008812 Ga0495581_0008812_1290_2261 323
713 3300047317 Ga0495604_0002188 Ga0495604_0002188_11229_12200 323
714 3300047317 Ga0495604_0008319 Ga0495604_0008319_3839_4810 323
715 3300047317 Ga0495604_0010113 Ga0495604_0010113_3456_4427 323
716 3300047317 Ga0495604_0064366 Ga0495604_0064366_1586_2557 323
717 3300047317 Ga0495604_0110212 Ga0495604_0110212_419_1390 323
718 3300047319 Ga0495674_0013056 Ga0495674_0013056_1516_2487 323
719 3300047319 Ga0495674_0036791 Ga0495674_0036791_110_1081 323
720 3300047319 Ga0495674_0048295 Ga0495674_0048295_2308_3279 323
721 3300047319 Ga0495674_0051728 Ga0495674_0051728_822_1793 323
722 3300047321 Ga0495676_0011421 Ga0495676_0011421_301_1272 323
723 3300047322 Ga0495680_0001141 Ga0495680_0001141_15911_16882 323
724 3300047322 Ga0495680_0010102 Ga0495680_0010102_3598_4569 323
725 3300047322 Ga0495680_0038937 Ga0495680_0038937_2090_3061 323
726 3300047322 Ga0495680_0048420 Ga0495680_0048420_1807_2778 323
727 3300047322 Ga0495680_0238994 Ga0495680_0238994_19_990 323
728 3300047444 Ga0495675_0039220 Ga0495675_0039220_1695_2666 323
729 3300047471 Ga0495684_0006104 Ga0495684_0006104_4629_5600 323
730 3300047471 Ga0495684_0010060 Ga0495684_0010060_2549_3520 323
731 3300047471 Ga0495684_0020457 Ga0495684_0020457_1976_2947 323
732 3300047471 Ga0495684_0058809 Ga0495684_0058809_1135_2106 323
733 3300047471 Ga0495684_0073968 Ga0495684_0073968_862_1833 323
734 3300047471 Ga0495684_0188075 Ga0495684_0188075_94_1065 323
735 3300047673 Ga0495593_0004694 Ga0495593_0004694_1235_2206 323
736 3300047673 Ga0495593_0008869 Ga0495593_0008869_4047_5018 323
737 3300047673 Ga0495593_0052120 Ga0495593_0052120_1121_2092 323
738 3300048088 Ga0495602_0034111 Ga0495602_0034111_561_1532 323
739 3300048088 Ga0495602_0065731 Ga0495602_0065731_352_1323 323
740 3300048088 Ga0495602_0098847 Ga0495602_0098847_807_1778 323
741 3300048088 Ga0495602_0212290 Ga0495602_0212290_366_1337 323
742 3300048089 Ga0495614_0022151 Ga0495614_0022151_1719_2690 323
743 3300048903 Ga0496100_0100777 Ga0496100_0100777_599_1570 323
744 3300048904 Ga0496101_0088556 Ga0496101_0088556_416_1387 323
745 3300048904 Ga0496101_0091124 Ga0496101_0091124_1008_1979 323
746 3300048904 Ga0496101_0127464 Ga0496101_0127464_275_1246 323
747 3300048905 Ga0496102_0147343 Ga0496102_0147343_1049_2020 323
748 3300048906 Ga0496103_0068858 Ga0496103_0068858_666_1637 323
749 3300048907 Ga0496104_0001309 Ga0496104_0001309_15339_16310 323
750 3300048909 Ga0496106_0012056 Ga0496106_0012056_2455_3426 323
751 3300048910 Ga0496107_0091730 Ga0496107_0091730_1129_2100 323
752 3300048911 Ga0496108_0042972 Ga0496108_0042972_2751_3722 323
753 3300048912 Ga0496109_0028955 Ga0496109_0028955_2882_3853 323
754 3300048912 Ga0496109_0082139 Ga0496109_0082139_1128_2099 323
755 3300048913 Ga0496110_0064629 Ga0496110_0064629_764_1735 323
756 3300048913 Ga0496110_0120957 Ga0496110_0120957_79_1050 323
757 3300048914 Ga0496111_0038261 Ga0496111_0038261_290_1261 323
758 3300048915 Ga0496112_0018864 Ga0496112_0018864_111_1082 323
759 3300048915 Ga0496112_0032245 Ga0496112_0032245_2180_3151 323
760 3300048916 Ga0496113_0023422 Ga0496113_0023422_2071_3042 323
761 3300048917 Ga0496114_0008833 Ga0496114_0008833_4838_5809 323
762 3300048918 Ga0496115_0063797 Ga0496115_0063797_1666_2637 323
763 3300048918 Ga0496115_0067725 Ga0496115_0067725_1811_2782 323
764 3300048922 Ga0496119_0001483 Ga0496119_0001483_18973_19995 323
765 3300048923 Ga0496120_0001510 Ga0496120_0001510_8144_9166 323
766 3300049578 Ga0501042_0029142 Ga0501042_0029142_559_1530 323
767 3300050507 nmdc:mga05p37_15523_c1 nmdc:mga05p37_15523_c1_785_1756 323
768 3300050512 nmdc:mga0n895_16343_c1 nmdc:mga0n895_16343_c1_4820_5791 323
769 3300050512 nmdc:mga0n895_211522_c1 nmdc:mga0n895_211522_c1_579_1550 323
770 3300050512 nmdc:mga0n895_226944_c1 nmdc:mga0n895_226944_c1_174_1145 323
771 3300050512 nmdc:mga0n895_40648_c1 nmdc:mga0n895_40648_c1_744_1715 323
772 3300050513 nmdc:mga0rr50_19140_c1 nmdc:mga0rr50_19140_c1_3340_4311 323
773 3300050513 nmdc:mga0rr50_3711_c1 nmdc:mga0rr50_3711_c1_297_1268 323
774 3300050513 nmdc:mga0rr50_38836_c1 nmdc:mga0rr50_38836_c1_1397_2368 323
775 3300050514 nmdc:mga08x19_134478_c1 nmdc:mga08x19_134478_c1_375_1346 323
776 3300050514 nmdc:mga08x19_54296_c1 nmdc:mga08x19_54296_c1_579_1550 323
777 3300050515 nmdc:mga0a205_144637_c1 nmdc:mga0a205_144637_c1_350_1321 323
778 3300050515 nmdc:mga0a205_182263_c1 nmdc:mga0a205_182263_c1_802_1773 323
779 3300050515 nmdc:mga0a205_210299_c1 nmdc:mga0a205_210299_c1_138_1109 323
780 3300050515 nmdc:mga0a205_29022_c1 nmdc:mga0a205_29022_c1_3512_4483 323
781 3300053077 Ga0495601_0011723 Ga0495601_0011723_4040_5011 323
782 3300053077 Ga0495601_0038761 Ga0495601_0038761_1828_2799 323
783 3300053077 Ga0495601_0061268 Ga0495601_0061268_1068_2093 323
784 3300053077 Ga0495601_0121297 Ga0495601_0121297_357_1328 323
785 3300053077 Ga0495601_0303107 Ga0495601_0303107_18_989 323
786 3300053078 Ga0495612_0046026 Ga0495612_0046026_356_1327 323
787 3300053078 Ga0495612_0090150 Ga0495612_0090150_280_1251 323
788 3300053078 Ga0495612_0091550 Ga0495612_0091550_45_1016 323
789 3300053084 Ga0495595_0027744 Ga0495595_0027744_271_1242 323
790 3300053085 Ga0495619_0001376 Ga0495619_0001376_7479_8450 323
791 3300053085 Ga0495619_0025529 Ga0495619_0025529_2574_3545 323
792 3300053085 Ga0495619_0051096 Ga0495619_0051096_606_1577 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

66

354

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.9133 2 301
6ky6-assembly2.cif.gz_B crystal structure of a thermostable aldo-keto reductase tm1743 in complexs with inhibitor epalrestat in space group p3221cc 0.9101 1 300
6ky6-assembly2.cif.gz_B crystal structure of a thermostable aldo-keto reductase tm1743 in complexs with inhibitor epalrestat in space group p3221cc 0.9037 1 300
3f7j-assembly2.cif.gz_B b.subtilis yvgn 0.9024 10 300
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.898 10 309
ID Description Score Start End Superfamily
af_P9WQA7_10_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9775 10 308 3.20.20.100
af_P9WQA7_10_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9679 10 308 3.20.20.100
af_Q0D8N4_49_369_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9236 2 307 3.20.20.100
af_P77256_1_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.921 1 305 3.20.20.100
af_Q7XCS4_50_365_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9196 4 304 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A536G358-F1-model_v4 Aldo/keto reductase 0.9779 3 301 GO:0016491
AF-A0A7I7P738-F1-model_v4 Putative oxidoreductase 0.9711 3 249 GO:0016491
AF-A0A535NI90-F1-model_v4 Aldo/keto reductase 0.9687 42 308 GO:0016491
AF-X8DAP4-F1-model_v4 Aldo/keto reductase family protein 0.9627 1 151 GO:0016491
AF-A0A535NI90-F1-model_v4 Aldo/keto reductase 0.9614 42 308 GO:0016491

Feature Viewer

pLDDT pTM Quality
93.91 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map