F481015
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 792 | 324 | 762 | 323 |
Family's Representative Sequence
| Representative Sequence | 3300005471|Ga0070698_100024159|Ga0070698_1000241594 |
| Length | 375 |
| Sequence | MITRGPEGELTGRRAQRMPCCEPRRPGFHLDGGPLGDPRSGESRRDGWRLGAMRYLSTVPGKQISKIGLGTWQFGSREWGYGSQYADEVAQAIVGRAVELGVTLFDTAEIYGFGRSERILGQALGENRESVFLATKIFPVLPVAPVVEQRAVASANRLGVRRLDLYQVHQANPLVRDGTIMRGMRALQRVGLVGEVGVSNYSLQRWRAAEDALGSPVLSNQVPYSLVARAPEQDLLPYASSHGRLVLAYSPLAQGLLSGRYHPGNRPANRVRAANPLFLPENLERAGELLAVLDEVAAAHSATPAQIALAWVIHHPAVAAIPGASSVEQLERNVAAAEIDLTEDQYQALADAAARFRPLTGPAVFPRLARARFGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 3 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 4 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 5 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 6 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 7 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 8 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 9 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 10 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 11 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 12 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 13 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 14 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 15 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 16 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 17 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 18 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 19 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 20 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 21 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 22 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 23 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 24 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 103 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 104 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 120 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 175 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 176 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 179 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 182 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 188 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 189 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 191 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 193 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 196 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 201 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 207 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 209 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 216 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 218 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 221 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 222 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 223 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 224 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 225 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 226 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 227 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 228 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 229 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 230 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 231 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 232 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 233 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 234 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 235 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 236 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 285 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 286 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 287 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 288 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 289 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 290 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 293 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 294 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 295 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 296 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 297 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 298 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 299 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 300 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 301 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 302 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 303 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 304 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 305 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 306 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 307 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 319 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 320 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 321 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 322 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 323 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
| 324 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.33 |
| Metatranscriptomes | 0.88 |
| Isolates | 3.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 1.77 |
| Rhizoplane | 4.42 |
| Rhizosphere | 89.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25404J52841_10014316 | 3300003659 | Bacteria | 1720 |
| 2 | Ga0070658_10307055 | 3300005327 | Bacteria | 1353 |
| 3 | Ga0070683_100054857 | 3300005329 | Bacteria | 3696 |
| 4 | Ga0070683_100228010 | 3300005329 | Bacteria | 1771 |
| 5 | Ga0070683_100389592 | 3300005329 | Bacteria | 1328 |
| 6 | Ga0070690_100058556 | 3300005330 | Bacteria | 2474 |
| 7 | Ga0070690_100148548 | 3300005330 | Bacteria | 1597 |
| 8 | Ga0070670_100065443 | 3300005331 | Bacteria | 3119 |
| 9 | Ga0068869_100019345 | 3300005334 | Bacteria | 4650 |
| 10 | Ga0068869_100106552 | 3300005334 | Bacteria | 2127 |
| 11 | Ga0070666_10025892 | 3300005335 | Bacteria | 3827 |
| 12 | Ga0070666_10238081 | 3300005335 | Bacteria | 1287 |
| 13 | Ga0070680_100011567 | 3300005336 | Bacteria | 6832 |
| 14 | Ga0068868_100119303 | 3300005338 | Bacteria | 2150 |
| 15 | Ga0068868_100262683 | 3300005338 | Bacteria | 1456 |
| 16 | Ga0068868_100263811 | 3300005338 | Bacteria | 1453 |
| 17 | Ga0070689_100020282 | 3300005340 | Bacteria | 4930 |
| 18 | Ga0070661_100083340 | 3300005344 | Bacteria | 2361 |
| 19 | Ga0070668_100019088 | 3300005347 | Bacteria | 5154 |
| 20 | Ga0070668_100106358 | 3300005347 | Bacteria | 2229 |
| 21 | Ga0070668_100129291 | 3300005347 | Bacteria | 2026 |
| 22 | Ga0070668_100316061 | 3300005347 | Bacteria | 1313 |
| 23 | Ga0070669_100114824 | 3300005353 | Bacteria | 2047 |
| 24 | Ga0070675_100039028 | 3300005354 | Bacteria | 3872 |
| 25 | Ga0070671_100156235 | 3300005355 | Bacteria | 1927 |
| 26 | Ga0070671_100180201 | 3300005355 | Bacteria | 1788 |
| 27 | Ga0070674_100152178 | 3300005356 | Bacteria | 1747 |
| 28 | Ga0070674_100182536 | 3300005356 | Bacteria | 1608 |
| 29 | Ga0070673_100026254 | 3300005364 | Bacteria | 4300 |
| 30 | Ga0070673_100197168 | 3300005364 | Bacteria | 1732 |
| 31 | Ga0070688_100034873 | 3300005365 | Bacteria | 3052 |
| 32 | Ga0070659_100039455 | 3300005366 | Bacteria | 3686 |
| 33 | Ga0070709_10003910 | 3300005434 | Bacteria | 8036 |
| 34 | Ga0070709_10009428 | 3300005434 | Bacteria | 5386 |
| 35 | Ga0070709_10026945 | 3300005434 | Bacteria | 3412 |
| 36 | Ga0070709_10133540 | 3300005434 | Bacteria | 1697 |
| 37 | Ga0070714_100037540 | 3300005435 | Bacteria | 4071 |
| 38 | Ga0070714_100062696 | 3300005435 | Bacteria | 3195 |
| 39 | Ga0070714_100190821 | 3300005435 | Bacteria | 1870 |
| 40 | Ga0070714_100274580 | 3300005435 | Bacteria | 1564 |
| 41 | Ga0070713_100082165 | 3300005436 | Bacteria | 2750 |
| 42 | Ga0070713_100190692 | 3300005436 | Bacteria | 1847 |
| 43 | Ga0070713_100226420 | 3300005436 | Bacteria | 1698 |
| 44 | Ga0070710_10000904 | 3300005437 | Bacteria | 14218 |
| 45 | Ga0070710_10004883 | 3300005437 | Bacteria | 6344 |
| 46 | Ga0070710_10028861 | 3300005437 | Bacteria | 2971 |
| 47 | Ga0070710_10064110 | 3300005437 | Bacteria | 2101 |
| 48 | Ga0070710_10068837 | 3300005437 | Bacteria | 2035 |
| 49 | Ga0070710_10122688 | 3300005437 | Bacteria | 1574 |
| 50 | Ga0070710_10134454 | 3300005437 | Bacteria | 1511 |
| 51 | Ga0070711_100009717 | 3300005439 | Bacteria | 5926 |
| 52 | Ga0070711_100034966 | 3300005439 | Bacteria | 3355 |
| 53 | Ga0070711_100257822 | 3300005439 | Bacteria | 1371 |
| 54 | Ga0070708_100016030 | 3300005445 | Bacteria | 6207 |
| 55 | Ga0070708_100033029 | 3300005445 | Bacteria | 4494 |
| 56 | Ga0070708_100039435 | 3300005445 | Bacteria | 4132 |
| 57 | Ga0070708_100217362 | 3300005445 | Bacteria | 1792 |
| 58 | Ga0070663_100034948 | 3300005455 | Bacteria | 3484 |
| 59 | Ga0070663_100129676 | 3300005455 | Bacteria | 1913 |
| 60 | Ga0070662_100046033 | 3300005457 | Bacteria | 3133 |
| 61 | Ga0070681_10285530 | 3300005458 | Bacteria | 1561 |
| 62 | Ga0070685_10015905 | 3300005466 | Bacteria | 4002 |
| 63 | Ga0070685_10027294 | 3300005466 | Bacteria | 3155 |
| 64 | Ga0070685_10064927 | 3300005466 | Bacteria | 2147 |
| 65 | Ga0070706_100000304 | 3300005467 | Bacteria | 59524 |
| 66 | Ga0070706_100001944 | 3300005467 | Bacteria | 21302 |
| 67 | Ga0070706_100012966 | 3300005467 | Bacteria | 7714 |
| 68 | Ga0070706_100014928 | 3300005467 | Bacteria | 7175 |
| 69 | Ga0070706_100025734 | 3300005467 | Bacteria | 5415 |
| 70 | Ga0070706_100027455 | 3300005467 | Bacteria | 5239 |
| 71 | Ga0070706_100108556 | 3300005467 | Bacteria | 2582 |
| 72 | Ga0070707_100000391 | 3300005468 | Bacteria | 43195 |
| 73 | Ga0070707_100001468 | 3300005468 | Bacteria | 23083 |
| 74 | Ga0070707_100007741 | 3300005468 | Bacteria | 9980 |
| 75 | Ga0070707_100073623 | 3300005468 | Bacteria | 3294 |
| 76 | Ga0070707_100079896 | 3300005468 | Bacteria | 3157 |
| 77 | Ga0070707_100136364 | 3300005468 | Bacteria | 2387 |
| 78 | Ga0070707_100138827 | 3300005468 | Bacteria | 2365 |
| 79 | Ga0070707_100362920 | 3300005468 | Bacteria | 1407 |
| 80 | Ga0070698_100000459 | 3300005471 | Bacteria | 43224 |
| 81 | Ga0070698_100002351 | 3300005471 | Bacteria | 20891 |
| 82 | Ga0070698_100002430 | 3300005471 | Bacteria | 20529 |
| 83 | Ga0070698_100009462 | 3300005471 | Bacteria | 10440 |
| 84 | Ga0070698_100020690 | 3300005471 | Bacteria | 6899 |
| 85 | Ga0070698_100024159 | 3300005471 | Bacteria | 6342 |
| 86 | Ga0070698_100030237 | 3300005471 | Bacteria | 5617 |
| 87 | Ga0070698_100051342 | 3300005471 | Bacteria | 4200 |
| 88 | Ga0070698_100428454 | 3300005471 | Bacteria | 1257 |
| 89 | Ga0070699_100006444 | 3300005518 | Bacteria | 10222 |
| 90 | Ga0070699_100011087 | 3300005518 | Bacteria | 7792 |
| 91 | Ga0070699_100058356 | 3300005518 | Bacteria | 3343 |
| 92 | Ga0070679_100094804 | 3300005530 | Bacteria | 2972 |
| 93 | Ga0070679_100168529 | 3300005530 | Bacteria | 2163 |
| 94 | Ga0070684_100087998 | 3300005535 | Bacteria | 2759 |
| 95 | Ga0070684_100159388 | 3300005535 | Bacteria | 2046 |
| 96 | Ga0070684_100166004 | 3300005535 | Bacteria | 2004 |
| 97 | Ga0070697_100013155 | 3300005536 | Bacteria | 6488 |
| 98 | Ga0068853_100052780 | 3300005539 | Bacteria | 3501 |
| 99 | Ga0070672_100171136 | 3300005543 | Bacteria | 1806 |
| 100 | Ga0070686_100004561 | 3300005544 | Bacteria | 7643 |
| 101 | Ga0070695_100227929 | 3300005545 | Bacteria | 1346 |
| 102 | Ga0070665_100011840 | 3300005548 | Bacteria | 8812 |
| 103 | Ga0070664_100042165 | 3300005564 | Bacteria | 3852 |
| 104 | Ga0070664_100073571 | 3300005564 | Bacteria | 2932 |
| 105 | Ga0068857_100102439 | 3300005577 | Bacteria | 2570 |
| 106 | Ga0068857_100181637 | 3300005577 | Bacteria | 1915 |
| 107 | Ga0068854_100043970 | 3300005578 | Bacteria | 3168 |
| 108 | Ga0068856_100005337 | 3300005614 | Bacteria | 12684 |
| 109 | Ga0068856_100530009 | 3300005614 | Bacteria | 1199 |
| 110 | Ga0070702_100065487 | 3300005615 | Bacteria | 2129 |
| 111 | Ga0068852_100015035 | 3300005616 | Bacteria | 5984 |
| 112 | Ga0068859_100131592 | 3300005617 | Bacteria | 2573 |
| 113 | Ga0068859_100233854 | 3300005617 | Bacteria | 1926 |
| 114 | Ga0068864_100138350 | 3300005618 | Bacteria | 2194 |
| 115 | Ga0068861_100197437 | 3300005719 | Bacteria | 1686 |
| 116 | Ga0068861_100278119 | 3300005719 | Bacteria | 1440 |
| 117 | Ga0068851_10034145 | 3300005834 | Bacteria | 2538 |
| 118 | Ga0068870_10034090 | 3300005840 | Bacteria | 2603 |
| 119 | Ga0068863_100128422 | 3300005841 | Bacteria | 2419 |
| 120 | Ga0068863_100228187 | 3300005841 | Bacteria | 1795 |
| 121 | Ga0068858_100051466 | 3300005842 | Bacteria | 3810 |
| 122 | Ga0068858_100135762 | 3300005842 | Bacteria | 2308 |
| 123 | Ga0068858_100346033 | 3300005842 | Bacteria | 1423 |
| 124 | Ga0068860_100003227 | 3300005843 | Bacteria | 16817 |
| 125 | Ga0068862_100053879 | 3300005844 | Bacteria | 3444 |
| 126 | Ga0081540_1003217 | 3300005983 | Bacteria | 13015 |
| 127 | Ga0081540_1027577 | 3300005983 | Bacteria | 3213 |
| 128 | Ga0081540_1098164 | 3300005983 | Bacteria | 1269 |
| 129 | Ga0070717_10000957 | 3300006028 | Bacteria | 19238 |
| 130 | Ga0070717_10017635 | 3300006028 | Bacteria | 5558 |
| 131 | Ga0070717_10083684 | 3300006028 | Bacteria | 2683 |
| 132 | Ga0070717_10152460 | 3300006028 | Bacteria | 2000 |
| 133 | Ga0070717_10169117 | 3300006028 | Bacteria | 1900 |
| 134 | Ga0070715_10036415 | 3300006163 | Bacteria | 2029 |
| 135 | Ga0070716_100003216 | 3300006173 | Bacteria | 7661 |
| 136 | Ga0070716_100003549 | 3300006173 | Bacteria | 7362 |
| 137 | Ga0070716_100055349 | 3300006173 | Bacteria | 2270 |
| 138 | Ga0070716_100101853 | 3300006173 | Bacteria | 1762 |
| 139 | Ga0070716_100102300 | 3300006173 | Bacteria | 1759 |
| 140 | Ga0070712_100019088 | 3300006175 | Bacteria | 4464 |
| 141 | Ga0070712_100054704 | 3300006175 | Bacteria | 2791 |
| 142 | Ga0075428_100000006 | 3300006844 | Bacteria | 288592 |
| 143 | Ga0075428_100400953 | 3300006844 | Bacteria | 1470 |
| 144 | Ga0075433_10132296 | 3300006852 | Bacteria | 2216 |
| 145 | Ga0075433_10171303 | 3300006852 | Bacteria | 1932 |
| 146 | Ga0075434_100008309 | 3300006871 | Bacteria | 9642 |
| 147 | Ga0075434_100199751 | 3300006871 | Bacteria | 2019 |
| 148 | Ga0075436_100042128 | 3300006914 | Bacteria | 3148 |
| 149 | Ga0075436_100098745 | 3300006914 | Bacteria | 2032 |
| 150 | Ga0075436_100114690 | 3300006914 | Bacteria | 1881 |
| 151 | Ga0097620_100131585 | 3300006931 | Bacteria | 2573 |
| 152 | Ga0097620_100233858 | 3300006931 | Bacteria | 1926 |
| 153 | Ga0075435_100003093 | 3300007076 | Bacteria | 11237 |
| 154 | Ga0075435_100022570 | 3300007076 | Bacteria | 4855 |
| 155 | Ga0075435_100074672 | 3300007076 | Bacteria | 2774 |
| 156 | Ga0105240_10246813 | 3300009093 | Bacteria | 2067 |
| 157 | Ga0111539_10058886 | 3300009094 | Bacteria | 4556 |
| 158 | Ga0105245_10125987 | 3300009098 | Bacteria | 2398 |
| 159 | Ga0105247_10000653 | 3300009101 | Bacteria | 27504 |
| 160 | Ga0105247_10057860 | 3300009101 | Bacteria | 2397 |
| 161 | Ga0114129_10001706 | 3300009147 | Bacteria | 29983 |
| 162 | Ga0114129_10216275 | 3300009147 | Bacteria | 2588 |
| 163 | Ga0114129_10272082 | 3300009147 | Bacteria | 2266 |
| 164 | Ga0105243_10192998 | 3300009148 | Bacteria | 1780 |
| 165 | Ga0105241_10049814 | 3300009174 | Bacteria | 3191 |
| 166 | Ga0105241_10194998 | 3300009174 | Bacteria | 1688 |
| 167 | Ga0105248_10002051 | 3300009177 | Bacteria | 22313 |
| 168 | Ga0105248_10199453 | 3300009177 | Bacteria | 2254 |
| 169 | Ga0105248_10262019 | 3300009177 | Bacteria | 1946 |
| 170 | Ga0105237_10038697 | 3300009545 | Bacteria | 4816 |
| 171 | Ga0105237_10110865 | 3300009545 | Bacteria | 2736 |
| 172 | Ga0105238_10164015 | 3300009551 | Bacteria | 2198 |
| 173 | Ga0105238_10352983 | 3300009551 | Bacteria | 1460 |
| 174 | Ga0105249_10129973 | 3300009553 | Bacteria | 2403 |
| 175 | Ga0157340_1001763 | 3300012473 | Bacteria | 1037 |
| 176 | Ga0157343_1000704 | 3300012488 | Bacteria | 1425 |
| 177 | Ga0157342_1000128 | 3300012507 | Bacteria | 3705 |
| 178 | Ga0157373_10188795 | 3300013100 | Bacteria | 1452 |
| 179 | Ga0157371_10031125 | 3300013102 | Bacteria | 3844 |
| 180 | Ga0157374_10119354 | 3300013296 | Bacteria | 2544 |
| 181 | Ga0157378_10118292 | 3300013297 | Bacteria | 2439 |
| 182 | Ga0163162_10118115 | 3300013306 | Bacteria | 2754 |
| 183 | Ga0157372_10331052 | 3300013307 | Bacteria | 1773 |
| 184 | Ga0157375_10075052 | 3300013308 | Bacteria | 3405 |
| 185 | Ga0157375_10110925 | 3300013308 | Bacteria | 2841 |
| 186 | Ga0157375_10306487 | 3300013308 | Bacteria | 1752 |
| 187 | Ga0163163_10036129 | 3300014325 | Bacteria | 4797 |
| 188 | Ga0163163_10490122 | 3300014325 | Bacteria | 1290 |
| 189 | Ga0157380_10327205 | 3300014326 | Bacteria | 1424 |
| 190 | Ga0157377_10052086 | 3300014745 | Bacteria | 2310 |
| 191 | Ga0157379_10014328 | 3300014968 | Bacteria | 6957 |
| 192 | Ga0157379_10052116 | 3300014968 | Bacteria | 3654 |
| 193 | Ga0157379_10090891 | 3300014968 | Bacteria | 2739 |
| 194 | Ga0163161_10048989 | 3300017792 | Bacteria | 3052 |
| 195 | Ga0197907_10234494 | 3300020069 | Bacteria | 1394 |
| 196 | Ga0197907_10862487 | 3300020069 | Bacteria | 2277 |
| 197 | Ga0206356_11175517 | 3300020070 | Bacteria | 1410 |
| 198 | Ga0206355_1300986 | 3300020076 | Bacteria | 1053 |
| 199 | Ga0206350_11006390 | 3300020080 | Bacteria | 1162 |
| 200 | Ga0213876_10025033 | 3300021384 | Bacteria | 3151 |
| 201 | Ga0224712_10037192 | 3300022467 | Bacteria | 1810 |
| 202 | Ga0224712_10043681 | 3300022467 | Bacteria | 1705 |
| 203 | Ga0224572_1001884 | 3300024225 | Bacteria | 3244 |
| 204 | Ga0224572_1004440 | 3300024225 | Bacteria | 2439 |
| 205 | Ga0207656_10026789 | 3300025321 | Bacteria | 2353 |
| 206 | Ga0207653_10006120 | 3300025885 | Bacteria | 3751 |
| 207 | Ga0207692_10032663 | 3300025898 | Bacteria | 2503 |
| 208 | Ga0207692_10141376 | 3300025898 | Bacteria | 1369 |
| 209 | Ga0207710_10000427 | 3300025900 | Bacteria | 27512 |
| 210 | Ga0207710_10008820 | 3300025900 | Bacteria | 4245 |
| 211 | Ga0207688_10004929 | 3300025901 | Bacteria | 7267 |
| 212 | Ga0207688_10030605 | 3300025901 | Bacteria | 2969 |
| 213 | Ga0207688_10030693 | 3300025901 | Bacteria | 2964 |
| 214 | Ga0207688_10049544 | 3300025901 | Bacteria | 2348 |
| 215 | Ga0207647_10106216 | 3300025904 | Bacteria | 1663 |
| 216 | Ga0207685_10002433 | 3300025905 | Bacteria | 4266 |
| 217 | Ga0207699_10010354 | 3300025906 | Bacteria | 4677 |
| 218 | Ga0207699_10015551 | 3300025906 | Bacteria | 3955 |
| 219 | Ga0207699_10016061 | 3300025906 | Bacteria | 3906 |
| 220 | Ga0207699_10028211 | 3300025906 | Bacteria | 3117 |
| 221 | Ga0207699_10031439 | 3300025906 | Bacteria | 2980 |
| 222 | Ga0207699_10111121 | 3300025906 | Bacteria | 1756 |
| 223 | Ga0207699_10144210 | 3300025906 | Bacteria | 1568 |
| 224 | Ga0207699_10187716 | 3300025906 | Bacteria | 1393 |
| 225 | Ga0207643_10004651 | 3300025908 | Bacteria | 7371 |
| 226 | Ga0207643_10024555 | 3300025908 | Bacteria | 3326 |
| 227 | Ga0207643_10142162 | 3300025908 | Bacteria | 1434 |
| 228 | Ga0207643_10181117 | 3300025908 | Bacteria | 1275 |
| 229 | Ga0207705_10195211 | 3300025909 | Bacteria | 1532 |
| 230 | Ga0207684_10017737 | 3300025910 | Bacteria | 6106 |
| 231 | Ga0207684_10020340 | 3300025910 | Bacteria | 5671 |
| 232 | Ga0207684_10035311 | 3300025910 | Bacteria | 4245 |
| 233 | Ga0207684_10061221 | 3300025910 | Bacteria | 3197 |
| 234 | Ga0207684_10066624 | 3300025910 | Bacteria | 3059 |
| 235 | Ga0207684_10127084 | 3300025910 | Bacteria | 2188 |
| 236 | Ga0207684_10354144 | 3300025910 | Bacteria | 1263 |
| 237 | Ga0207693_10015973 | 3300025915 | Bacteria | 6010 |
| 238 | Ga0207693_10018028 | 3300025915 | Bacteria | 5627 |
| 239 | Ga0207693_10064440 | 3300025915 | Bacteria | 2871 |
| 240 | Ga0207693_10114512 | 3300025915 | Bacteria | 2116 |
| 241 | Ga0207693_10125228 | 3300025915 | Bacteria | 2019 |
| 242 | Ga0207693_10140956 | 3300025915 | Bacteria | 1896 |
| 243 | Ga0207663_10084094 | 3300025916 | Bacteria | 2092 |
| 244 | Ga0207663_10091482 | 3300025916 | Bacteria | 2020 |
| 245 | Ga0207663_10146629 | 3300025916 | Bacteria | 1651 |
| 246 | Ga0207663_10200169 | 3300025916 | Bacteria | 1440 |
| 247 | Ga0207663_10253087 | 3300025916 | Bacteria | 1297 |
| 248 | Ga0207662_10005260 | 3300025918 | Bacteria | 6874 |
| 249 | Ga0207657_10010213 | 3300025919 | Bacteria | 9377 |
| 250 | Ga0207657_10042914 | 3300025919 | Bacteria | 3987 |
| 251 | Ga0207657_10175370 | 3300025919 | Bacteria | 1735 |
| 252 | Ga0207646_10000721 | 3300025922 | Bacteria | 42920 |
| 253 | Ga0207646_10005267 | 3300025922 | Bacteria | 13639 |
| 254 | Ga0207646_10011465 | 3300025922 | Bacteria | 8586 |
| 255 | Ga0207646_10012021 | 3300025922 | Bacteria | 8343 |
| 256 | Ga0207646_10012951 | 3300025922 | Bacteria | 7994 |
| 257 | Ga0207646_10054928 | 3300025922 | Bacteria | 3562 |
| 258 | Ga0207646_10072294 | 3300025922 | Bacteria | 3081 |
| 259 | Ga0207646_10119409 | 3300025922 | Bacteria | 2368 |
| 260 | Ga0207681_10203370 | 3300025923 | Bacteria | 1522 |
| 261 | Ga0207694_10173720 | 3300025924 | Bacteria | 1745 |
| 262 | Ga0207650_10061064 | 3300025925 | Bacteria | 2813 |
| 263 | Ga0207687_10274042 | 3300025927 | Bacteria | 1350 |
| 264 | Ga0207700_10006097 | 3300025928 | Bacteria | 7263 |
| 265 | Ga0207700_10074764 | 3300025928 | Bacteria | 2623 |
| 266 | Ga0207700_10119208 | 3300025928 | Bacteria | 2137 |
| 267 | Ga0207700_10120314 | 3300025928 | Bacteria | 2128 |
| 268 | Ga0207700_10145907 | 3300025928 | Bacteria | 1950 |
| 269 | Ga0207664_10014557 | 3300025929 | Bacteria | 5685 |
| 270 | Ga0207664_10048722 | 3300025929 | Bacteria | 3333 |
| 271 | Ga0207664_10080519 | 3300025929 | Bacteria | 2647 |
| 272 | Ga0207664_10148383 | 3300025929 | Bacteria | 1990 |
| 273 | Ga0207664_10186580 | 3300025929 | Bacteria | 1783 |
| 274 | Ga0207664_10191406 | 3300025929 | Bacteria | 1761 |
| 275 | Ga0207664_10210754 | 3300025929 | Bacteria | 1681 |
| 276 | Ga0207664_10276052 | 3300025929 | Bacteria | 1474 |
| 277 | Ga0207644_10066237 | 3300025931 | Bacteria | 2629 |
| 278 | Ga0207644_10089250 | 3300025931 | Bacteria | 2294 |
| 279 | Ga0207644_10145591 | 3300025931 | Bacteria | 1829 |
| 280 | Ga0207690_10257544 | 3300025932 | Bacteria | 1350 |
| 281 | Ga0207706_10036934 | 3300025933 | Bacteria | 4339 |
| 282 | Ga0207706_10071616 | 3300025933 | Bacteria | 3049 |
| 283 | Ga0207686_10024646 | 3300025934 | Bacteria | 3489 |
| 284 | Ga0207709_10071177 | 3300025935 | Bacteria | 2207 |
| 285 | Ga0207670_10368777 | 3300025936 | Bacteria | 1141 |
| 286 | Ga0207704_10038422 | 3300025938 | Bacteria | 2776 |
| 287 | Ga0207665_10007909 | 3300025939 | Bacteria | 7025 |
| 288 | Ga0207665_10008012 | 3300025939 | Bacteria | 6969 |
| 289 | Ga0207665_10011477 | 3300025939 | Bacteria | 5819 |
| 290 | Ga0207665_10013277 | 3300025939 | Bacteria | 5415 |
| 291 | Ga0207665_10132730 | 3300025939 | Bacteria | 1769 |
| 292 | Ga0207665_10146339 | 3300025939 | Bacteria | 1689 |
| 293 | Ga0207665_10177369 | 3300025939 | Bacteria | 1542 |
| 294 | Ga0207691_10038381 | 3300025940 | Bacteria | 4433 |
| 295 | Ga0207691_10052809 | 3300025940 | Bacteria | 3711 |
| 296 | Ga0207711_10012631 | 3300025941 | Bacteria | 7013 |
| 297 | Ga0207711_10265108 | 3300025941 | Bacteria | 1580 |
| 298 | Ga0207689_10013895 | 3300025942 | Bacteria | 6858 |
| 299 | Ga0207689_10065141 | 3300025942 | Bacteria | 2997 |
| 300 | Ga0207661_10047456 | 3300025944 | Bacteria | 3410 |
| 301 | Ga0207668_10029215 | 3300025972 | Bacteria | 3612 |
| 302 | Ga0207668_10100081 | 3300025972 | Bacteria | 2152 |
| 303 | Ga0207640_10060440 | 3300025981 | Bacteria | 2505 |
| 304 | Ga0207640_10123878 | 3300025981 | Bacteria | 1857 |
| 305 | Ga0207678_10013076 | 3300026067 | Bacteria | 7282 |
| 306 | Ga0207678_10045539 | 3300026067 | Bacteria | 3794 |
| 307 | Ga0207678_10078837 | 3300026067 | Bacteria | 2821 |
| 308 | Ga0207678_10124754 | 3300026067 | Bacteria | 2197 |
| 309 | Ga0207708_10030437 | 3300026075 | Bacteria | 4092 |
| 310 | Ga0207708_10052090 | 3300026075 | Bacteria | 3118 |
| 311 | Ga0207708_10155506 | 3300026075 | Bacteria | 1803 |
| 312 | Ga0207641_10081544 | 3300026088 | Bacteria | 2809 |
| 313 | Ga0207641_10111024 | 3300026088 | Bacteria | 2431 |
| 314 | Ga0207641_10111644 | 3300026088 | Bacteria | 2424 |
| 315 | Ga0207648_10044613 | 3300026089 | Bacteria | 3890 |
| 316 | Ga0207676_10233246 | 3300026095 | Bacteria | 1646 |
| 317 | Ga0207676_10322364 | 3300026095 | Bacteria | 1419 |
| 318 | Ga0207674_10019026 | 3300026116 | Bacteria | 7442 |
| 319 | Ga0207675_100025028 | 3300026118 | Bacteria | 5555 |
| 320 | Ga0207675_100069866 | 3300026118 | Bacteria | 3282 |
| 321 | Ga0207675_100357494 | 3300026118 | Bacteria | 1432 |
| 322 | Ga0207683_10014371 | 3300026121 | Bacteria | 6744 |
| 323 | Ga0207683_10052998 | 3300026121 | Bacteria | 3555 |
| 324 | Ga0207683_10081019 | 3300026121 | Bacteria | 2880 |
| 325 | Ga0207428_10238015 | 3300027907 | Bacteria | 1361 |
| 326 | Ga0268266_10113261 | 3300028379 | Bacteria | 2405 |
| 327 | Ga0268266_10364858 | 3300028379 | Bacteria | 1360 |
| 328 | Ga0268265_10182176 | 3300028380 | Bacteria | 1806 |
| 329 | Ga0268264_10009372 | 3300028381 | Bacteria | 8103 |
| 330 | Ga0265324_10006155 | 3300029957 | Bacteria | 5059 |
| 331 | Ga0265320_10006561 | 3300031240 | Bacteria | 7321 |
| 332 | Ga0265325_10177202 | 3300031241 | Bacteria | 994 |
| 333 | Ga0265329_10009577 | 3300031242 | Bacteria | 3602 |
| 334 | Ga0265331_10030462 | 3300031250 | Bacteria | 2686 |
| 335 | Ga0265316_10112549 | 3300031344 | Bacteria | 2060 |
| 336 | Ga0265316_10135504 | 3300031344 | Bacteria | 1853 |
| 337 | Ga0307408_100033730 | 3300031548 | Bacteria | 3579 |
| 338 | Ga0265314_10021773 | 3300031711 | Bacteria | 4922 |
| 339 | Ga0307405_10242280 | 3300031731 | Bacteria | 1336 |
| 340 | Ga0307413_10028882 | 3300031824 | Bacteria | 3096 |
| 341 | Ga0307410_10318765 | 3300031852 | Bacteria | 1232 |
| 342 | Ga0307406_10021130 | 3300031901 | Bacteria | 3846 |
| 343 | Ga0307406_10319316 | 3300031901 | Bacteria | 1201 |
| 344 | Ga0307416_100440234 | 3300032002 | Bacteria | 1353 |
| 345 | Ga0307416_100442983 | 3300032002 | Bacteria | 1349 |
| 346 | Ga0307411_10174750 | 3300032005 | Bacteria | 1624 |
| 347 | Ga0307415_100435911 | 3300032126 | Bacteria | 1129 |
| 348 | Ga0373930_0009124 | 3300034816 | Bacteria | 1749 |
| 349 | Ga0373930_0012284 | 3300034816 | Bacteria | 1560 |
| 350 | Ga0373950_0009047 | 3300034818 | Bacteria | 1580 |
| 351 | Ga0373958_0008127 | 3300034819 | Bacteria | 1692 |
| 352 | Ga0373926_0002888 | 3300035083 | Bacteria | 5505 |
| 353 | Ga0373926_0005963 | 3300035083 | Bacteria | 4032 |
| 354 | Ga0373928_0013853 | 3300035084 | Bacteria | 1622 |
| 355 | Ga0373929_0008200 | 3300035085 | Bacteria | 1924 |
| 356 | Ga0373934_0000004 | 3300035086 | Bacteria | 87334 |
| 357 | Ga0373934_0011407 | 3300035086 | Bacteria | 3343 |
| 358 | Ga0373934_0096560 | 3300035086 | Bacteria | 1193 |
| 359 | Ga0373940_0007051 | 3300035088 | Bacteria | 2522 |
| 360 | Ga0373944_0000349 | 3300035089 | Bacteria | 10418 |
| 361 | Ga0373944_0002650 | 3300035089 | Bacteria | 4560 |
| 362 | Ga0373949_0018718 | 3300035090 | Bacteria | 1572 |
| 363 | Ga0373951_0007194 | 3300035091 | Bacteria | 2532 |
| 364 | Ga0373923_0002644 | 3300035111 | Bacteria | 5563 |
| 365 | Ga0373923_0020460 | 3300035111 | Bacteria | 2571 |
| 366 | Ga0373923_0035992 | 3300035111 | Bacteria | 2018 |
| 367 | Ga0373923_0044907 | 3300035111 | Bacteria | 1833 |
| 368 | Ga0373932_0031955 | 3300035112 | Bacteria | 1469 |
| 369 | Ga0373936_0000220 | 3300035113 | Bacteria | 18777 |
| 370 | Ga0373936_0001068 | 3300035113 | Bacteria | 9812 |
| 371 | Ga0373936_0002061 | 3300035113 | Bacteria | 7452 |
| 372 | Ga0373936_0012695 | 3300035113 | Bacteria | 3208 |
| 373 | Ga0373936_0015154 | 3300035113 | Bacteria | 2952 |
| 374 | Ga0373936_0019841 | 3300035113 | Bacteria | 2607 |
| 375 | Ga0373941_0021056 | 3300035115 | Bacteria | 1835 |
| 376 | Ga0373945_0000244 | 3300035116 | Bacteria | 15102 |
| 377 | Ga0373945_0015334 | 3300035116 | Bacteria | 2577 |
| 378 | Ga0373945_0032384 | 3300035116 | Bacteria | 1852 |
| 379 | Ga0373953_0002744 | 3300035117 | Bacteria | 5349 |
| 380 | Ga0373953_0017686 | 3300035117 | Bacteria | 2625 |
| 381 | Ga0373954_0002885 | 3300035118 | Bacteria | 7254 |
| 382 | Ga0373954_0013444 | 3300035118 | Bacteria | 3647 |
| 383 | Ga0373954_0036710 | 3300035118 | Bacteria | 2275 |
| 384 | Ga0373954_0129349 | 3300035118 | Bacteria | 1229 |
| 385 | Ga0373956_0000601 | 3300035119 | Bacteria | 14759 |
| 386 | Ga0373956_0005179 | 3300035119 | Bacteria | 5221 |
| 387 | Ga0373956_0005238 | 3300035119 | Bacteria | 5191 |
| 388 | Ga0373956_0029995 | 3300035119 | Bacteria | 2374 |
| 389 | Ga0373957_0001123 | 3300035120 | Bacteria | 7102 |
| 390 | Ga0373957_0011856 | 3300035120 | Bacteria | 2920 |
| 391 | Ga0373957_0021174 | 3300035120 | Bacteria | 2305 |
| 392 | Ga0373960_0003322 | 3300035121 | Bacteria | 3641 |
| 393 | Ga0373943_0000328 | 3300035170 | Bacteria | 19825 |
| 394 | Ga0373943_0145201 | 3300035170 | Bacteria | 1281 |
| 395 | Ga0373946_0000075 | 3300035171 | Bacteria | 26757 |
| 396 | Ga0373946_0005982 | 3300035171 | Bacteria | 4411 |
| 397 | Ga0373955_0000025 | 3300035172 | Bacteria | 58341 |
| 398 | Ga0373955_0002512 | 3300035172 | Bacteria | 8015 |
| 399 | Ga0373955_0003650 | 3300035172 | Bacteria | 6775 |
| 400 | Ga0373955_0019498 | 3300035172 | Bacteria | 3391 |
| 401 | Ga0373955_0079252 | 3300035172 | Bacteria | 1852 |
| 402 | Ga0373955_0233813 | 3300035172 | Bacteria | 1100 |
| 403 | Ga0373961_0050359 | 3300035241 | Bacteria | 1233 |
| 404 | Ga0373924_0001226 | 3300035410 | Bacteria | 8220 |
| 405 | Ga0373924_0002268 | 3300035410 | Bacteria | 6452 |
| 406 | Ga0373924_0007457 | 3300035410 | Bacteria | 3950 |
| 407 | Ga0373924_0010732 | 3300035410 | Bacteria | 3388 |
| 408 | Ga0373924_0013650 | 3300035410 | Bacteria | 3055 |
| 409 | Ga0373924_0068951 | 3300035410 | Bacteria | 1489 |
| 410 | Ga0373931_0052813 | 3300035691 | Bacteria | 2168 |
| 411 | Ga0373931_0139516 | 3300035691 | Bacteria | 1402 |
| 412 | Ga0373935_0030952 | 3300035692 | Bacteria | 3317 |
| 413 | Ga0373935_0033784 | 3300035692 | Bacteria | 3185 |
| 414 | Ga0373935_0054162 | 3300035692 | Bacteria | 2553 |
| 415 | Ga0373935_0108878 | 3300035692 | Bacteria | 1837 |
| 416 | Ga0373935_0149137 | 3300035692 | Bacteria | 1585 |
| 417 | Ga0373927_0001015 | 3300035695 | Bacteria | 21352 |
| 418 | Ga0373927_0021392 | 3300035695 | Bacteria | 4239 |
| 419 | Ga0373927_0053558 | 3300035695 | Bacteria | 2610 |
| 420 | Ga0373933_0000119 | 3300035724 | Bacteria | 51009 |
| 421 | Ga0373933_0004173 | 3300035724 | Bacteria | 7959 |
| 422 | Ga0373933_0024733 | 3300035724 | Bacteria | 3438 |
| 423 | Ga0373933_0064226 | 3300035724 | Bacteria | 2220 |
| 424 | Ga0373933_0088685 | 3300035724 | Bacteria | 1906 |
| 425 | Ga0373933_0090983 | 3300035724 | Bacteria | 1882 |
| 426 | Ga0373933_0105029 | 3300035724 | Bacteria | 1756 |
| 427 | Ga0373947_0004111 | 3300035725 | Bacteria | 8555 |
| 428 | Ga0373947_0043076 | 3300035725 | Bacteria | 2696 |
| 429 | Ga0373947_0043587 | 3300035725 | Bacteria | 2680 |
| 430 | Ga0373947_0044624 | 3300035725 | Bacteria | 2650 |
| 431 | Ga0373937_0000306 | 3300036401 | Bacteria | 46226 |
| 432 | Ga0373937_0010502 | 3300036401 | Bacteria | 8085 |
| 433 | Ga0373937_0020026 | 3300036401 | Bacteria | 5992 |
| 434 | Ga0373937_0089479 | 3300036401 | Bacteria | 2850 |
| 435 | Ga0373937_0104712 | 3300036401 | Bacteria | 2628 |
| 436 | Ga0373937_0188091 | 3300036401 | Bacteria | 1939 |
| 437 | Ga0373925_0002044 | 3300037068 | Bacteria | 16633 |
| 438 | Ga0373925_0014178 | 3300037068 | Bacteria | 5767 |
| 439 | Ga0373925_0022145 | 3300037068 | Bacteria | 4633 |
| 440 | Ga0373925_0051372 | 3300037068 | Bacteria | 3077 |
| 441 | Ga0373925_0063822 | 3300037068 | Bacteria | 2772 |
| 442 | Ga0436364_0684862 | 3300037853 | Bacteria | 1652 |
| 443 | Ga0436364_1223233 | 3300037853 | Bacteria | 42179 |
| 444 | Ga0436364_1508755 | 3300037853 | Bacteria | 3504 |
| 445 | Ga0395901_0000675 | 3300038443 | Bacteria | 39208 |
| 446 | Ga0436365_1284536 | 3300039437 | Bacteria | 1831 |
| 447 | Ga0436365_1434212 | 3300039437 | Bacteria | 3747 |
| 448 | Ga0436365_1763233 | 3300039437 | Bacteria | 4979 |
| 449 | Ga0436360_1310721 | 3300039438 | Bacteria | 1560 |
| 450 | Ga0436361_0791607 | 3300039447 | Bacteria | 1615 |
| 451 | Ga0436363_0349552 | 3300039450 | Bacteria | 2693 |
| 452 | Ga0436362_0617347 | 3300039453 | Bacteria | 6593 |
| 453 | Ga0466972_0029415 | 3300044658 | Bacteria | 2704 |
| 454 | Ga0466965_0001449 | 3300044683 | Bacteria | 9580 |
| 455 | Ga0466966_0041819 | 3300044684 | Bacteria | 2944 |
| 456 | Ga0466963_0140320 | 3300044694 | Bacteria | 1674 |
| 457 | Ga0466963_0243266 | 3300044694 | Bacteria | 1262 |
| 458 | Ga0466970_0038436 | 3300044765 | Bacteria | 2538 |
| 459 | Ga0466970_0068404 | 3300044765 | Bacteria | 1908 |
| 460 | Ga0466957_0140776 | 3300044842 | Bacteria | 1554 |
| 461 | Ga0466960_0000278 | 3300044901 | Bacteria | 17801 |
| 462 | Ga0466960_0067955 | 3300044901 | Bacteria | 1767 |
| 463 | Ga0466959_0092827 | 3300045049 | Bacteria | 2167 |
| 464 | Ga0466959_0160212 | 3300045049 | Bacteria | 1582 |
| 465 | Ga0466967_0007489 | 3300045976 | Bacteria | 7880 |
| 466 | Ga0466967_0058535 | 3300045976 | Bacteria | 3406 |
| 467 | Ga0466967_0143573 | 3300045976 | Bacteria | 2225 |
| 468 | Ga0466967_0161677 | 3300045976 | Bacteria | 2102 |
| 469 | Ga0466967_0168385 | 3300045976 | Bacteria | 2060 |
| 470 | Ga0495592_0000200 | 3300046454 | Bacteria | 51023 |
| 471 | Ga0495592_0029712 | 3300046454 | Bacteria | 4137 |
| 472 | Ga0495592_0041720 | 3300046454 | Bacteria | 3438 |
| 473 | Ga0495592_0068761 | 3300046454 | Bacteria | 2584 |
| 474 | Ga0495603_0018166 | 3300046455 | Bacteria | 4254 |
| 475 | Ga0495629_0001817 | 3300046459 | Bacteria | 16723 |
| 476 | Ga0495629_0002479 | 3300046459 | Bacteria | 14154 |
| 477 | Ga0495641_0004811 | 3300046461 | Bacteria | 9388 |
| 478 | Ga0495641_0009894 | 3300046461 | Bacteria | 5611 |
| 479 | Ga0495641_0022070 | 3300046461 | Bacteria | 3190 |
| 480 | Ga0495641_0036940 | 3300046461 | Bacteria | 2292 |
| 481 | Ga0495641_0038424 | 3300046461 | Bacteria | 2236 |
| 482 | Ga0495651_0000151 | 3300046462 | Bacteria | 51025 |
| 483 | Ga0495651_0001835 | 3300046462 | Bacteria | 16403 |
| 484 | Ga0495651_0009665 | 3300046462 | Bacteria | 7416 |
| 485 | Ga0495651_0013256 | 3300046462 | Bacteria | 6375 |
| 486 | Ga0495651_0025398 | 3300046462 | Bacteria | 4611 |
| 487 | Ga0495651_0060843 | 3300046462 | Bacteria | 2891 |
| 488 | Ga0495651_0073989 | 3300046462 | Bacteria | 2585 |
| 489 | Ga0495651_0128320 | 3300046462 | Bacteria | 1854 |
| 490 | Ga0495653_0006911 | 3300046463 | Bacteria | 9323 |
| 491 | Ga0495653_0010666 | 3300046463 | Bacteria | 7523 |
| 492 | Ga0495653_0015770 | 3300046463 | Bacteria | 6160 |
| 493 | Ga0495653_0041530 | 3300046463 | Bacteria | 3589 |
| 494 | Ga0495653_0080141 | 3300046463 | Bacteria | 2416 |
| 495 | Ga0495650_0050918 | 3300046471 | Bacteria | 1709 |
| 496 | Ga0495580_0003452 | 3300046472 | Bacteria | 13458 |
| 497 | Ga0495580_0012452 | 3300046472 | Bacteria | 6520 |
| 498 | Ga0495582_0007220 | 3300046473 | Bacteria | 6162 |
| 499 | Ga0495582_0029206 | 3300046473 | Bacteria | 3026 |
| 500 | Ga0495639_0001194 | 3300046475 | Bacteria | 11725 |
| 501 | Ga0495639_0034631 | 3300046475 | Bacteria | 2259 |
| 502 | Ga0495639_0036443 | 3300046475 | Bacteria | 2203 |
| 503 | Ga0495662_0000398 | 3300046476 | Bacteria | 19448 |
| 504 | Ga0495662_0005224 | 3300046476 | Bacteria | 6509 |
| 505 | Ga0495662_0027735 | 3300046476 | Bacteria | 2736 |
| 506 | Ga0495662_0050165 | 3300046476 | Bacteria | 2014 |
| 507 | Ga0495664_0000170 | 3300046477 | Bacteria | 31859 |
| 508 | Ga0495664_0143157 | 3300046477 | Bacteria | 1449 |
| 509 | Ga0495664_0201046 | 3300046477 | Bacteria | 1207 |
| 510 | Ga0495594_0059990 | 3300046499 | Bacteria | 2104 |
| 511 | Ga0495608_0000147 | 3300046511 | Bacteria | 50943 |
| 512 | Ga0495608_0001781 | 3300046511 | Bacteria | 15382 |
| 513 | Ga0495608_0007778 | 3300046511 | Bacteria | 7549 |
| 514 | Ga0495608_0018624 | 3300046511 | Bacteria | 4786 |
| 515 | Ga0495608_0040793 | 3300046511 | Bacteria | 3108 |
| 516 | Ga0495608_0051155 | 3300046511 | Bacteria | 2739 |
| 517 | Ga0495608_0057961 | 3300046511 | Bacteria | 2554 |
| 518 | Ga0495608_0063909 | 3300046511 | Bacteria | 2413 |
| 519 | Ga0495618_0004682 | 3300046514 | Bacteria | 8368 |
| 520 | Ga0495618_0010066 | 3300046514 | Bacteria | 5719 |
| 521 | Ga0495618_0026716 | 3300046514 | Bacteria | 3591 |
| 522 | Ga0495618_0038593 | 3300046514 | Bacteria | 3002 |
| 523 | Ga0495618_0128046 | 3300046514 | Bacteria | 1625 |
| 524 | Ga0495618_0134190 | 3300046514 | Bacteria | 1584 |
| 525 | Ga0495628_0000753 | 3300046516 | Bacteria | 29919 |
| 526 | Ga0495628_0023071 | 3300046516 | Bacteria | 5108 |
| 527 | Ga0495628_0034053 | 3300046516 | Bacteria | 4101 |
| 528 | Ga0495628_0074588 | 3300046516 | Bacteria | 2642 |
| 529 | Ga0495628_0117409 | 3300046516 | Bacteria | 2043 |
| 530 | Ga0495628_0149645 | 3300046516 | Bacteria | 1779 |
| 531 | Ga0495628_0166989 | 3300046516 | Bacteria | 1670 |
| 532 | Ga0495630_0003733 | 3300046517 | Bacteria | 10620 |
| 533 | Ga0495630_0003909 | 3300046517 | Bacteria | 10416 |
| 534 | Ga0495630_0010026 | 3300046517 | Bacteria | 6824 |
| 535 | Ga0495630_0023818 | 3300046517 | Bacteria | 4525 |
| 536 | Ga0495666_0000939 | 3300046526 | Bacteria | 13683 |
| 537 | Ga0495666_0016616 | 3300046526 | Bacteria | 3665 |
| 538 | Ga0495652_0000276 | 3300046529 | Bacteria | 60614 |
| 539 | Ga0495652_0011993 | 3300046529 | Bacteria | 7834 |
| 540 | Ga0495652_0029193 | 3300046529 | Bacteria | 4845 |
| 541 | Ga0495652_0088918 | 3300046529 | Bacteria | 2530 |
| 542 | Ga0495652_0183517 | 3300046529 | Bacteria | 1603 |
| 543 | Ga0495665_0002626 | 3300046531 | Bacteria | 9692 |
| 544 | Ga0495665_0004314 | 3300046531 | Bacteria | 7682 |
| 545 | Ga0495665_0004598 | 3300046531 | Bacteria | 7446 |
| 546 | Ga0495665_0011845 | 3300046531 | Bacteria | 4722 |
| 547 | Ga0495665_0033780 | 3300046531 | Bacteria | 2735 |
| 548 | Ga0495640_0010262 | 3300046533 | Bacteria | 7248 |
| 549 | Ga0495640_0025492 | 3300046533 | Bacteria | 4287 |
| 550 | Ga0495640_0028266 | 3300046533 | Bacteria | 4038 |
| 551 | Ga0495640_0033054 | 3300046533 | Bacteria | 3678 |
| 552 | Ga0495640_0074594 | 3300046533 | Bacteria | 2268 |
| 553 | Ga0495640_0124688 | 3300046533 | Bacteria | 1671 |
| 554 | Ga0495586_0008699 | 3300046535 | Bacteria | 5405 |
| 555 | Ga0495586_0014824 | 3300046535 | Bacteria | 4142 |
| 556 | Ga0495586_0018638 | 3300046535 | Bacteria | 3695 |
| 557 | Ga0495587_0000045 | 3300046536 | Bacteria | 108362 |
| 558 | Ga0495587_0003044 | 3300046536 | Bacteria | 11199 |
| 559 | Ga0495587_0017474 | 3300046536 | Bacteria | 4455 |
| 560 | Ga0495587_0055643 | 3300046536 | Bacteria | 2329 |
| 561 | Ga0495587_0089957 | 3300046536 | Bacteria | 1773 |
| 562 | Ga0495645_0008023 | 3300046543 | Bacteria | 7351 |
| 563 | Ga0495645_0010953 | 3300046543 | Bacteria | 6367 |
| 564 | Ga0495645_0055998 | 3300046543 | Bacteria | 2863 |
| 565 | Ga0495645_0069753 | 3300046543 | Bacteria | 2537 |
| 566 | Ga0495667_0000051 | 3300046559 | Bacteria | 109277 |
| 567 | Ga0495667_0003213 | 3300046559 | Bacteria | 10957 |
| 568 | Ga0495667_0008153 | 3300046559 | Bacteria | 7108 |
| 569 | Ga0495667_0009637 | 3300046559 | Bacteria | 6547 |
| 570 | Ga0495667_0019737 | 3300046559 | Bacteria | 4548 |
| 571 | Ga0495667_0038149 | 3300046559 | Bacteria | 3200 |
| 572 | Ga0495667_0059364 | 3300046559 | Bacteria | 2510 |
| 573 | Ga0495667_0065057 | 3300046559 | Bacteria | 2385 |
| 574 | Ga0495634_0005420 | 3300046642 | Bacteria | 9821 |
| 575 | Ga0495634_0014722 | 3300046642 | Bacteria | 5629 |
| 576 | Ga0495634_0014943 | 3300046642 | Bacteria | 5582 |
| 577 | Ga0495634_0089820 | 3300046642 | Bacteria | 1996 |
| 578 | Ga0495635_0006037 | 3300046663 | Bacteria | 8445 |
| 579 | Ga0495635_0006196 | 3300046663 | Bacteria | 8335 |
| 580 | Ga0495635_0031178 | 3300046663 | Bacteria | 3703 |
| 581 | Ga0495635_0035952 | 3300046663 | Bacteria | 3434 |
| 582 | Ga0495635_0036304 | 3300046663 | Bacteria | 3416 |
| 583 | Ga0495635_0068783 | 3300046663 | Bacteria | 2428 |
| 584 | Ga0495635_0096216 | 3300046663 | Bacteria | 2024 |
| 585 | Ga0495635_0191623 | 3300046663 | Bacteria | 1388 |
| 586 | Ga0495657_0000044 | 3300046675 | Bacteria | 108383 |
| 587 | Ga0495657_0006495 | 3300046675 | Bacteria | 9141 |
| 588 | Ga0495657_0007455 | 3300046675 | Bacteria | 8453 |
| 589 | Ga0495657_0017348 | 3300046675 | Bacteria | 5227 |
| 590 | Ga0495657_0018258 | 3300046675 | Bacteria | 5081 |
| 591 | Ga0495657_0046655 | 3300046675 | Bacteria | 2932 |
| 592 | Ga0495657_0141935 | 3300046675 | Bacteria | 1496 |
| 593 | Ga0495599_0000101 | 3300046678 | Bacteria | 60499 |
| 594 | Ga0495599_0014227 | 3300046678 | Bacteria | 4925 |
| 595 | Ga0495599_0025541 | 3300046678 | Bacteria | 3698 |
| 596 | Ga0495599_0026352 | 3300046678 | Bacteria | 3642 |
| 597 | Ga0495599_0095464 | 3300046678 | Bacteria | 1854 |
| 598 | Ga0495599_0122805 | 3300046678 | Bacteria | 1614 |
| 599 | Ga0495599_0172506 | 3300046678 | Bacteria | 1334 |
| 600 | Ga0495599_0235241 | 3300046678 | Bacteria | 1118 |
| 601 | Ga0495599_0248122 | 3300046678 | Bacteria | 1084 |
| 602 | Ga0495623_0001529 | 3300046679 | Bacteria | 15620 |
| 603 | Ga0495623_0007854 | 3300046679 | Bacteria | 6938 |
| 604 | Ga0495623_0010798 | 3300046679 | Bacteria | 5912 |
| 605 | Ga0495646_0004595 | 3300046680 | Bacteria | 8701 |
| 606 | Ga0495646_0006309 | 3300046680 | Bacteria | 7523 |
| 607 | Ga0495646_0060322 | 3300046680 | Bacteria | 2262 |
| 608 | Ga0495646_0082479 | 3300046680 | Bacteria | 1871 |
| 609 | Ga0495646_0122619 | 3300046680 | Bacteria | 1469 |
| 610 | Ga0495647_0004707 | 3300046681 | Bacteria | 4451 |
| 611 | Ga0495658_0001230 | 3300046683 | Bacteria | 13450 |
| 612 | Ga0495658_0003103 | 3300046683 | Bacteria | 8305 |
| 613 | Ga0495658_0009091 | 3300046683 | Bacteria | 4940 |
| 614 | Ga0495613_0018718 | 3300046689 | Bacteria | 5164 |
| 615 | Ga0495613_0018898 | 3300046689 | Bacteria | 5133 |
| 616 | Ga0495624_0012799 | 3300046690 | Bacteria | 5728 |
| 617 | Ga0495624_0021657 | 3300046690 | Bacteria | 4260 |
| 618 | Ga0495624_0030650 | 3300046690 | Bacteria | 3501 |
| 619 | Ga0495624_0038097 | 3300046690 | Bacteria | 3090 |
| 620 | Ga0495624_0070078 | 3300046690 | Bacteria | 2183 |
| 621 | Ga0495600_0002019 | 3300046809 | Bacteria | 11414 |
| 622 | Ga0495600_0003438 | 3300046809 | Bacteria | 9308 |
| 623 | Ga0495600_0009486 | 3300046809 | Bacteria | 6016 |
| 624 | Ga0495600_0020118 | 3300046809 | Bacteria | 4269 |
| 625 | Ga0495600_0028588 | 3300046809 | Bacteria | 3607 |
| 626 | Ga0495600_0063964 | 3300046809 | Bacteria | 2404 |
| 627 | Ga0495600_0084737 | 3300046809 | Bacteria | 2068 |
| 628 | Ga0495600_0235223 | 3300046809 | Bacteria | 1168 |
| 629 | Ga0495581_0002552 | 3300047315 | Bacteria | 10335 |
| 630 | Ga0495581_0003056 | 3300047315 | Bacteria | 9582 |
| 631 | Ga0495581_0004566 | 3300047315 | Bacteria | 8001 |
| 632 | Ga0495581_0008812 | 3300047315 | Bacteria | 5839 |
| 633 | Ga0495581_0019126 | 3300047315 | Bacteria | 3976 |
| 634 | Ga0495604_0000046 | 3300047317 | Bacteria | 110553 |
| 635 | Ga0495604_0002188 | 3300047317 | Bacteria | 15682 |
| 636 | Ga0495604_0008319 | 3300047317 | Bacteria | 8204 |
| 637 | Ga0495604_0010113 | 3300047317 | Bacteria | 7474 |
| 638 | Ga0495604_0024752 | 3300047317 | Bacteria | 4789 |
| 639 | Ga0495604_0064366 | 3300047317 | Bacteria | 2794 |
| 640 | Ga0495604_0080912 | 3300047317 | Bacteria | 2433 |
| 641 | Ga0495604_0110212 | 3300047317 | Bacteria | 2008 |
| 642 | Ga0495674_0002355 | 3300047319 | Bacteria | 18525 |
| 643 | Ga0495674_0013056 | 3300047319 | Bacteria | 7818 |
| 644 | Ga0495674_0036791 | 3300047319 | Bacteria | 4402 |
| 645 | Ga0495674_0048295 | 3300047319 | Bacteria | 3766 |
| 646 | Ga0495674_0051728 | 3300047319 | Bacteria | 3620 |
| 647 | Ga0495674_0237211 | 3300047319 | Bacteria | 1504 |
| 648 | Ga0495674_0269650 | 3300047319 | Bacteria | 1397 |
| 649 | Ga0495676_0011421 | 3300047321 | Bacteria | 8017 |
| 650 | Ga0495676_0045228 | 3300047321 | Bacteria | 3585 |
| 651 | Ga0495680_0000108 | 3300047322 | Bacteria | 77095 |
| 652 | Ga0495680_0001141 | 3300047322 | Bacteria | 29263 |
| 653 | Ga0495680_0010102 | 3300047322 | Bacteria | 8440 |
| 654 | Ga0495680_0011952 | 3300047322 | Bacteria | 7662 |
| 655 | Ga0495680_0038937 | 3300047322 | Bacteria | 3796 |
| 656 | Ga0495680_0048420 | 3300047322 | Bacteria | 3337 |
| 657 | Ga0495680_0116620 | 3300047322 | Bacteria | 1974 |
| 658 | Ga0495680_0238994 | 3300047322 | Bacteria | 1291 |
| 659 | Ga0495675_0000119 | 3300047444 | Bacteria | 57079 |
| 660 | Ga0495675_0039220 | 3300047444 | Bacteria | 3016 |
| 661 | Ga0495684_0002594 | 3300047471 | Bacteria | 14368 |
| 662 | Ga0495684_0005128 | 3300047471 | Bacteria | 10221 |
| 663 | Ga0495684_0006104 | 3300047471 | Bacteria | 9375 |
| 664 | Ga0495684_0010060 | 3300047471 | Bacteria | 7311 |
| 665 | Ga0495684_0020457 | 3300047471 | Bacteria | 5100 |
| 666 | Ga0495684_0058809 | 3300047471 | Bacteria | 2927 |
| 667 | Ga0495684_0073968 | 3300047471 | Bacteria | 2588 |
| 668 | Ga0495684_0145479 | 3300047471 | Bacteria | 1775 |
| 669 | Ga0495684_0188075 | 3300047471 | Bacteria | 1528 |
| 670 | Ga0495593_0004694 | 3300047673 | Bacteria | 8127 |
| 671 | Ga0495593_0008869 | 3300047673 | Bacteria | 5835 |
| 672 | Ga0495593_0052120 | 3300047673 | Bacteria | 2163 |
| 673 | Ga0495602_0000167 | 3300048088 | Bacteria | 61216 |
| 674 | Ga0495602_0034111 | 3300048088 | Bacteria | 4765 |
| 675 | Ga0495602_0044948 | 3300048088 | Bacteria | 4001 |
| 676 | Ga0495602_0065731 | 3300048088 | Bacteria | 3128 |
| 677 | Ga0495602_0098847 | 3300048088 | Bacteria | 2400 |
| 678 | Ga0495602_0212290 | 3300048088 | Bacteria | 1468 |
| 679 | Ga0495602_0229833 | 3300048088 | Bacteria | 1394 |
| 680 | Ga0495614_0022151 | 3300048089 | Bacteria | 2743 |
| 681 | Ga0496100_0100777 | 3300048903 | Bacteria | 1990 |
| 682 | Ga0496100_0115773 | 3300048903 | Bacteria | 1870 |
| 683 | Ga0496101_0088556 | 3300048904 | Bacteria | 2299 |
| 684 | Ga0496101_0091124 | 3300048904 | Bacteria | 2268 |
| 685 | Ga0496101_0108107 | 3300048904 | Bacteria | 2090 |
| 686 | Ga0496101_0127464 | 3300048904 | Bacteria | 1930 |
| 687 | Ga0496102_0000147 | 3300048905 | Bacteria | 96295 |
| 688 | Ga0496102_0147343 | 3300048905 | Bacteria | 2210 |
| 689 | Ga0496103_0000261 | 3300048906 | Bacteria | 50634 |
| 690 | Ga0496103_0068858 | 3300048906 | Bacteria | 2211 |
| 691 | Ga0496104_0001309 | 3300048907 | Bacteria | 21482 |
| 692 | Ga0496104_0102892 | 3300048907 | Bacteria | 2736 |
| 693 | Ga0496105_0045715 | 3300048908 | Bacteria | 3613 |
| 694 | Ga0496106_0012056 | 3300048909 | Bacteria | 6378 |
| 695 | Ga0496106_0279793 | 3300048909 | Bacteria | 1337 |
| 696 | Ga0496107_0091730 | 3300048910 | Bacteria | 2221 |
| 697 | Ga0496108_0042972 | 3300048911 | Bacteria | 3774 |
| 698 | Ga0496108_0063912 | 3300048911 | Bacteria | 3100 |
| 699 | Ga0496108_0099244 | 3300048911 | Bacteria | 2482 |
| 700 | Ga0496108_0246669 | 3300048911 | Bacteria | 1553 |
| 701 | Ga0496109_0028955 | 3300048912 | Bacteria | 4959 |
| 702 | Ga0496109_0072212 | 3300048912 | Bacteria | 3170 |
| 703 | Ga0496109_0082139 | 3300048912 | Bacteria | 2969 |
| 704 | Ga0496110_0064629 | 3300048913 | Bacteria | 3234 |
| 705 | Ga0496110_0120957 | 3300048913 | Bacteria | 2358 |
| 706 | Ga0496110_0177955 | 3300048913 | Bacteria | 1931 |
| 707 | Ga0496111_0038261 | 3300048914 | Bacteria | 3437 |
| 708 | Ga0496112_0018864 | 3300048915 | Bacteria | 6498 |
| 709 | Ga0496112_0032245 | 3300048915 | Bacteria | 5087 |
| 710 | Ga0496113_0023422 | 3300048916 | Bacteria | 4378 |
| 711 | Ga0496113_0412306 | 3300048916 | Bacteria | 1085 |
| 712 | Ga0496114_0008833 | 3300048917 | Bacteria | 7987 |
| 713 | Ga0496115_0063797 | 3300048918 | Bacteria | 2972 |
| 714 | Ga0496115_0067725 | 3300048918 | Bacteria | 2888 |
| 715 | Ga0496116_0000425 | 3300048919 | Bacteria | 59407 |
| 716 | Ga0496117_0000274 | 3300048920 | Bacteria | 96150 |
| 717 | Ga0496118_0000602 | 3300048921 | Bacteria | 59438 |
| 718 | Ga0496119_0001483 | 3300048922 | Bacteria | 28127 |
| 719 | Ga0496119_0002434 | 3300048922 | Bacteria | 20442 |
| 720 | Ga0496120_0001510 | 3300048923 | Bacteria | 27511 |
| 721 | Ga0496120_0004006 | 3300048923 | Bacteria | 12796 |
| 722 | Ga0496121_0005158 | 3300048924 | Bacteria | 16971 |
| 723 | Ga0496124_0021894 | 3300048927 | Bacteria | 5879 |
| 724 | Ga0496125_0118334 | 3300048928 | Bacteria | 1897 |
| 725 | Ga0496126_0000419 | 3300048929 | Bacteria | 85931 |
| 726 | Ga0501042_0029142 | 3300049578 | Bacteria | 3893 |
| 727 | nmdc:mga05p37_15523_c1 | 3300050507 | Bacteria | 9156 |
| 728 | nmdc:mga08y16_224495_c1 | 3300050511 | Bacteria | 1944 |
| 729 | nmdc:mga08y16_284172_c1 | 3300050511 | Bacteria | 1706 |
| 730 | nmdc:mga0n895_16343_c1 | 3300050512 | Bacteria | 6805 |
| 731 | nmdc:mga0n895_211522_c1 | 3300050512 | Bacteria | 1970 |
| 732 | nmdc:mga0n895_226944_c1 | 3300050512 | Bacteria | 1896 |
| 733 | nmdc:mga0n895_336011_c1 | 3300050512 | Bacteria | 1530 |
| 734 | nmdc:mga0n895_343739_c1 | 3300050512 | Bacteria | 1511 |
| 735 | nmdc:mga0n895_40648_c1 | 3300050512 | Bacteria | 4518 |
| 736 | nmdc:mga0n895_53056_c1 | 3300050512 | Bacteria | 3982 |
| 737 | nmdc:mga0rr50_19140_c1 | 3300050513 | Bacteria | 4614 |
| 738 | nmdc:mga0rr50_3711_c1 | 3300050513 | Bacteria | 8847 |
| 739 | nmdc:mga0rr50_38836_c1 | 3300050513 | Bacteria | 3449 |
| 740 | nmdc:mga08x19_134478_c1 | 3300050514 | Bacteria | 1666 |
| 741 | nmdc:mga08x19_54296_c1 | 3300050514 | Bacteria | 2579 |
| 742 | nmdc:mga0a205_144637_c1 | 3300050515 | Bacteria | 2277 |
| 743 | nmdc:mga0a205_182263_c1 | 3300050515 | Bacteria | 1994 |
| 744 | nmdc:mga0a205_210299_c1 | 3300050515 | Bacteria | 1834 |
| 745 | nmdc:mga0a205_29022_c1 | 3300050515 | Bacteria | 5293 |
| 746 | Ga0495601_0011723 | 3300053077 | Bacteria | 5254 |
| 747 | Ga0495601_0038761 | 3300053077 | Bacteria | 2980 |
| 748 | Ga0495601_0061268 | 3300053077 | Bacteria | 2388 |
| 749 | Ga0495601_0121297 | 3300053077 | Bacteria | 1698 |
| 750 | Ga0495601_0303107 | 3300053077 | Bacteria | 1040 |
| 751 | Ga0495612_0046026 | 3300053078 | Bacteria | 1786 |
| 752 | Ga0495612_0085489 | 3300053078 | Bacteria | 1330 |
| 753 | Ga0495612_0090150 | 3300053078 | Bacteria | 1297 |
| 754 | Ga0495612_0091550 | 3300053078 | Bacteria | 1288 |
| 755 | Ga0495595_0000441 | 3300053084 | Bacteria | 15723 |
| 756 | Ga0495595_0025916 | 3300053084 | Bacteria | 2601 |
| 757 | Ga0495595_0027744 | 3300053084 | Bacteria | 2524 |
| 758 | Ga0495619_0001376 | 3300053085 | Bacteria | 16004 |
| 759 | Ga0495619_0025529 | 3300053085 | Bacteria | 3795 |
| 760 | Ga0495619_0051096 | 3300053085 | Bacteria | 2731 |
| 761 | Ga0495619_0054587 | 3300053085 | Bacteria | 2645 |
| 762 | Ga0495619_0197827 | 3300053085 | Unclassified | 1391 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300032126 | Ga0307415_100435911 | Ga0307415_1004359112 | 260 |
| 2 | 3300038443 | Ga0395901_0000675 | Ga0395901_0000675_29836_30825 | 285 |
| 3 | 3300037853 | Ga0436364_0684862 | Ga0436364_0684862_122_1105 | 298 |
| 4 | 3300006028 | Ga0070717_10152460 | Ga0070717_101524602 | 299 |
| 5 | 3300005530 | Ga0070679_100168529 | Ga0070679_1001685292 | 300 |
| 6 | 3300005614 | Ga0068856_100530009 | Ga0068856_1005300092 | 300 |
| 7 | 3300005840 | Ga0068870_10034090 | Ga0068870_100340903 | 300 |
| 8 | 3300005841 | Ga0068863_100228187 | Ga0068863_1002281872 | 300 |
| 9 | 3300005842 | Ga0068858_100346033 | Ga0068858_1003460332 | 300 |
| 10 | 3300009174 | Ga0105241_10049814 | Ga0105241_100498144 | 300 |
| 11 | 3300025908 | Ga0207643_10004651 | Ga0207643_100046516 | 300 |
| 12 | 3300005329 | Ga0070683_100228010 | Ga0070683_1002280102 | 302 |
| 13 | 3300005535 | Ga0070684_100087998 | Ga0070684_1000879983 | 302 |
| 14 | 3300009551 | Ga0105238_10352983 | Ga0105238_103529832 | 302 |
| 15 | 3300025919 | Ga0207657_10175370 | Ga0207657_101753701 | 302 |
| 16 | 3300025944 | Ga0207661_10047456 | Ga0207661_100474562 | 302 |
| 17 | 3300025981 | Ga0207640_10060440 | Ga0207640_100604403 | 302 |
| 18 | 3300031344 | Ga0265316_10112549 | Ga0265316_101125491 | 304 |
| 19 | 3300046559 | Ga0495667_0038149 | Ga0495667_0038149_2224_3174 | 305 |
| 20 | 3300046559 | Ga0495667_0059364 | Ga0495667_0059364_554_1630 | 305 |
| 21 | 3300035111 | Ga0373923_0020460 | Ga0373923_0020460_172_1233 | 306 |
| 22 | 3300035120 | Ga0373957_0021174 | Ga0373957_0021174_1158_2234 | 306 |
| 23 | 3300035410 | Ga0373924_0007457 | Ga0373924_0007457_1403_2464 | 306 |
| 24 | 3300036401 | Ga0373937_0104712 | Ga0373937_0104712_72_1133 | 306 |
| 25 | 3300046529 | Ga0495652_0088918 | Ga0495652_0088918_19_1080 | 306 |
| 26 | 3300047322 | Ga0495680_0116620 | Ga0495680_0116620_848_1924 | 306 |
| 27 | 3300047471 | Ga0495684_0005128 | Ga0495684_0005128_5850_6926 | 306 |
| 28 | 3300053085 | Ga0495619_0054587 | Ga0495619_0054587_436_1512 | 306 |
| 29 | 3300005471 | Ga0070698_100002430 | Ga0070698_10000243016 | 307 |
| 30 | 3300035724 | Ga0373933_0024733 | Ga0373933_0024733_2200_3261 | 307 |
| 31 | 3300044658 | Ga0466972_0029415 | Ga0466972_0029415_770_1750 | 307 |
| 32 | 3300044683 | Ga0466965_0001449 | Ga0466965_0001449_826_1806 | 307 |
| 33 | 3300044765 | Ga0466970_0038436 | Ga0466970_0038436_1055_2035 | 307 |
| 34 | 3300044901 | Ga0466960_0000278 | Ga0466960_0000278_1567_2547 | 307 |
| 35 | 3300045976 | Ga0466967_0143573 | Ga0466967_0143573_995_1975 | 307 |
| 36 | 3300046678 | Ga0495599_0172506 | Ga0495599_0172506_271_1203 | 307 |
| 37 | 3300005434 | Ga0070709_10009428 | Ga0070709_100094283 | 308 |
| 38 | 3300005437 | Ga0070710_10004883 | Ga0070710_100048833 | 308 |
| 39 | 3300005445 | Ga0070708_100039435 | Ga0070708_1000394353 | 308 |
| 40 | 3300005467 | Ga0070706_100012966 | Ga0070706_1000129665 | 308 |
| 41 | 3300005471 | Ga0070698_100020690 | Ga0070698_1000206902 | 308 |
| 42 | 3300005536 | Ga0070697_100013155 | Ga0070697_1000131553 | 308 |
| 43 | 3300006028 | Ga0070717_10083684 | Ga0070717_100836842 | 308 |
| 44 | 3300006173 | Ga0070716_100102300 | Ga0070716_1001023002 | 308 |
| 45 | 3300025906 | Ga0207699_10031439 | Ga0207699_100314392 | 308 |
| 46 | 3300025910 | Ga0207684_10017737 | Ga0207684_100177374 | 308 |
| 47 | 3300025922 | Ga0207646_10012951 | Ga0207646_100129511 | 308 |
| 48 | 3300025939 | Ga0207665_10132730 | Ga0207665_101327302 | 308 |
| 49 | 3300029957 | Ga0265324_10006155 | Ga0265324_100061554 | 308 |
| 50 | 3300031240 | Ga0265320_10006561 | Ga0265320_100065618 | 308 |
| 51 | 3300031241 | Ga0265325_10177202 | Ga0265325_101772021 | 308 |
| 52 | 3300031242 | Ga0265329_10009577 | Ga0265329_100095777 | 308 |
| 53 | 3300031250 | Ga0265331_10030462 | Ga0265331_100304625 | 308 |
| 54 | 3300031344 | Ga0265316_10135504 | Ga0265316_101355042 | 308 |
| 55 | 3300031711 | Ga0265314_10021773 | Ga0265314_100217737 | 308 |
| 56 | 3300035113 | Ga0373936_0015154 | Ga0373936_0015154_1445_2521 | 308 |
| 57 | 3300035117 | Ga0373953_0002744 | Ga0373953_0002744_460_1521 | 308 |
| 58 | 3300035172 | Ga0373955_0002512 | Ga0373955_0002512_3606_4667 | 308 |
| 59 | 3300035692 | Ga0373935_0054162 | Ga0373935_0054162_115_1176 | 308 |
| 60 | 3300046476 | Ga0495662_0027735 | Ga0495662_0027735_655_1731 | 308 |
| 61 | 3300046533 | Ga0495640_0010262 | Ga0495640_0010262_734_1810 | 308 |
| 62 | 3300046642 | Ga0495634_0014943 | Ga0495634_0014943_3754_4830 | 308 |
| 63 | 3300046663 | Ga0495635_0035952 | Ga0495635_0035952_1676_2752 | 308 |
| 64 | 3300046680 | Ga0495646_0006309 | Ga0495646_0006309_4064_5125 | 308 |
| 65 | 3300047319 | Ga0495674_0237211 | Ga0495674_0237211_492_1424 | 308 |
| 66 | 3300045976 | Ga0466967_0007489 | Ga0466967_0007489_4810_5799 | 310 |
| 67 | 3300039438 | Ga0436360_1310721 | Ga0436360_1310721_379_1317 | 311 |
| 68 | 3300039447 | Ga0436361_0791607 | Ga0436361_0791607_187_1125 | 311 |
| 69 | 3300039453 | Ga0436362_0617347 | Ga0436362_0617347_5432_6370 | 311 |
| 70 | 3300025929 | Ga0207664_10276052 | Ga0207664_102760522 | 314 |
| 71 | 3300046511 | Ga0495608_0007778 | Ga0495608_0007778_4789_5769 | 315 |
| 72 | 3300047317 | Ga0495604_0080912 | Ga0495604_0080912_1003_1983 | 315 |
| 73 | 3300053084 | Ga0495595_0025916 | Ga0495595_0025916_920_1900 | 315 |
| 74 | 3300053085 | Ga0495619_0197827 | Ga0495619_0197827_177_1157 | 315 |
| 75 | iso_pu_bacteria | 2818991318 | 2819428681 | 315 |
| 76 | iso_pu_bacteria | 2915358134 | 2915361906 | 315 |
| 77 | iso_pu_bacteria | 8054472261 | 8054477316 | 315 |
| 78 | 3300005434 | Ga0070709_10003910 | Ga0070709_100039101 | 316 |
| 79 | 3300005437 | Ga0070710_10000904 | Ga0070710_1000090413 | 316 |
| 80 | 3300005437 | Ga0070710_10064110 | Ga0070710_100641103 | 316 |
| 81 | 3300005437 | Ga0070710_10134454 | Ga0070710_101344542 | 316 |
| 82 | 3300005439 | Ga0070711_100009717 | Ga0070711_1000097171 | 316 |
| 83 | 3300005439 | Ga0070711_100257822 | Ga0070711_1002578222 | 316 |
| 84 | 3300005445 | Ga0070708_100016030 | Ga0070708_1000160306 | 316 |
| 85 | 3300005467 | Ga0070706_100108556 | Ga0070706_1001085562 | 316 |
| 86 | 3300005468 | Ga0070707_100001468 | Ga0070707_10000146817 | 316 |
| 87 | 3300005468 | Ga0070707_100079896 | Ga0070707_1000798962 | 316 |
| 88 | 3300005471 | Ga0070698_100002351 | Ga0070698_10000235120 | 316 |
| 89 | 3300005518 | Ga0070699_100011087 | Ga0070699_1000110875 | 316 |
| 90 | 3300005535 | Ga0070684_100166004 | Ga0070684_1001660042 | 316 |
| 91 | 3300006028 | Ga0070717_10017635 | Ga0070717_100176352 | 316 |
| 92 | 3300006173 | Ga0070716_100003549 | Ga0070716_1000035494 | 316 |
| 93 | 3300006175 | Ga0070712_100019088 | Ga0070712_1000190884 | 316 |
| 94 | 3300024225 | Ga0224572_1001884 | Ga0224572_10018843 | 316 |
| 95 | 3300025906 | Ga0207699_10010354 | Ga0207699_100103541 | 316 |
| 96 | 3300025910 | Ga0207684_10066624 | Ga0207684_100666242 | 316 |
| 97 | 3300025915 | Ga0207693_10125228 | Ga0207693_101252282 | 316 |
| 98 | 3300025916 | Ga0207663_10253087 | Ga0207663_102530871 | 316 |
| 99 | 3300025922 | Ga0207646_10005267 | Ga0207646_100052673 | 316 |
| 100 | 3300025922 | Ga0207646_10012021 | Ga0207646_100120214 | 316 |
| 101 | 3300025928 | Ga0207700_10006097 | Ga0207700_100060975 | 316 |
| 102 | 3300025929 | Ga0207664_10048722 | Ga0207664_100487224 | 316 |
| 103 | 3300025929 | Ga0207664_10080519 | Ga0207664_100805192 | 316 |
| 104 | 3300035083 | Ga0373926_0005963 | Ga0373926_0005963_1498_2475 | 316 |
| 105 | 3300035086 | Ga0373934_0000004 | Ga0373934_0000004_18378_19370 | 316 |
| 106 | 3300035089 | Ga0373944_0002650 | Ga0373944_0002650_3093_4070 | 316 |
| 107 | 3300035113 | Ga0373936_0000220 | Ga0373936_0000220_2989_3966 | 316 |
| 108 | 3300035113 | Ga0373936_0012695 | Ga0373936_0012695_79_1071 | 316 |
| 109 | 3300035116 | Ga0373945_0000244 | Ga0373945_0000244_10970_11947 | 316 |
| 110 | 3300035117 | Ga0373953_0017686 | Ga0373953_0017686_236_1228 | 316 |
| 111 | 3300035118 | Ga0373954_0002885 | Ga0373954_0002885_4890_5882 | 316 |
| 112 | 3300035119 | Ga0373956_0000601 | Ga0373956_0000601_6129_7121 | 316 |
| 113 | 3300035120 | Ga0373957_0001123 | Ga0373957_0001123_261_1253 | 316 |
| 114 | 3300035170 | Ga0373943_0000328 | Ga0373943_0000328_1823_2800 | 316 |
| 115 | 3300035171 | Ga0373946_0000075 | Ga0373946_0000075_25673_26650 | 316 |
| 116 | 3300035172 | Ga0373955_0000025 | Ga0373955_0000025_35319_36311 | 316 |
| 117 | 3300035172 | Ga0373955_0233813 | Ga0373955_0233813_112_1089 | 316 |
| 118 | 3300035410 | Ga0373924_0010732 | Ga0373924_0010732_190_1182 | 316 |
| 119 | 3300035692 | Ga0373935_0108878 | Ga0373935_0108878_273_1265 | 316 |
| 120 | 3300035695 | Ga0373927_0001015 | Ga0373927_0001015_5981_6958 | 316 |
| 121 | 3300035724 | Ga0373933_0000119 | Ga0373933_0000119_22022_23014 | 316 |
| 122 | 3300036401 | Ga0373937_0000306 | Ga0373937_0000306_23197_24189 | 316 |
| 123 | 3300037068 | Ga0373925_0014178 | Ga0373925_0014178_2421_3398 | 316 |
| 124 | 3300046454 | Ga0495592_0000200 | Ga0495592_0000200_22041_23033 | 316 |
| 125 | 3300046461 | Ga0495641_0038424 | Ga0495641_0038424_848_1825 | 316 |
| 126 | 3300046462 | Ga0495651_0000151 | Ga0495651_0000151_27996_28988 | 316 |
| 127 | 3300046462 | Ga0495651_0013256 | Ga0495651_0013256_3365_4342 | 316 |
| 128 | 3300046463 | Ga0495653_0006911 | Ga0495653_0006911_2926_3918 | 316 |
| 129 | 3300046475 | Ga0495639_0034631 | Ga0495639_0034631_149_1126 | 316 |
| 130 | 3300046476 | Ga0495662_0005224 | Ga0495662_0005224_667_1644 | 316 |
| 131 | 3300046477 | Ga0495664_0000170 | Ga0495664_0000170_27164_28141 | 316 |
| 132 | 3300046511 | Ga0495608_0000147 | Ga0495608_0000147_27961_28953 | 316 |
| 133 | 3300046511 | Ga0495608_0057961 | Ga0495608_0057961_310_1287 | 316 |
| 134 | 3300046514 | Ga0495618_0004682 | Ga0495618_0004682_6058_7035 | 316 |
| 135 | 3300046516 | Ga0495628_0000753 | Ga0495628_0000753_22756_23748 | 316 |
| 136 | 3300046516 | Ga0495628_0149645 | Ga0495628_0149645_538_1509 | 316 |
| 137 | 3300046516 | Ga0495628_0166989 | Ga0495628_0166989_383_1360 | 316 |
| 138 | 3300046517 | Ga0495630_0003909 | Ga0495630_0003909_8873_9850 | 316 |
| 139 | 3300046529 | Ga0495652_0000276 | Ga0495652_0000276_37585_38577 | 316 |
| 140 | 3300046531 | Ga0495665_0011845 | Ga0495665_0011845_495_1472 | 316 |
| 141 | 3300046536 | Ga0495587_0000045 | Ga0495587_0000045_21088_22080 | 316 |
| 142 | 3300046543 | Ga0495645_0055998 | Ga0495645_0055998_684_1655 | 316 |
| 143 | 3300046559 | Ga0495667_0000051 | Ga0495667_0000051_22015_23007 | 316 |
| 144 | 3300046642 | Ga0495634_0089820 | Ga0495634_0089820_700_1677 | 316 |
| 145 | 3300046663 | Ga0495635_0006196 | Ga0495635_0006196_3331_4308 | 316 |
| 146 | 3300046663 | Ga0495635_0096216 | Ga0495635_0096216_866_1858 | 316 |
| 147 | 3300046675 | Ga0495657_0000044 | Ga0495657_0000044_21111_22103 | 316 |
| 148 | 3300046675 | Ga0495657_0018258 | Ga0495657_0018258_319_1296 | 316 |
| 149 | 3300046678 | Ga0495599_0000101 | Ga0495599_0000101_37467_38459 | 316 |
| 150 | 3300046678 | Ga0495599_0025541 | Ga0495599_0025541_115_1092 | 316 |
| 151 | 3300046679 | Ga0495623_0001529 | Ga0495623_0001529_8469_9461 | 316 |
| 152 | 3300046680 | Ga0495646_0060322 | Ga0495646_0060322_1086_2078 | 316 |
| 153 | 3300046690 | Ga0495624_0030650 | Ga0495624_0030650_1843_2820 | 316 |
| 154 | 3300046809 | Ga0495600_0003438 | Ga0495600_0003438_7039_8031 | 316 |
| 155 | 3300047317 | Ga0495604_0000046 | Ga0495604_0000046_22021_23013 | 316 |
| 156 | 3300047319 | Ga0495674_0002355 | Ga0495674_0002355_10421_11398 | 316 |
| 157 | 3300047321 | Ga0495676_0045228 | Ga0495676_0045228_1363_2340 | 316 |
| 158 | 3300047322 | Ga0495680_0000108 | Ga0495680_0000108_22042_23034 | 316 |
| 159 | 3300047322 | Ga0495680_0011952 | Ga0495680_0011952_408_1385 | 316 |
| 160 | 3300047444 | Ga0495675_0000119 | Ga0495675_0000119_54021_55013 | 316 |
| 161 | 3300047471 | Ga0495684_0002594 | Ga0495684_0002594_1045_2022 | 316 |
| 162 | 3300048088 | Ga0495602_0000167 | Ga0495602_0000167_6207_7199 | 316 |
| 163 | 3300050512 | nmdc:mga0n895_336011_c1 | nmdc:mga0n895_336011_c1_334_1404 | 316 |
| 164 | 3300053078 | Ga0495612_0085489 | Ga0495612_0085489_19_996 | 316 |
| 165 | 3300053084 | Ga0495595_0000441 | Ga0495595_0000441_8555_9547 | 316 |
| 166 | 3300005467 | Ga0070706_100027455 | Ga0070706_1000274553 | 317 |
| 167 | 3300005468 | Ga0070707_100000391 | Ga0070707_10000039126 | 317 |
| 168 | 3300005471 | Ga0070698_100000459 | Ga0070698_10000045926 | 317 |
| 169 | 3300025910 | Ga0207684_10020340 | Ga0207684_100203403 | 317 |
| 170 | 3300025922 | Ga0207646_10000721 | Ga0207646_1000072123 | 317 |
| 171 | 3300035086 | Ga0373934_0011407 | Ga0373934_0011407_162_1154 | 317 |
| 172 | 3300035724 | Ga0373933_0064226 | Ga0373933_0064226_702_1694 | 317 |
| 173 | 3300037068 | Ga0373925_0063822 | Ga0373925_0063822_584_1576 | 317 |
| 174 | 3300046462 | Ga0495651_0060843 | Ga0495651_0060843_1668_2660 | 317 |
| 175 | 3300046463 | Ga0495653_0015770 | Ga0495653_0015770_1392_2384 | 317 |
| 176 | 3300046511 | Ga0495608_0018624 | Ga0495608_0018624_2922_3914 | 317 |
| 177 | 3300046529 | Ga0495652_0183517 | Ga0495652_0183517_454_1446 | 317 |
| 178 | 3300046536 | Ga0495587_0089957 | Ga0495587_0089957_607_1599 | 317 |
| 179 | 3300046559 | Ga0495667_0009637 | Ga0495667_0009637_5356_6348 | 317 |
| 180 | 3300046663 | Ga0495635_0068783 | Ga0495635_0068783_541_1533 | 317 |
| 181 | 3300046809 | Ga0495600_0063964 | Ga0495600_0063964_916_1908 | 317 |
| 182 | 3300047319 | Ga0495674_0269650 | Ga0495674_0269650_133_1125 | 317 |
| 183 | 3300047471 | Ga0495684_0145479 | Ga0495684_0145479_651_1643 | 317 |
| 184 | 3300048916 | Ga0496113_0412306 | Ga0496113_0412306_68_1045 | 317 |
| 185 | 3300005347 | Ga0070668_100106358 | Ga0070668_1001063582 | 318 |
| 186 | 3300005548 | Ga0070665_100011840 | Ga0070665_1000118402 | 318 |
| 187 | 3300005841 | Ga0068863_100128422 | Ga0068863_1001284222 | 318 |
| 188 | 3300005843 | Ga0068860_100003227 | Ga0068860_10000322721 | 318 |
| 189 | 3300014968 | Ga0157379_10014328 | Ga0157379_100143283 | 318 |
| 190 | 3300025906 | Ga0207699_10144210 | Ga0207699_101442102 | 318 |
| 191 | 3300025915 | Ga0207693_10018028 | Ga0207693_100180282 | 318 |
| 192 | 3300025916 | Ga0207663_10200169 | Ga0207663_102001692 | 318 |
| 193 | 3300025929 | Ga0207664_10148383 | Ga0207664_101483832 | 318 |
| 194 | 3300025931 | Ga0207644_10066237 | Ga0207644_100662372 | 318 |
| 195 | 3300025939 | Ga0207665_10146339 | Ga0207665_101463392 | 318 |
| 196 | 3300025972 | Ga0207668_10100081 | Ga0207668_101000812 | 318 |
| 197 | 3300026088 | Ga0207641_10111644 | Ga0207641_101116442 | 318 |
| 198 | 3300028379 | Ga0268266_10113261 | Ga0268266_101132612 | 318 |
| 199 | 3300028381 | Ga0268264_10009372 | Ga0268264_100093725 | 318 |
| 200 | 3300035410 | Ga0373924_0013650 | Ga0373924_0013650_418_1395 | 318 |
| 201 | 3300045976 | Ga0466967_0161677 | Ga0466967_0161677_880_1857 | 318 |
| 202 | 3300046533 | Ga0495640_0124688 | Ga0495640_0124688_53_1045 | 318 |
| 203 | 3300047315 | Ga0495581_0019126 | Ga0495581_0019126_2985_3962 | 318 |
| 204 | 3300047317 | Ga0495604_0024752 | Ga0495604_0024752_3720_4712 | 318 |
| 205 | 3300048088 | Ga0495602_0044948 | Ga0495602_0044948_2151_3143 | 318 |
| 206 | 3300048904 | Ga0496101_0108107 | Ga0496101_0108107_681_1658 | 318 |
| 207 | 3300048905 | Ga0496102_0000147 | Ga0496102_0000147_48783_49760 | 318 |
| 208 | 3300048906 | Ga0496103_0000261 | Ga0496103_0000261_3163_4140 | 318 |
| 209 | 3300048907 | Ga0496104_0102892 | Ga0496104_0102892_1386_2363 | 318 |
| 210 | 3300048908 | Ga0496105_0045715 | Ga0496105_0045715_2129_3106 | 318 |
| 211 | 3300048913 | Ga0496110_0177955 | Ga0496110_0177955_449_1426 | 318 |
| 212 | 3300048919 | Ga0496116_0000425 | Ga0496116_0000425_11948_12925 | 318 |
| 213 | 3300048920 | Ga0496117_0000274 | Ga0496117_0000274_83226_84203 | 318 |
| 214 | 3300048921 | Ga0496118_0000602 | Ga0496118_0000602_11948_12925 | 318 |
| 215 | 3300048922 | Ga0496119_0002434 | Ga0496119_0002434_7325_8302 | 318 |
| 216 | 3300048923 | Ga0496120_0004006 | Ga0496120_0004006_11366_12343 | 318 |
| 217 | 3300048924 | Ga0496121_0005158 | Ga0496121_0005158_11934_12911 | 318 |
| 218 | 3300048927 | Ga0496124_0021894 | Ga0496124_0021894_2786_3763 | 318 |
| 219 | 3300048928 | Ga0496125_0118334 | Ga0496125_0118334_888_1865 | 318 |
| 220 | 3300048929 | Ga0496126_0000419 | Ga0496126_0000419_48341_49318 | 318 |
| 221 | iso_pu_bacteria | 2501939600 | 2501944684 | 318 |
| 222 | iso_pu_bacteria | 2622736626 | 2623586825 | 318 |
| 223 | iso_pu_bacteria | 2626541554 | 2626637038 | 318 |
| 224 | iso_pu_bacteria | 2687453743 | 2689989899 | 318 |
| 225 | iso_pu_bacteria | 2831935698 | 2831938353 | 318 |
| 226 | iso_pu_bacteria | 2832004796 | 2832006443 | 318 |
| 227 | iso_pu_bacteria | 2858868258 | 2858872291 | 318 |
| 228 | iso_pu_bacteria | 2866065130 | 2866065601 | 318 |
| 229 | iso_pu_bacteria | 2867507094 | 2867511155 | 318 |
| 230 | iso_pu_bacteria | 2902582711 | 2902585539 | 318 |
| 231 | iso_pu_bacteria | 8003856774 | 8003859845 | 318 |
| 232 | iso_pu_bacteria | 8055412473 | 8055413433 | 318 |
| 233 | 3300031548 | Ga0307408_100033730 | Ga0307408_1000337303 | 319 |
| 234 | 3300031731 | Ga0307405_10242280 | Ga0307405_102422802 | 319 |
| 235 | 3300031852 | Ga0307410_10318765 | Ga0307410_103187652 | 319 |
| 236 | 3300031901 | Ga0307406_10021130 | Ga0307406_100211302 | 319 |
| 237 | 3300031901 | Ga0307406_10319316 | Ga0307406_103193162 | 319 |
| 238 | 3300032002 | Ga0307416_100440234 | Ga0307416_1004402342 | 319 |
| 239 | 3300032002 | Ga0307416_100442983 | Ga0307416_1004429832 | 319 |
| 240 | 3300039450 | Ga0436363_0349552 | Ga0436363_0349552_75_1040 | 319 |
| 241 | 3300045049 | Ga0466959_0092827 | Ga0466959_0092827_489_1457 | 319 |
| 242 | iso_pu_bacteria | 2527291627 | 2528204734 | 319 |
| 243 | iso_pu_bacteria | 2527291629 | 2528214750 | 319 |
| 244 | iso_pu_bacteria | 2546825537 | 2546949698 | 319 |
| 245 | iso_pu_bacteria | 2576861822 | 2579750602 | 319 |
| 246 | iso_pu_bacteria | 2579778521 | 2579856964 | 319 |
| 247 | iso_pu_bacteria | 2619618881 | 2619858276 | 319 |
| 248 | iso_pu_bacteria | 2619619003 | 2620352879 | 319 |
| 249 | iso_pu_bacteria | 2684623036 | 2686544519 | 319 |
| 250 | iso_pu_bacteria | 2710264753 | 2710602894 | 319 |
| 251 | iso_pu_bacteria | 2773857924 | 2774867850 | 319 |
| 252 | iso_pu_bacteria | 637000116 | 637880226 | 319 |
| 253 | iso_pu_bacteria | 8054913762 | 8054915940 | 319 |
| 254 | iso_pu_bacteria | 8054920844 | 8054926375 | 319 |
| 255 | 3300005327 | Ga0070658_10307055 | Ga0070658_103070551 | 320 |
| 256 | 3300005338 | Ga0068868_100263811 | Ga0068868_1002638111 | 320 |
| 257 | 3300005347 | Ga0070668_100316061 | Ga0070668_1003160611 | 320 |
| 258 | 3300005435 | Ga0070714_100037540 | Ga0070714_1000375403 | 320 |
| 259 | 3300005435 | Ga0070714_100190821 | Ga0070714_1001908211 | 320 |
| 260 | 3300005436 | Ga0070713_100190692 | Ga0070713_1001906922 | 320 |
| 261 | 3300005577 | Ga0068857_100181637 | Ga0068857_1001816372 | 320 |
| 262 | 3300006871 | Ga0075434_100199751 | Ga0075434_1001997512 | 320 |
| 263 | 3300009098 | Ga0105245_10125987 | Ga0105245_101259873 | 320 |
| 264 | 3300009147 | Ga0114129_10272082 | Ga0114129_102720822 | 320 |
| 265 | 3300013308 | Ga0157375_10075052 | Ga0157375_100750523 | 320 |
| 266 | 3300014326 | Ga0157380_10327205 | Ga0157380_103272052 | 320 |
| 267 | 3300025901 | Ga0207688_10030693 | Ga0207688_100306933 | 320 |
| 268 | 3300025908 | Ga0207643_10142162 | Ga0207643_101421621 | 320 |
| 269 | 3300025915 | Ga0207693_10140956 | Ga0207693_101409562 | 320 |
| 270 | 3300025927 | Ga0207687_10274042 | Ga0207687_102740422 | 320 |
| 271 | 3300025928 | Ga0207700_10119208 | Ga0207700_101192082 | 320 |
| 272 | 3300025932 | Ga0207690_10257544 | Ga0207690_102575442 | 320 |
| 273 | 3300025936 | Ga0207670_10368777 | Ga0207670_103687771 | 320 |
| 274 | 3300026067 | Ga0207678_10124754 | Ga0207678_101247542 | 320 |
| 275 | 3300026075 | Ga0207708_10155506 | Ga0207708_101555062 | 320 |
| 276 | 3300028379 | Ga0268266_10364858 | Ga0268266_103648582 | 320 |
| 277 | 3300044694 | Ga0466963_0140320 | Ga0466963_0140320_13_981 | 320 |
| 278 | 3300045976 | Ga0466967_0168385 | Ga0466967_0168385_248_1216 | 320 |
| 279 | 3300046678 | Ga0495599_0235241 | Ga0495599_0235241_29_1096 | 320 |
| 280 | 3300048911 | Ga0496108_0063912 | Ga0496108_0063912_1459_2436 | 320 |
| 281 | 3300048912 | Ga0496109_0072212 | Ga0496109_0072212_755_1732 | 320 |
| 282 | 3300050511 | nmdc:mga08y16_284172_c1 | nmdc:mga08y16_284172_c1_97_1077 | 320 |
| 283 | 3300050512 | nmdc:mga0n895_343739_c1 | nmdc:mga0n895_343739_c1_365_1435 | 320 |
| 284 | 3300050512 | nmdc:mga0n895_53056_c1 | nmdc:mga0n895_53056_c1_1341_2387 | 320 |
| 285 | 3300005329 | Ga0070683_100054857 | Ga0070683_1000548572 | 321 |
| 286 | 3300005330 | Ga0070690_100148548 | Ga0070690_1001485481 | 321 |
| 287 | 3300005331 | Ga0070670_100065443 | Ga0070670_1000654432 | 321 |
| 288 | 3300005334 | Ga0068869_100019345 | Ga0068869_1000193453 | 321 |
| 289 | 3300005335 | Ga0070666_10238081 | Ga0070666_102380811 | 321 |
| 290 | 3300005338 | Ga0068868_100119303 | Ga0068868_1001193032 | 321 |
| 291 | 3300005347 | Ga0070668_100019088 | Ga0070668_1000190885 | 321 |
| 292 | 3300005353 | Ga0070669_100114824 | Ga0070669_1001148242 | 321 |
| 293 | 3300005354 | Ga0070675_100039028 | Ga0070675_1000390282 | 321 |
| 294 | 3300005355 | Ga0070671_100156235 | Ga0070671_1001562352 | 321 |
| 295 | 3300005356 | Ga0070674_100182536 | Ga0070674_1001825362 | 321 |
| 296 | 3300005364 | Ga0070673_100197168 | Ga0070673_1001971681 | 321 |
| 297 | 3300005366 | Ga0070659_100039455 | Ga0070659_1000394553 | 321 |
| 298 | 3300005455 | Ga0070663_100034948 | Ga0070663_1000349482 | 321 |
| 299 | 3300005457 | Ga0070662_100046033 | Ga0070662_1000460332 | 321 |
| 300 | 3300005466 | Ga0070685_10015905 | Ga0070685_100159052 | 321 |
| 301 | 3300005466 | Ga0070685_10064927 | Ga0070685_100649272 | 321 |
| 302 | 3300005535 | Ga0070684_100159388 | Ga0070684_1001593882 | 321 |
| 303 | 3300005543 | Ga0070672_100171136 | Ga0070672_1001711362 | 321 |
| 304 | 3300005564 | Ga0070664_100073571 | Ga0070664_1000735712 | 321 |
| 305 | 3300005578 | Ga0068854_100043970 | Ga0068854_1000439703 | 321 |
| 306 | 3300005616 | Ga0068852_100015035 | Ga0068852_1000150358 | 321 |
| 307 | 3300005617 | Ga0068859_100233854 | Ga0068859_1002338542 | 321 |
| 308 | 3300005618 | Ga0068864_100138350 | Ga0068864_1001383502 | 321 |
| 309 | 3300005842 | Ga0068858_100051466 | Ga0068858_1000514663 | 321 |
| 310 | 3300005844 | Ga0068862_100053879 | Ga0068862_1000538793 | 321 |
| 311 | 3300006844 | Ga0075428_100000006 | Ga0075428_10000000629 | 321 |
| 312 | 3300006931 | Ga0097620_100233858 | Ga0097620_1002338582 | 321 |
| 313 | 3300009094 | Ga0111539_10058886 | Ga0111539_100588862 | 321 |
| 314 | 3300009101 | Ga0105247_10057860 | Ga0105247_100578602 | 321 |
| 315 | 3300009148 | Ga0105243_10192998 | Ga0105243_101929982 | 321 |
| 316 | 3300009545 | Ga0105237_10038697 | Ga0105237_100386972 | 321 |
| 317 | 3300013296 | Ga0157374_10119354 | Ga0157374_101193542 | 321 |
| 318 | 3300013306 | Ga0163162_10118115 | Ga0163162_101181152 | 321 |
| 319 | 3300013307 | Ga0157372_10331052 | Ga0157372_103310522 | 321 |
| 320 | 3300013308 | Ga0157375_10110925 | Ga0157375_101109254 | 321 |
| 321 | 3300014325 | Ga0163163_10490122 | Ga0163163_104901221 | 321 |
| 322 | 3300014968 | Ga0157379_10052116 | Ga0157379_100521164 | 321 |
| 323 | 3300021384 | Ga0213876_10025033 | Ga0213876_100250332 | 321 |
| 324 | 3300025900 | Ga0207710_10008820 | Ga0207710_100088207 | 321 |
| 325 | 3300025901 | Ga0207688_10030605 | Ga0207688_100306052 | 321 |
| 326 | 3300025901 | Ga0207688_10049544 | Ga0207688_100495441 | 321 |
| 327 | 3300025904 | Ga0207647_10106216 | Ga0207647_101062162 | 321 |
| 328 | 3300025908 | Ga0207643_10181117 | Ga0207643_101811171 | 321 |
| 329 | 3300025909 | Ga0207705_10195211 | Ga0207705_101952112 | 321 |
| 330 | 3300025919 | Ga0207657_10042914 | Ga0207657_100429143 | 321 |
| 331 | 3300025923 | Ga0207681_10203370 | Ga0207681_102033702 | 321 |
| 332 | 3300025925 | Ga0207650_10061064 | Ga0207650_100610642 | 321 |
| 333 | 3300025933 | Ga0207706_10036934 | Ga0207706_100369344 | 321 |
| 334 | 3300025935 | Ga0207709_10071177 | Ga0207709_100711772 | 321 |
| 335 | 3300025940 | Ga0207691_10052809 | Ga0207691_100528093 | 321 |
| 336 | 3300025942 | Ga0207689_10065141 | Ga0207689_100651412 | 321 |
| 337 | 3300025972 | Ga0207668_10029215 | Ga0207668_100292153 | 321 |
| 338 | 3300025981 | Ga0207640_10123878 | Ga0207640_101238782 | 321 |
| 339 | 3300026067 | Ga0207678_10045539 | Ga0207678_100455392 | 321 |
| 340 | 3300026067 | Ga0207678_10078837 | Ga0207678_100788372 | 321 |
| 341 | 3300026075 | Ga0207708_10030437 | Ga0207708_100304376 | 321 |
| 342 | 3300026089 | Ga0207648_10044613 | Ga0207648_100446134 | 321 |
| 343 | 3300026118 | Ga0207675_100069866 | Ga0207675_1000698662 | 321 |
| 344 | 3300026121 | Ga0207683_10052998 | Ga0207683_100529983 | 321 |
| 345 | 3300027907 | Ga0207428_10238015 | Ga0207428_102380152 | 321 |
| 346 | 3300031824 | Ga0307413_10028882 | Ga0307413_100288823 | 321 |
| 347 | 3300032005 | Ga0307411_10174750 | Ga0307411_101747502 | 321 |
| 348 | 3300039437 | Ga0436365_1763233 | Ga0436365_1763233_2437_3408 | 321 |
| 349 | 3300044684 | Ga0466966_0041819 | Ga0466966_0041819_698_1663 | 321 |
| 350 | 3300044694 | Ga0466963_0243266 | Ga0466963_0243266_15_1004 | 321 |
| 351 | 3300044765 | Ga0466970_0068404 | Ga0466970_0068404_104_1093 | 321 |
| 352 | 3300044842 | Ga0466957_0140776 | Ga0466957_0140776_216_1205 | 321 |
| 353 | 3300044901 | Ga0466960_0067955 | Ga0466960_0067955_651_1640 | 321 |
| 354 | 3300045049 | Ga0466959_0160212 | Ga0466959_0160212_300_1265 | 321 |
| 355 | 3300045976 | Ga0466967_0058535 | Ga0466967_0058535_1788_2777 | 321 |
| 356 | 3300046516 | Ga0495628_0074588 | Ga0495628_0074588_1123_2091 | 321 |
| 357 | 3300048088 | Ga0495602_0229833 | Ga0495602_0229833_14_1060 | 321 |
| 358 | 3300048903 | Ga0496100_0115773 | Ga0496100_0115773_225_1196 | 321 |
| 359 | 3300048909 | Ga0496106_0279793 | Ga0496106_0279793_208_1179 | 321 |
| 360 | 3300048911 | Ga0496108_0099244 | Ga0496108_0099244_1365_2357 | 321 |
| 361 | 3300048911 | Ga0496108_0246669 | Ga0496108_0246669_131_1102 | 321 |
| 362 | 3300050511 | nmdc:mga08y16_224495_c1 | nmdc:mga08y16_224495_c1_170_1141 | 321 |
| 363 | 3300005468 | Ga0070707_100362920 | Ga0070707_1003629202 | 322 |
| 364 | 3300039437 | Ga0436365_1284536 | Ga0436365_1284536_504_1472 | 322 |
| 365 | 3300039437 | Ga0436365_1434212 | Ga0436365_1434212_2681_3649 | 322 |
| 366 | 3300046471 | Ga0495650_0050918 | Ga0495650_0050918_37_1017 | 322 |
| 367 | iso_pu_bacteria | 2996221748 | 2996227357 | 322 |
| 368 | iso_pu_bacteria | 8055157932 | 8055160796 | 322 |
| 369 | 3300003659 | JGI25404J52841_10014316 | JGI25404J52841_100143162 | 323 |
| 370 | 3300005329 | Ga0070683_100389592 | Ga0070683_1003895921 | 323 |
| 371 | 3300005330 | Ga0070690_100058556 | Ga0070690_1000585563 | 323 |
| 372 | 3300005334 | Ga0068869_100106552 | Ga0068869_1001065523 | 323 |
| 373 | 3300005335 | Ga0070666_10025892 | Ga0070666_100258925 | 323 |
| 374 | 3300005336 | Ga0070680_100011567 | Ga0070680_1000115673 | 323 |
| 375 | 3300005338 | Ga0068868_100262683 | Ga0068868_1002626832 | 323 |
| 376 | 3300005340 | Ga0070689_100020282 | Ga0070689_1000202824 | 323 |
| 377 | 3300005344 | Ga0070661_100083340 | Ga0070661_1000833403 | 323 |
| 378 | 3300005347 | Ga0070668_100129291 | Ga0070668_1001292912 | 323 |
| 379 | 3300005355 | Ga0070671_100180201 | Ga0070671_1001802012 | 323 |
| 380 | 3300005356 | Ga0070674_100152178 | Ga0070674_1001521782 | 323 |
| 381 | 3300005364 | Ga0070673_100026254 | Ga0070673_1000262545 | 323 |
| 382 | 3300005365 | Ga0070688_100034873 | Ga0070688_1000348731 | 323 |
| 383 | 3300005434 | Ga0070709_10026945 | Ga0070709_100269453 | 323 |
| 384 | 3300005434 | Ga0070709_10133540 | Ga0070709_101335402 | 323 |
| 385 | 3300005435 | Ga0070714_100062696 | Ga0070714_1000626961 | 323 |
| 386 | 3300005435 | Ga0070714_100274580 | Ga0070714_1002745801 | 323 |
| 387 | 3300005436 | Ga0070713_100082165 | Ga0070713_1000821652 | 323 |
| 388 | 3300005436 | Ga0070713_100226420 | Ga0070713_1002264202 | 323 |
| 389 | 3300005437 | Ga0070710_10028861 | Ga0070710_100288614 | 323 |
| 390 | 3300005437 | Ga0070710_10068837 | Ga0070710_100688371 | 323 |
| 391 | 3300005437 | Ga0070710_10122688 | Ga0070710_101226881 | 323 |
| 392 | 3300005439 | Ga0070711_100034966 | Ga0070711_1000349664 | 323 |
| 393 | 3300005445 | Ga0070708_100033029 | Ga0070708_1000330293 | 323 |
| 394 | 3300005445 | Ga0070708_100217362 | Ga0070708_1002173622 | 323 |
| 395 | 3300005455 | Ga0070663_100129676 | Ga0070663_1001296762 | 323 |
| 396 | 3300005458 | Ga0070681_10285530 | Ga0070681_102855302 | 323 |
| 397 | 3300005466 | Ga0070685_10027294 | Ga0070685_100272942 | 323 |
| 398 | 3300005467 | Ga0070706_100000304 | Ga0070706_10000030427 | 323 |
| 399 | 3300005467 | Ga0070706_100001944 | Ga0070706_1000019449 | 323 |
| 400 | 3300005467 | Ga0070706_100014928 | Ga0070706_1000149287 | 323 |
| 401 | 3300005467 | Ga0070706_100025734 | Ga0070706_1000257344 | 323 |
| 402 | 3300005468 | Ga0070707_100007741 | Ga0070707_1000077417 | 323 |
| 403 | 3300005468 | Ga0070707_100073623 | Ga0070707_1000736232 | 323 |
| 404 | 3300005468 | Ga0070707_100136364 | Ga0070707_1001363643 | 323 |
| 405 | 3300005468 | Ga0070707_100138827 | Ga0070707_1001388272 | 323 |
| 406 | 3300005471 | Ga0070698_100009462 | Ga0070698_1000094628 | 323 |
| 407 | 3300005471 | Ga0070698_100024159 | Ga0070698_1000241594 | 323 |
| 408 | 3300005471 | Ga0070698_100030237 | Ga0070698_1000302374 | 323 |
| 409 | 3300005471 | Ga0070698_100051342 | Ga0070698_1000513424 | 323 |
| 410 | 3300005471 | Ga0070698_100428454 | Ga0070698_1004284541 | 323 |
| 411 | 3300005518 | Ga0070699_100006444 | Ga0070699_1000064445 | 323 |
| 412 | 3300005518 | Ga0070699_100058356 | Ga0070699_1000583562 | 323 |
| 413 | 3300005530 | Ga0070679_100094804 | Ga0070679_1000948044 | 323 |
| 414 | 3300005539 | Ga0068853_100052780 | Ga0068853_1000527804 | 323 |
| 415 | 3300005544 | Ga0070686_100004561 | Ga0070686_1000045615 | 323 |
| 416 | 3300005545 | Ga0070695_100227929 | Ga0070695_1002279291 | 323 |
| 417 | 3300005564 | Ga0070664_100042165 | Ga0070664_1000421655 | 323 |
| 418 | 3300005577 | Ga0068857_100102439 | Ga0068857_1001024393 | 323 |
| 419 | 3300005614 | Ga0068856_100005337 | Ga0068856_10000533712 | 323 |
| 420 | 3300005615 | Ga0070702_100065487 | Ga0070702_1000654872 | 323 |
| 421 | 3300005617 | Ga0068859_100131592 | Ga0068859_1001315923 | 323 |
| 422 | 3300005719 | Ga0068861_100197437 | Ga0068861_1001974372 | 323 |
| 423 | 3300005719 | Ga0068861_100278119 | Ga0068861_1002781192 | 323 |
| 424 | 3300005834 | Ga0068851_10034145 | Ga0068851_100341453 | 323 |
| 425 | 3300005842 | Ga0068858_100135762 | Ga0068858_1001357622 | 323 |
| 426 | 3300005983 | Ga0081540_1003217 | Ga0081540_10032176 | 323 |
| 427 | 3300005983 | Ga0081540_1027577 | Ga0081540_10275773 | 323 |
| 428 | 3300005983 | Ga0081540_1098164 | Ga0081540_10981641 | 323 |
| 429 | 3300006028 | Ga0070717_10000957 | Ga0070717_1000095713 | 323 |
| 430 | 3300006028 | Ga0070717_10169117 | Ga0070717_101691172 | 323 |
| 431 | 3300006163 | Ga0070715_10036415 | Ga0070715_100364152 | 323 |
| 432 | 3300006173 | Ga0070716_100003216 | Ga0070716_1000032164 | 323 |
| 433 | 3300006173 | Ga0070716_100055349 | Ga0070716_1000553493 | 323 |
| 434 | 3300006173 | Ga0070716_100101853 | Ga0070716_1001018532 | 323 |
| 435 | 3300006175 | Ga0070712_100054704 | Ga0070712_1000547044 | 323 |
| 436 | 3300006844 | Ga0075428_100400953 | Ga0075428_1004009532 | 323 |
| 437 | 3300006852 | Ga0075433_10132296 | Ga0075433_101322962 | 323 |
| 438 | 3300006852 | Ga0075433_10171303 | Ga0075433_101713032 | 323 |
| 439 | 3300006871 | Ga0075434_100008309 | Ga0075434_1000083097 | 323 |
| 440 | 3300006914 | Ga0075436_100042128 | Ga0075436_1000421284 | 323 |
| 441 | 3300006914 | Ga0075436_100098745 | Ga0075436_1000987453 | 323 |
| 442 | 3300006914 | Ga0075436_100114690 | Ga0075436_1001146902 | 323 |
| 443 | 3300006931 | Ga0097620_100131585 | Ga0097620_1001315853 | 323 |
| 444 | 3300007076 | Ga0075435_100003093 | Ga0075435_10000309312 | 323 |
| 445 | 3300007076 | Ga0075435_100022570 | Ga0075435_1000225706 | 323 |
| 446 | 3300007076 | Ga0075435_100074672 | Ga0075435_1000746723 | 323 |
| 447 | 3300009093 | Ga0105240_10246813 | Ga0105240_102468133 | 323 |
| 448 | 3300009101 | Ga0105247_10000653 | Ga0105247_100006538 | 323 |
| 449 | 3300009147 | Ga0114129_10001706 | Ga0114129_100017068 | 323 |
| 450 | 3300009147 | Ga0114129_10216275 | Ga0114129_102162752 | 323 |
| 451 | 3300009174 | Ga0105241_10194998 | Ga0105241_101949982 | 323 |
| 452 | 3300009177 | Ga0105248_10002051 | Ga0105248_100020515 | 323 |
| 453 | 3300009177 | Ga0105248_10199453 | Ga0105248_101994532 | 323 |
| 454 | 3300009177 | Ga0105248_10262019 | Ga0105248_102620192 | 323 |
| 455 | 3300009545 | Ga0105237_10110865 | Ga0105237_101108651 | 323 |
| 456 | 3300009551 | Ga0105238_10164015 | Ga0105238_101640153 | 323 |
| 457 | 3300009553 | Ga0105249_10129973 | Ga0105249_101299733 | 323 |
| 458 | 3300012473 | Ga0157340_1001763 | Ga0157340_10017631 | 323 |
| 459 | 3300012488 | Ga0157343_1000704 | Ga0157343_10007042 | 323 |
| 460 | 3300012507 | Ga0157342_1000128 | Ga0157342_10001284 | 323 |
| 461 | 3300013100 | Ga0157373_10188795 | Ga0157373_101887952 | 323 |
| 462 | 3300013102 | Ga0157371_10031125 | Ga0157371_100311254 | 323 |
| 463 | 3300013297 | Ga0157378_10118292 | Ga0157378_101182923 | 323 |
| 464 | 3300013308 | Ga0157375_10306487 | Ga0157375_103064872 | 323 |
| 465 | 3300014325 | Ga0163163_10036129 | Ga0163163_100361292 | 323 |
| 466 | 3300014745 | Ga0157377_10052086 | Ga0157377_100520862 | 323 |
| 467 | 3300014968 | Ga0157379_10090891 | Ga0157379_100908912 | 323 |
| 468 | 3300017792 | Ga0163161_10048989 | Ga0163161_100489894 | 323 |
| 469 | 3300020069 | Ga0197907_10234494 | Ga0197907_102344942 | 323 |
| 470 | 3300020069 | Ga0197907_10862487 | Ga0197907_108624872 | 323 |
| 471 | 3300020070 | Ga0206356_11175517 | Ga0206356_111755172 | 323 |
| 472 | 3300020076 | Ga0206355_1300986 | Ga0206355_13009861 | 323 |
| 473 | 3300020080 | Ga0206350_11006390 | Ga0206350_110063901 | 323 |
| 474 | 3300022467 | Ga0224712_10037192 | Ga0224712_100371922 | 323 |
| 475 | 3300022467 | Ga0224712_10043681 | Ga0224712_100436811 | 323 |
| 476 | 3300024225 | Ga0224572_1004440 | Ga0224572_10044402 | 323 |
| 477 | 3300025321 | Ga0207656_10026789 | Ga0207656_100267893 | 323 |
| 478 | 3300025885 | Ga0207653_10006120 | Ga0207653_100061204 | 323 |
| 479 | 3300025898 | Ga0207692_10032663 | Ga0207692_100326633 | 323 |
| 480 | 3300025898 | Ga0207692_10141376 | Ga0207692_101413762 | 323 |
| 481 | 3300025900 | Ga0207710_10000427 | Ga0207710_100004278 | 323 |
| 482 | 3300025901 | Ga0207688_10004929 | Ga0207688_100049292 | 323 |
| 483 | 3300025905 | Ga0207685_10002433 | Ga0207685_100024334 | 323 |
| 484 | 3300025906 | Ga0207699_10015551 | Ga0207699_100155515 | 323 |
| 485 | 3300025906 | Ga0207699_10016061 | Ga0207699_100160611 | 323 |
| 486 | 3300025906 | Ga0207699_10028211 | Ga0207699_100282113 | 323 |
| 487 | 3300025906 | Ga0207699_10111121 | Ga0207699_101111212 | 323 |
| 488 | 3300025906 | Ga0207699_10187716 | Ga0207699_101877162 | 323 |
| 489 | 3300025908 | Ga0207643_10024555 | Ga0207643_100245551 | 323 |
| 490 | 3300025910 | Ga0207684_10035311 | Ga0207684_100353114 | 323 |
| 491 | 3300025910 | Ga0207684_10061221 | Ga0207684_100612212 | 323 |
| 492 | 3300025910 | Ga0207684_10127084 | Ga0207684_101270842 | 323 |
| 493 | 3300025910 | Ga0207684_10354144 | Ga0207684_103541441 | 323 |
| 494 | 3300025915 | Ga0207693_10015973 | Ga0207693_100159735 | 323 |
| 495 | 3300025915 | Ga0207693_10064440 | Ga0207693_100644402 | 323 |
| 496 | 3300025915 | Ga0207693_10114512 | Ga0207693_101145122 | 323 |
| 497 | 3300025916 | Ga0207663_10084094 | Ga0207663_100840943 | 323 |
| 498 | 3300025916 | Ga0207663_10091482 | Ga0207663_100914822 | 323 |
| 499 | 3300025916 | Ga0207663_10146629 | Ga0207663_101466291 | 323 |
| 500 | 3300025918 | Ga0207662_10005260 | Ga0207662_100052604 | 323 |
| 501 | 3300025919 | Ga0207657_10010213 | Ga0207657_100102136 | 323 |
| 502 | 3300025922 | Ga0207646_10011465 | Ga0207646_100114656 | 323 |
| 503 | 3300025922 | Ga0207646_10054928 | Ga0207646_100549281 | 323 |
| 504 | 3300025922 | Ga0207646_10072294 | Ga0207646_100722942 | 323 |
| 505 | 3300025922 | Ga0207646_10119409 | Ga0207646_101194092 | 323 |
| 506 | 3300025924 | Ga0207694_10173720 | Ga0207694_101737201 | 323 |
| 507 | 3300025928 | Ga0207700_10074764 | Ga0207700_100747642 | 323 |
| 508 | 3300025928 | Ga0207700_10120314 | Ga0207700_101203141 | 323 |
| 509 | 3300025928 | Ga0207700_10145907 | Ga0207700_101459072 | 323 |
| 510 | 3300025929 | Ga0207664_10014557 | Ga0207664_100145572 | 323 |
| 511 | 3300025929 | Ga0207664_10186580 | Ga0207664_101865802 | 323 |
| 512 | 3300025929 | Ga0207664_10191406 | Ga0207664_101914062 | 323 |
| 513 | 3300025929 | Ga0207664_10210754 | Ga0207664_102107542 | 323 |
| 514 | 3300025931 | Ga0207644_10089250 | Ga0207644_100892503 | 323 |
| 515 | 3300025931 | Ga0207644_10145591 | Ga0207644_101455912 | 323 |
| 516 | 3300025933 | Ga0207706_10071616 | Ga0207706_100716162 | 323 |
| 517 | 3300025934 | Ga0207686_10024646 | Ga0207686_100246464 | 323 |
| 518 | 3300025938 | Ga0207704_10038422 | Ga0207704_100384224 | 323 |
| 519 | 3300025939 | Ga0207665_10007909 | Ga0207665_100079095 | 323 |
| 520 | 3300025939 | Ga0207665_10008012 | Ga0207665_100080128 | 323 |
| 521 | 3300025939 | Ga0207665_10011477 | Ga0207665_100114774 | 323 |
| 522 | 3300025939 | Ga0207665_10013277 | Ga0207665_100132776 | 323 |
| 523 | 3300025939 | Ga0207665_10177369 | Ga0207665_101773691 | 323 |
| 524 | 3300025940 | Ga0207691_10038381 | Ga0207691_100383814 | 323 |
| 525 | 3300025941 | Ga0207711_10012631 | Ga0207711_100126314 | 323 |
| 526 | 3300025941 | Ga0207711_10265108 | Ga0207711_102651081 | 323 |
| 527 | 3300025942 | Ga0207689_10013895 | Ga0207689_100138956 | 323 |
| 528 | 3300026067 | Ga0207678_10013076 | Ga0207678_100130767 | 323 |
| 529 | 3300026075 | Ga0207708_10052090 | Ga0207708_100520904 | 323 |
| 530 | 3300026088 | Ga0207641_10081544 | Ga0207641_100815443 | 323 |
| 531 | 3300026088 | Ga0207641_10111024 | Ga0207641_101110242 | 323 |
| 532 | 3300026095 | Ga0207676_10233246 | Ga0207676_102332461 | 323 |
| 533 | 3300026095 | Ga0207676_10322364 | Ga0207676_103223641 | 323 |
| 534 | 3300026116 | Ga0207674_10019026 | Ga0207674_100190265 | 323 |
| 535 | 3300026118 | Ga0207675_100025028 | Ga0207675_1000250286 | 323 |
| 536 | 3300026118 | Ga0207675_100357494 | Ga0207675_1003574942 | 323 |
| 537 | 3300026121 | Ga0207683_10014371 | Ga0207683_100143714 | 323 |
| 538 | 3300026121 | Ga0207683_10081019 | Ga0207683_100810194 | 323 |
| 539 | 3300028380 | Ga0268265_10182176 | Ga0268265_101821762 | 323 |
| 540 | 3300034816 | Ga0373930_0009124 | Ga0373930_0009124_209_1180 | 323 |
| 541 | 3300034816 | Ga0373930_0012284 | Ga0373930_0012284_298_1269 | 323 |
| 542 | 3300034818 | Ga0373950_0009047 | Ga0373950_0009047_488_1459 | 323 |
| 543 | 3300034819 | Ga0373958_0008127 | Ga0373958_0008127_173_1144 | 323 |
| 544 | 3300035083 | Ga0373926_0002888 | Ga0373926_0002888_2040_3011 | 323 |
| 545 | 3300035084 | Ga0373928_0013853 | Ga0373928_0013853_172_1143 | 323 |
| 546 | 3300035085 | Ga0373929_0008200 | Ga0373929_0008200_941_1912 | 323 |
| 547 | 3300035086 | Ga0373934_0096560 | Ga0373934_0096560_171_1142 | 323 |
| 548 | 3300035088 | Ga0373940_0007051 | Ga0373940_0007051_951_1922 | 323 |
| 549 | 3300035089 | Ga0373944_0000349 | Ga0373944_0000349_2415_3386 | 323 |
| 550 | 3300035090 | Ga0373949_0018718 | Ga0373949_0018718_287_1258 | 323 |
| 551 | 3300035091 | Ga0373951_0007194 | Ga0373951_0007194_122_1093 | 323 |
| 552 | 3300035111 | Ga0373923_0002644 | Ga0373923_0002644_750_1721 | 323 |
| 553 | 3300035111 | Ga0373923_0035992 | Ga0373923_0035992_911_1882 | 323 |
| 554 | 3300035111 | Ga0373923_0044907 | Ga0373923_0044907_691_1662 | 323 |
| 555 | 3300035112 | Ga0373932_0031955 | Ga0373932_0031955_411_1382 | 323 |
| 556 | 3300035113 | Ga0373936_0001068 | Ga0373936_0001068_4795_5766 | 323 |
| 557 | 3300035113 | Ga0373936_0002061 | Ga0373936_0002061_2334_3305 | 323 |
| 558 | 3300035113 | Ga0373936_0019841 | Ga0373936_0019841_1571_2542 | 323 |
| 559 | 3300035115 | Ga0373941_0021056 | Ga0373941_0021056_782_1753 | 323 |
| 560 | 3300035116 | Ga0373945_0015334 | Ga0373945_0015334_476_1447 | 323 |
| 561 | 3300035116 | Ga0373945_0032384 | Ga0373945_0032384_120_1097 | 323 |
| 562 | 3300035118 | Ga0373954_0013444 | Ga0373954_0013444_1825_2796 | 323 |
| 563 | 3300035118 | Ga0373954_0036710 | Ga0373954_0036710_778_1749 | 323 |
| 564 | 3300035118 | Ga0373954_0129349 | Ga0373954_0129349_235_1206 | 323 |
| 565 | 3300035119 | Ga0373956_0005179 | Ga0373956_0005179_1101_2072 | 323 |
| 566 | 3300035119 | Ga0373956_0005238 | Ga0373956_0005238_2006_2977 | 323 |
| 567 | 3300035119 | Ga0373956_0029995 | Ga0373956_0029995_821_1792 | 323 |
| 568 | 3300035120 | Ga0373957_0011856 | Ga0373957_0011856_923_1894 | 323 |
| 569 | 3300035121 | Ga0373960_0003322 | Ga0373960_0003322_1823_2794 | 323 |
| 570 | 3300035170 | Ga0373943_0145201 | Ga0373943_0145201_209_1180 | 323 |
| 571 | 3300035171 | Ga0373946_0005982 | Ga0373946_0005982_3140_4111 | 323 |
| 572 | 3300035172 | Ga0373955_0003650 | Ga0373955_0003650_1414_2385 | 323 |
| 573 | 3300035172 | Ga0373955_0019498 | Ga0373955_0019498_2183_3154 | 323 |
| 574 | 3300035172 | Ga0373955_0079252 | Ga0373955_0079252_501_1472 | 323 |
| 575 | 3300035241 | Ga0373961_0050359 | Ga0373961_0050359_42_1013 | 323 |
| 576 | 3300035410 | Ga0373924_0001226 | Ga0373924_0001226_2083_3054 | 323 |
| 577 | 3300035410 | Ga0373924_0002268 | Ga0373924_0002268_2162_3133 | 323 |
| 578 | 3300035410 | Ga0373924_0068951 | Ga0373924_0068951_465_1436 | 323 |
| 579 | 3300035691 | Ga0373931_0052813 | Ga0373931_0052813_577_1548 | 323 |
| 580 | 3300035691 | Ga0373931_0139516 | Ga0373931_0139516_60_1031 | 323 |
| 581 | 3300035692 | Ga0373935_0030952 | Ga0373935_0030952_222_1193 | 323 |
| 582 | 3300035692 | Ga0373935_0033784 | Ga0373935_0033784_2172_3143 | 323 |
| 583 | 3300035692 | Ga0373935_0149137 | Ga0373935_0149137_440_1411 | 323 |
| 584 | 3300035695 | Ga0373927_0021392 | Ga0373927_0021392_2354_3325 | 323 |
| 585 | 3300035695 | Ga0373927_0053558 | Ga0373927_0053558_1115_2086 | 323 |
| 586 | 3300035724 | Ga0373933_0004173 | Ga0373933_0004173_5305_6276 | 323 |
| 587 | 3300035724 | Ga0373933_0088685 | Ga0373933_0088685_208_1179 | 323 |
| 588 | 3300035724 | Ga0373933_0090983 | Ga0373933_0090983_872_1843 | 323 |
| 589 | 3300035724 | Ga0373933_0105029 | Ga0373933_0105029_709_1680 | 323 |
| 590 | 3300035725 | Ga0373947_0004111 | Ga0373947_0004111_5142_6113 | 323 |
| 591 | 3300035725 | Ga0373947_0043076 | Ga0373947_0043076_117_1088 | 323 |
| 592 | 3300035725 | Ga0373947_0043587 | Ga0373947_0043587_1166_2137 | 323 |
| 593 | 3300035725 | Ga0373947_0044624 | Ga0373947_0044624_291_1262 | 323 |
| 594 | 3300036401 | Ga0373937_0010502 | Ga0373937_0010502_3536_4507 | 323 |
| 595 | 3300036401 | Ga0373937_0020026 | Ga0373937_0020026_4389_5360 | 323 |
| 596 | 3300036401 | Ga0373937_0089479 | Ga0373937_0089479_1800_2771 | 323 |
| 597 | 3300036401 | Ga0373937_0188091 | Ga0373937_0188091_857_1828 | 323 |
| 598 | 3300037068 | Ga0373925_0002044 | Ga0373925_0002044_13137_14108 | 323 |
| 599 | 3300037068 | Ga0373925_0022145 | Ga0373925_0022145_343_1314 | 323 |
| 600 | 3300037068 | Ga0373925_0051372 | Ga0373925_0051372_1875_2846 | 323 |
| 601 | 3300037853 | Ga0436364_1223233 | Ga0436364_1223233_31055_32044 | 323 |
| 602 | 3300037853 | Ga0436364_1508755 | Ga0436364_1508755_316_1287 | 323 |
| 603 | 3300046454 | Ga0495592_0029712 | Ga0495592_0029712_2869_3840 | 323 |
| 604 | 3300046454 | Ga0495592_0041720 | Ga0495592_0041720_1807_2778 | 323 |
| 605 | 3300046454 | Ga0495592_0068761 | Ga0495592_0068761_182_1153 | 323 |
| 606 | 3300046455 | Ga0495603_0018166 | Ga0495603_0018166_2864_3835 | 323 |
| 607 | 3300046459 | Ga0495629_0001817 | Ga0495629_0001817_8326_9297 | 323 |
| 608 | 3300046459 | Ga0495629_0002479 | Ga0495629_0002479_7912_8883 | 323 |
| 609 | 3300046461 | Ga0495641_0004811 | Ga0495641_0004811_4942_5913 | 323 |
| 610 | 3300046461 | Ga0495641_0009894 | Ga0495641_0009894_751_1722 | 323 |
| 611 | 3300046461 | Ga0495641_0022070 | Ga0495641_0022070_1208_2179 | 323 |
| 612 | 3300046461 | Ga0495641_0036940 | Ga0495641_0036940_383_1354 | 323 |
| 613 | 3300046462 | Ga0495651_0001835 | Ga0495651_0001835_1979_2950 | 323 |
| 614 | 3300046462 | Ga0495651_0009665 | Ga0495651_0009665_2658_3629 | 323 |
| 615 | 3300046462 | Ga0495651_0025398 | Ga0495651_0025398_409_1380 | 323 |
| 616 | 3300046462 | Ga0495651_0073989 | Ga0495651_0073989_1193_2164 | 323 |
| 617 | 3300046462 | Ga0495651_0128320 | Ga0495651_0128320_528_1499 | 323 |
| 618 | 3300046463 | Ga0495653_0010666 | Ga0495653_0010666_844_1815 | 323 |
| 619 | 3300046463 | Ga0495653_0041530 | Ga0495653_0041530_1187_2158 | 323 |
| 620 | 3300046463 | Ga0495653_0080141 | Ga0495653_0080141_470_1441 | 323 |
| 621 | 3300046472 | Ga0495580_0003452 | Ga0495580_0003452_4832_5803 | 323 |
| 622 | 3300046472 | Ga0495580_0012452 | Ga0495580_0012452_653_1624 | 323 |
| 623 | 3300046473 | Ga0495582_0007220 | Ga0495582_0007220_3742_4713 | 323 |
| 624 | 3300046473 | Ga0495582_0029206 | Ga0495582_0029206_902_1873 | 323 |
| 625 | 3300046475 | Ga0495639_0001194 | Ga0495639_0001194_3353_4324 | 323 |
| 626 | 3300046475 | Ga0495639_0036443 | Ga0495639_0036443_756_1727 | 323 |
| 627 | 3300046476 | Ga0495662_0000398 | Ga0495662_0000398_10910_11881 | 323 |
| 628 | 3300046476 | Ga0495662_0050165 | Ga0495662_0050165_210_1181 | 323 |
| 629 | 3300046477 | Ga0495664_0143157 | Ga0495664_0143157_188_1159 | 323 |
| 630 | 3300046477 | Ga0495664_0201046 | Ga0495664_0201046_148_1128 | 323 |
| 631 | 3300046499 | Ga0495594_0059990 | Ga0495594_0059990_428_1399 | 323 |
| 632 | 3300046511 | Ga0495608_0001781 | Ga0495608_0001781_13325_14296 | 323 |
| 633 | 3300046511 | Ga0495608_0040793 | Ga0495608_0040793_552_1523 | 323 |
| 634 | 3300046511 | Ga0495608_0051155 | Ga0495608_0051155_913_1884 | 323 |
| 635 | 3300046511 | Ga0495608_0063909 | Ga0495608_0063909_584_1555 | 323 |
| 636 | 3300046514 | Ga0495618_0010066 | Ga0495618_0010066_2253_3224 | 323 |
| 637 | 3300046514 | Ga0495618_0026716 | Ga0495618_0026716_2361_3332 | 323 |
| 638 | 3300046514 | Ga0495618_0038593 | Ga0495618_0038593_1807_2778 | 323 |
| 639 | 3300046514 | Ga0495618_0128046 | Ga0495618_0128046_529_1500 | 323 |
| 640 | 3300046514 | Ga0495618_0134190 | Ga0495618_0134190_165_1136 | 323 |
| 641 | 3300046516 | Ga0495628_0023071 | Ga0495628_0023071_792_1763 | 323 |
| 642 | 3300046516 | Ga0495628_0034053 | Ga0495628_0034053_352_1323 | 323 |
| 643 | 3300046516 | Ga0495628_0117409 | Ga0495628_0117409_746_1717 | 323 |
| 644 | 3300046517 | Ga0495630_0003733 | Ga0495630_0003733_6067_7038 | 323 |
| 645 | 3300046517 | Ga0495630_0010026 | Ga0495630_0010026_3729_4700 | 323 |
| 646 | 3300046517 | Ga0495630_0023818 | Ga0495630_0023818_2311_3282 | 323 |
| 647 | 3300046526 | Ga0495666_0000939 | Ga0495666_0000939_12336_13307 | 323 |
| 648 | 3300046526 | Ga0495666_0016616 | Ga0495666_0016616_1869_2840 | 323 |
| 649 | 3300046529 | Ga0495652_0011993 | Ga0495652_0011993_3424_4395 | 323 |
| 650 | 3300046529 | Ga0495652_0029193 | Ga0495652_0029193_2443_3414 | 323 |
| 651 | 3300046531 | Ga0495665_0002626 | Ga0495665_0002626_5460_6431 | 323 |
| 652 | 3300046531 | Ga0495665_0004314 | Ga0495665_0004314_1222_2193 | 323 |
| 653 | 3300046531 | Ga0495665_0004598 | Ga0495665_0004598_2227_3198 | 323 |
| 654 | 3300046531 | Ga0495665_0033780 | Ga0495665_0033780_1235_2206 | 323 |
| 655 | 3300046533 | Ga0495640_0025492 | Ga0495640_0025492_1458_2429 | 323 |
| 656 | 3300046533 | Ga0495640_0028266 | Ga0495640_0028266_756_1727 | 323 |
| 657 | 3300046533 | Ga0495640_0033054 | Ga0495640_0033054_2125_3096 | 323 |
| 658 | 3300046533 | Ga0495640_0074594 | Ga0495640_0074594_455_1426 | 323 |
| 659 | 3300046535 | Ga0495586_0008699 | Ga0495586_0008699_1697_2668 | 323 |
| 660 | 3300046535 | Ga0495586_0014824 | Ga0495586_0014824_2520_3491 | 323 |
| 661 | 3300046535 | Ga0495586_0018638 | Ga0495586_0018638_2679_3650 | 323 |
| 662 | 3300046536 | Ga0495587_0003044 | Ga0495587_0003044_9994_10965 | 323 |
| 663 | 3300046536 | Ga0495587_0017474 | Ga0495587_0017474_3115_4086 | 323 |
| 664 | 3300046536 | Ga0495587_0055643 | Ga0495587_0055643_608_1579 | 323 |
| 665 | 3300046543 | Ga0495645_0008023 | Ga0495645_0008023_2849_3820 | 323 |
| 666 | 3300046543 | Ga0495645_0010953 | Ga0495645_0010953_4311_5282 | 323 |
| 667 | 3300046543 | Ga0495645_0069753 | Ga0495645_0069753_1191_2162 | 323 |
| 668 | 3300046559 | Ga0495667_0003213 | Ga0495667_0003213_590_1561 | 323 |
| 669 | 3300046559 | Ga0495667_0008153 | Ga0495667_0008153_4930_5901 | 323 |
| 670 | 3300046559 | Ga0495667_0019737 | Ga0495667_0019737_2443_3414 | 323 |
| 671 | 3300046559 | Ga0495667_0065057 | Ga0495667_0065057_335_1306 | 323 |
| 672 | 3300046642 | Ga0495634_0005420 | Ga0495634_0005420_4601_5572 | 323 |
| 673 | 3300046642 | Ga0495634_0014722 | Ga0495634_0014722_4367_5338 | 323 |
| 674 | 3300046663 | Ga0495635_0006037 | Ga0495635_0006037_822_1793 | 323 |
| 675 | 3300046663 | Ga0495635_0031178 | Ga0495635_0031178_1977_2948 | 323 |
| 676 | 3300046663 | Ga0495635_0036304 | Ga0495635_0036304_889_1860 | 323 |
| 677 | 3300046663 | Ga0495635_0191623 | Ga0495635_0191623_147_1118 | 323 |
| 678 | 3300046675 | Ga0495657_0006495 | Ga0495657_0006495_3340_4311 | 323 |
| 679 | 3300046675 | Ga0495657_0007455 | Ga0495657_0007455_5468_6439 | 323 |
| 680 | 3300046675 | Ga0495657_0017348 | Ga0495657_0017348_2825_3796 | 323 |
| 681 | 3300046675 | Ga0495657_0046655 | Ga0495657_0046655_1027_1998 | 323 |
| 682 | 3300046675 | Ga0495657_0141935 | Ga0495657_0141935_76_1047 | 323 |
| 683 | 3300046678 | Ga0495599_0014227 | Ga0495599_0014227_2895_3866 | 323 |
| 684 | 3300046678 | Ga0495599_0026352 | Ga0495599_0026352_352_1323 | 323 |
| 685 | 3300046678 | Ga0495599_0095464 | Ga0495599_0095464_528_1499 | 323 |
| 686 | 3300046678 | Ga0495599_0122805 | Ga0495599_0122805_624_1595 | 323 |
| 687 | 3300046678 | Ga0495599_0248122 | Ga0495599_0248122_103_1074 | 323 |
| 688 | 3300046679 | Ga0495623_0007854 | Ga0495623_0007854_4144_5115 | 323 |
| 689 | 3300046679 | Ga0495623_0010798 | Ga0495623_0010798_4320_5291 | 323 |
| 690 | 3300046680 | Ga0495646_0004595 | Ga0495646_0004595_2077_3048 | 323 |
| 691 | 3300046680 | Ga0495646_0082479 | Ga0495646_0082479_84_1055 | 323 |
| 692 | 3300046680 | Ga0495646_0122619 | Ga0495646_0122619_468_1439 | 323 |
| 693 | 3300046681 | Ga0495647_0004707 | Ga0495647_0004707_2064_3035 | 323 |
| 694 | 3300046683 | Ga0495658_0001230 | Ga0495658_0001230_6825_7796 | 323 |
| 695 | 3300046683 | Ga0495658_0003103 | Ga0495658_0003103_7030_8001 | 323 |
| 696 | 3300046683 | Ga0495658_0009091 | Ga0495658_0009091_930_1901 | 323 |
| 697 | 3300046689 | Ga0495613_0018718 | Ga0495613_0018718_4129_5100 | 323 |
| 698 | 3300046689 | Ga0495613_0018898 | Ga0495613_0018898_715_1686 | 323 |
| 699 | 3300046690 | Ga0495624_0012799 | Ga0495624_0012799_2496_3467 | 323 |
| 700 | 3300046690 | Ga0495624_0021657 | Ga0495624_0021657_2204_3175 | 323 |
| 701 | 3300046690 | Ga0495624_0038097 | Ga0495624_0038097_1129_2100 | 323 |
| 702 | 3300046690 | Ga0495624_0070078 | Ga0495624_0070078_567_1538 | 323 |
| 703 | 3300046809 | Ga0495600_0002019 | Ga0495600_0002019_9967_10938 | 323 |
| 704 | 3300046809 | Ga0495600_0009486 | Ga0495600_0009486_4174_5145 | 323 |
| 705 | 3300046809 | Ga0495600_0020118 | Ga0495600_0020118_2183_3154 | 323 |
| 706 | 3300046809 | Ga0495600_0028588 | Ga0495600_0028588_352_1323 | 323 |
| 707 | 3300046809 | Ga0495600_0084737 | Ga0495600_0084737_750_1721 | 323 |
| 708 | 3300046809 | Ga0495600_0235223 | Ga0495600_0235223_60_1031 | 323 |
| 709 | 3300047315 | Ga0495581_0002552 | Ga0495581_0002552_2401_3372 | 323 |
| 710 | 3300047315 | Ga0495581_0003056 | Ga0495581_0003056_6865_7836 | 323 |
| 711 | 3300047315 | Ga0495581_0004566 | Ga0495581_0004566_3583_4554 | 323 |
| 712 | 3300047315 | Ga0495581_0008812 | Ga0495581_0008812_1290_2261 | 323 |
| 713 | 3300047317 | Ga0495604_0002188 | Ga0495604_0002188_11229_12200 | 323 |
| 714 | 3300047317 | Ga0495604_0008319 | Ga0495604_0008319_3839_4810 | 323 |
| 715 | 3300047317 | Ga0495604_0010113 | Ga0495604_0010113_3456_4427 | 323 |
| 716 | 3300047317 | Ga0495604_0064366 | Ga0495604_0064366_1586_2557 | 323 |
| 717 | 3300047317 | Ga0495604_0110212 | Ga0495604_0110212_419_1390 | 323 |
| 718 | 3300047319 | Ga0495674_0013056 | Ga0495674_0013056_1516_2487 | 323 |
| 719 | 3300047319 | Ga0495674_0036791 | Ga0495674_0036791_110_1081 | 323 |
| 720 | 3300047319 | Ga0495674_0048295 | Ga0495674_0048295_2308_3279 | 323 |
| 721 | 3300047319 | Ga0495674_0051728 | Ga0495674_0051728_822_1793 | 323 |
| 722 | 3300047321 | Ga0495676_0011421 | Ga0495676_0011421_301_1272 | 323 |
| 723 | 3300047322 | Ga0495680_0001141 | Ga0495680_0001141_15911_16882 | 323 |
| 724 | 3300047322 | Ga0495680_0010102 | Ga0495680_0010102_3598_4569 | 323 |
| 725 | 3300047322 | Ga0495680_0038937 | Ga0495680_0038937_2090_3061 | 323 |
| 726 | 3300047322 | Ga0495680_0048420 | Ga0495680_0048420_1807_2778 | 323 |
| 727 | 3300047322 | Ga0495680_0238994 | Ga0495680_0238994_19_990 | 323 |
| 728 | 3300047444 | Ga0495675_0039220 | Ga0495675_0039220_1695_2666 | 323 |
| 729 | 3300047471 | Ga0495684_0006104 | Ga0495684_0006104_4629_5600 | 323 |
| 730 | 3300047471 | Ga0495684_0010060 | Ga0495684_0010060_2549_3520 | 323 |
| 731 | 3300047471 | Ga0495684_0020457 | Ga0495684_0020457_1976_2947 | 323 |
| 732 | 3300047471 | Ga0495684_0058809 | Ga0495684_0058809_1135_2106 | 323 |
| 733 | 3300047471 | Ga0495684_0073968 | Ga0495684_0073968_862_1833 | 323 |
| 734 | 3300047471 | Ga0495684_0188075 | Ga0495684_0188075_94_1065 | 323 |
| 735 | 3300047673 | Ga0495593_0004694 | Ga0495593_0004694_1235_2206 | 323 |
| 736 | 3300047673 | Ga0495593_0008869 | Ga0495593_0008869_4047_5018 | 323 |
| 737 | 3300047673 | Ga0495593_0052120 | Ga0495593_0052120_1121_2092 | 323 |
| 738 | 3300048088 | Ga0495602_0034111 | Ga0495602_0034111_561_1532 | 323 |
| 739 | 3300048088 | Ga0495602_0065731 | Ga0495602_0065731_352_1323 | 323 |
| 740 | 3300048088 | Ga0495602_0098847 | Ga0495602_0098847_807_1778 | 323 |
| 741 | 3300048088 | Ga0495602_0212290 | Ga0495602_0212290_366_1337 | 323 |
| 742 | 3300048089 | Ga0495614_0022151 | Ga0495614_0022151_1719_2690 | 323 |
| 743 | 3300048903 | Ga0496100_0100777 | Ga0496100_0100777_599_1570 | 323 |
| 744 | 3300048904 | Ga0496101_0088556 | Ga0496101_0088556_416_1387 | 323 |
| 745 | 3300048904 | Ga0496101_0091124 | Ga0496101_0091124_1008_1979 | 323 |
| 746 | 3300048904 | Ga0496101_0127464 | Ga0496101_0127464_275_1246 | 323 |
| 747 | 3300048905 | Ga0496102_0147343 | Ga0496102_0147343_1049_2020 | 323 |
| 748 | 3300048906 | Ga0496103_0068858 | Ga0496103_0068858_666_1637 | 323 |
| 749 | 3300048907 | Ga0496104_0001309 | Ga0496104_0001309_15339_16310 | 323 |
| 750 | 3300048909 | Ga0496106_0012056 | Ga0496106_0012056_2455_3426 | 323 |
| 751 | 3300048910 | Ga0496107_0091730 | Ga0496107_0091730_1129_2100 | 323 |
| 752 | 3300048911 | Ga0496108_0042972 | Ga0496108_0042972_2751_3722 | 323 |
| 753 | 3300048912 | Ga0496109_0028955 | Ga0496109_0028955_2882_3853 | 323 |
| 754 | 3300048912 | Ga0496109_0082139 | Ga0496109_0082139_1128_2099 | 323 |
| 755 | 3300048913 | Ga0496110_0064629 | Ga0496110_0064629_764_1735 | 323 |
| 756 | 3300048913 | Ga0496110_0120957 | Ga0496110_0120957_79_1050 | 323 |
| 757 | 3300048914 | Ga0496111_0038261 | Ga0496111_0038261_290_1261 | 323 |
| 758 | 3300048915 | Ga0496112_0018864 | Ga0496112_0018864_111_1082 | 323 |
| 759 | 3300048915 | Ga0496112_0032245 | Ga0496112_0032245_2180_3151 | 323 |
| 760 | 3300048916 | Ga0496113_0023422 | Ga0496113_0023422_2071_3042 | 323 |
| 761 | 3300048917 | Ga0496114_0008833 | Ga0496114_0008833_4838_5809 | 323 |
| 762 | 3300048918 | Ga0496115_0063797 | Ga0496115_0063797_1666_2637 | 323 |
| 763 | 3300048918 | Ga0496115_0067725 | Ga0496115_0067725_1811_2782 | 323 |
| 764 | 3300048922 | Ga0496119_0001483 | Ga0496119_0001483_18973_19995 | 323 |
| 765 | 3300048923 | Ga0496120_0001510 | Ga0496120_0001510_8144_9166 | 323 |
| 766 | 3300049578 | Ga0501042_0029142 | Ga0501042_0029142_559_1530 | 323 |
| 767 | 3300050507 | nmdc:mga05p37_15523_c1 | nmdc:mga05p37_15523_c1_785_1756 | 323 |
| 768 | 3300050512 | nmdc:mga0n895_16343_c1 | nmdc:mga0n895_16343_c1_4820_5791 | 323 |
| 769 | 3300050512 | nmdc:mga0n895_211522_c1 | nmdc:mga0n895_211522_c1_579_1550 | 323 |
| 770 | 3300050512 | nmdc:mga0n895_226944_c1 | nmdc:mga0n895_226944_c1_174_1145 | 323 |
| 771 | 3300050512 | nmdc:mga0n895_40648_c1 | nmdc:mga0n895_40648_c1_744_1715 | 323 |
| 772 | 3300050513 | nmdc:mga0rr50_19140_c1 | nmdc:mga0rr50_19140_c1_3340_4311 | 323 |
| 773 | 3300050513 | nmdc:mga0rr50_3711_c1 | nmdc:mga0rr50_3711_c1_297_1268 | 323 |
| 774 | 3300050513 | nmdc:mga0rr50_38836_c1 | nmdc:mga0rr50_38836_c1_1397_2368 | 323 |
| 775 | 3300050514 | nmdc:mga08x19_134478_c1 | nmdc:mga08x19_134478_c1_375_1346 | 323 |
| 776 | 3300050514 | nmdc:mga08x19_54296_c1 | nmdc:mga08x19_54296_c1_579_1550 | 323 |
| 777 | 3300050515 | nmdc:mga0a205_144637_c1 | nmdc:mga0a205_144637_c1_350_1321 | 323 |
| 778 | 3300050515 | nmdc:mga0a205_182263_c1 | nmdc:mga0a205_182263_c1_802_1773 | 323 |
| 779 | 3300050515 | nmdc:mga0a205_210299_c1 | nmdc:mga0a205_210299_c1_138_1109 | 323 |
| 780 | 3300050515 | nmdc:mga0a205_29022_c1 | nmdc:mga0a205_29022_c1_3512_4483 | 323 |
| 781 | 3300053077 | Ga0495601_0011723 | Ga0495601_0011723_4040_5011 | 323 |
| 782 | 3300053077 | Ga0495601_0038761 | Ga0495601_0038761_1828_2799 | 323 |
| 783 | 3300053077 | Ga0495601_0061268 | Ga0495601_0061268_1068_2093 | 323 |
| 784 | 3300053077 | Ga0495601_0121297 | Ga0495601_0121297_357_1328 | 323 |
| 785 | 3300053077 | Ga0495601_0303107 | Ga0495601_0303107_18_989 | 323 |
| 786 | 3300053078 | Ga0495612_0046026 | Ga0495612_0046026_356_1327 | 323 |
| 787 | 3300053078 | Ga0495612_0090150 | Ga0495612_0090150_280_1251 | 323 |
| 788 | 3300053078 | Ga0495612_0091550 | Ga0495612_0091550_45_1016 | 323 |
| 789 | 3300053084 | Ga0495595_0027744 | Ga0495595_0027744_271_1242 | 323 |
| 790 | 3300053085 | Ga0495619_0001376 | Ga0495619_0001376_7479_8450 | 323 |
| 791 | 3300053085 | Ga0495619_0025529 | Ga0495619_0025529_2574_3545 | 323 |
| 792 | 3300053085 | Ga0495619_0051096 | Ga0495619_0051096_606_1577 | 323 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1pz0-assembly1.cif.gz_A | structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) | 0.9133 | 2 | 301 |
| 6ky6-assembly2.cif.gz_B | crystal structure of a thermostable aldo-keto reductase tm1743 in complexs with inhibitor epalrestat in space group p3221cc | 0.9101 | 1 | 300 |
| 6ky6-assembly2.cif.gz_B | crystal structure of a thermostable aldo-keto reductase tm1743 in complexs with inhibitor epalrestat in space group p3221cc | 0.9037 | 1 | 300 |
| 3f7j-assembly2.cif.gz_B | b.subtilis yvgn | 0.9024 | 10 | 300 |
| 4xap-assembly1.cif.gz_A | crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 | 0.898 | 10 | 309 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WQA7_10_309_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9775 | 10 | 308 | 3.20.20.100 |
| af_P9WQA7_10_309_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9679 | 10 | 308 | 3.20.20.100 |
| af_Q0D8N4_49_369_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9236 | 2 | 307 | 3.20.20.100 |
| af_P77256_1_325_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.921 | 1 | 305 | 3.20.20.100 |
| af_Q7XCS4_50_365_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9196 | 4 | 304 | 3.20.20.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536G358-F1-model_v4 | Aldo/keto reductase | 0.9779 | 3 | 301 |
GO:0016491
|
| AF-A0A7I7P738-F1-model_v4 | Putative oxidoreductase | 0.9711 | 3 | 249 |
GO:0016491
|
| AF-A0A535NI90-F1-model_v4 | Aldo/keto reductase | 0.9687 | 42 | 308 |
GO:0016491
|
| AF-X8DAP4-F1-model_v4 | Aldo/keto reductase family protein | 0.9627 | 1 | 151 |
GO:0016491
|
| AF-A0A535NI90-F1-model_v4 | Aldo/keto reductase | 0.9614 | 42 | 308 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar