F481019

General Info

Members Datasets Scaffolds Average Seq Length
792 277 720 216

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10031628|Ga0105244_100316283
Length 229
Sequence MLFDRILRGESMQPEFWHKKWESNQIGFHQPEVNPYLQRHWSGLAIPPQSRVLVPLCGKSLDLLWLAGQGYRVLGVELSEKAVEDFFREQQLQPQISEEGGFKVYRAGAIELWCGDFFALSASDVADCTALYDRAALIALPAPMRERYAAHLLSILPTGLRGLLITLDYDQAQMPGPPFAVTDGEVQQLFGGDWAVQALEGQDVLSESGKFLQAGVTRLEERVYRLAAQ

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231012 Pseudomonas sp. GM33 Isolate Nodule
8 2511231014 Pseudomonas sp. GM48 Isolate Nodule
9 2511231015 Pseudomonas sp. GM49 Isolate Nodule
10 2511231016 Pseudomonas sp. GM50 Isolate Nodule
11 2511231017 Pseudomonas sp. GM55 Isolate Nodule
12 2511231018 Pseudomonas sp. GM60 Isolate Nodule
13 2511231019 Pseudomonas sp. GM67 Isolate Nodule
14 2511231020 Pseudomonas sp. GM74 Isolate Nodule
15 2511231021 Pseudomonas sp. GM78 Isolate Nodule
16 2511231022 Pseudomonas sp. GM79 Isolate Nodule
17 2511231031 Pseudomonas sp. GM16 Isolate Nodule
18 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
19 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
20 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
21 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
22 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
23 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
24 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
25 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
26 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
27 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
28 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
29 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
30 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
31 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
32 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
33 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
34 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
35 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
36 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
37 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
38 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
39 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
40 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
41 2773857670 Pseudomonas sp. 478 Isolate Unclassified
42 2773857673 Pseudomonas sp. 443 Isolate Unclassified
43 2784132063 Pseudomonas sp. 424 Isolate Unclassified
44 2784132072 Pseudomonas sp. 460 Isolate Unclassified
45 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
46 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
47 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
48 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
49 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
50 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
51 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
52 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
53 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
54 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
55 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
56 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
57 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
58 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
59 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
60 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
61 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
62 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
63 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
64 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
65 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
66 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
67 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
68 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
69 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
70 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
71 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
72 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
73 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
74 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
75 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
76 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
77 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
78 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
79 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
122 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
128 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
129 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
130 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
131 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
132 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
133 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
134 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
135 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
136 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
137 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
138 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
139 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
140 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
141 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
142 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
143 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
144 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
145 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
146 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
147 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
148 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
149 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
150 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
151 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
152 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
153 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
154 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
155 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
156 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
157 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
158 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
159 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
160 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
161 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
162 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
163 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
164 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
165 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
166 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
167 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
168 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
172 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
177 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
183 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
184 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
187 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
188 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
191 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
192 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
193 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
194 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
195 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
196 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
197 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
198 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
202 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
205 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
206 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
212 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
213 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
214 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
217 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
218 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
219 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
220 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
221 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
222 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
223 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
232 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
235 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
236 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
237 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
238 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
241 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
244 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
252 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
258 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
259 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
260 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
261 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
262 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
263 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
267 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
268 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
269 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
270 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
271 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
272 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
273 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
274 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
275 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
276 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
277 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.91
Metatranscriptomes 0
Isolates 9.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.29
Nodule 2.15
Rhizoplane 1.77
Rhizosphere 84.34
Stem 0
Stem Tuber 0
Unclassified 7.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_45 2124908027 Bacteria 78063
2 SwRhRL2b_contig_69147 2162886007 Bacteria 873
3 JGI25162J39368_1000166 3300002737 Bacteria 72515
4 JGI25163J39215_1002633 3300002771 Bacteria 1748
5 JGI25164J39214_1000129 3300002772 Bacteria 72515
6 JGI25165J46597_1000251 3300003214 Bacteria 72515
7 Ga0055538_1000090 3300003751 Bacteria 78300
8 Ga0055536_1005960 3300003781 Bacteria 5817
9 Ga0055530_10006166 3300003791 Bacteria 5436
10 Ga0055540_1005034 3300003792 Bacteria 5735
11 Ga0055531_10000081 3300003794 Bacteria 103600
12 Ga0065714_10010459 3300005288 Bacteria 5427
13 Ga0065714_10070542 3300005288 Bacteria 3818
14 Ga0065714_10092066 3300005288 Bacteria 1883
15 Ga0065714_10170633 3300005288 Bacteria 1006
16 Ga0065714_10173305 3300005288 Bacteria 990
17 Ga0065714_10201283 3300005288 Bacteria 894
18 Ga0065714_10273403 3300005288 Bacteria 735
19 Ga0065704_10308499 3300005289 Bacteria 870
20 Ga0065712_10001107 3300005290 Bacteria 6830
21 Ga0070664_100000046 3300005564 Bacteria 74475
22 Ga0075364_10488836 3300006051 Bacteria 841
23 Ga0075364_10499566 3300006051 Bacteria 831
24 Ga0075432_10014500 3300006058 Bacteria 2684
25 Ga0075432_10019401 3300006058 Bacteria 2323
26 Ga0075432_10019741 3300006058 Bacteria 2303
27 Ga0075432_10127708 3300006058 Bacteria 960
28 Ga0075432_10198631 3300006058 Bacteria 792
29 Ga0075362_10072461 3300006177 Bacteria 1576
30 Ga0075362_10160182 3300006177 Bacteria 1083
31 Ga0075436_100094800 3300006914 Bacteria 2075
32 Ga0075436_100410213 3300006914 Bacteria 982
33 Ga0075436_100437767 3300006914 Bacteria 951
34 Ga0079104_1000124 3300006946 Bacteria 110752
35 Ga0105251_10003252 3300009011 Bacteria 11939
36 Ga0105251_10022662 3300009011 Bacteria 3255
37 Ga0105251_10031002 3300009011 Bacteria 2679
38 Ga0105251_10048996 3300009011 Bacteria 2024
39 Ga0105251_10160240 3300009011 Bacteria 1014
40 Ga0105244_10031628 3300009036 Bacteria 2808
41 Ga0105244_10033637 3300009036 Bacteria 2702
42 Ga0105244_10048477 3300009036 Bacteria 2174
43 Ga0105244_10075147 3300009036 Bacteria 1679
44 Ga0105244_10148122 3300009036 Bacteria 1125
45 Ga0105250_10014387 3300009092 Bacteria 3253
46 Ga0105250_10021327 3300009092 Bacteria 2616
47 Ga0105250_10046013 3300009092 Bacteria 1749
48 Ga0105243_10000103 3300009148 Bacteria 97091
49 Ga0105243_10050840 3300009148 Bacteria 3276
50 Ga0105243_10095801 3300009148 Bacteria 2454
51 Ga0105243_10219411 3300009148 Bacteria 1680
52 Ga0105242_10000360 3300009176 Bacteria 36330
53 Ga0105237_10001117 3300009545 Bacteria 35949
54 Ga0105246_10000120 3300011119 Bacteria 35764
55 Ga0105246_10017224 3300011119 Bacteria 4592
56 Ga0105246_10048863 3300011119 Bacteria 2894
57 Ga0157345_1000513 3300012498 Bacteria 3575
58 Ga0157373_10051536 3300013100 Bacteria 2931
59 Ga0157373_10066380 3300013100 Bacteria 2553
60 Ga0157373_10096452 3300013100 Bacteria 2082
61 Ga0157370_10094744 3300013104 Bacteria 2801
62 Ga0157370_10155034 3300013104 Bacteria 2131
63 Ga0157370_10483423 3300013104 Bacteria 1138
64 Ga0157369_10111961 3300013105 Bacteria 2900
65 Ga0157369_10126060 3300013105 Bacteria 2714
66 Ga0157369_10639166 3300013105 Bacteria 1098
67 Ga0163162_10000072 3300013306 Bacteria 92818
68 Ga0163162_10100570 3300013306 Bacteria 2983
69 Ga0163162_10449337 3300013306 Bacteria 1421
70 Ga0163162_10873987 3300013306 Bacteria 1013
71 Ga0157372_10149886 3300013307 Bacteria 2691
72 Ga0182008_10031343 3300014497 Bacteria 2677
73 Ga0182008_10031625 3300014497 Bacteria 2663
74 Ga0182006_1028705 3300015261 Bacteria 2260
75 Ga0182006_1033493 3300015261 Bacteria 2059
76 Ga0182006_1073877 3300015261 Bacteria 1258
77 Ga0182005_1011906 3300015265 Bacteria 2466
78 Ga0182005_1029533 3300015265 Bacteria 1495
79 Ga0182005_1043052 3300015265 Bacteria 1227
80 Ga0163161_10035264 3300017792 Bacteria 3581
81 Ga0163161_10081123 3300017792 Bacteria 2388
82 Ga0163161_10426942 3300017792 Bacteria 1067
83 Ga0163161_10427163 3300017792 Bacteria 1067
84 Ga0209760_100043 3300025207 Bacteria 113964
85 Ga0207427_100047 3300025231 Bacteria 240409
86 Ga0209437_100009 3300025233 Bacteria 915954
87 Ga0209233_1000032 3300025261 Bacteria 623596
88 Ga0209675_1001166 3300025291 Bacteria 15960
89 Ga0209676_1000010 3300025292 Bacteria 954025
90 Ga0209676_1000223 3300025292 Bacteria 124359
91 Ga0209676_1011039 3300025292 Bacteria 3690
92 Ga0209050_1000081 3300025298 Bacteria 267533
93 Ga0209050_1000363 3300025298 Bacteria 86923
94 Ga0209051_1000185 3300025303 Bacteria 110195
95 Ga0209257_1000040 3300025304 Bacteria 538759
96 Ga0207696_1001259 3300025711 Bacteria 14233
97 Ga0207696_1013428 3300025711 Bacteria 2854
98 Ga0207655_1000337 3300025728 Bacteria 68266
99 Ga0207655_1000505 3300025728 Bacteria 49919
100 Ga0207655_1006756 3300025728 Bacteria 7547
101 Ga0207655_1018427 3300025728 Bacteria 3702
102 Ga0207655_1027295 3300025728 Bacteria 2722
103 Ga0207713_1003166 3300025735 Bacteria 11392
104 Ga0207713_1011393 3300025735 Bacteria 4839
105 Ga0207713_1026485 3300025735 Bacteria 2656
106 Ga0207713_1038700 3300025735 Bacteria 2021
107 Ga0207713_1046083 3300025735 Bacteria 1776
108 Ga0207713_1096955 3300025735 Bacteria 1025
109 Ga0207671_10000163 3300025914 Bacteria 103443
110 Ga0207649_10000068 3300025920 Bacteria 91623
111 Ga0207706_10116564 3300025933 Bacteria 2349
112 Ga0207686_10005101 3300025934 Bacteria 7062
113 Ga0207709_10000035 3300025935 Bacteria 300968
114 Ga0207709_10045584 3300025935 Bacteria 2656
115 Ga0207679_10000018 3300025945 Bacteria 238375
116 Ga0209281_1000077 3300027111 Bacteria 262887
117 Ga0209974_10156359 3300027876 Bacteria 825
118 Ga0207428_10007690 3300027907 Bacteria 9809
119 Ga0207428_10093554 3300027907 Bacteria 2331
120 Ga0207428_10244259 3300027907 Bacteria 1341
121 Ga0207428_10423656 3300027907 Bacteria 973
122 Ga0268266_10029554 3300028379 Bacteria 4658
123 Ga0307511_10047440 3300030521 Bacteria 3514
124 Ga0307511_10104221 3300030521 Bacteria 1843
125 Ga0265316_10308070 3300031344 Bacteria 1152
126 Ga0316576_10004630 3300031727 Bacteria 8279
127 Ga0316578_10098962 3300031728 Bacteria 1747
128 Ga0316580_10003921 3300032139 Bacteria 4274
129 Ga0307510_10070363 3300033180 Bacteria 3494
130 Ga0316574_0106152 3300035398 Bacteria 1799
131 Ga0316582_0154463 3300036647 Bacteria 1552
132 Ga0316584_0002484 3300036712 Bacteria 11676
133 Ga0439438_008196 3300041405 Bacteria 3491
134 Ga0439438_014495 3300041405 Bacteria 2344
135 Ga0439438_031086 3300041405 Bacteria 1420
136 Ga0439438_040759 3300041405 Bacteria 1206
137 Ga0439438_055586 3300041405 Bacteria 998
138 Ga0439447_007353 3300041407 Bacteria 3507
139 Ga0439447_010466 3300041407 Bacteria 2750
140 Ga0439447_011378 3300041407 Bacteria 2599
141 Ga0439447_014410 3300041407 Bacteria 2218
142 Ga0439447_021259 3300041407 Bacteria 1711
143 Ga0439466_0014706 3300041411 Bacteria 2845
144 Ga0439466_0015232 3300041411 Bacteria 2794
145 Ga0439466_0017509 3300041411 Bacteria 2581
146 Ga0439466_0018265 3300041411 Bacteria 2517
147 Ga0439466_0019575 3300041411 Bacteria 2422
148 Ga0439466_0021038 3300041411 Bacteria 2318
149 Ga0439466_0021960 3300041411 Bacteria 2256
150 Ga0439466_0022771 3300041411 Bacteria 2208
151 Ga0439466_0095950 3300041411 Bacteria 927
152 Ga0439465_0039767 3300041413 Bacteria 1519
153 Ga0451841_0546259 3300041498 Bacteria 1748
154 Ga0439432_005719 3300042006 Bacteria 4466
155 Ga0439432_016757 3300042006 Bacteria 2464
156 Ga0439432_040892 3300042006 Bacteria 1469
157 Ga0439432_053306 3300042006 Bacteria 1258
158 Ga0439451_002967 3300042009 Bacteria 3449
159 Ga0439451_011913 3300042009 Bacteria 1753
160 Ga0439451_012832 3300042009 Bacteria 1693
161 Ga0439451_026311 3300042009 Bacteria 1172
162 Ga0439452_002355 3300042010 Bacteria 7021
163 Ga0439452_007459 3300042010 Bacteria 3348
164 Ga0439452_007500 3300042010 Bacteria 3339
165 Ga0439452_007673 3300042010 Bacteria 3295
166 Ga0439452_011854 3300042010 Bacteria 2497
167 Ga0439452_014300 3300042010 Bacteria 2207
168 Ga0439456_001682 3300042013 Bacteria 4461
169 Ga0439456_007491 3300042013 Bacteria 2242
170 Ga0439456_008192 3300042013 Bacteria 2157
171 Ga0439456_008812 3300042013 Bacteria 2085
172 Ga0439456_014034 3300042013 Bacteria 1669
173 Ga0439456_026271 3300042013 Bacteria 1238
174 Ga0439456_037255 3300042013 Bacteria 1050
175 Ga0439463_011576 3300042016 Bacteria 2165
176 Ga0439463_019362 3300042016 Bacteria 1695
177 Ga0450911_003129 3300042115 Bacteria 3002
178 Ga0450911_005208 3300042115 Bacteria 2040
179 Ga0450911_010400 3300042115 Bacteria 1286
180 Ga0450919_001877 3300042121 Bacteria 2730
181 Ga0450919_001886 3300042121 Bacteria 2722
182 Ga0450921_009723 3300042123 Bacteria 799
183 Ga0450922_000839 3300042124 Bacteria 3146
184 Ga0450923_004559 3300042125 Bacteria 2180
185 Ga0450890_003208 3300042127 Bacteria 2182
186 Ga0450902_004619 3300042137 Bacteria 2053
187 Ga0450902_005318 3300042137 Bacteria 1939
188 Ga0450902_006885 3300042137 Bacteria 1748
189 Ga0450902_011212 3300042137 Bacteria 1422
190 Ga0450902_012858 3300042137 Bacteria 1344
191 Ga0450903_003143 3300042138 Bacteria 2877
192 Ga0450903_004746 3300042138 Bacteria 2301
193 Ga0450903_007141 3300042138 Bacteria 1845
194 Ga0450903_010069 3300042138 Bacteria 1533
195 Ga0450904_002725 3300042139 Bacteria 2028
196 Ga0450904_013239 3300042139 Bacteria 821
197 Ga0450889_005903 3300042144 Bacteria 1224
198 Ga0450906_001629 3300042145 Bacteria 4926
199 Ga0450906_006887 3300042145 Bacteria 2271
200 Ga0450907_000439 3300042146 Bacteria 12184
201 Ga0450907_003283 3300042146 Bacteria 2911
202 Ga0450907_003381 3300042146 Bacteria 2854
203 Ga0450910_003571 3300042147 Bacteria 2069
204 Ga0450910_003719 3300042147 Bacteria 2035
205 Ga0439446_0010809 3300042156 Bacteria 2465
206 Ga0439446_0016916 3300042156 Bacteria 2034
207 Ga0450908_007212 3300042184 Bacteria 2099
208 Ga0450908_009461 3300042184 Bacteria 1809
209 Ga0450909_001303 3300042185 Bacteria 3472
210 Ga0450909_003330 3300042185 Bacteria 2287
211 Ga0439434_0002467 3300042435 Bacteria 5382
212 Ga0439434_0021955 3300042435 Bacteria 1918
213 Ga0439464_0002620 3300042439 Bacteria 4451
214 Ga0439460_0001391 3300042461 Bacteria 5698
215 Ga0439460_0014027 3300042461 Bacteria 2102
216 Ga0439460_0030432 3300042461 Bacteria 1534
217 Ga0450918_004279 3300042531 Bacteria 2610
218 Ga0450893_0016160 3300042532 Bacteria 1262
219 Ga0450901_000675 3300042533 Bacteria 4034
220 Ga0439440_0002009 3300042993 Bacteria 3788
221 Ga0439440_0004814 3300042993 Bacteria 2662
222 Ga0439440_0005609 3300042993 Bacteria 2497
223 Ga0495617_008593 3300046452 Bacteria 3515
224 Ga0495617_009506 3300046452 Bacteria 3338
225 Ga0495617_010357 3300046452 Bacteria 3194
226 Ga0495617_011426 3300046452 Bacteria 3028
227 Ga0495617_016005 3300046452 Bacteria 2537
228 Ga0495617_016417 3300046452 Bacteria 2503
229 Ga0495617_033710 3300046452 Bacteria 1718
230 Ga0495617_042153 3300046452 Bacteria 1525
231 Ga0495617_066475 3300046452 Bacteria 1188
232 Ga0495617_098759 3300046452 Bacteria 949
233 Ga0495627_007725 3300046453 Bacteria 4100
234 Ga0495627_010534 3300046453 Bacteria 3356
235 Ga0495627_013063 3300046453 Bacteria 2930
236 Ga0495627_013545 3300046453 Bacteria 2868
237 Ga0495627_020542 3300046453 Bacteria 2199
238 Ga0495592_0089177 3300046454 Bacteria 2215
239 Ga0495603_0035954 3300046455 Bacteria 2974
240 Ga0495603_0052937 3300046455 Bacteria 2409
241 Ga0495590_0005246 3300046457 Bacteria 5141
242 Ga0495590_0014589 3300046457 Bacteria 2865
243 Ga0495590_0022190 3300046457 Bacteria 2245
244 Ga0495590_0029768 3300046457 Bacteria 1913
245 Ga0495590_0046241 3300046457 Bacteria 1518
246 Ga0495590_0154197 3300046457 Bacteria 833
247 Ga0495590_0180978 3300046457 Bacteria 770
248 Ga0495591_000114 3300046458 Bacteria 93304
249 Ga0495591_007843 3300046458 Bacteria 4460
250 Ga0495591_008615 3300046458 Bacteria 4157
251 Ga0495591_015266 3300046458 Bacteria 2721
252 Ga0495591_033099 3300046458 Bacteria 1533
253 Ga0495591_088785 3300046458 Bacteria 779
254 Ga0495591_090806 3300046458 Bacteria 766
255 Ga0495629_0081244 3300046459 Bacteria 2262
256 Ga0495638_0027707 3300046460 Bacteria 3665
257 Ga0495638_0035709 3300046460 Bacteria 3167
258 Ga0495638_0035871 3300046460 Bacteria 3159
259 Ga0495638_0052593 3300046460 Bacteria 2536
260 Ga0495638_0064651 3300046460 Bacteria 2253
261 Ga0495638_0064853 3300046460 Bacteria 2249
262 Ga0495638_0065212 3300046460 Bacteria 2242
263 Ga0495638_0075931 3300046460 Bacteria 2047
264 Ga0495638_0114457 3300046460 Bacteria 1599
265 Ga0495638_0179684 3300046460 Bacteria 1208
266 Ga0495653_0015606 3300046463 Bacteria 6191
267 Ga0495653_0022948 3300046463 Bacteria 5046
268 Ga0495653_0118087 3300046463 Bacteria 1894
269 Ga0495653_0347525 3300046463 Bacteria 954
270 Ga0495650_0013460 3300046471 Bacteria 4322
271 Ga0495650_0014720 3300046471 Bacteria 4047
272 Ga0495650_0016594 3300046471 Bacteria 3724
273 Ga0495650_0024565 3300046471 Bacteria 2843
274 Ga0495650_0026177 3300046471 Bacteria 2718
275 Ga0495650_0029647 3300046471 Bacteria 2490
276 Ga0495605_0004649 3300046474 Bacteria 8027
277 Ga0495605_0020759 3300046474 Bacteria 3487
278 Ga0495605_0021889 3300046474 Bacteria 3381
279 Ga0495605_0022290 3300046474 Bacteria 3346
280 Ga0495605_0034576 3300046474 Bacteria 2558
281 Ga0495605_0039237 3300046474 Bacteria 2373
282 Ga0495605_0042352 3300046474 Bacteria 2264
283 Ga0495605_0053383 3300046474 Bacteria 1960
284 Ga0495605_0096026 3300046474 Bacteria 1368
285 Ga0495639_0006221 3300046475 Bacteria 5128
286 Ga0495584_0012604 3300046491 Bacteria 4316
287 Ga0495584_0015953 3300046491 Bacteria 3833
288 Ga0495584_0018277 3300046491 Bacteria 3563
289 Ga0495584_0022048 3300046491 Bacteria 3232
290 Ga0495584_0023313 3300046491 Bacteria 3138
291 Ga0495584_0031469 3300046491 Bacteria 2685
292 Ga0495584_0032170 3300046491 Bacteria 2655
293 Ga0495584_0033561 3300046491 Bacteria 2596
294 Ga0495584_0055360 3300046491 Bacteria 1996
295 Ga0495584_0117184 3300046491 Bacteria 1348
296 Ga0495584_0318824 3300046491 Bacteria 789
297 Ga0495585_0000245 3300046492 Bacteria 56106
298 Ga0495585_0004200 3300046492 Bacteria 9404
299 Ga0495585_0033165 3300046492 Bacteria 2924
300 Ga0495585_0043154 3300046492 Bacteria 2523
301 Ga0495585_0046829 3300046492 Bacteria 2410
302 Ga0495585_0052949 3300046492 Bacteria 2247
303 Ga0495585_0058530 3300046492 Bacteria 2125
304 Ga0495585_0082405 3300046492 Bacteria 1741
305 Ga0495585_0087997 3300046492 Bacteria 1675
306 Ga0495585_0247007 3300046492 Bacteria 892
307 Ga0495585_0270545 3300046492 Bacteria 842
308 Ga0495594_0016019 3300046499 Bacteria 3944
309 Ga0495594_0025802 3300046499 Bacteria 3159
310 Ga0495596_0002112 3300046500 Bacteria 10892
311 Ga0495596_0045511 3300046500 Bacteria 1725
312 Ga0495607_0018686 3300046501 Bacteria 4413
313 Ga0495607_0028694 3300046501 Bacteria 3430
314 Ga0495607_0030980 3300046501 Bacteria 3277
315 Ga0495607_0031915 3300046501 Bacteria 3221
316 Ga0495607_0038912 3300046501 Bacteria 2844
317 Ga0495607_0043739 3300046501 Bacteria 2646
318 Ga0495607_0056035 3300046501 Bacteria 2264
319 Ga0495607_0075474 3300046501 Bacteria 1868
320 Ga0495607_0097320 3300046501 Bacteria 1582
321 Ga0495607_0152067 3300046501 Bacteria 1183
322 Ga0495607_0295241 3300046501 Bacteria 764
323 Ga0495607_0368597 3300046501 Bacteria 659
324 Ga0495583_0009134 3300046506 Bacteria 5958
325 Ga0495583_0030487 3300046506 Bacteria 2625
326 Ga0495606_0029081 3300046507 Bacteria 3886
327 Ga0495606_0035115 3300046507 Bacteria 3432
328 Ga0495606_0035730 3300046507 Bacteria 3393
329 Ga0495606_0042520 3300046507 Bacteria 3037
330 Ga0495606_0072455 3300046507 Bacteria 2164
331 Ga0495606_0158121 3300046507 Bacteria 1324
332 Ga0495606_0206301 3300046507 Bacteria 1116
333 Ga0495610_0018982 3300046512 Bacteria 3862
334 Ga0495610_0020975 3300046512 Bacteria 3606
335 Ga0495610_0025532 3300046512 Bacteria 3168
336 Ga0495610_0028511 3300046512 Bacteria 2951
337 Ga0495610_0065025 3300046512 Bacteria 1722
338 Ga0495610_0104649 3300046512 Bacteria 1262
339 Ga0495610_0108552 3300046512 Bacteria 1232
340 Ga0495610_0123916 3300046512 Bacteria 1129
341 Ga0495610_0127014 3300046512 Bacteria 1111
342 Ga0495610_0157869 3300046512 Bacteria 961
343 Ga0495610_0158590 3300046512 Bacteria 958
344 Ga0495610_0202824 3300046512 Bacteria 811
345 Ga0495610_0204068 3300046512 Bacteria 807
346 Ga0495616_0016026 3300046513 Bacteria 4154
347 Ga0495616_0017366 3300046513 Bacteria 3970
348 Ga0495616_0026526 3300046513 Bacteria 3082
349 Ga0495616_0028524 3300046513 Bacteria 2955
350 Ga0495616_0046001 3300046513 Bacteria 2205
351 Ga0495616_0056060 3300046513 Bacteria 1948
352 Ga0495616_0126440 3300046513 Bacteria 1175
353 Ga0495616_0145534 3300046513 Bacteria 1075
354 Ga0495616_0169368 3300046513 Bacteria 977
355 Ga0495616_0227181 3300046513 Bacteria 810
356 Ga0495620_0000307 3300046515 Bacteria 34934
357 Ga0495620_0012814 3300046515 Bacteria 4313
358 Ga0495620_0014040 3300046515 Bacteria 4083
359 Ga0495620_0027440 3300046515 Bacteria 2663
360 Ga0495620_0030439 3300046515 Bacteria 2484
361 Ga0495620_0047522 3300046515 Bacteria 1846
362 Ga0495620_0056846 3300046515 Bacteria 1644
363 Ga0495630_0094397 3300046517 Bacteria 2261
364 Ga0495631_0011811 3300046518 Bacteria 4284
365 Ga0495631_0015974 3300046518 Bacteria 3588
366 Ga0495631_0016373 3300046518 Bacteria 3536
367 Ga0495631_0059457 3300046518 Bacteria 1660
368 Ga0495631_0077000 3300046518 Bacteria 1439
369 Ga0495631_0135334 3300046518 Bacteria 1058
370 Ga0495632_0001221 3300046519 Bacteria 21803
371 Ga0495632_0025007 3300046519 Bacteria 3163
372 Ga0495632_0025390 3300046519 Bacteria 3134
373 Ga0495632_0028760 3300046519 Bacteria 2899
374 Ga0495632_0033236 3300046519 Bacteria 2650
375 Ga0495632_0046316 3300046519 Bacteria 2161
376 Ga0495632_0062423 3300046519 Bacteria 1806
377 Ga0495632_0090758 3300046519 Bacteria 1448
378 Ga0495632_0114779 3300046519 Bacteria 1262
379 Ga0495637_0002342 3300046520 Bacteria 10493
380 Ga0495637_0002900 3300046520 Bacteria 9274
381 Ga0495637_0011496 3300046520 Bacteria 4250
382 Ga0495637_0020567 3300046520 Bacteria 3036
383 Ga0495637_0025635 3300046520 Bacteria 2655
384 Ga0495637_0025727 3300046520 Bacteria 2649
385 Ga0495637_0026713 3300046520 Bacteria 2588
386 Ga0495637_0027470 3300046520 Bacteria 2545
387 Ga0495637_0043624 3300046520 Bacteria 1912
388 Ga0495637_0045885 3300046520 Bacteria 1850
389 Ga0495637_0053564 3300046520 Bacteria 1679
390 Ga0495637_0084751 3300046520 Bacteria 1258
391 Ga0495637_0157806 3300046520 Bacteria 852
392 Ga0495637_0161744 3300046520 Bacteria 839
393 Ga0495643_0034907 3300046522 Bacteria 2771
394 Ga0495643_0035813 3300046522 Bacteria 2731
395 Ga0495643_0037478 3300046522 Bacteria 2659
396 Ga0495643_0063719 3300046522 Bacteria 1948
397 Ga0495643_0071960 3300046522 Bacteria 1814
398 Ga0495644_0002915 3300046523 Bacteria 6792
399 Ga0495644_0009811 3300046523 Bacteria 3686
400 Ga0495644_0037566 3300046523 Bacteria 1827
401 Ga0495644_0090585 3300046523 Bacteria 1154
402 Ga0495648_0000627 3300046524 Bacteria 37754
403 Ga0495648_0001736 3300046524 Bacteria 21072
404 Ga0495648_0005912 3300046524 Bacteria 10069
405 Ga0495648_0021607 3300046524 Bacteria 4453
406 Ga0495648_0034102 3300046524 Bacteria 3318
407 Ga0495648_0043948 3300046524 Bacteria 2793
408 Ga0495648_0050361 3300046524 Bacteria 2545
409 Ga0495648_0050493 3300046524 Bacteria 2540
410 Ga0495648_0054060 3300046524 Bacteria 2428
411 Ga0495648_0072062 3300046524 Bacteria 2000
412 Ga0495648_0077575 3300046524 Bacteria 1903
413 Ga0495648_0138283 3300046524 Bacteria 1285
414 Ga0495666_0023209 3300046526 Bacteria 3068
415 Ga0495666_0042056 3300046526 Bacteria 2210
416 Ga0495642_0001507 3300046528 Bacteria 10362
417 Ga0495642_0005249 3300046528 Bacteria 4981
418 Ga0495642_0019182 3300046528 Bacteria 2679
419 Ga0495654_0013034 3300046530 Bacteria 4453
420 Ga0495654_0023600 3300046530 Bacteria 3184
421 Ga0495654_0024566 3300046530 Bacteria 3111
422 Ga0495654_0032199 3300046530 Bacteria 2658
423 Ga0495654_0035636 3300046530 Bacteria 2503
424 Ga0495654_0036666 3300046530 Bacteria 2463
425 Ga0495654_0038560 3300046530 Bacteria 2388
426 Ga0495654_0039483 3300046530 Bacteria 2356
427 Ga0495654_0039989 3300046530 Bacteria 2338
428 Ga0495654_0047110 3300046530 Bacteria 2120
429 Ga0495654_0051116 3300046530 Bacteria 2017
430 Ga0495654_0051679 3300046530 Bacteria 2004
431 Ga0495654_0059100 3300046530 Bacteria 1847
432 Ga0495654_0081510 3300046530 Bacteria 1516
433 Ga0495654_0107854 3300046530 Bacteria 1273
434 Ga0495654_0114916 3300046530 Bacteria 1224
435 Ga0495586_0022675 3300046535 Bacteria 3350
436 Ga0495586_0058927 3300046535 Bacteria 2086
437 Ga0495587_0013898 3300046536 Bacteria 5054
438 Ga0495587_0087381 3300046536 Bacteria 1804
439 Ga0495587_0297243 3300046536 Bacteria 903
440 Ga0495609_0005305 3300046538 Bacteria 6824
441 Ga0495609_0025577 3300046538 Bacteria 2706
442 Ga0495609_0026890 3300046538 Bacteria 2631
443 Ga0495609_0033503 3300046538 Bacteria 2332
444 Ga0495609_0070339 3300046538 Bacteria 1538
445 Ga0495609_0106615 3300046538 Bacteria 1211
446 Ga0495597_0014713 3300046542 Bacteria 3721
447 Ga0495597_0022135 3300046542 Bacteria 2950
448 Ga0495597_0025439 3300046542 Bacteria 2725
449 Ga0495597_0046612 3300046542 Bacteria 1920
450 Ga0495597_0047473 3300046542 Bacteria 1900
451 Ga0495597_0050822 3300046542 Bacteria 1828
452 Ga0495597_0055803 3300046542 Bacteria 1731
453 Ga0495597_0095174 3300046542 Bacteria 1260
454 Ga0495597_0226590 3300046542 Bacteria 740
455 Ga0495645_0059506 3300046543 Bacteria 2770
456 Ga0495645_0236637 3300046543 Bacteria 1220
457 Ga0495622_0007863 3300046557 Bacteria 4948
458 Ga0495622_0036929 3300046557 Bacteria 2276
459 Ga0495622_0072633 3300046557 Bacteria 1587
460 Ga0495622_0082146 3300046557 Bacteria 1482
461 Ga0495633_0016039 3300046558 Bacteria 3875
462 Ga0495633_0019590 3300046558 Bacteria 3420
463 Ga0495633_0021488 3300046558 Bacteria 3227
464 Ga0495633_0050971 3300046558 Bacteria 1950
465 Ga0495633_0054553 3300046558 Bacteria 1880
466 Ga0495633_0245027 3300046558 Bacteria 818
467 Ga0495656_0239239 3300046615 Bacteria 913
468 Ga0495668_0007580 3300046616 Bacteria 6922
469 Ga0495668_0311347 3300046616 Bacteria 863
470 Ga0495634_0087422 3300046642 Bacteria 2028
471 Ga0495611_0000220 3300046648 Bacteria 39983
472 Ga0495611_0021644 3300046648 Bacteria 2778
473 Ga0495611_0244884 3300046648 Bacteria 831
474 Ga0495611_0276595 3300046648 Bacteria 776
475 Ga0495625_0007116 3300046660 Bacteria 9827
476 Ga0495625_0024545 3300046660 Bacteria 4587
477 Ga0495625_0052039 3300046660 Bacteria 2933
478 Ga0495625_0054176 3300046660 Bacteria 2865
479 Ga0495625_0059599 3300046660 Bacteria 2707
480 Ga0495625_0060543 3300046660 Bacteria 2682
481 Ga0495625_0061658 3300046660 Bacteria 2653
482 Ga0495625_0061763 3300046660 Bacteria 2650
483 Ga0495625_0062270 3300046660 Bacteria 2637
484 Ga0495625_0067647 3300046660 Bacteria 2513
485 Ga0495625_0094797 3300046660 Bacteria 2058
486 Ga0495625_0239332 3300046660 Bacteria 1182
487 Ga0495625_0368208 3300046660 Bacteria 904
488 Ga0495659_0028257 3300046664 Bacteria 1940
489 Ga0495661_0033825 3300046665 Bacteria 3221
490 Ga0495661_0036024 3300046665 Bacteria 3101
491 Ga0495661_0055651 3300046665 Bacteria 2370
492 Ga0495661_0071386 3300046665 Bacteria 2029
493 Ga0495661_0090374 3300046665 Bacteria 1743
494 Ga0495661_0140282 3300046665 Bacteria 1315
495 Ga0495661_0265433 3300046665 Bacteria 870
496 Ga0495588_0032089 3300046674 Bacteria 2646
497 Ga0495588_0041705 3300046674 Bacteria 2344
498 Ga0495657_0195833 3300046675 Bacteria 1233
499 Ga0495623_0031640 3300046679 Bacteria 3401
500 Ga0495646_0027729 3300046680 Bacteria 3550
501 Ga0495646_0056929 3300046680 Bacteria 2342
502 Ga0495669_0056496 3300046684 Bacteria 1769
503 Ga0495669_0064013 3300046684 Bacteria 1668
504 Ga0495613_0055068 3300046689 Bacteria 2923
505 Ga0495613_0069871 3300046689 Bacteria 2560
506 Ga0495613_0076054 3300046689 Bacteria 2444
507 Ga0495624_0047892 3300046690 Bacteria 2715
508 Ga0495624_0144141 3300046690 Bacteria 1458
509 Ga0495670_0011207 3300046691 Bacteria 4407
510 Ga0495670_0024588 3300046691 Bacteria 2977
511 Ga0495670_0030213 3300046691 Bacteria 2691
512 Ga0495670_0099055 3300046691 Bacteria 1499
513 Ga0495670_0327848 3300046691 Bacteria 822
514 Ga0495670_0344617 3300046691 Bacteria 801
515 Ga0495671_0003907 3300046692 Bacteria 9038
516 Ga0495671_0014615 3300046692 Bacteria 4219
517 Ga0495671_0019659 3300046692 Bacteria 3565
518 Ga0495671_0020154 3300046692 Bacteria 3515
519 Ga0495671_0026675 3300046692 Bacteria 2992
520 Ga0495671_0031652 3300046692 Bacteria 2704
521 Ga0495671_0041134 3300046692 Bacteria 2328
522 Ga0495671_0070305 3300046692 Bacteria 1719
523 Ga0495671_0191605 3300046692 Bacteria 993
524 Ga0495671_0236434 3300046692 Bacteria 883
525 Ga0495649_0009999 3300046694 Bacteria 5608
526 Ga0495649_0014503 3300046694 Bacteria 4514
527 Ga0495649_0025632 3300046694 Bacteria 3284
528 Ga0495649_0029700 3300046694 Bacteria 3021
529 Ga0495649_0033868 3300046694 Bacteria 2811
530 Ga0495649_0039715 3300046694 Bacteria 2579
531 Ga0495649_0049413 3300046694 Bacteria 2284
532 Ga0495649_0072235 3300046694 Bacteria 1849
533 Ga0495649_0080718 3300046694 Bacteria 1739
534 Ga0495649_0086905 3300046694 Bacteria 1668
535 Ga0495649_0107238 3300046694 Bacteria 1482
536 Ga0495649_0154486 3300046694 Bacteria 1204
537 Ga0495649_0179901 3300046694 Bacteria 1103
538 Ga0495589_0024078 3300046794 Bacteria 3095
539 Ga0495589_0024944 3300046794 Bacteria 3036
540 Ga0495589_0026036 3300046794 Bacteria 2965
541 Ga0495589_0029993 3300046794 Bacteria 2741
542 Ga0495589_0033565 3300046794 Bacteria 2576
543 Ga0495589_0034234 3300046794 Bacteria 2551
544 Ga0495589_0054170 3300046794 Bacteria 1978
545 Ga0495589_0064801 3300046794 Bacteria 1791
546 Ga0495589_0118667 3300046794 Bacteria 1274
547 Ga0495589_0279566 3300046794 Bacteria 776
548 Ga0495600_0073069 3300046809 Bacteria 2239
549 Ga0495600_0113825 3300046809 Bacteria 1761
550 Ga0495660_0012537 3300046810 Bacteria 4921
551 Ga0495660_0027317 3300046810 Bacteria 3230
552 Ga0495660_0027752 3300046810 Bacteria 3200
553 Ga0495660_0034878 3300046810 Bacteria 2813
554 Ga0495660_0038124 3300046810 Bacteria 2673
555 Ga0495660_0048297 3300046810 Bacteria 2327
556 Ga0495660_0049678 3300046810 Bacteria 2288
557 Ga0495660_0060062 3300046810 Bacteria 2043
558 Ga0495660_0062628 3300046810 Bacteria 1993
559 Ga0495660_0076837 3300046810 Bacteria 1758
560 Ga0495660_0120823 3300046810 Bacteria 1325
561 Ga0495660_0132735 3300046810 Bacteria 1247
562 Ga0495581_0020380 3300047315 Bacteria 3848
563 Ga0495604_0055965 3300047317 Bacteria 3038
564 Ga0495604_0068113 3300047317 Bacteria 2702
565 Ga0495604_0100508 3300047317 Bacteria 2126
566 Ga0495672_0015502 3300047320 Bacteria 5171
567 Ga0495672_0017766 3300047320 Bacteria 4746
568 Ga0495672_0031670 3300047320 Bacteria 3299
569 Ga0495672_0032357 3300047320 Bacteria 3255
570 Ga0495672_0043301 3300047320 Bacteria 2707
571 Ga0495672_0045739 3300047320 Bacteria 2616
572 Ga0495672_0047754 3300047320 Bacteria 2543
573 Ga0495672_0051192 3300047320 Bacteria 2433
574 Ga0495672_0069480 3300047320 Bacteria 1999
575 Ga0495672_0083745 3300047320 Bacteria 1770
576 Ga0495676_0071113 3300047321 Bacteria 2676
577 Ga0495676_0097246 3300047321 Bacteria 2187
578 Ga0495680_0048987 3300047322 Bacteria 3313
579 Ga0495680_0050622 3300047322 Bacteria 3246
580 Ga0495680_0103114 3300047322 Bacteria 2123
581 Ga0495683_0020306 3300047323 Bacteria 3427
582 Ga0495683_0020310 3300047323 Bacteria 3427
583 Ga0495683_0021183 3300047323 Bacteria 3350
584 Ga0495683_0022382 3300047323 Bacteria 3249
585 Ga0495683_0041440 3300047323 Bacteria 2323
586 Ga0495683_0047159 3300047323 Bacteria 2162
587 Ga0495683_0049683 3300047323 Bacteria 2100
588 Ga0495683_0254882 3300047323 Bacteria 768
589 Ga0495687_022831 3300047443 Bacteria 2997
590 Ga0495687_035416 3300047443 Bacteria 2245
591 Ga0495675_0103336 3300047444 Bacteria 1781
592 Ga0495675_0118346 3300047444 Bacteria 1650
593 Ga0495675_0296113 3300047444 Bacteria 962
594 Ga0495677_0006910 3300047445 Bacteria 4266
595 Ga0495677_0091563 3300047445 Bacteria 1146
596 Ga0495679_010365 3300047446 Bacteria 3661
597 Ga0495679_011858 3300047446 Bacteria 3347
598 Ga0495679_016987 3300047446 Bacteria 2615
599 Ga0495679_020699 3300047446 Bacteria 2286
600 Ga0495679_023073 3300047446 Bacteria 2117
601 Ga0495679_024311 3300047446 Bacteria 2042
602 Ga0495679_025976 3300047446 Bacteria 1950
603 Ga0495679_088960 3300047446 Bacteria 868
604 Ga0495679_120704 3300047446 Bacteria 716
605 Ga0495685_015561 3300047447 Bacteria 2596
606 Ga0495673_0014266 3300047469 Bacteria 4135
607 Ga0495673_0016666 3300047469 Bacteria 3751
608 Ga0495673_0017337 3300047469 Bacteria 3661
609 Ga0495673_0017567 3300047469 Bacteria 3627
610 Ga0495673_0020586 3300047469 Bacteria 3281
611 Ga0495673_0027735 3300047469 Bacteria 2690
612 Ga0495673_0030599 3300047469 Bacteria 2526
613 Ga0495673_0038643 3300047469 Bacteria 2170
614 Ga0495673_0039354 3300047469 Bacteria 2145
615 Ga0495673_0050123 3300047469 Bacteria 1834
616 Ga0495673_0056093 3300047469 Bacteria 1706
617 Ga0495673_0100178 3300047469 Bacteria 1172
618 Ga0495673_0136960 3300047469 Bacteria 957
619 Ga0495681_0003347 3300047470 Bacteria 11153
620 Ga0495681_0011339 3300047470 Bacteria 5314
621 Ga0495681_0014504 3300047470 Bacteria 4511
622 Ga0495681_0014986 3300047470 Bacteria 4410
623 Ga0495681_0025480 3300047470 Bacteria 3093
624 Ga0495681_0027058 3300047470 Bacteria 2973
625 Ga0495681_0029715 3300047470 Bacteria 2793
626 Ga0495681_0031606 3300047470 Bacteria 2676
627 Ga0495681_0043596 3300047470 Bacteria 2161
628 Ga0495681_0046284 3300047470 Bacteria 2075
629 Ga0495681_0049208 3300047470 Bacteria 1993
630 Ga0495681_0057715 3300047470 Bacteria 1801
631 Ga0495681_0103173 3300047470 Bacteria 1244
632 Ga0495681_0114406 3300047470 Bacteria 1164
633 Ga0495681_0131613 3300047470 Bacteria 1064
634 Ga0495681_0154988 3300047470 Bacteria 958
635 Ga0495684_0097991 3300047471 Bacteria 2217
636 Ga0495684_0185087 3300047471 Bacteria 1542
637 Ga0495686_0019800 3300047472 Bacteria 4493
638 Ga0495686_0027927 3300047472 Bacteria 3678
639 Ga0495686_0093911 3300047472 Bacteria 1818
640 Ga0495686_0206970 3300047472 Bacteria 1123
641 Ga0495593_0044272 3300047673 Bacteria 2381
642 Ga0495593_0048673 3300047673 Bacteria 2253
643 Ga0495602_0081869 3300048088 Bacteria 2712
644 Ga0495614_0235507 3300048089 Bacteria 835
645 Ga0495626_0004078 3300048091 Bacteria 9096
646 Ga0495626_0016115 3300048091 Bacteria 3806
647 Ga0495626_0016716 3300048091 Bacteria 3720
648 Ga0495626_0018016 3300048091 Bacteria 3556
649 Ga0495626_0018283 3300048091 Bacteria 3523
650 Ga0495626_0019291 3300048091 Bacteria 3411
651 Ga0495626_0043555 3300048091 Bacteria 2104
652 Ga0495626_0094192 3300048091 Bacteria 1313
653 Ga0495626_0308938 3300048091 Bacteria 623
654 Ga0496100_0504091 3300048903 Bacteria 933
655 Ga0496101_0378753 3300048904 Bacteria 1113
656 Ga0496102_0885733 3300048905 Bacteria 814
657 Ga0496106_0175168 3300048909 Bacteria 1702
658 Ga0496110_0141470 3300048913 Bacteria 2175
659 Ga0496110_0340821 3300048913 Bacteria 1365
660 Ga0496111_0142609 3300048914 Bacteria 1775
661 Ga0496116_0000419 3300048919 Bacteria 60095
662 Ga0496116_0051754 3300048919 Bacteria 2725
663 Ga0496116_0055201 3300048919 Bacteria 2611
664 Ga0496117_0065026 3300048920 Bacteria 2482
665 Ga0496117_0078212 3300048920 Bacteria 2184
666 Ga0496117_0079958 3300048920 Bacteria 2151
667 Ga0496117_0107948 3300048920 Bacteria 1742
668 Ga0496117_0323392 3300048920 Bacteria 807
669 Ga0496118_0052717 3300048921 Bacteria 3099
670 Ga0496118_0065195 3300048921 Bacteria 2666
671 Ga0496118_0122586 3300048921 Bacteria 1690
672 Ga0496118_0193715 3300048921 Bacteria 1212
673 Ga0496118_0275672 3300048921 Bacteria 939
674 Ga0496119_0104734 3300048922 Bacteria 1581
675 Ga0496120_0068431 3300048923 Bacteria 1958
676 Ga0496120_0172049 3300048923 Bacteria 1070
677 Ga0496121_0077278 3300048924 Bacteria 2651
678 Ga0496121_0112019 3300048924 Bacteria 2079
679 Ga0496121_0114208 3300048924 Bacteria 2053
680 Ga0496122_0061036 3300048925 Bacteria 2770
681 Ga0496122_0132649 3300048925 Bacteria 1578
682 Ga0496124_0044265 3300048927 Bacteria 3820
683 Ga0496124_0086230 3300048927 Bacteria 2570
684 Ga0496124_0094215 3300048927 Bacteria 2436
685 Ga0496124_0184480 3300048927 Bacteria 1602
686 Ga0496125_0025675 3300048928 Bacteria 5388
687 Ga0496125_0081528 3300048928 Bacteria 2471
688 Ga0496125_0092923 3300048928 Bacteria 2253
689 Ga0496125_0300930 3300048928 Bacteria 982
690 Ga0496126_0051977 3300048929 Bacteria 3727
691 Ga0495678_015963 3300049459 Bacteria 3446
692 Ga0495678_016475 3300049459 Bacteria 3378
693 Ga0495678_019012 3300049459 Bacteria 3075
694 Ga0495678_020318 3300049459 Bacteria 2943
695 Ga0495678_022351 3300049459 Bacteria 2766
696 Ga0495678_022489 3300049459 Bacteria 2755
697 Ga0495678_025005 3300049459 Bacteria 2570
698 Ga0495678_030928 3300049459 Bacteria 2236
699 Ga0495678_039641 3300049459 Bacteria 1899
700 Ga0495678_054284 3300049459 Bacteria 1534
701 Ga0495678_068848 3300049459 Bacteria 1303
702 Ga0495678_074461 3300049459 Bacteria 1235
703 Ga0495678_141510 3300049459 Bacteria 786
704 Ga0495682_0014871 3300049460 Bacteria 2949
705 Ga0495682_0017363 3300049460 Bacteria 2716
706 Ga0495682_0020171 3300049460 Bacteria 2502
707 Ga0495682_0021731 3300049460 Bacteria 2403
708 Ga0495682_0022344 3300049460 Bacteria 2365
709 Ga0495682_0031729 3300049460 Bacteria 1952
710 nmdc:mga03683_164708_c1 3300050489 Bacteria 1006
711 nmdc:mga03683_215375_c1 3300050489 Bacteria 885
712 nmdc:mga00v17_142360_c1 3300050491 Bacteria 1538
713 nmdc:mga00v17_428799_c1 3300050491 Bacteria 859
714 nmdc:mga08x19_115935_c1 3300050514 Bacteria 1791
715 nmdc:mga08x19_370031_c1 3300050514 Bacteria 1003
716 nmdc:mga0sz30_35910_c1 3300050516 Bacteria 2070
717 Ga0500647_0155131 3300053091 Bacteria 1066
718 Ga0500572_006597 3300053111 Bacteria 2662
719 Ga0500586_062485 3300053145 Bacteria 1297
720 Ga0500634_0045727 3300053161 Bacteria 2367

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046501 Ga0495607_0368597 Ga0495607_0368597_64_648 176
2 3300048091 Ga0495626_0308938 Ga0495626_0308938_20_580 186
3 2162886007 SwRhRL2b_contig_69147 SwRhRL2b_0841.00001670 188
4 3300005289 Ga0065704_10308499 Ga0065704_103084991 188
5 3300042016 Ga0439463_011576 Ga0439463_011576_1087_1743 188
6 3300042993 Ga0439440_0005609 Ga0439440_0005609_1220_1876 188
7 3300009011 Ga0105251_10022662 Ga0105251_100226623 190
8 3300025735 Ga0207713_1011393 Ga0207713_10113933 190
9 3300042013 Ga0439456_008812 Ga0439456_008812_1101_1757 191
10 3300046452 Ga0495617_033710 Ga0495617_033710_1053_1700 191
11 3300046474 Ga0495605_0096026 Ga0495605_0096026_571_1227 191
12 3300046501 Ga0495607_0056035 Ga0495607_0056035_1025_1672 191
13 3300046507 Ga0495606_0029081 Ga0495606_0029081_1003_1650 191
14 3300046530 Ga0495654_0047110 Ga0495654_0047110_913_1569 191
15 3300046538 Ga0495609_0026890 Ga0495609_0026890_976_1623 191
16 3300046660 Ga0495625_0094797 Ga0495625_0094797_623_1279 191
17 3300046665 Ga0495661_0140282 Ga0495661_0140282_572_1219 191
18 3300047446 Ga0495679_088960 Ga0495679_088960_160_807 191
19 3300047470 Ga0495681_0046284 Ga0495681_0046284_1067_1714 191
20 3300049459 Ga0495678_020318 Ga0495678_020318_130_777 191
21 3300049460 Ga0495682_0017363 Ga0495682_0017363_1017_1664 191
22 3300005288 Ga0065714_10010459 Ga0065714_100104593 192
23 3300006177 Ga0075362_10072461 Ga0075362_100724612 192
24 3300003781 Ga0055536_1005960 Ga0055536_10059603 194
25 3300003791 Ga0055530_10006166 Ga0055530_100061663 194
26 3300003792 Ga0055540_1005034 Ga0055540_10050343 194
27 3300003794 Ga0055531_10000081 Ga0055531_1000008186 194
28 3300009036 Ga0105244_10048477 Ga0105244_100484772 194
29 3300025292 Ga0209676_1000010 Ga0209676_100001086 194
30 3300025298 Ga0209050_1000081 Ga0209050_1000081164 194
31 3300025303 Ga0209051_1000185 Ga0209051_100018515 194
32 3300025304 Ga0209257_1000040 Ga0209257_1000040439 194
33 3300025728 Ga0207655_1018427 Ga0207655_10184273 194
34 3300047469 Ga0495673_0038643 Ga0495673_0038643_1059_1706 197
35 3300033180 Ga0307510_10070363 Ga0307510_100703633 199
36 3300048919 Ga0496116_0051754 Ga0496116_0051754_1051_1698 200
37 3300048920 Ga0496117_0065026 Ga0496117_0065026_823_1470 200
38 3300048921 Ga0496118_0065195 Ga0496118_0065195_995_1642 200
39 3300009092 Ga0105250_10021327 Ga0105250_100213273 201
40 3300012498 Ga0157345_1000513 Ga0157345_10005132 201
41 3300025711 Ga0207696_1013428 Ga0207696_10134283 201
42 3300046458 Ga0495591_015266 Ga0495591_015266_1053_1700 201
43 3300046520 Ga0495637_0161744 Ga0495637_0161744_151_798 201
44 3300046557 Ga0495622_0007863 Ga0495622_0007863_2083_2730 201
45 3300046690 Ga0495624_0144141 Ga0495624_0144141_567_1214 201
46 3300047320 Ga0495672_0032357 Ga0495672_0032357_1055_1702 201
47 3300053111 Ga0500572_006597 Ga0500572_006597_1056_1703 201
48 3300048925 Ga0496122_0061036 Ga0496122_0061036_1137_1784 203
49 3300046522 Ga0495643_0035813 Ga0495643_0035813_1097_1744 204
50 3300046648 Ga0495611_0000220 Ga0495611_0000220_1108_1755 204
51 3300046660 Ga0495625_0059599 Ga0495625_0059599_1681_2328 204
52 3300031727 Ga0316576_10004630 Ga0316576_100046307 208
53 3300036712 Ga0316584_0002484 Ga0316584_0002484_5639_6301 208
54 iso_pu_bacteria 2511231031 2511410861 211
55 iso_pu_bacteria 2738543025 2739314093 211
56 iso_pu_bacteria 2773857673 2774132804 211
57 iso_pu_bacteria 2904518522 2904521356 211
58 iso_pu_bacteria 2969304461 2969308653 211
59 iso_pu_bacteria 3007614139 3007616893 211
60 iso_pu_bacteria 2623620443 2624481894 213
61 iso_pu_bacteria 2784132063 2784263384 213
62 iso_pu_bacteria 2818991456 2819655638 213
63 iso_pu_bacteria 2852657418 2852662331 213
64 3300013100 Ga0157373_10066380 Ga0157373_100663802 214
65 3300046519 Ga0495632_0033236 Ga0495632_0033236_945_1589 214
66 3300046660 Ga0495625_0061658 Ga0495625_0061658_1049_1693 214
67 iso_pu_bacteria 2511231004 2511255032 214
68 iso_pu_bacteria 2511231006 2511268436 214
69 iso_pu_bacteria 2511231007 2511273081 214
70 iso_pu_bacteria 2511231008 2511276110 214
71 iso_pu_bacteria 2511231016 2511326176 214
72 iso_pu_bacteria 2511231018 2511339029 214
73 iso_pu_bacteria 2511231019 2511347167 214
74 iso_pu_bacteria 2511231020 2511349837 214
75 iso_pu_bacteria 2511231022 2511365738 214
76 iso_pu_bacteria 2582580891 2583793669 214
77 iso_pu_bacteria 2597489887 2597859328 214
78 iso_pu_bacteria 2599185185 2599482159 214
79 iso_pu_bacteria 2599185257 2599804123 214
80 iso_pu_bacteria 2600254931 2600364235 214
81 iso_pu_bacteria 2600255318 2601796245 214
82 iso_pu_bacteria 2603880185 2606073394 214
83 iso_pu_bacteria 2603880199 2606126960 214
84 iso_pu_bacteria 2619619299 2621300915 214
85 iso_pu_bacteria 2623620446 2624491020 214
86 iso_pu_bacteria 2643221565 2643845596 214
87 iso_pu_bacteria 2671180172 2671770309 214
88 iso_pu_bacteria 2713897149 2715758197 214
89 iso_pu_bacteria 2738541265 2738670460 214
90 iso_pu_bacteria 2738541282 2738748853 214
91 iso_pu_bacteria 2738541303 2738857895 214
92 iso_pu_bacteria 2740892503 2743738861 214
93 iso_pu_bacteria 2773857670 2774123420 214
94 iso_pu_bacteria 2784132072 2784316038 214
95 iso_pu_bacteria 2808606377 2808930589 214
96 iso_pu_bacteria 2808606381 2808952711 214
97 iso_pu_bacteria 2808606382 2808957293 214
98 iso_pu_bacteria 2808606445 2809218748 214
99 iso_pu_bacteria 2816332298 2817489784 214
100 iso_pu_bacteria 2878029506 2878033878 214
101 iso_pu_bacteria 2880230671 2880234504 214
102 iso_pu_bacteria 2904550169 2904555716 214
103 iso_pu_bacteria 2919697872 2919702034 214
104 iso_pu_bacteria 2923153595 2923157933 214
105 iso_pu_bacteria 2939636861 2939637649 214
106 iso_pu_bacteria 2974289157 2974289973 214
107 iso_pu_bacteria 2984286254 2984288247 214
108 iso_pu_bacteria 3007395558 3007397243 214
109 iso_pu_bacteria 3007419365 3007424271 214
110 iso_pu_bacteria 3007619802 3007625510 214
111 iso_pu_bacteria 3007718800 3007718885 214
112 iso_pu_bacteria 8015687852 8015692031 214
113 iso_pu_bacteria 8019775933 8019780962 214
114 iso_pu_bacteria 8055770955 8055775240 214
115 iso_pu_bacteria 8056155041 8056157338 214
116 iso_pu_bacteria 8056172158 8056173302 214
117 iso_pu_bacteria 8056569372 8056572701 214
118 3300009011 Ga0105251_10048996 Ga0105251_100489963 215
119 3300013100 Ga0157373_10051536 Ga0157373_100515363 215
120 3300013105 Ga0157369_10126060 Ga0157369_101260602 215
121 3300013306 Ga0163162_10000072 Ga0163162_100000723 215
122 3300025735 Ga0207713_1038700 Ga0207713_10387002 215
123 3300028379 Ga0268266_10029554 Ga0268266_100295542 215
124 3300041498 Ga0451841_0546259 Ga0451841_0546259_98_745 215
125 3300042144 Ga0450889_005903 Ga0450889_005903_302_949 215
126 3300046452 Ga0495617_009506 Ga0495617_009506_993_1640 215
127 3300046452 Ga0495617_016417 Ga0495617_016417_825_1472 215
128 3300046453 Ga0495627_007725 Ga0495627_007725_1030_1677 215
129 3300046457 Ga0495590_0154197 Ga0495590_0154197_18_665 215
130 3300046458 Ga0495591_008615 Ga0495591_008615_1075_1722 215
131 3300046463 Ga0495653_0347525 Ga0495653_0347525_123_770 215
132 3300046471 Ga0495650_0026177 Ga0495650_0026177_1052_1699 215
133 3300046474 Ga0495605_0020759 Ga0495605_0020759_1761_2408 215
134 3300046474 Ga0495605_0042352 Ga0495605_0042352_917_1564 215
135 3300046491 Ga0495584_0055360 Ga0495584_0055360_1062_1709 215
136 3300046492 Ga0495585_0043154 Ga0495585_0043154_844_1491 215
137 3300046492 Ga0495585_0046829 Ga0495585_0046829_1199_1846 215
138 3300046492 Ga0495585_0052949 Ga0495585_0052949_539_1186 215
139 3300046500 Ga0495596_0045511 Ga0495596_0045511_515_1162 215
140 3300046501 Ga0495607_0038912 Ga0495607_0038912_1145_1792 215
141 3300046507 Ga0495606_0072455 Ga0495606_0072455_1042_1689 215
142 3300046512 Ga0495610_0108552 Ga0495610_0108552_310_957 215
143 3300046513 Ga0495616_0016026 Ga0495616_0016026_2454_3101 215
144 3300046513 Ga0495616_0126440 Ga0495616_0126440_33_680 215
145 3300046513 Ga0495616_0227181 Ga0495616_0227181_112_759 215
146 3300046515 Ga0495620_0000307 Ga0495620_0000307_2548_3195 215
147 3300046515 Ga0495620_0027440 Ga0495620_0027440_1054_1701 215
148 3300046518 Ga0495631_0015974 Ga0495631_0015974_1890_2537 215
149 3300046518 Ga0495631_0077000 Ga0495631_0077000_685_1332 215
150 3300046519 Ga0495632_0062423 Ga0495632_0062423_430_1077 215
151 3300046520 Ga0495637_0025635 Ga0495637_0025635_980_1627 215
152 3300046520 Ga0495637_0026713 Ga0495637_0026713_1017_1664 215
153 3300046520 Ga0495637_0043624 Ga0495637_0043624_332_979 215
154 3300046524 Ga0495648_0043948 Ga0495648_0043948_458_1105 215
155 3300046524 Ga0495648_0072062 Ga0495648_0072062_410_1057 215
156 3300046524 Ga0495648_0077575 Ga0495648_0077575_1145_1792 215
157 3300046524 Ga0495648_0138283 Ga0495648_0138283_39_686 215
158 3300046530 Ga0495654_0013034 Ga0495654_0013034_2610_3257 215
159 3300046530 Ga0495654_0051679 Ga0495654_0051679_224_871 215
160 3300046530 Ga0495654_0114916 Ga0495654_0114916_18_665 215
161 3300046538 Ga0495609_0025577 Ga0495609_0025577_1062_1709 215
162 3300046538 Ga0495609_0106615 Ga0495609_0106615_65_712 215
163 3300046542 Ga0495597_0025439 Ga0495597_0025439_1058_1705 215
164 3300046542 Ga0495597_0055803 Ga0495597_0055803_1028_1675 215
165 3300046558 Ga0495633_0016039 Ga0495633_0016039_1018_1665 215
166 3300046616 Ga0495668_0311347 Ga0495668_0311347_153_800 215
167 3300046648 Ga0495611_0276595 Ga0495611_0276595_27_674 215
168 3300046660 Ga0495625_0007116 Ga0495625_0007116_2454_3101 215
169 3300046660 Ga0495625_0368208 Ga0495625_0368208_88_735 215
170 3300046665 Ga0495661_0090374 Ga0495661_0090374_1045_1692 215
171 3300046692 Ga0495671_0014615 Ga0495671_0014615_2610_3257 215
172 3300046692 Ga0495671_0031652 Ga0495671_0031652_1050_1697 215
173 3300046694 Ga0495649_0009999 Ga0495649_0009999_2434_3081 215
174 3300046694 Ga0495649_0039715 Ga0495649_0039715_1032_1679 215
175 3300046694 Ga0495649_0080718 Ga0495649_0080718_978_1625 215
176 3300046794 Ga0495589_0029993 Ga0495589_0029993_1041_1688 215
177 3300046810 Ga0495660_0027752 Ga0495660_0027752_21_668 215
178 3300046810 Ga0495660_0038124 Ga0495660_0038124_1051_1698 215
179 3300046810 Ga0495660_0048297 Ga0495660_0048297_547_1194 215
180 3300046810 Ga0495660_0076837 Ga0495660_0076837_382_1029 215
181 3300047321 Ga0495676_0071113 Ga0495676_0071113_973_1620 215
182 3300047323 Ga0495683_0041440 Ga0495683_0041440_535_1182 215
183 3300047446 Ga0495679_010365 Ga0495679_010365_1968_2615 215
184 3300047446 Ga0495679_020699 Ga0495679_020699_1087_1734 215
185 3300047446 Ga0495679_120704 Ga0495679_120704_49_696 215
186 3300047469 Ga0495673_0014266 Ga0495673_0014266_2457_3104 215
187 3300047469 Ga0495673_0056093 Ga0495673_0056093_726_1373 215
188 3300047470 Ga0495681_0031606 Ga0495681_0031606_1103_1750 215
189 3300047470 Ga0495681_0131613 Ga0495681_0131613_377_1024 215
190 3300047472 Ga0495686_0027927 Ga0495686_0027927_2005_2652 215
191 3300048091 Ga0495626_0019291 Ga0495626_0019291_1076_1723 215
192 3300048091 Ga0495626_0043555 Ga0495626_0043555_1034_1681 215
193 3300048919 Ga0496116_0000419 Ga0496116_0000419_57533_58180 215
194 3300049459 Ga0495678_022351 Ga0495678_022351_546_1193 215
195 3300049459 Ga0495678_030928 Ga0495678_030928_439_1086 215
196 3300049459 Ga0495678_068848 Ga0495678_068848_100_747 215
197 3300049459 Ga0495678_074461 Ga0495678_074461_459_1106 215
198 3300049460 Ga0495682_0031729 Ga0495682_0031729_360_1007 215
199 3300047446 Ga0495679_016987 Ga0495679_016987_843_1493 216
200 3300009092 Ga0105250_10014387 Ga0105250_100143872 217
201 3300009148 Ga0105243_10219411 Ga0105243_102194112 217
202 3300011119 Ga0105246_10017224 Ga0105246_100172242 217
203 3300013105 Ga0157369_10639166 Ga0157369_106391662 217
204 3300013307 Ga0157372_10149886 Ga0157372_101498863 217
205 3300015261 Ga0182006_1028705 Ga0182006_10287052 217
206 3300025711 Ga0207696_1001259 Ga0207696_100125915 217
207 3300025728 Ga0207655_1006756 Ga0207655_10067567 217
208 3300025728 Ga0207655_1027295 Ga0207655_10272953 217
209 3300025735 Ga0207713_1026485 Ga0207713_10264853 217
210 3300025933 Ga0207706_10116564 Ga0207706_101165643 217
211 3300041405 Ga0439438_055586 Ga0439438_055586_14_667 217
212 3300041407 Ga0439447_011378 Ga0439447_011378_893_1546 217
213 3300041411 Ga0439466_0015232 Ga0439466_0015232_71_724 217
214 3300041411 Ga0439466_0022771 Ga0439466_0022771_487_1140 217
215 3300042127 Ga0450890_003208 Ga0450890_003208_973_1626 217
216 3300042137 Ga0450902_004619 Ga0450902_004619_1382_2035 217
217 3300046452 Ga0495617_011426 Ga0495617_011426_1584_2237 217
218 3300046453 Ga0495627_013545 Ga0495627_013545_1886_2539 217
219 3300046458 Ga0495591_000114 Ga0495591_000114_90603_91256 217
220 3300046471 Ga0495650_0029647 Ga0495650_0029647_643_1296 217
221 3300046491 Ga0495584_0022048 Ga0495584_0022048_2104_2757 217
222 3300046512 Ga0495610_0020975 Ga0495610_0020975_2047_2700 217
223 3300046515 Ga0495620_0014040 Ga0495620_0014040_2500_3153 217
224 3300046519 Ga0495632_0090758 Ga0495632_0090758_198_851 217
225 3300046530 Ga0495654_0059100 Ga0495654_0059100_785_1438 217
226 3300046558 Ga0495633_0054553 Ga0495633_0054553_64_717 217
227 3300047469 Ga0495673_0016666 Ga0495673_0016666_1087_1740 217
228 3300047470 Ga0495681_0114406 Ga0495681_0114406_449_1102 217
229 3300048903 Ga0496100_0504091 Ga0496100_0504091_162_815 217
230 3300048904 Ga0496101_0378753 Ga0496101_0378753_60_713 217
231 3300048909 Ga0496106_0175168 Ga0496106_0175168_790_1443 217
232 3300048919 Ga0496116_0055201 Ga0496116_0055201_895_1548 217
233 3300048920 Ga0496117_0079958 Ga0496117_0079958_1029_1682 217
234 3300048921 Ga0496118_0052717 Ga0496118_0052717_1977_2630 217
235 3300048922 Ga0496119_0104734 Ga0496119_0104734_60_713 217
236 3300048923 Ga0496120_0068431 Ga0496120_0068431_913_1566 217
237 3300048923 Ga0496120_0172049 Ga0496120_0172049_323_976 217
238 3300048924 Ga0496121_0077278 Ga0496121_0077278_1047_1700 217
239 3300048925 Ga0496122_0132649 Ga0496122_0132649_533_1186 217
240 2124908027 MRS2a_Contig_45 MRS2a_00337700 218
241 3300002737 JGI25162J39368_1000166 JGI25162J39368_100016664 218
242 3300002771 JGI25163J39215_1002633 JGI25163J39215_10026332 218
243 3300002772 JGI25164J39214_1000129 JGI25164J39214_100012914 218
244 3300003214 JGI25165J46597_1000251 JGI25165J46597_100025114 218
245 3300003751 Ga0055538_1000090 Ga0055538_100009041 218
246 3300005288 Ga0065714_10070542 Ga0065714_100705424 218
247 3300005288 Ga0065714_10092066 Ga0065714_100920662 218
248 3300005288 Ga0065714_10170633 Ga0065714_101706332 218
249 3300005288 Ga0065714_10173305 Ga0065714_101733052 218
250 3300005288 Ga0065714_10201283 Ga0065714_102012831 218
251 3300005288 Ga0065714_10273403 Ga0065714_102734031 218
252 3300005290 Ga0065712_10001107 Ga0065712_100011071 218
253 3300005564 Ga0070664_100000046 Ga0070664_10000004672 218
254 3300006051 Ga0075364_10488836 Ga0075364_104888361 218
255 3300006051 Ga0075364_10499566 Ga0075364_104995661 218
256 3300006058 Ga0075432_10014500 Ga0075432_100145002 218
257 3300006058 Ga0075432_10019401 Ga0075432_100194012 218
258 3300006058 Ga0075432_10019741 Ga0075432_100197412 218
259 3300006058 Ga0075432_10127708 Ga0075432_101277081 218
260 3300006058 Ga0075432_10198631 Ga0075432_101986311 218
261 3300006177 Ga0075362_10160182 Ga0075362_101601822 218
262 3300006914 Ga0075436_100094800 Ga0075436_1000948002 218
263 3300006914 Ga0075436_100410213 Ga0075436_1004102131 218
264 3300006914 Ga0075436_100437767 Ga0075436_1004377671 218
265 3300006946 Ga0079104_1000124 Ga0079104_100012477 218
266 3300009011 Ga0105251_10003252 Ga0105251_1000325211 218
267 3300009011 Ga0105251_10031002 Ga0105251_100310022 218
268 3300009011 Ga0105251_10160240 Ga0105251_101602401 218
269 3300009036 Ga0105244_10031628 Ga0105244_100316283 218
270 3300009036 Ga0105244_10033637 Ga0105244_100336372 218
271 3300009036 Ga0105244_10075147 Ga0105244_100751472 218
272 3300009036 Ga0105244_10148122 Ga0105244_101481222 218
273 3300009092 Ga0105250_10046013 Ga0105250_100460132 218
274 3300009148 Ga0105243_10000103 Ga0105243_100001033 218
275 3300009148 Ga0105243_10050840 Ga0105243_100508402 218
276 3300009148 Ga0105243_10095801 Ga0105243_100958012 218
277 3300009176 Ga0105242_10000360 Ga0105242_1000036039 218
278 3300009545 Ga0105237_10001117 Ga0105237_1000111713 218
279 3300011119 Ga0105246_10000120 Ga0105246_1000012019 218
280 3300011119 Ga0105246_10048863 Ga0105246_100488632 218
281 3300013100 Ga0157373_10096452 Ga0157373_100964523 218
282 3300013104 Ga0157370_10094744 Ga0157370_100947442 218
283 3300013104 Ga0157370_10155034 Ga0157370_101550343 218
284 3300013104 Ga0157370_10483423 Ga0157370_104834232 218
285 3300013105 Ga0157369_10111961 Ga0157369_101119613 218
286 3300013306 Ga0163162_10100570 Ga0163162_101005702 218
287 3300013306 Ga0163162_10449337 Ga0163162_104493371 218
288 3300013306 Ga0163162_10873987 Ga0163162_108739871 218
289 3300014497 Ga0182008_10031343 Ga0182008_100313432 218
290 3300014497 Ga0182008_10031625 Ga0182008_100316253 218
291 3300015261 Ga0182006_1033493 Ga0182006_10334932 218
292 3300015261 Ga0182006_1073877 Ga0182006_10738771 218
293 3300015265 Ga0182005_1011906 Ga0182005_10119062 218
294 3300015265 Ga0182005_1029533 Ga0182005_10295332 218
295 3300015265 Ga0182005_1043052 Ga0182005_10430522 218
296 3300017792 Ga0163161_10035264 Ga0163161_100352643 218
297 3300017792 Ga0163161_10081123 Ga0163161_100811232 218
298 3300017792 Ga0163161_10426942 Ga0163161_104269421 218
299 3300017792 Ga0163161_10427163 Ga0163161_104271632 218
300 3300025207 Ga0209760_100043 Ga0209760_10004366 218
301 3300025231 Ga0207427_100047 Ga0207427_10004763 218
302 3300025233 Ga0209437_100009 Ga0209437_10000963 218
303 3300025261 Ga0209233_1000032 Ga0209233_100003263 218
304 3300025291 Ga0209675_1001166 Ga0209675_10011666 218
305 3300025292 Ga0209676_1000223 Ga0209676_100022339 218
306 3300025292 Ga0209676_1011039 Ga0209676_10110393 218
307 3300025298 Ga0209050_1000363 Ga0209050_100036375 218
308 3300025728 Ga0207655_1000337 Ga0207655_10003372 218
309 3300025728 Ga0207655_1000505 Ga0207655_10005053 218
310 3300025735 Ga0207713_1003166 Ga0207713_100316611 218
311 3300025735 Ga0207713_1046083 Ga0207713_10460832 218
312 3300025735 Ga0207713_1096955 Ga0207713_10969551 218
313 3300025914 Ga0207671_10000163 Ga0207671_100001636 218
314 3300025920 Ga0207649_10000068 Ga0207649_100000686 218
315 3300025934 Ga0207686_10005101 Ga0207686_100051017 218
316 3300025935 Ga0207709_10000035 Ga0207709_1000003584 218
317 3300025935 Ga0207709_10045584 Ga0207709_100455842 218
318 3300025945 Ga0207679_10000018 Ga0207679_1000001843 218
319 3300027111 Ga0209281_1000077 Ga0209281_100007777 218
320 3300027876 Ga0209974_10156359 Ga0209974_101563591 218
321 3300027907 Ga0207428_10007690 Ga0207428_100076902 218
322 3300027907 Ga0207428_10093554 Ga0207428_100935542 218
323 3300027907 Ga0207428_10244259 Ga0207428_102442591 218
324 3300027907 Ga0207428_10423656 Ga0207428_104236562 218
325 3300030521 Ga0307511_10047440 Ga0307511_100474403 218
326 3300030521 Ga0307511_10104221 Ga0307511_101042212 218
327 3300031344 Ga0265316_10308070 Ga0265316_103080702 218
328 3300031728 Ga0316578_10098962 Ga0316578_100989622 218
329 3300032139 Ga0316580_10003921 Ga0316580_100039213 218
330 3300035398 Ga0316574_0106152 Ga0316574_0106152_688_1350 218
331 3300036647 Ga0316582_0154463 Ga0316582_0154463_371_1033 218
332 3300041405 Ga0439438_008196 Ga0439438_008196_955_1611 218
333 3300041405 Ga0439438_014495 Ga0439438_014495_1156_1812 218
334 3300041405 Ga0439438_031086 Ga0439438_031086_174_854 218
335 3300041405 Ga0439438_040759 Ga0439438_040759_36_692 218
336 3300041407 Ga0439447_007353 Ga0439447_007353_960_1616 218
337 3300041407 Ga0439447_010466 Ga0439447_010466_1650_2306 218
338 3300041407 Ga0439447_014410 Ga0439447_014410_1284_1940 218
339 3300041407 Ga0439447_021259 Ga0439447_021259_168_824 218
340 3300041411 Ga0439466_0014706 Ga0439466_0014706_101_757 218
341 3300041411 Ga0439466_0017509 Ga0439466_0017509_1481_2137 218
342 3300041411 Ga0439466_0018265 Ga0439466_0018265_1752_2408 218
343 3300041411 Ga0439466_0019575 Ga0439466_0019575_470_1126 218
344 3300041411 Ga0439466_0021038 Ga0439466_0021038_1351_2007 218
345 3300041411 Ga0439466_0021960 Ga0439466_0021960_695_1351 218
346 3300041411 Ga0439466_0095950 Ga0439466_0095950_246_902 218
347 3300041413 Ga0439465_0039767 Ga0439465_0039767_407_1063 218
348 3300042006 Ga0439432_005719 Ga0439432_005719_2252_2908 218
349 3300042006 Ga0439432_016757 Ga0439432_016757_1083_1739 218
350 3300042006 Ga0439432_040892 Ga0439432_040892_528_1184 218
351 3300042006 Ga0439432_053306 Ga0439432_053306_74_730 218
352 3300042009 Ga0439451_002967 Ga0439451_002967_1778_2458 218
353 3300042009 Ga0439451_011913 Ga0439451_011913_1019_1675 218
354 3300042009 Ga0439451_012832 Ga0439451_012832_93_749 218
355 3300042009 Ga0439451_026311 Ga0439451_026311_197_853 218
356 3300042010 Ga0439452_002355 Ga0439452_002355_864_1520 218
357 3300042010 Ga0439452_007459 Ga0439452_007459_1866_2522 218
358 3300042010 Ga0439452_007500 Ga0439452_007500_1373_2029 218
359 3300042010 Ga0439452_007673 Ga0439452_007673_770_1426 218
360 3300042010 Ga0439452_011854 Ga0439452_011854_1227_1883 218
361 3300042010 Ga0439452_014300 Ga0439452_014300_1382_2038 218
362 3300042013 Ga0439456_001682 Ga0439456_001682_1431_2087 218
363 3300042013 Ga0439456_007491 Ga0439456_007491_334_990 218
364 3300042013 Ga0439456_008192 Ga0439456_008192_947_1603 218
365 3300042013 Ga0439456_014034 Ga0439456_014034_766_1446 218
366 3300042013 Ga0439456_026271 Ga0439456_026271_77_733 218
367 3300042013 Ga0439456_037255 Ga0439456_037255_354_1010 218
368 3300042016 Ga0439463_019362 Ga0439463_019362_186_842 218
369 3300042115 Ga0450911_003129 Ga0450911_003129_1471_2127 218
370 3300042115 Ga0450911_005208 Ga0450911_005208_983_1639 218
371 3300042115 Ga0450911_010400 Ga0450911_010400_591_1247 218
372 3300042121 Ga0450919_001877 Ga0450919_001877_1762_2418 218
373 3300042121 Ga0450919_001886 Ga0450919_001886_589_1245 218
374 3300042123 Ga0450921_009723 Ga0450921_009723_24_680 218
375 3300042124 Ga0450922_000839 Ga0450922_000839_618_1274 218
376 3300042125 Ga0450923_004559 Ga0450923_004559_254_910 218
377 3300042137 Ga0450902_005318 Ga0450902_005318_625_1281 218
378 3300042137 Ga0450902_006885 Ga0450902_006885_968_1624 218
379 3300042137 Ga0450902_011212 Ga0450902_011212_214_870 218
380 3300042137 Ga0450902_012858 Ga0450902_012858_294_950 218
381 3300042138 Ga0450903_003143 Ga0450903_003143_2047_2703 218
382 3300042138 Ga0450903_004746 Ga0450903_004746_1129_1785 218
383 3300042138 Ga0450903_007141 Ga0450903_007141_547_1203 218
384 3300042138 Ga0450903_010069 Ga0450903_010069_692_1348 218
385 3300042139 Ga0450904_002725 Ga0450904_002725_707_1363 218
386 3300042139 Ga0450904_013239 Ga0450904_013239_38_694 218
387 3300042145 Ga0450906_001629 Ga0450906_001629_2404_3060 218
388 3300042145 Ga0450906_006887 Ga0450906_006887_975_1631 218
389 3300042146 Ga0450907_000439 Ga0450907_000439_9572_10228 218
390 3300042146 Ga0450907_003283 Ga0450907_003283_564_1220 218
391 3300042146 Ga0450907_003381 Ga0450907_003381_989_1645 218
392 3300042147 Ga0450910_003571 Ga0450910_003571_1003_1659 218
393 3300042147 Ga0450910_003719 Ga0450910_003719_49_705 218
394 3300042156 Ga0439446_0010809 Ga0439446_0010809_747_1403 218
395 3300042156 Ga0439446_0016916 Ga0439446_0016916_1177_1833 218
396 3300042184 Ga0450908_007212 Ga0450908_007212_313_969 218
397 3300042184 Ga0450908_009461 Ga0450908_009461_180_836 218
398 3300042185 Ga0450909_001303 Ga0450909_001303_884_1540 218
399 3300042185 Ga0450909_003330 Ga0450909_003330_647_1303 218
400 3300042435 Ga0439434_0002467 Ga0439434_0002467_971_1627 218
401 3300042435 Ga0439434_0021955 Ga0439434_0021955_848_1504 218
402 3300042439 Ga0439464_0002620 Ga0439464_0002620_3469_4125 218
403 3300042461 Ga0439460_0001391 Ga0439460_0001391_987_1643 218
404 3300042461 Ga0439460_0014027 Ga0439460_0014027_943_1599 218
405 3300042461 Ga0439460_0030432 Ga0439460_0030432_186_842 218
406 3300042531 Ga0450918_004279 Ga0450918_004279_410_1066 218
407 3300042532 Ga0450893_0016160 Ga0450893_0016160_348_1004 218
408 3300042533 Ga0450901_000675 Ga0450901_000675_959_1621 218
409 3300042993 Ga0439440_0002009 Ga0439440_0002009_334_990 218
410 3300042993 Ga0439440_0004814 Ga0439440_0004814_1694_2350 218
411 3300046452 Ga0495617_008593 Ga0495617_008593_2056_2712 218
412 3300046452 Ga0495617_010357 Ga0495617_010357_309_965 218
413 3300046452 Ga0495617_016005 Ga0495617_016005_958_1614 218
414 3300046452 Ga0495617_042153 Ga0495617_042153_504_1160 218
415 3300046452 Ga0495617_066475 Ga0495617_066475_214_870 218
416 3300046452 Ga0495617_098759 Ga0495617_098759_47_703 218
417 3300046453 Ga0495627_010534 Ga0495627_010534_2242_2898 218
418 3300046453 Ga0495627_013063 Ga0495627_013063_2128_2784 218
419 3300046453 Ga0495627_020542 Ga0495627_020542_576_1232 218
420 3300046454 Ga0495592_0089177 Ga0495592_0089177_506_1162 218
421 3300046455 Ga0495603_0035954 Ga0495603_0035954_989_1645 218
422 3300046455 Ga0495603_0052937 Ga0495603_0052937_533_1213 218
423 3300046457 Ga0495590_0005246 Ga0495590_0005246_1986_2642 218
424 3300046457 Ga0495590_0014589 Ga0495590_0014589_1027_1683 218
425 3300046457 Ga0495590_0022190 Ga0495590_0022190_1066_1722 218
426 3300046457 Ga0495590_0029768 Ga0495590_0029768_1087_1743 218
427 3300046457 Ga0495590_0046241 Ga0495590_0046241_80_736 218
428 3300046457 Ga0495590_0180978 Ga0495590_0180978_30_686 218
429 3300046458 Ga0495591_007843 Ga0495591_007843_521_1177 218
430 3300046458 Ga0495591_033099 Ga0495591_033099_809_1465 218
431 3300046458 Ga0495591_088785 Ga0495591_088785_69_725 218
432 3300046458 Ga0495591_090806 Ga0495591_090806_65_721 218
433 3300046459 Ga0495629_0081244 Ga0495629_0081244_70_726 218
434 3300046460 Ga0495638_0027707 Ga0495638_0027707_2048_2704 218
435 3300046460 Ga0495638_0035709 Ga0495638_0035709_970_1626 218
436 3300046460 Ga0495638_0035871 Ga0495638_0035871_1979_2635 218
437 3300046460 Ga0495638_0052593 Ga0495638_0052593_989_1669 218
438 3300046460 Ga0495638_0064651 Ga0495638_0064651_1449_2105 218
439 3300046460 Ga0495638_0064853 Ga0495638_0064853_552_1208 218
440 3300046460 Ga0495638_0065212 Ga0495638_0065212_451_1107 218
441 3300046460 Ga0495638_0075931 Ga0495638_0075931_466_1122 218
442 3300046460 Ga0495638_0114457 Ga0495638_0114457_867_1523 218
443 3300046460 Ga0495638_0179684 Ga0495638_0179684_13_669 218
444 3300046463 Ga0495653_0015606 Ga0495653_0015606_96_752 218
445 3300046463 Ga0495653_0022948 Ga0495653_0022948_3323_3979 218
446 3300046463 Ga0495653_0118087 Ga0495653_0118087_1051_1707 218
447 3300046471 Ga0495650_0013460 Ga0495650_0013460_1162_1818 218
448 3300046471 Ga0495650_0014720 Ga0495650_0014720_971_1627 218
449 3300046471 Ga0495650_0016594 Ga0495650_0016594_772_1428 218
450 3300046471 Ga0495650_0024565 Ga0495650_0024565_1896_2552 218
451 3300046474 Ga0495605_0004649 Ga0495605_0004649_4377_5033 218
452 3300046474 Ga0495605_0021889 Ga0495605_0021889_557_1213 218
453 3300046474 Ga0495605_0022290 Ga0495605_0022290_1752_2408 218
454 3300046474 Ga0495605_0034576 Ga0495605_0034576_1482_2138 218
455 3300046474 Ga0495605_0039237 Ga0495605_0039237_1202_1858 218
456 3300046474 Ga0495605_0053383 Ga0495605_0053383_709_1365 218
457 3300046475 Ga0495639_0006221 Ga0495639_0006221_3777_4433 218
458 3300046491 Ga0495584_0012604 Ga0495584_0012604_1805_2461 218
459 3300046491 Ga0495584_0015953 Ga0495584_0015953_2635_3291 218
460 3300046491 Ga0495584_0018277 Ga0495584_0018277_2529_3185 218
461 3300046491 Ga0495584_0023313 Ga0495584_0023313_679_1335 218
462 3300046491 Ga0495584_0031469 Ga0495584_0031469_878_1534 218
463 3300046491 Ga0495584_0032170 Ga0495584_0032170_1095_1775 218
464 3300046491 Ga0495584_0033561 Ga0495584_0033561_1120_1776 218
465 3300046491 Ga0495584_0117184 Ga0495584_0117184_83_739 218
466 3300046491 Ga0495584_0318824 Ga0495584_0318824_66_722 218
467 3300046492 Ga0495585_0000245 Ga0495585_0000245_36738_37394 218
468 3300046492 Ga0495585_0004200 Ga0495585_0004200_7427_8083 218
469 3300046492 Ga0495585_0033165 Ga0495585_0033165_1956_2612 218
470 3300046492 Ga0495585_0058530 Ga0495585_0058530_501_1157 218
471 3300046492 Ga0495585_0082405 Ga0495585_0082405_992_1648 218
472 3300046492 Ga0495585_0087997 Ga0495585_0087997_987_1643 218
473 3300046492 Ga0495585_0247007 Ga0495585_0247007_212_868 218
474 3300046492 Ga0495585_0270545 Ga0495585_0270545_46_702 218
475 3300046499 Ga0495594_0016019 Ga0495594_0016019_479_1135 218
476 3300046499 Ga0495594_0025802 Ga0495594_0025802_542_1198 218
477 3300046500 Ga0495596_0002112 Ga0495596_0002112_8854_9510 218
478 3300046501 Ga0495607_0018686 Ga0495607_0018686_2679_3335 218
479 3300046501 Ga0495607_0028694 Ga0495607_0028694_727_1383 218
480 3300046501 Ga0495607_0030980 Ga0495607_0030980_382_1038 218
481 3300046501 Ga0495607_0031915 Ga0495607_0031915_594_1250 218
482 3300046501 Ga0495607_0043739 Ga0495607_0043739_768_1424 218
483 3300046501 Ga0495607_0075474 Ga0495607_0075474_44_700 218
484 3300046501 Ga0495607_0097320 Ga0495607_0097320_385_1041 218
485 3300046501 Ga0495607_0152067 Ga0495607_0152067_496_1152 218
486 3300046501 Ga0495607_0295241 Ga0495607_0295241_53_709 218
487 3300046506 Ga0495583_0009134 Ga0495583_0009134_163_819 218
488 3300046506 Ga0495583_0030487 Ga0495583_0030487_1462_2118 218
489 3300046507 Ga0495606_0035115 Ga0495606_0035115_1792_2448 218
490 3300046507 Ga0495606_0035730 Ga0495606_0035730_2264_2920 218
491 3300046507 Ga0495606_0042520 Ga0495606_0042520_1153_1809 218
492 3300046507 Ga0495606_0158121 Ga0495606_0158121_524_1180 218
493 3300046507 Ga0495606_0206301 Ga0495606_0206301_317_973 218
494 3300046512 Ga0495610_0018982 Ga0495610_0018982_913_1569 218
495 3300046512 Ga0495610_0025532 Ga0495610_0025532_241_897 218
496 3300046512 Ga0495610_0028511 Ga0495610_0028511_1639_2295 218
497 3300046512 Ga0495610_0065025 Ga0495610_0065025_87_743 218
498 3300046512 Ga0495610_0104649 Ga0495610_0104649_205_885 218
499 3300046512 Ga0495610_0123916 Ga0495610_0123916_184_864 218
500 3300046512 Ga0495610_0127014 Ga0495610_0127014_41_697 218
501 3300046512 Ga0495610_0157869 Ga0495610_0157869_258_938 218
502 3300046512 Ga0495610_0158590 Ga0495610_0158590_95_751 218
503 3300046512 Ga0495610_0202824 Ga0495610_0202824_39_695 218
504 3300046512 Ga0495610_0204068 Ga0495610_0204068_79_735 218
505 3300046513 Ga0495616_0017366 Ga0495616_0017366_1044_1700 218
506 3300046513 Ga0495616_0026526 Ga0495616_0026526_1579_2235 218
507 3300046513 Ga0495616_0028524 Ga0495616_0028524_990_1646 218
508 3300046513 Ga0495616_0046001 Ga0495616_0046001_1510_2166 218
509 3300046513 Ga0495616_0056060 Ga0495616_0056060_175_831 218
510 3300046513 Ga0495616_0145534 Ga0495616_0145534_337_993 218
511 3300046513 Ga0495616_0169368 Ga0495616_0169368_308_964 218
512 3300046515 Ga0495620_0012814 Ga0495620_0012814_1772_2428 218
513 3300046515 Ga0495620_0030439 Ga0495620_0030439_668_1324 218
514 3300046515 Ga0495620_0047522 Ga0495620_0047522_91_747 218
515 3300046515 Ga0495620_0056846 Ga0495620_0056846_907_1563 218
516 3300046517 Ga0495630_0094397 Ga0495630_0094397_808_1464 218
517 3300046518 Ga0495631_0011811 Ga0495631_0011811_2832_3488 218
518 3300046518 Ga0495631_0016373 Ga0495631_0016373_1903_2559 218
519 3300046518 Ga0495631_0059457 Ga0495631_0059457_987_1643 218
520 3300046518 Ga0495631_0135334 Ga0495631_0135334_353_1009 218
521 3300046519 Ga0495632_0001221 Ga0495632_0001221_16942_17598 218
522 3300046519 Ga0495632_0025007 Ga0495632_0025007_1951_2607 218
523 3300046519 Ga0495632_0025390 Ga0495632_0025390_693_1349 218
524 3300046519 Ga0495632_0028760 Ga0495632_0028760_934_1590 218
525 3300046519 Ga0495632_0046316 Ga0495632_0046316_754_1410 218
526 3300046519 Ga0495632_0114779 Ga0495632_0114779_96_752 218
527 3300046520 Ga0495637_0002342 Ga0495637_0002342_2478_3134 218
528 3300046520 Ga0495637_0002900 Ga0495637_0002900_1185_1841 218
529 3300046520 Ga0495637_0011496 Ga0495637_0011496_964_1620 218
530 3300046520 Ga0495637_0020567 Ga0495637_0020567_94_750 218
531 3300046520 Ga0495637_0025727 Ga0495637_0025727_646_1326 218
532 3300046520 Ga0495637_0027470 Ga0495637_0027470_730_1386 218
533 3300046520 Ga0495637_0045885 Ga0495637_0045885_933_1589 218
534 3300046520 Ga0495637_0053564 Ga0495637_0053564_145_801 218
535 3300046520 Ga0495637_0084751 Ga0495637_0084751_494_1150 218
536 3300046520 Ga0495637_0157806 Ga0495637_0157806_94_750 218
537 3300046522 Ga0495643_0034907 Ga0495643_0034907_2051_2707 218
538 3300046522 Ga0495643_0037478 Ga0495643_0037478_183_839 218
539 3300046522 Ga0495643_0063719 Ga0495643_0063719_709_1365 218
540 3300046522 Ga0495643_0071960 Ga0495643_0071960_985_1641 218
541 3300046523 Ga0495644_0002915 Ga0495644_0002915_5329_5985 218
542 3300046523 Ga0495644_0009811 Ga0495644_0009811_2048_2704 218
543 3300046523 Ga0495644_0037566 Ga0495644_0037566_98_754 218
544 3300046523 Ga0495644_0090585 Ga0495644_0090585_57_713 218
545 3300046524 Ga0495648_0000627 Ga0495648_0000627_35386_36045 218
546 3300046524 Ga0495648_0001736 Ga0495648_0001736_1171_1827 218
547 3300046524 Ga0495648_0005912 Ga0495648_0005912_7456_8112 218
548 3300046524 Ga0495648_0021607 Ga0495648_0021607_2883_3539 218
549 3300046524 Ga0495648_0034102 Ga0495648_0034102_854_1510 218
550 3300046524 Ga0495648_0050361 Ga0495648_0050361_1439_2095 218
551 3300046524 Ga0495648_0050493 Ga0495648_0050493_305_961 218
552 3300046524 Ga0495648_0054060 Ga0495648_0054060_1096_1752 218
553 3300046526 Ga0495666_0023209 Ga0495666_0023209_1635_2291 218
554 3300046526 Ga0495666_0042056 Ga0495666_0042056_1016_1672 218
555 3300046528 Ga0495642_0001507 Ga0495642_0001507_9555_10211 218
556 3300046528 Ga0495642_0005249 Ga0495642_0005249_1804_2460 218
557 3300046528 Ga0495642_0019182 Ga0495642_0019182_1582_2238 218
558 3300046530 Ga0495654_0023600 Ga0495654_0023600_1630_2286 218
559 3300046530 Ga0495654_0024566 Ga0495654_0024566_2293_2949 218
560 3300046530 Ga0495654_0032199 Ga0495654_0032199_1148_1804 218
561 3300046530 Ga0495654_0035636 Ga0495654_0035636_1154_1810 218
562 3300046530 Ga0495654_0036666 Ga0495654_0036666_822_1478 218
563 3300046530 Ga0495654_0038560 Ga0495654_0038560_498_1154 218
564 3300046530 Ga0495654_0039483 Ga0495654_0039483_1456_2112 218
565 3300046530 Ga0495654_0039989 Ga0495654_0039989_544_1200 218
566 3300046530 Ga0495654_0051116 Ga0495654_0051116_1058_1714 218
567 3300046530 Ga0495654_0081510 Ga0495654_0081510_390_1046 218
568 3300046530 Ga0495654_0107854 Ga0495654_0107854_117_773 218
569 3300046535 Ga0495586_0022675 Ga0495586_0022675_611_1267 218
570 3300046535 Ga0495586_0058927 Ga0495586_0058927_223_879 218
571 3300046536 Ga0495587_0013898 Ga0495587_0013898_263_919 218
572 3300046536 Ga0495587_0087381 Ga0495587_0087381_716_1372 218
573 3300046536 Ga0495587_0297243 Ga0495587_0297243_107_763 218
574 3300046538 Ga0495609_0005305 Ga0495609_0005305_5187_5843 218
575 3300046538 Ga0495609_0033503 Ga0495609_0033503_523_1179 218
576 3300046538 Ga0495609_0070339 Ga0495609_0070339_190_846 218
577 3300046542 Ga0495597_0014713 Ga0495597_0014713_1000_1656 218
578 3300046542 Ga0495597_0022135 Ga0495597_0022135_1920_2576 218
579 3300046542 Ga0495597_0046612 Ga0495597_0046612_371_1027 218
580 3300046542 Ga0495597_0047473 Ga0495597_0047473_105_761 218
581 3300046542 Ga0495597_0050822 Ga0495597_0050822_464_1120 218
582 3300046542 Ga0495597_0095174 Ga0495597_0095174_251_907 218
583 3300046542 Ga0495597_0226590 Ga0495597_0226590_10_666 218
584 3300046543 Ga0495645_0059506 Ga0495645_0059506_43_699 218
585 3300046543 Ga0495645_0236637 Ga0495645_0236637_148_804 218
586 3300046557 Ga0495622_0036929 Ga0495622_0036929_1131_1787 218
587 3300046557 Ga0495622_0072633 Ga0495622_0072633_341_1006 218
588 3300046557 Ga0495622_0082146 Ga0495622_0082146_534_1190 218
589 3300046558 Ga0495633_0019590 Ga0495633_0019590_991_1647 218
590 3300046558 Ga0495633_0021488 Ga0495633_0021488_528_1184 218
591 3300046558 Ga0495633_0050971 Ga0495633_0050971_884_1540 218
592 3300046558 Ga0495633_0245027 Ga0495633_0245027_25_681 218
593 3300046615 Ga0495656_0239239 Ga0495656_0239239_140_796 218
594 3300046616 Ga0495668_0007580 Ga0495668_0007580_5292_5948 218
595 3300046642 Ga0495634_0087422 Ga0495634_0087422_865_1521 218
596 3300046648 Ga0495611_0021644 Ga0495611_0021644_34_690 218
597 3300046648 Ga0495611_0244884 Ga0495611_0244884_163_819 218
598 3300046660 Ga0495625_0024545 Ga0495625_0024545_1882_2538 218
599 3300046660 Ga0495625_0052039 Ga0495625_0052039_1035_1691 218
600 3300046660 Ga0495625_0054176 Ga0495625_0054176_2175_2831 218
601 3300046660 Ga0495625_0060543 Ga0495625_0060543_404_1060 218
602 3300046660 Ga0495625_0061763 Ga0495625_0061763_1398_2054 218
603 3300046660 Ga0495625_0062270 Ga0495625_0062270_1327_1983 218
604 3300046660 Ga0495625_0067647 Ga0495625_0067647_1521_2177 218
605 3300046660 Ga0495625_0239332 Ga0495625_0239332_128_784 218
606 3300046664 Ga0495659_0028257 Ga0495659_0028257_136_792 218
607 3300046665 Ga0495661_0033825 Ga0495661_0033825_1384_2040 218
608 3300046665 Ga0495661_0036024 Ga0495661_0036024_1585_2241 218
609 3300046665 Ga0495661_0055651 Ga0495661_0055651_1032_1691 218
610 3300046665 Ga0495661_0071386 Ga0495661_0071386_898_1554 218
611 3300046665 Ga0495661_0265433 Ga0495661_0265433_174_830 218
612 3300046674 Ga0495588_0032089 Ga0495588_0032089_966_1622 218
613 3300046674 Ga0495588_0041705 Ga0495588_0041705_1121_1777 218
614 3300046675 Ga0495657_0195833 Ga0495657_0195833_454_1110 218
615 3300046679 Ga0495623_0031640 Ga0495623_0031640_893_1549 218
616 3300046680 Ga0495646_0027729 Ga0495646_0027729_827_1483 218
617 3300046680 Ga0495646_0056929 Ga0495646_0056929_779_1435 218
618 3300046684 Ga0495669_0056496 Ga0495669_0056496_891_1547 218
619 3300046684 Ga0495669_0064013 Ga0495669_0064013_18_674 218
620 3300046689 Ga0495613_0055068 Ga0495613_0055068_173_829 218
621 3300046689 Ga0495613_0069871 Ga0495613_0069871_1852_2508 218
622 3300046689 Ga0495613_0076054 Ga0495613_0076054_733_1389 218
623 3300046690 Ga0495624_0047892 Ga0495624_0047892_987_1643 218
624 3300046691 Ga0495670_0011207 Ga0495670_0011207_3265_3921 218
625 3300046691 Ga0495670_0024588 Ga0495670_0024588_2252_2908 218
626 3300046691 Ga0495670_0030213 Ga0495670_0030213_1372_2028 218
627 3300046691 Ga0495670_0099055 Ga0495670_0099055_811_1467 218
628 3300046691 Ga0495670_0327848 Ga0495670_0327848_75_731 218
629 3300046691 Ga0495670_0344617 Ga0495670_0344617_105_761 218
630 3300046692 Ga0495671_0003907 Ga0495671_0003907_1126_1782 218
631 3300046692 Ga0495671_0019659 Ga0495671_0019659_1938_2594 218
632 3300046692 Ga0495671_0020154 Ga0495671_0020154_1875_2531 218
633 3300046692 Ga0495671_0026675 Ga0495671_0026675_2051_2707 218
634 3300046692 Ga0495671_0041134 Ga0495671_0041134_1658_2314 218
635 3300046692 Ga0495671_0070305 Ga0495671_0070305_319_975 218
636 3300046692 Ga0495671_0191605 Ga0495671_0191605_230_886 218
637 3300046692 Ga0495671_0236434 Ga0495671_0236434_10_666 218
638 3300046694 Ga0495649_0014503 Ga0495649_0014503_3075_3731 218
639 3300046694 Ga0495649_0025632 Ga0495649_0025632_333_989 218
640 3300046694 Ga0495649_0029700 Ga0495649_0029700_1255_1911 218
641 3300046694 Ga0495649_0033868 Ga0495649_0033868_977_1633 218
642 3300046694 Ga0495649_0049413 Ga0495649_0049413_251_907 218
643 3300046694 Ga0495649_0072235 Ga0495649_0072235_251_907 218
644 3300046694 Ga0495649_0086905 Ga0495649_0086905_958_1614 218
645 3300046694 Ga0495649_0107238 Ga0495649_0107238_76_732 218
646 3300046694 Ga0495649_0154486 Ga0495649_0154486_462_1118 218
647 3300046694 Ga0495649_0179901 Ga0495649_0179901_12_668 218
648 3300046794 Ga0495589_0024078 Ga0495589_0024078_1851_2507 218
649 3300046794 Ga0495589_0024944 Ga0495589_0024944_866_1522 218
650 3300046794 Ga0495589_0026036 Ga0495589_0026036_909_1565 218
651 3300046794 Ga0495589_0033565 Ga0495589_0033565_1440_2096 218
652 3300046794 Ga0495589_0034234 Ga0495589_0034234_1275_1931 218
653 3300046794 Ga0495589_0054170 Ga0495589_0054170_238_894 218
654 3300046794 Ga0495589_0064801 Ga0495589_0064801_1081_1737 218
655 3300046794 Ga0495589_0118667 Ga0495589_0118667_55_711 218
656 3300046794 Ga0495589_0279566 Ga0495589_0279566_81_737 218
657 3300046809 Ga0495600_0073069 Ga0495600_0073069_1056_1712 218
658 3300046809 Ga0495600_0113825 Ga0495600_0113825_293_949 218
659 3300046810 Ga0495660_0012537 Ga0495660_0012537_3706_4362 218
660 3300046810 Ga0495660_0027317 Ga0495660_0027317_599_1255 218
661 3300046810 Ga0495660_0034878 Ga0495660_0034878_2059_2715 218
662 3300046810 Ga0495660_0049678 Ga0495660_0049678_1254_1910 218
663 3300046810 Ga0495660_0060062 Ga0495660_0060062_986_1642 218
664 3300046810 Ga0495660_0062628 Ga0495660_0062628_851_1507 218
665 3300046810 Ga0495660_0120823 Ga0495660_0120823_48_704 218
666 3300046810 Ga0495660_0132735 Ga0495660_0132735_60_716 218
667 3300047315 Ga0495581_0020380 Ga0495581_0020380_956_1612 218
668 3300047317 Ga0495604_0055965 Ga0495604_0055965_704_1360 218
669 3300047317 Ga0495604_0068113 Ga0495604_0068113_983_1639 218
670 3300047317 Ga0495604_0100508 Ga0495604_0100508_426_1082 218
671 3300047320 Ga0495672_0015502 Ga0495672_0015502_2482_3138 218
672 3300047320 Ga0495672_0017766 Ga0495672_0017766_2432_3088 218
673 3300047320 Ga0495672_0031670 Ga0495672_0031670_269_925 218
674 3300047320 Ga0495672_0043301 Ga0495672_0043301_977_1633 218
675 3300047320 Ga0495672_0045739 Ga0495672_0045739_342_998 218
676 3300047320 Ga0495672_0047754 Ga0495672_0047754_1660_2316 218
677 3300047320 Ga0495672_0051192 Ga0495672_0051192_1277_1933 218
678 3300047320 Ga0495672_0069480 Ga0495672_0069480_259_915 218
679 3300047320 Ga0495672_0083745 Ga0495672_0083745_786_1442 218
680 3300047321 Ga0495676_0097246 Ga0495676_0097246_468_1124 218
681 3300047322 Ga0495680_0048987 Ga0495680_0048987_1739_2395 218
682 3300047322 Ga0495680_0050622 Ga0495680_0050622_42_698 218
683 3300047322 Ga0495680_0103114 Ga0495680_0103114_562_1218 218
684 3300047323 Ga0495683_0020306 Ga0495683_0020306_1769_2425 218
685 3300047323 Ga0495683_0020310 Ga0495683_0020310_2030_2686 218
686 3300047323 Ga0495683_0021183 Ga0495683_0021183_810_1466 218
687 3300047323 Ga0495683_0022382 Ga0495683_0022382_1602_2258 218
688 3300047323 Ga0495683_0047159 Ga0495683_0047159_1044_1700 218
689 3300047323 Ga0495683_0049683 Ga0495683_0049683_753_1409 218
690 3300047323 Ga0495683_0254882 Ga0495683_0254882_30_686 218
691 3300047443 Ga0495687_022831 Ga0495687_022831_533_1189 218
692 3300047443 Ga0495687_035416 Ga0495687_035416_485_1141 218
693 3300047444 Ga0495675_0103336 Ga0495675_0103336_962_1618 218
694 3300047444 Ga0495675_0118346 Ga0495675_0118346_173_829 218
695 3300047444 Ga0495675_0296113 Ga0495675_0296113_253_909 218
696 3300047445 Ga0495677_0006910 Ga0495677_0006910_2509_3165 218
697 3300047445 Ga0495677_0091563 Ga0495677_0091563_419_1075 218
698 3300047446 Ga0495679_011858 Ga0495679_011858_1012_1668 218
699 3300047446 Ga0495679_023073 Ga0495679_023073_394_1050 218
700 3300047446 Ga0495679_024311 Ga0495679_024311_1125_1781 218
701 3300047446 Ga0495679_025976 Ga0495679_025976_900_1556 218
702 3300047447 Ga0495685_015561 Ga0495685_015561_366_1022 218
703 3300047469 Ga0495673_0017337 Ga0495673_0017337_718_1374 218
704 3300047469 Ga0495673_0017567 Ga0495673_0017567_963_1619 218
705 3300047469 Ga0495673_0020586 Ga0495673_0020586_778_1434 218
706 3300047469 Ga0495673_0027735 Ga0495673_0027735_1693_2349 218
707 3300047469 Ga0495673_0030599 Ga0495673_0030599_881_1537 218
708 3300047469 Ga0495673_0039354 Ga0495673_0039354_577_1233 218
709 3300047469 Ga0495673_0050123 Ga0495673_0050123_892_1548 218
710 3300047469 Ga0495673_0100178 Ga0495673_0100178_27_683 218
711 3300047469 Ga0495673_0136960 Ga0495673_0136960_33_689 218
712 3300047470 Ga0495681_0003347 Ga0495681_0003347_610_1266 218
713 3300047470 Ga0495681_0011339 Ga0495681_0011339_2069_2725 218
714 3300047470 Ga0495681_0014504 Ga0495681_0014504_1634_2290 218
715 3300047470 Ga0495681_0014986 Ga0495681_0014986_2683_3339 218
716 3300047470 Ga0495681_0025480 Ga0495681_0025480_1477_2157 218
717 3300047470 Ga0495681_0027058 Ga0495681_0027058_771_1451 218
718 3300047470 Ga0495681_0029715 Ga0495681_0029715_1128_1808 218
719 3300047470 Ga0495681_0043596 Ga0495681_0043596_246_902 218
720 3300047470 Ga0495681_0049208 Ga0495681_0049208_1103_1759 218
721 3300047470 Ga0495681_0057715 Ga0495681_0057715_1094_1750 218
722 3300047470 Ga0495681_0103173 Ga0495681_0103173_117_773 218
723 3300047470 Ga0495681_0154988 Ga0495681_0154988_215_871 218
724 3300047471 Ga0495684_0097991 Ga0495684_0097991_506_1162 218
725 3300047471 Ga0495684_0185087 Ga0495684_0185087_667_1323 218
726 3300047472 Ga0495686_0019800 Ga0495686_0019800_3144_3800 218
727 3300047472 Ga0495686_0093911 Ga0495686_0093911_1033_1689 218
728 3300047472 Ga0495686_0206970 Ga0495686_0206970_408_1064 218
729 3300047673 Ga0495593_0044272 Ga0495593_0044272_930_1586 218
730 3300047673 Ga0495593_0048673 Ga0495593_0048673_974_1630 218
731 3300048088 Ga0495602_0081869 Ga0495602_0081869_1075_1731 218
732 3300048089 Ga0495614_0235507 Ga0495614_0235507_28_684 218
733 3300048091 Ga0495626_0004078 Ga0495626_0004078_7433_8089 218
734 3300048091 Ga0495626_0016115 Ga0495626_0016115_1642_2298 218
735 3300048091 Ga0495626_0016716 Ga0495626_0016716_765_1421 218
736 3300048091 Ga0495626_0018016 Ga0495626_0018016_966_1622 218
737 3300048091 Ga0495626_0018283 Ga0495626_0018283_1731_2387 218
738 3300048091 Ga0495626_0094192 Ga0495626_0094192_555_1211 218
739 3300048905 Ga0496102_0885733 Ga0496102_0885733_79_735 218
740 3300048913 Ga0496110_0141470 Ga0496110_0141470_896_1552 218
741 3300048913 Ga0496110_0340821 Ga0496110_0340821_304_960 218
742 3300048914 Ga0496111_0142609 Ga0496111_0142609_105_761 218
743 3300048920 Ga0496117_0078212 Ga0496117_0078212_1041_1697 218
744 3300048920 Ga0496117_0107948 Ga0496117_0107948_116_772 218
745 3300048920 Ga0496117_0323392 Ga0496117_0323392_133_789 218
746 3300048921 Ga0496118_0122586 Ga0496118_0122586_961_1617 218
747 3300048921 Ga0496118_0193715 Ga0496118_0193715_488_1144 218
748 3300048921 Ga0496118_0275672 Ga0496118_0275672_165_854 218
749 3300048924 Ga0496121_0112019 Ga0496121_0112019_1011_1700 218
750 3300048924 Ga0496121_0114208 Ga0496121_0114208_57_713 218
751 3300048927 Ga0496124_0044265 Ga0496124_0044265_80_736 218
752 3300048927 Ga0496124_0086230 Ga0496124_0086230_1695_2351 218
753 3300048927 Ga0496124_0094215 Ga0496124_0094215_1048_1704 218
754 3300048927 Ga0496124_0184480 Ga0496124_0184480_603_1259 218
755 3300048928 Ga0496125_0025675 Ga0496125_0025675_671_1327 218
756 3300048928 Ga0496125_0081528 Ga0496125_0081528_488_1144 218
757 3300048928 Ga0496125_0092923 Ga0496125_0092923_1034_1690 218
758 3300048928 Ga0496125_0300930 Ga0496125_0300930_252_908 218
759 3300048929 Ga0496126_0051977 Ga0496126_0051977_2521_3177 218
760 3300049459 Ga0495678_015963 Ga0495678_015963_1334_1990 218
761 3300049459 Ga0495678_016475 Ga0495678_016475_581_1237 218
762 3300049459 Ga0495678_019012 Ga0495678_019012_342_998 218
763 3300049459 Ga0495678_022489 Ga0495678_022489_2023_2679 218
764 3300049459 Ga0495678_025005 Ga0495678_025005_1361_2017 218
765 3300049459 Ga0495678_039641 Ga0495678_039641_527_1183 218
766 3300049459 Ga0495678_054284 Ga0495678_054284_643_1299 218
767 3300049459 Ga0495678_141510 Ga0495678_141510_104_760 218
768 3300049460 Ga0495682_0014871 Ga0495682_0014871_1908_2564 218
769 3300049460 Ga0495682_0020171 Ga0495682_0020171_1092_1748 218
770 3300049460 Ga0495682_0021731 Ga0495682_0021731_650_1306 218
771 3300049460 Ga0495682_0022344 Ga0495682_0022344_1184_1840 218
772 3300050489 nmdc:mga03683_164708_c1 nmdc:mga03683_164708_c1_69_725 218
773 3300050489 nmdc:mga03683_215375_c1 nmdc:mga03683_215375_c1_76_732 218
774 3300050491 nmdc:mga00v17_142360_c1 nmdc:mga00v17_142360_c1_430_1086 218
775 3300050491 nmdc:mga00v17_428799_c1 nmdc:mga00v17_428799_c1_115_771 218
776 3300050514 nmdc:mga08x19_115935_c1 nmdc:mga08x19_115935_c1_839_1495 218
777 3300050514 nmdc:mga08x19_370031_c1 nmdc:mga08x19_370031_c1_158_814 218
778 3300050516 nmdc:mga0sz30_35910_c1 nmdc:mga0sz30_35910_c1_1271_1927 218
779 3300053091 Ga0500647_0155131 Ga0500647_0155131_21_677 218
780 3300053145 Ga0500586_062485 Ga0500586_062485_385_1041 218
781 3300053161 Ga0500634_0045727 Ga0500634_0045727_1112_1771 218
782 iso_pu_bacteria 2511231012 2511301088 218
783 iso_pu_bacteria 2511231014 2511312272 218
784 iso_pu_bacteria 2511231015 2511322442 218
785 iso_pu_bacteria 2511231017 2511331149 218
786 iso_pu_bacteria 2511231021 2511356458 218
787 iso_pu_bacteria 2643221589 2643956473 218
788 iso_pu_bacteria 2643221602 2644025485 218
789 iso_pu_bacteria 2738543004 2739201932 218
790 iso_pu_bacteria 2738543015 2739259264 218
791 iso_pu_bacteria 2919456309 2919461094 218
792 iso_pu_bacteria 8056125926 8056127600 218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05724

TPMT

Thiopurine S-methyltransferase (TPMT)

12

229

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gb4-assembly1.cif.gz_A crystal structure of thiopurine methyltransferase (18204406) from mus musculus at 1.35 a resolution 0.8892 1 218
2gb4-assembly1.cif.gz_A crystal structure of thiopurine methyltransferase (18204406) from mus musculus at 1.35 a resolution 0.8854 1 218
2h11-assembly2.cif.gz_B amino-terminal truncated thiopurine s-methyltransferase complexed with s-adenosyl-l-homocysteine 0.8846 1 218
2h11-assembly2.cif.gz_B amino-terminal truncated thiopurine s-methyltransferase complexed with s-adenosyl-l-homocysteine 0.8808 1 218
8ajp-assembly1.cif.gz_A crystal structure of halogen methyl transferase from paraburkholderia xenovorans at 1.8 a in complex with sah 0.7948 2 218
ID Description Score Start End Superfamily
2bzgA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8666 1 218 3.40.50.150
2bzgA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8628 1 218 3.40.50.150
af_A0A1D6FP61_65_209_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8503 37 80 3.40.50.150
af_P9WKL5_23_210_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8209 19 184 3.40.50.150
af_A0A0P0X625_117_343_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7819 39 147 3.40.50.150
ID Description Score Start End GO Terms
AF-Q66QM3-F1-model_v4 Thiopurine methyltransferase 0.9959 51 117 GO:0005737
GO:0008119
GO:0032259
AF-A0A0P8ZSH7-F1-model_v4 Thiopurine S-methyltransferase (EC 2.1.1.67) 0.9904 42 218 GO:0005737
GO:0008119
GO:0010038
GO:0032259
AF-A0A1F6TGG1-F1-model_v4 thiopurine S-methyltransferase (EC 2.1.1.67) 0.9875 44 218 GO:0005737
GO:0008119
GO:0032259
AF-Q66QR9-F1-model_v4 Thiopurine methyltransferase 0.9861 50 117 GO:0005737
GO:0008119
GO:0032259
AF-A0A656YRT3-F1-model_v4 deleted 0.984 33 184

Feature Viewer

pLDDT pTM Quality
90.91 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map