F481089
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 794 | 420 | 771 | 390 |
Family's Representative Sequence
| Representative Sequence | 3300005455|Ga0070663_100000518|Ga0070663_10000051810 |
| Length | 413 |
| Sequence | MTDVDINQFNNVRAGTGFLGGTMATAVAAKQNIKELVFEWEGKDKNGKIVRGEMRAGGEAMVSSSLRRQGILVTKVKKRRMSGGKSIKQKDIAIFTRQLSTMMRAGVPLIQAFDIVARGSTNPKVTRLLTDIRGDIETGTSLSAAFRKHPLYFDALYCNLVEAGEAGGILETLLDRLAIYQEKTMAIKNKIKSALIYPIAVLAFKDVFTSFGADLPAPTLLVIGMSEFFIKYWWAIFGFLIGGTYFFIQSWRRSEKMQKAMDRLLLKVPVFGDLVNKSAVARWTRTLSTMFAAGVPLVEALDSVGGASGNAVFSEATEQIQKDVSTGSALTTSMQTTGVFPVMVLQMCAIGEESGSLDAMLGKAAEFYEDEVDEAVKGLSSLMEPFIIVILGTLIGGIVVSMYLPIFKLGQVV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 3 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 4 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 5 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 6 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 7 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 8 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 9 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 10 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 11 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 12 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 13 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 14 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 15 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 16 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 17 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 18 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 19 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 20 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 21 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 22 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 23 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 24 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 25 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 26 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 27 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 28 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 29 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 30 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 31 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 32 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 33 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 34 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 35 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 36 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 37 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 38 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 39 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 41 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 42 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 43 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 45 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 46 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 47 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 48 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 49 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 50 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 51 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 52 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 53 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 54 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 59 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 61 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 79 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 83 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 87 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 89 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 90 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 91 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 92 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 93 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 94 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 95 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 96 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 97 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 98 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 99 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 100 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 101 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 102 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 103 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 104 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 105 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 106 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 107 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 108 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 109 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 110 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 111 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 112 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 113 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 114 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 115 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 117 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 118 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 119 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 130 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 143 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 144 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 145 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 152 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 155 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 214 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 215 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 223 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 224 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 225 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 228 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 230 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 231 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 232 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 233 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 234 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 235 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 236 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 237 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 238 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 239 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 240 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 241 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 243 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 244 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 245 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 246 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 247 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 248 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 249 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 250 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 251 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 252 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 253 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 254 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 255 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 256 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 257 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 258 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 261 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 262 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 263 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 264 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 265 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 266 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 267 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 268 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 271 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 272 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 273 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 274 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 275 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 276 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 277 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 278 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 279 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 280 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 281 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 282 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 283 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 284 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 285 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 286 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 287 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 288 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 289 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 290 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 291 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 292 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 293 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 294 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 295 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 296 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 297 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 298 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 299 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 300 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 301 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 302 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 303 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 304 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 305 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 338 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 339 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 340 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 341 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 342 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 345 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 346 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 347 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 348 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 349 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 350 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 352 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 366 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 367 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 368 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 369 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 370 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 371 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 372 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 376 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 377 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 378 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 382 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 383 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 384 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 385 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 386 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 387 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 388 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 389 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 395 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 396 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 397 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 398 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 399 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 400 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 401 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 402 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 403 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 404 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 405 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 406 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 407 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 408 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 409 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 410 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 411 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 412 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 413 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 414 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 415 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 416 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 418 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 419 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 420 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.85 |
| Metatranscriptomes | 0.25 |
| Isolates | 2.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 23.43 |
| Nodule | 0.88 |
| Rhizoplane | 2.39 |
| Rhizosphere | 63.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2612269 | 2162886007 | Bacteria | 2079 |
| 2 | JGI24740J21852_10009684 | 3300001979 | Bacteria | 3756 |
| 3 | JGI25155J39150_1000022 | 3300002704 | Bacteria | 142950 |
| 4 | JGI25156J39149_1000005 | 3300002705 | Bacteria | 263980 |
| 5 | JGI25156J39149_1001576 | 3300002705 | Bacteria | 9397 |
| 6 | JGI25156J39149_1011117 | 3300002705 | Bacteria | 2061 |
| 7 | JGI25154J39366_1000017 | 3300002738 | Bacteria | 252448 |
| 8 | JGI25154J39366_1001005 | 3300002738 | Bacteria | 11359 |
| 9 | JGI25157J39369_1000003 | 3300002741 | Bacteria | 274935 |
| 10 | JGI25157J39369_1000161 | 3300002741 | Bacteria | 56020 |
| 11 | JGI25152J39213_1000892 | 3300002773 | Bacteria | 14659 |
| 12 | JGI25150J39212_1006922 | 3300002774 | Bacteria | 2306 |
| 13 | Ga0006778J45830_1017384 | 3300003162 | Bacteria | 4665 |
| 14 | JGI25151J46595_10009446 | 3300003187 | Bacteria | 4616 |
| 15 | JGI25153J46596_10000420 | 3300003215 | Bacteria | 27768 |
| 16 | JGI25153J46596_10001641 | 3300003215 | Bacteria | 13278 |
| 17 | rootL2_10008162 | 3300003322 | Bacteria | 9210 |
| 18 | rootH1_10008605 | 3300003323 | Bacteria | 5110 |
| 19 | Ga0055539_1000819 | 3300003752 | Bacteria | 7323 |
| 20 | Ga0055539_1001622 | 3300003752 | Bacteria | 4046 |
| 21 | Ga0055533_1000016 | 3300003756 | Bacteria | 396179 |
| 22 | Ga0055525_1000004 | 3300003759 | Bacteria | 888039 |
| 23 | Ga0055525_1000579 | 3300003759 | Bacteria | 16084 |
| 24 | Ga0055535_1000165 | 3300003761 | Bacteria | 71549 |
| 25 | Ga0055529_1000214 | 3300003763 | Bacteria | 76244 |
| 26 | Ga0055529_1000405 | 3300003763 | Bacteria | 45555 |
| 27 | Ga0055526_1002203 | 3300003771 | Bacteria | 13346 |
| 28 | Ga0055526_1006651 | 3300003771 | Bacteria | 6206 |
| 29 | Ga0055524_1000070 | 3300003775 | Bacteria | 128656 |
| 30 | Ga0055524_1003058 | 3300003775 | Bacteria | 8280 |
| 31 | Ga0055524_1007833 | 3300003775 | Bacteria | 4498 |
| 32 | Ga0055536_1017428 | 3300003781 | Bacteria | 2352 |
| 33 | Ga0055530_10001971 | 3300003791 | Bacteria | 13967 |
| 34 | Ga0055540_1000013 | 3300003792 | Bacteria | 262274 |
| 35 | Ga0055531_10000500 | 3300003794 | Bacteria | 35897 |
| 36 | Ga0055531_10007051 | 3300003794 | Bacteria | 6220 |
| 37 | Ga0055531_10007794 | 3300003794 | Bacteria | 5767 |
| 38 | Ga0055531_10009798 | 3300003794 | Bacteria | 4856 |
| 39 | Ga0055543_1002676 | 3300004625 | Bacteria | 5717 |
| 40 | Ga0065165_1000290 | 3300005262 | Bacteria | 85623 |
| 41 | Ga0065165_1000684 | 3300005262 | Bacteria | 48557 |
| 42 | Ga0065165_1001958 | 3300005262 | Bacteria | 19506 |
| 43 | Ga0065704_10075751 | 3300005289 | Bacteria | 5439 |
| 44 | Ga0065712_10074677 | 3300005290 | Bacteria | 4035 |
| 45 | Ga0065715_10091140 | 3300005293 | Bacteria | 6072 |
| 46 | Ga0065707_10082503 | 3300005295 | Bacteria | 14412 |
| 47 | Ga0065707_10125111 | 3300005295 | Bacteria | 2009 |
| 48 | Ga0070658_10014951 | 3300005327 | Bacteria | 6215 |
| 49 | Ga0070658_10019373 | 3300005327 | Bacteria | 5450 |
| 50 | Ga0070658_10054588 | 3300005327 | Bacteria | 3244 |
| 51 | Ga0070676_10006078 | 3300005328 | Bacteria | 6445 |
| 52 | Ga0070676_10009675 | 3300005328 | Bacteria | 5212 |
| 53 | Ga0070690_100004971 | 3300005330 | Bacteria | 7441 |
| 54 | Ga0070690_100111163 | 3300005330 | Bacteria | 1828 |
| 55 | Ga0070670_100001440 | 3300005331 | Bacteria | 19100 |
| 56 | Ga0068869_100002210 | 3300005334 | Bacteria | 11707 |
| 57 | Ga0068869_100020143 | 3300005334 | Bacteria | 4569 |
| 58 | Ga0070666_10012271 | 3300005335 | Bacteria | 5399 |
| 59 | Ga0068868_100001584 | 3300005338 | Bacteria | 15507 |
| 60 | Ga0068868_100019660 | 3300005338 | Bacteria | 5064 |
| 61 | Ga0068868_100167694 | 3300005338 | Bacteria | 1817 |
| 62 | Ga0070660_100038637 | 3300005339 | Bacteria | 3624 |
| 63 | Ga0070660_100167864 | 3300005339 | Bacteria | 1771 |
| 64 | Ga0070661_100001368 | 3300005344 | Bacteria | 17026 |
| 65 | Ga0070668_100060188 | 3300005347 | Bacteria | 2940 |
| 66 | Ga0070669_100013295 | 3300005353 | Bacteria | 5850 |
| 67 | Ga0070675_100000596 | 3300005354 | Bacteria | 24774 |
| 68 | Ga0070675_100000897 | 3300005354 | Bacteria | 21177 |
| 69 | Ga0070675_100003464 | 3300005354 | Bacteria | 11959 |
| 70 | Ga0070675_100088502 | 3300005354 | Bacteria | 2591 |
| 71 | Ga0070675_100113830 | 3300005354 | Bacteria | 2292 |
| 72 | Ga0070671_100016897 | 3300005355 | Bacteria | 5902 |
| 73 | Ga0070671_100021310 | 3300005355 | Bacteria | 5294 |
| 74 | Ga0070671_100084720 | 3300005355 | Bacteria | 2651 |
| 75 | Ga0070671_100244503 | 3300005355 | Bacteria | 1523 |
| 76 | Ga0070674_100001095 | 3300005356 | Bacteria | 14216 |
| 77 | Ga0070674_100004331 | 3300005356 | Bacteria | 8090 |
| 78 | Ga0070674_100095397 | 3300005356 | Bacteria | 2156 |
| 79 | Ga0070674_100124483 | 3300005356 | Bacteria | 1913 |
| 80 | Ga0070673_100004498 | 3300005364 | Bacteria | 8821 |
| 81 | Ga0070673_100169486 | 3300005364 | Bacteria | 1863 |
| 82 | Ga0070673_100188200 | 3300005364 | Bacteria | 1771 |
| 83 | Ga0070673_100256766 | 3300005364 | Bacteria | 1525 |
| 84 | Ga0070659_100000400 | 3300005366 | Bacteria | 32855 |
| 85 | Ga0070659_100006742 | 3300005366 | Bacteria | 8303 |
| 86 | Ga0070667_100033941 | 3300005367 | Bacteria | 4268 |
| 87 | Ga0070667_100074671 | 3300005367 | Bacteria | 2893 |
| 88 | Ga0070709_10004984 | 3300005434 | Bacteria | 7173 |
| 89 | Ga0070713_100196145 | 3300005436 | Bacteria | 1821 |
| 90 | Ga0070711_100007985 | 3300005439 | Bacteria | 6459 |
| 91 | Ga0070663_100000518 | 3300005455 | Bacteria | 20374 |
| 92 | Ga0070663_100014328 | 3300005455 | Bacteria | 5087 |
| 93 | Ga0070678_100003986 | 3300005456 | Bacteria | 8301 |
| 94 | Ga0070662_100000321 | 3300005457 | Bacteria | 28578 |
| 95 | Ga0070662_100031644 | 3300005457 | Bacteria | 3714 |
| 96 | Ga0070662_100033616 | 3300005457 | Bacteria | 3612 |
| 97 | Ga0070662_100036944 | 3300005457 | Bacteria | 3460 |
| 98 | Ga0070662_100118071 | 3300005457 | Bacteria | 2030 |
| 99 | Ga0070681_10020347 | 3300005458 | Bacteria | 6652 |
| 100 | Ga0068867_100000020 | 3300005459 | Bacteria | 93210 |
| 101 | Ga0068867_100000345 | 3300005459 | Bacteria | 30786 |
| 102 | Ga0068867_100004939 | 3300005459 | Bacteria | 9397 |
| 103 | Ga0068867_100021134 | 3300005459 | Bacteria | 4642 |
| 104 | Ga0068867_100030261 | 3300005459 | Bacteria | 3905 |
| 105 | Ga0068867_100090647 | 3300005459 | Bacteria | 2320 |
| 106 | Ga0070706_100002083 | 3300005467 | Bacteria | 20391 |
| 107 | Ga0070699_100095918 | 3300005518 | Bacteria | 2597 |
| 108 | Ga0070679_100000726 | 3300005530 | Bacteria | 28453 |
| 109 | Ga0070679_100118893 | 3300005530 | Bacteria | 2627 |
| 110 | Ga0068853_100054521 | 3300005539 | Bacteria | 3445 |
| 111 | Ga0068853_100082267 | 3300005539 | Bacteria | 2820 |
| 112 | Ga0068853_100209625 | 3300005539 | Bacteria | 1776 |
| 113 | Ga0068853_100240990 | 3300005539 | Bacteria | 1657 |
| 114 | Ga0070672_100002357 | 3300005543 | Bacteria | 11950 |
| 115 | Ga0070672_100016993 | 3300005543 | Bacteria | 5224 |
| 116 | Ga0070672_100052383 | 3300005543 | Bacteria | 3186 |
| 117 | Ga0070672_100162201 | 3300005543 | Bacteria | 1855 |
| 118 | Ga0070696_100052607 | 3300005546 | Bacteria | 2833 |
| 119 | Ga0070665_100008338 | 3300005548 | Bacteria | 10481 |
| 120 | Ga0068855_100019854 | 3300005563 | Bacteria | 8072 |
| 121 | Ga0068855_100237808 | 3300005563 | Bacteria | 2036 |
| 122 | Ga0070664_100003718 | 3300005564 | Bacteria | 12293 |
| 123 | Ga0070664_100004137 | 3300005564 | Bacteria | 11655 |
| 124 | Ga0070664_100080251 | 3300005564 | Bacteria | 2810 |
| 125 | Ga0068857_100012908 | 3300005577 | Bacteria | 7279 |
| 126 | Ga0068854_100014737 | 3300005578 | Bacteria | 5160 |
| 127 | Ga0068854_100054800 | 3300005578 | Bacteria | 2869 |
| 128 | Ga0068856_100001351 | 3300005614 | Bacteria | 25782 |
| 129 | Ga0068856_100082500 | 3300005614 | Bacteria | 3191 |
| 130 | Ga0068852_100023487 | 3300005616 | Bacteria | 4964 |
| 131 | Ga0068852_100025824 | 3300005616 | Bacteria | 4765 |
| 132 | Ga0068852_100058097 | 3300005616 | Bacteria | 3349 |
| 133 | Ga0068852_100061831 | 3300005616 | Bacteria | 3255 |
| 134 | Ga0068852_100067076 | 3300005616 | Bacteria | 3136 |
| 135 | Ga0068852_100152543 | 3300005616 | Bacteria | 2150 |
| 136 | Ga0068859_100030751 | 3300005617 | Bacteria | 5388 |
| 137 | Ga0068859_100052468 | 3300005617 | Bacteria | 4100 |
| 138 | Ga0068859_100068165 | 3300005617 | Bacteria | 3593 |
| 139 | Ga0068859_100221010 | 3300005617 | Bacteria | 1982 |
| 140 | Ga0068859_100277212 | 3300005617 | Bacteria | 1769 |
| 141 | Ga0068864_100000334 | 3300005618 | Bacteria | 41519 |
| 142 | Ga0068864_100014003 | 3300005618 | Bacteria | 6649 |
| 143 | Ga0068864_100034295 | 3300005618 | Bacteria | 4317 |
| 144 | Ga0068864_100077961 | 3300005618 | Bacteria | 2899 |
| 145 | Ga0068864_100101421 | 3300005618 | Bacteria | 2553 |
| 146 | Ga0068866_10007309 | 3300005718 | Bacteria | 4622 |
| 147 | Ga0068861_100006327 | 3300005719 | Bacteria | 8059 |
| 148 | Ga0068861_100029493 | 3300005719 | Bacteria | 4014 |
| 149 | Ga0068851_10026998 | 3300005834 | Bacteria | 2826 |
| 150 | Ga0068851_10035671 | 3300005834 | Bacteria | 2487 |
| 151 | Ga0068870_10087375 | 3300005840 | Bacteria | 1736 |
| 152 | Ga0068870_10092667 | 3300005840 | Bacteria | 1692 |
| 153 | Ga0068863_100001360 | 3300005841 | Bacteria | 24329 |
| 154 | Ga0068863_100047246 | 3300005841 | Bacteria | 4084 |
| 155 | Ga0068863_100066221 | 3300005841 | Bacteria | 3417 |
| 156 | Ga0068858_100001418 | 3300005842 | Bacteria | 24635 |
| 157 | Ga0068858_100004761 | 3300005842 | Bacteria | 13288 |
| 158 | Ga0068860_100010504 | 3300005843 | Bacteria | 9153 |
| 159 | Ga0068860_100010883 | 3300005843 | Bacteria | 8971 |
| 160 | Ga0068860_100089309 | 3300005843 | Bacteria | 2934 |
| 161 | Ga0068862_100015539 | 3300005844 | Bacteria | 6323 |
| 162 | Ga0068862_100053277 | 3300005844 | Bacteria | 3463 |
| 163 | Ga0075365_10002764 | 3300006038 | Bacteria | 8766 |
| 164 | Ga0075368_10007078 | 3300006042 | Bacteria | 3950 |
| 165 | Ga0075363_100001729 | 3300006048 | Bacteria | 8486 |
| 166 | Ga0075364_10005356 | 3300006051 | Bacteria | 7452 |
| 167 | Ga0075364_10011648 | 3300006051 | Bacteria | 5347 |
| 168 | Ga0075364_10120282 | 3300006051 | Bacteria | 1758 |
| 169 | Ga0075362_10000284 | 3300006177 | Bacteria | 14282 |
| 170 | Ga0075362_10003380 | 3300006177 | Bacteria | 5565 |
| 171 | Ga0075362_10005103 | 3300006177 | Bacteria | 4778 |
| 172 | Ga0075367_10002511 | 3300006178 | Bacteria | 8410 |
| 173 | Ga0075367_10015326 | 3300006178 | Bacteria | 4163 |
| 174 | Ga0075367_10114122 | 3300006178 | Bacteria | 1660 |
| 175 | Ga0075369_10001928 | 3300006186 | Bacteria | 7282 |
| 176 | Ga0075366_10001067 | 3300006195 | Bacteria | 13458 |
| 177 | Ga0075366_10001345 | 3300006195 | Bacteria | 12278 |
| 178 | Ga0075366_10001564 | 3300006195 | Bacteria | 11440 |
| 179 | Ga0075366_10004269 | 3300006195 | Bacteria | 7667 |
| 180 | Ga0075366_10010045 | 3300006195 | Bacteria | 5305 |
| 181 | Ga0075366_10010991 | 3300006195 | Bacteria | 5097 |
| 182 | Ga0075366_10013284 | 3300006195 | Bacteria | 4684 |
| 183 | Ga0075366_10025491 | 3300006195 | Bacteria | 3454 |
| 184 | Ga0075366_10026442 | 3300006195 | Bacteria | 3399 |
| 185 | Ga0075366_10030762 | 3300006195 | Bacteria | 3157 |
| 186 | Ga0075366_10035927 | 3300006195 | Bacteria | 2921 |
| 187 | Ga0075366_10060378 | 3300006195 | Bacteria | 2252 |
| 188 | Ga0075366_10093630 | 3300006195 | Bacteria | 1800 |
| 189 | Ga0075366_10133459 | 3300006195 | Bacteria | 1499 |
| 190 | Ga0075370_10000523 | 3300006353 | Bacteria | 14643 |
| 191 | Ga0075370_10000616 | 3300006353 | Bacteria | 13743 |
| 192 | Ga0075370_10001109 | 3300006353 | Bacteria | 11261 |
| 193 | Ga0075370_10002323 | 3300006353 | Bacteria | 8784 |
| 194 | Ga0075370_10002528 | 3300006353 | Bacteria | 8493 |
| 195 | Ga0075370_10004121 | 3300006353 | Bacteria | 7005 |
| 196 | Ga0075370_10004682 | 3300006353 | Bacteria | 6675 |
| 197 | Ga0075370_10005371 | 3300006353 | Bacteria | 6359 |
| 198 | Ga0075370_10022925 | 3300006353 | Bacteria | 3434 |
| 199 | Ga0075370_10027497 | 3300006353 | Bacteria | 3156 |
| 200 | Ga0075370_10031724 | 3300006353 | Bacteria | 2951 |
| 201 | Ga0075370_10039435 | 3300006353 | Bacteria | 2661 |
| 202 | Ga0075370_10086415 | 3300006353 | Bacteria | 1806 |
| 203 | Ga0068871_100030612 | 3300006358 | Bacteria | 4239 |
| 204 | Ga0068871_100049893 | 3300006358 | Bacteria | 3384 |
| 205 | Ga0075430_100030680 | 3300006846 | Bacteria | 4566 |
| 206 | Ga0075430_100083338 | 3300006846 | Bacteria | 2679 |
| 207 | Ga0075434_100254555 | 3300006871 | Bacteria | 1775 |
| 208 | Ga0068865_100062199 | 3300006881 | Bacteria | 2620 |
| 209 | Ga0097620_100030751 | 3300006931 | Bacteria | 5388 |
| 210 | Ga0097620_100052468 | 3300006931 | Bacteria | 4100 |
| 211 | Ga0097620_100068166 | 3300006931 | Bacteria | 3593 |
| 212 | Ga0097620_100221016 | 3300006931 | Bacteria | 1982 |
| 213 | Ga0097620_100277213 | 3300006931 | Bacteria | 1769 |
| 214 | Ga0099823_1000122 | 3300006944 | Bacteria | 39631 |
| 215 | Ga0079104_1000001 | 3300006946 | Bacteria | 521847 |
| 216 | Ga0099826_10077697 | 3300006948 | Bacteria | 2082 |
| 217 | Ga0105240_10005235 | 3300009093 | Bacteria | 19386 |
| 218 | Ga0105245_10243820 | 3300009098 | Bacteria | 1743 |
| 219 | Ga0105243_10001054 | 3300009148 | Bacteria | 25232 |
| 220 | Ga0105243_10024023 | 3300009148 | Bacteria | 4646 |
| 221 | Ga0105243_10084620 | 3300009148 | Bacteria | 2598 |
| 222 | Ga0105243_10139220 | 3300009148 | Bacteria | 2068 |
| 223 | Ga0105242_10005718 | 3300009176 | Bacteria | 9590 |
| 224 | Ga0105248_10000507 | 3300009177 | Bacteria | 44310 |
| 225 | Ga0105248_10008801 | 3300009177 | Bacteria | 11085 |
| 226 | Ga0105248_10033741 | 3300009177 | Bacteria | 5720 |
| 227 | Ga0105237_10002475 | 3300009545 | Bacteria | 22923 |
| 228 | Ga0105237_10029811 | 3300009545 | Bacteria | 5542 |
| 229 | Ga0105237_10265039 | 3300009545 | Bacteria | 1721 |
| 230 | Ga0105238_10016263 | 3300009551 | Bacteria | 7530 |
| 231 | Ga0105249_10039696 | 3300009553 | Bacteria | 4274 |
| 232 | Ga0105249_10113183 | 3300009553 | Bacteria | 2567 |
| 233 | Ga0105239_10001374 | 3300010375 | Bacteria | 32644 |
| 234 | Ga0105246_10141331 | 3300011119 | Bacteria | 1810 |
| 235 | Ga0157319_1000005 | 3300012497 | Bacteria | 372810 |
| 236 | Ga0157371_10049902 | 3300013102 | Bacteria | 2972 |
| 237 | Ga0157374_10008297 | 3300013296 | Bacteria | 8862 |
| 238 | Ga0157374_10019867 | 3300013296 | Bacteria | 5953 |
| 239 | Ga0157374_10180994 | 3300013296 | Bacteria | 2059 |
| 240 | Ga0157374_10309122 | 3300013296 | Bacteria | 1565 |
| 241 | Ga0157378_10008827 | 3300013297 | Bacteria | 8773 |
| 242 | Ga0157378_10017312 | 3300013297 | Bacteria | 6321 |
| 243 | Ga0157378_10375486 | 3300013297 | Bacteria | 1395 |
| 244 | Ga0163162_10001398 | 3300013306 | Bacteria | 22461 |
| 245 | Ga0163162_10033463 | 3300013306 | Bacteria | 5109 |
| 246 | Ga0163162_10095213 | 3300013306 | Bacteria | 3064 |
| 247 | Ga0163162_10256447 | 3300013306 | Bacteria | 1881 |
| 248 | Ga0157372_10080852 | 3300013307 | Bacteria | 3678 |
| 249 | Ga0157372_10081152 | 3300013307 | Bacteria | 3671 |
| 250 | Ga0157375_10008199 | 3300013308 | Bacteria | 9149 |
| 251 | Ga0157375_10143599 | 3300013308 | Bacteria | 2516 |
| 252 | Ga0157375_10232100 | 3300013308 | Bacteria | 2004 |
| 253 | Ga0163163_10004207 | 3300014325 | Bacteria | 12266 |
| 254 | Ga0157380_10017607 | 3300014326 | Bacteria | 5289 |
| 255 | Ga0157377_10000032 | 3300014745 | Bacteria | 121003 |
| 256 | Ga0157379_10140653 | 3300014968 | Bacteria | 2176 |
| 257 | Ga0157376_10027064 | 3300014969 | Bacteria | 4540 |
| 258 | Ga0163161_10018630 | 3300017792 | Bacteria | 4866 |
| 259 | Ga0163161_10042745 | 3300017792 | Bacteria | 3261 |
| 260 | Ga0213872_10000067 | 3300021361 | Bacteria | 92410 |
| 261 | Ga0213872_10000104 | 3300021361 | Bacteria | 78306 |
| 262 | Ga0213872_10000131 | 3300021361 | Bacteria | 68632 |
| 263 | Ga0213872_10000202 | 3300021361 | Bacteria | 52878 |
| 264 | Ga0213876_10039904 | 3300021384 | Bacteria | 2480 |
| 265 | Ga0209435_100002 | 3300025206 | Bacteria | 794178 |
| 266 | Ga0209674_100041 | 3300025226 | Bacteria | 396231 |
| 267 | Ga0209672_104321 | 3300025228 | Bacteria | 2662 |
| 268 | Ga0209563_100013 | 3300025230 | Bacteria | 941463 |
| 269 | Ga0209563_100043 | 3300025230 | Bacteria | 397271 |
| 270 | Ga0207427_100381 | 3300025231 | Bacteria | 26800 |
| 271 | Ga0209258_100270 | 3300025242 | Bacteria | 89254 |
| 272 | Ga0209258_100659 | 3300025242 | Bacteria | 24988 |
| 273 | Ga0207425_1000221 | 3300025245 | Bacteria | 44837 |
| 274 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 275 | Ga0209646_1000157 | 3300025246 | Bacteria | 94054 |
| 276 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 277 | Ga0209026_1000006 | 3300025250 | Bacteria | 677225 |
| 278 | Ga0209677_100711 | 3300025253 | Bacteria | 16959 |
| 279 | Ga0209677_101037 | 3300025253 | Bacteria | 13235 |
| 280 | Ga0209677_102491 | 3300025253 | Bacteria | 6878 |
| 281 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 282 | Ga0209759_1000194 | 3300025256 | Bacteria | 97047 |
| 283 | Ga0209759_1000424 | 3300025256 | Bacteria | 51523 |
| 284 | Ga0209759_1000691 | 3300025256 | Bacteria | 30300 |
| 285 | Ga0209759_1002749 | 3300025256 | Bacteria | 7471 |
| 286 | Ga0209129_1000012 | 3300025258 | Bacteria | 541516 |
| 287 | Ga0209129_1007833 | 3300025258 | Bacteria | 3088 |
| 288 | Ga0209129_1009954 | 3300025258 | Bacteria | 2429 |
| 289 | Ga0209455_1000195 | 3300025272 | Bacteria | 89254 |
| 290 | Ga0209673_1002136 | 3300025273 | Bacteria | 14727 |
| 291 | Ga0209673_1002759 | 3300025273 | Bacteria | 11484 |
| 292 | Ga0209673_1009600 | 3300025273 | Bacteria | 4164 |
| 293 | Ga0209673_1020356 | 3300025273 | Bacteria | 2352 |
| 294 | Ga0209675_1005904 | 3300025291 | Bacteria | 5024 |
| 295 | Ga0209676_1004490 | 3300025292 | Bacteria | 7750 |
| 296 | Ga0209025_1014696 | 3300025294 | Bacteria | 4789 |
| 297 | Ga0209564_1000008 | 3300025295 | Bacteria | 953227 |
| 298 | Ga0209564_1000022 | 3300025295 | Bacteria | 555109 |
| 299 | Ga0209564_1009909 | 3300025295 | Bacteria | 4462 |
| 300 | Ga0209758_1000124 | 3300025297 | Bacteria | 189933 |
| 301 | Ga0209758_1000659 | 3300025297 | Bacteria | 51717 |
| 302 | Ga0209050_1001261 | 3300025298 | Bacteria | 29214 |
| 303 | Ga0209050_1001940 | 3300025298 | Bacteria | 19661 |
| 304 | Ga0209256_1000015 | 3300025299 | Bacteria | 622953 |
| 305 | Ga0209256_1002459 | 3300025299 | Bacteria | 15065 |
| 306 | Ga0209256_1003797 | 3300025299 | Bacteria | 10151 |
| 307 | Ga0209256_1017844 | 3300025299 | Bacteria | 2336 |
| 308 | Ga0209051_1000022 | 3300025303 | Bacteria | 474879 |
| 309 | Ga0209051_1002503 | 3300025303 | Bacteria | 13078 |
| 310 | Ga0209051_1011018 | 3300025303 | Bacteria | 4508 |
| 311 | Ga0209257_1000030 | 3300025304 | Bacteria | 689812 |
| 312 | Ga0209257_1000131 | 3300025304 | Bacteria | 211464 |
| 313 | Ga0209257_1002950 | 3300025304 | Bacteria | 15605 |
| 314 | Ga0209257_1008508 | 3300025304 | Bacteria | 5804 |
| 315 | Ga0209257_1019929 | 3300025304 | Bacteria | 2501 |
| 316 | Ga0207656_10008962 | 3300025321 | Bacteria | 3706 |
| 317 | Ga0207680_10003642 | 3300025903 | Bacteria | 7244 |
| 318 | Ga0207699_10026054 | 3300025906 | Bacteria | 3218 |
| 319 | Ga0207645_10002553 | 3300025907 | Bacteria | 14225 |
| 320 | Ga0207645_10009688 | 3300025907 | Bacteria | 6654 |
| 321 | Ga0207645_10033716 | 3300025907 | Bacteria | 3290 |
| 322 | Ga0207705_10011535 | 3300025909 | Bacteria | 6391 |
| 323 | Ga0207705_10036505 | 3300025909 | Bacteria | 3517 |
| 324 | Ga0207684_10004207 | 3300025910 | Bacteria | 13660 |
| 325 | Ga0207707_10055208 | 3300025912 | Bacteria | 3456 |
| 326 | Ga0207695_10012572 | 3300025913 | Bacteria | 10144 |
| 327 | Ga0207695_10149780 | 3300025913 | Bacteria | 2273 |
| 328 | Ga0207695_10233319 | 3300025913 | Bacteria | 1744 |
| 329 | Ga0207671_10009202 | 3300025914 | Bacteria | 8285 |
| 330 | Ga0207662_10019082 | 3300025918 | Bacteria | 3898 |
| 331 | Ga0207657_10063349 | 3300025919 | Bacteria | 3162 |
| 332 | Ga0207649_10003258 | 3300025920 | Bacteria | 8883 |
| 333 | Ga0207652_10002099 | 3300025921 | Bacteria | 17115 |
| 334 | Ga0207681_10016795 | 3300025923 | Bacteria | 4586 |
| 335 | Ga0207681_10086408 | 3300025923 | Bacteria | 2228 |
| 336 | Ga0207694_10030708 | 3300025924 | Bacteria | 4102 |
| 337 | Ga0207694_10168735 | 3300025924 | Bacteria | 1771 |
| 338 | Ga0207650_10003695 | 3300025925 | Bacteria | 10463 |
| 339 | Ga0207650_10236481 | 3300025925 | Bacteria | 1475 |
| 340 | Ga0207659_10000320 | 3300025926 | Bacteria | 29036 |
| 341 | Ga0207659_10000393 | 3300025926 | Bacteria | 26320 |
| 342 | Ga0207659_10003450 | 3300025926 | Bacteria | 9475 |
| 343 | Ga0207664_10104915 | 3300025929 | Bacteria | 2341 |
| 344 | Ga0207644_10000523 | 3300025931 | Bacteria | 24867 |
| 345 | Ga0207644_10001550 | 3300025931 | Bacteria | 14827 |
| 346 | Ga0207644_10012254 | 3300025931 | Bacteria | 5693 |
| 347 | Ga0207644_10057557 | 3300025931 | Bacteria | 2807 |
| 348 | Ga0207644_10121935 | 3300025931 | Bacteria | 1985 |
| 349 | Ga0207644_10178504 | 3300025931 | Bacteria | 1663 |
| 350 | Ga0207690_10001638 | 3300025932 | Bacteria | 13859 |
| 351 | Ga0207690_10004656 | 3300025932 | Bacteria | 8112 |
| 352 | Ga0207690_10035692 | 3300025932 | Bacteria | 3214 |
| 353 | Ga0207690_10074416 | 3300025932 | Bacteria | 2352 |
| 354 | Ga0207690_10128606 | 3300025932 | Bacteria | 1850 |
| 355 | Ga0207706_10003929 | 3300025933 | Bacteria | 14099 |
| 356 | Ga0207706_10007856 | 3300025933 | Bacteria | 9846 |
| 357 | Ga0207706_10012561 | 3300025933 | Bacteria | 7711 |
| 358 | Ga0207706_10064488 | 3300025933 | Bacteria | 3225 |
| 359 | Ga0207686_10004376 | 3300025934 | Bacteria | 7571 |
| 360 | Ga0207709_10000641 | 3300025935 | Bacteria | 28524 |
| 361 | Ga0207709_10068392 | 3300025935 | Bacteria | 2244 |
| 362 | Ga0207669_10078651 | 3300025937 | Bacteria | 2102 |
| 363 | Ga0207669_10139330 | 3300025937 | Bacteria | 1681 |
| 364 | Ga0207704_10001183 | 3300025938 | Bacteria | 11632 |
| 365 | Ga0207691_10001174 | 3300025940 | Bacteria | 26054 |
| 366 | Ga0207691_10003014 | 3300025940 | Bacteria | 16441 |
| 367 | Ga0207691_10068627 | 3300025940 | Bacteria | 3203 |
| 368 | Ga0207691_10093883 | 3300025940 | Bacteria | 2685 |
| 369 | Ga0207711_10013367 | 3300025941 | Bacteria | 6819 |
| 370 | Ga0207711_10040439 | 3300025941 | Bacteria | 3967 |
| 371 | Ga0207689_10000709 | 3300025942 | Bacteria | 31888 |
| 372 | Ga0207689_10017725 | 3300025942 | Bacteria | 6017 |
| 373 | Ga0207661_10018007 | 3300025944 | Bacteria | 5243 |
| 374 | Ga0207679_10000320 | 3300025945 | Bacteria | 35996 |
| 375 | Ga0207679_10014305 | 3300025945 | Bacteria | 5213 |
| 376 | Ga0207679_10016849 | 3300025945 | Bacteria | 4858 |
| 377 | Ga0207679_10151457 | 3300025945 | Bacteria | 1888 |
| 378 | Ga0207679_10158916 | 3300025945 | Bacteria | 1848 |
| 379 | Ga0207667_10041642 | 3300025949 | Bacteria | 4884 |
| 380 | Ga0207667_10059070 | 3300025949 | Bacteria | 4019 |
| 381 | Ga0207651_10000288 | 3300025960 | Bacteria | 21640 |
| 382 | Ga0207651_10004392 | 3300025960 | Bacteria | 7097 |
| 383 | Ga0207651_10067546 | 3300025960 | Bacteria | 2516 |
| 384 | Ga0207712_10041004 | 3300025961 | Bacteria | 3180 |
| 385 | Ga0207712_10043840 | 3300025961 | Bacteria | 3088 |
| 386 | Ga0207712_10098149 | 3300025961 | Bacteria | 2172 |
| 387 | Ga0207658_10002018 | 3300025986 | Bacteria | 15149 |
| 388 | Ga0207658_10006443 | 3300025986 | Bacteria | 8013 |
| 389 | Ga0207677_10005663 | 3300026023 | Bacteria | 6794 |
| 390 | Ga0207677_10081437 | 3300026023 | Bacteria | 2323 |
| 391 | Ga0207677_10090360 | 3300026023 | Bacteria | 2225 |
| 392 | Ga0207703_10001527 | 3300026035 | Bacteria | 21014 |
| 393 | Ga0207703_10056732 | 3300026035 | Bacteria | 3191 |
| 394 | Ga0207639_10028218 | 3300026041 | Bacteria | 4096 |
| 395 | Ga0207639_10074445 | 3300026041 | Bacteria | 2667 |
| 396 | Ga0207678_10000837 | 3300026067 | Bacteria | 28213 |
| 397 | Ga0207702_10014223 | 3300026078 | Bacteria | 6609 |
| 398 | Ga0207702_10071683 | 3300026078 | Bacteria | 2984 |
| 399 | Ga0207702_10095711 | 3300026078 | Bacteria | 2610 |
| 400 | Ga0207641_10001785 | 3300026088 | Bacteria | 20711 |
| 401 | Ga0207641_10013425 | 3300026088 | Bacteria | 6718 |
| 402 | Ga0207641_10093049 | 3300026088 | Bacteria | 2642 |
| 403 | Ga0207648_10000172 | 3300026089 | Bacteria | 66986 |
| 404 | Ga0207648_10001516 | 3300026089 | Bacteria | 25587 |
| 405 | Ga0207648_10001958 | 3300026089 | Bacteria | 22499 |
| 406 | Ga0207648_10006990 | 3300026089 | Bacteria | 11158 |
| 407 | Ga0207648_10009203 | 3300026089 | Bacteria | 9488 |
| 408 | Ga0207648_10020382 | 3300026089 | Bacteria | 5971 |
| 409 | Ga0207648_10078353 | 3300026089 | Bacteria | 2882 |
| 410 | Ga0207676_10000211 | 3300026095 | Bacteria | 50035 |
| 411 | Ga0207676_10057097 | 3300026095 | Bacteria | 3072 |
| 412 | Ga0207676_10083434 | 3300026095 | Bacteria | 2602 |
| 413 | Ga0207674_10008473 | 3300026116 | Bacteria | 11873 |
| 414 | Ga0207674_10017562 | 3300026116 | Bacteria | 7805 |
| 415 | Ga0207675_100000563 | 3300026118 | Bacteria | 36307 |
| 416 | Ga0207675_100021908 | 3300026118 | Bacteria | 5949 |
| 417 | Ga0207683_10002977 | 3300026121 | Bacteria | 14783 |
| 418 | Ga0207683_10081152 | 3300026121 | Bacteria | 2878 |
| 419 | Ga0207698_10007606 | 3300026142 | Bacteria | 6794 |
| 420 | Ga0207698_10023324 | 3300026142 | Bacteria | 4321 |
| 421 | Ga0207698_10135176 | 3300026142 | Bacteria | 2114 |
| 422 | Ga0207698_10173629 | 3300026142 | Bacteria | 1901 |
| 423 | Ga0207698_10203183 | 3300026142 | Bacteria | 1776 |
| 424 | Ga0209281_1000057 | 3300027111 | Bacteria | 307145 |
| 425 | Ga0209389_1000372 | 3300027296 | Bacteria | 26966 |
| 426 | Ga0209970_1000052 | 3300027614 | Bacteria | 15551 |
| 427 | Ga0209813_10002855 | 3300027866 | Bacteria | 3999 |
| 428 | Ga0209813_10015368 | 3300027866 | Bacteria | 2073 |
| 429 | Ga0209974_10000240 | 3300027876 | Bacteria | 17737 |
| 430 | Ga0209974_10002936 | 3300027876 | Bacteria | 6185 |
| 431 | Ga0209974_10022749 | 3300027876 | Bacteria | 2075 |
| 432 | Ga0268266_10012086 | 3300028379 | Bacteria | 7471 |
| 433 | Ga0268265_10010386 | 3300028380 | Bacteria | 6290 |
| 434 | Ga0268265_10021176 | 3300028380 | Bacteria | 4550 |
| 435 | Ga0268265_10073523 | 3300028380 | Bacteria | 2670 |
| 436 | Ga0268264_10029170 | 3300028381 | Bacteria | 4518 |
| 437 | Ga0268264_10039871 | 3300028381 | Bacteria | 3880 |
| 438 | Ga0265336_10000189 | 3300028666 | Bacteria | 42983 |
| 439 | Ga0307517_10001109 | 3300028786 | Bacteria | 45519 |
| 440 | Ga0307517_10080174 | 3300028786 | Bacteria | 2798 |
| 441 | Ga0307515_10000062 | 3300028794 | Bacteria | 247284 |
| 442 | Ga0307515_10000354 | 3300028794 | Bacteria | 112621 |
| 443 | Ga0307515_10002885 | 3300028794 | Bacteria | 36551 |
| 444 | Ga0307515_10007796 | 3300028794 | Bacteria | 21069 |
| 445 | Ga0307515_10011216 | 3300028794 | Bacteria | 17021 |
| 446 | Ga0307515_10014391 | 3300028794 | Bacteria | 14674 |
| 447 | Ga0307515_10022668 | 3300028794 | Bacteria | 11052 |
| 448 | Ga0307515_10028135 | 3300028794 | Bacteria | 9566 |
| 449 | Ga0307515_10051550 | 3300028794 | Bacteria | 6132 |
| 450 | Ga0307515_10132811 | 3300028794 | Bacteria | 2728 |
| 451 | Ga0265324_10000255 | 3300029957 | Bacteria | 39393 |
| 452 | Ga0265330_10000091 | 3300031235 | Bacteria | 76638 |
| 453 | Ga0265332_10000028 | 3300031238 | Bacteria | 184029 |
| 454 | Ga0265325_10002488 | 3300031241 | Bacteria | 12420 |
| 455 | Ga0265331_10010440 | 3300031250 | Bacteria | 5139 |
| 456 | Ga0265327_10000035 | 3300031251 | Bacteria | 314419 |
| 457 | Ga0265327_10004357 | 3300031251 | Bacteria | 12581 |
| 458 | Ga0265316_10000217 | 3300031344 | Bacteria | 66919 |
| 459 | Ga0307513_10002583 | 3300031456 | Bacteria | 25034 |
| 460 | Ga0307513_10002745 | 3300031456 | Bacteria | 24211 |
| 461 | Ga0307513_10108518 | 3300031456 | Bacteria | 2776 |
| 462 | Ga0307513_10233390 | 3300031456 | Bacteria | 1651 |
| 463 | Ga0307509_10013544 | 3300031507 | Bacteria | 9644 |
| 464 | Ga0307509_10015315 | 3300031507 | Bacteria | 8954 |
| 465 | Ga0307509_10068367 | 3300031507 | Bacteria | 3718 |
| 466 | Ga0307509_10116595 | 3300031507 | Bacteria | 2660 |
| 467 | Ga0307408_100000023 | 3300031548 | Bacteria | 295931 |
| 468 | Ga0307408_100000557 | 3300031548 | Bacteria | 32161 |
| 469 | Ga0307408_100008274 | 3300031548 | Bacteria | 6865 |
| 470 | Ga0307408_100041905 | 3300031548 | Bacteria | 3248 |
| 471 | Ga0307408_100083420 | 3300031548 | Bacteria | 2395 |
| 472 | Ga0307508_10000043 | 3300031616 | Bacteria | 143889 |
| 473 | Ga0307508_10001327 | 3300031616 | Bacteria | 27990 |
| 474 | Ga0307514_10000522 | 3300031649 | Bacteria | 75925 |
| 475 | Ga0307514_10118284 | 3300031649 | Bacteria | 1856 |
| 476 | Ga0316575_10000446 | 3300031665 | Bacteria | 11788 |
| 477 | Ga0316579_10000450 | 3300031691 | Bacteria | 13195 |
| 478 | Ga0265314_10000054 | 3300031711 | Bacteria | 184029 |
| 479 | Ga0316578_10002134 | 3300031728 | Bacteria | 8507 |
| 480 | Ga0307516_10000237 | 3300031730 | Bacteria | 70929 |
| 481 | Ga0307516_10001691 | 3300031730 | Bacteria | 30381 |
| 482 | Ga0307516_10016330 | 3300031730 | Bacteria | 7769 |
| 483 | Ga0307516_10018452 | 3300031730 | Bacteria | 7250 |
| 484 | Ga0307516_10029700 | 3300031730 | Bacteria | 5524 |
| 485 | Ga0307516_10078944 | 3300031730 | Bacteria | 3136 |
| 486 | Ga0307405_10019313 | 3300031731 | Bacteria | 3782 |
| 487 | Ga0307405_10083139 | 3300031731 | Bacteria | 2098 |
| 488 | Ga0307410_10006646 | 3300031852 | Bacteria | 6260 |
| 489 | Ga0307410_10045313 | 3300031852 | Bacteria | 2928 |
| 490 | Ga0307406_10004659 | 3300031901 | Bacteria | 7474 |
| 491 | Ga0307406_10008142 | 3300031901 | Bacteria | 5841 |
| 492 | Ga0307412_10137171 | 3300031911 | Bacteria | 1786 |
| 493 | Ga0307412_10205631 | 3300031911 | Bacteria | 1498 |
| 494 | Ga0307409_100004843 | 3300031995 | Bacteria | 7642 |
| 495 | Ga0307409_100077536 | 3300031995 | Bacteria | 2670 |
| 496 | Ga0307416_100013538 | 3300032002 | Bacteria | 5550 |
| 497 | Ga0307416_100111213 | 3300032002 | Bacteria | 2414 |
| 498 | Ga0307414_10125348 | 3300032004 | Bacteria | 1983 |
| 499 | Ga0307411_10057114 | 3300032005 | Bacteria | 2576 |
| 500 | Ga0307411_10212264 | 3300032005 | Bacteria | 1495 |
| 501 | Ga0316583_10013533 | 3300032133 | Bacteria | 2944 |
| 502 | Ga0307507_10091114 | 3300033179 | Bacteria | 2612 |
| 503 | Ga0307510_10024047 | 3300033180 | Bacteria | 7046 |
| 504 | Ga0307510_10025385 | 3300033180 | Bacteria | 6834 |
| 505 | Ga0373934_0047653 | 3300035086 | Bacteria | 1695 |
| 506 | Ga0373939_0000049 | 3300035114 | Bacteria | 42693 |
| 507 | Ga0373954_0000065 | 3300035118 | Bacteria | 37154 |
| 508 | Ga0373931_0000092 | 3300035691 | Bacteria | 41580 |
| 509 | Ga0373931_0000552 | 3300035691 | Bacteria | 15381 |
| 510 | Ga0373931_0018707 | 3300035691 | Bacteria | 3447 |
| 511 | Ga0373931_0041306 | 3300035691 | Bacteria | 2422 |
| 512 | Ga0373927_0243128 | 3300035695 | Bacteria | 1183 |
| 513 | Ga0373947_0017704 | 3300035725 | Bacteria | 4099 |
| 514 | Ga0373937_0000149 | 3300036401 | Bacteria | 67267 |
| 515 | Ga0373925_0004978 | 3300037068 | Bacteria | 9975 |
| 516 | Ga0373925_0222076 | 3300037068 | Bacteria | 1508 |
| 517 | Ga0395899_0037827 | 3300037312 | Bacteria | 3617 |
| 518 | Ga0395900_0000253 | 3300037418 | Bacteria | 83308 |
| 519 | Ga0395898_0000880 | 3300037466 | Bacteria | 48977 |
| 520 | Ga0395898_0012451 | 3300037466 | Bacteria | 8795 |
| 521 | Ga0395905_0000151 | 3300037471 | Bacteria | 115485 |
| 522 | Ga0395905_0000483 | 3300037471 | Bacteria | 54915 |
| 523 | Ga0395905_0013148 | 3300037471 | Bacteria | 7944 |
| 524 | Ga0395905_0029065 | 3300037471 | Bacteria | 5209 |
| 525 | Ga0395905_0052487 | 3300037471 | Bacteria | 3816 |
| 526 | Ga0395905_0075957 | 3300037471 | Bacteria | 3148 |
| 527 | Ga0395905_0171267 | 3300037471 | Bacteria | 2039 |
| 528 | Ga0395901_0001368 | 3300038443 | Bacteria | 25522 |
| 529 | Ga0400487_51885 | 3300039110 | Bacteria | 77480 |
| 530 | Ga0436365_1030021 | 3300039437 | Bacteria | 3858 |
| 531 | Ga0436361_0369035 | 3300039447 | Bacteria | 3003 |
| 532 | Ga0436361_0378401 | 3300039447 | Bacteria | 33354 |
| 533 | Ga0436361_0379569 | 3300039447 | Bacteria | 51728 |
| 534 | Ga0436361_0644805 | 3300039447 | Bacteria | 9013 |
| 535 | Ga0436361_0745691 | 3300039447 | Bacteria | 89622 |
| 536 | Ga0436361_0750298 | 3300039447 | Bacteria | 51036 |
| 537 | Ga0436361_0843250 | 3300039447 | Bacteria | 7126 |
| 538 | Ga0451789_0776084 | 3300041443 | Bacteria | 3031 |
| 539 | Ga0451798_0151095 | 3300041458 | Bacteria | 3019 |
| 540 | Ga0451802_1906811 | 3300041460 | Bacteria | 2272 |
| 541 | Ga0451853_2309212 | 3300041512 | Bacteria | 1931 |
| 542 | Ga0439431_0001298 | 3300041997 | Bacteria | 5493 |
| 543 | Ga0439450_002180 | 3300042008 | Bacteria | 3033 |
| 544 | Ga0439455_0010812 | 3300042012 | Bacteria | 2015 |
| 545 | Ga0450917_000566 | 3300042120 | Bacteria | 2762 |
| 546 | Ga0450919_000054 | 3300042121 | Bacteria | 10255 |
| 547 | Ga0450888_000038 | 3300042126 | Bacteria | 9334 |
| 548 | Ga0450890_004930 | 3300042127 | Bacteria | 1727 |
| 549 | Ga0450897_001473 | 3300042128 | Bacteria | 1611 |
| 550 | Ga0450891_000454 | 3300042129 | Bacteria | 4281 |
| 551 | Ga0450892_000749 | 3300042130 | Bacteria | 3597 |
| 552 | Ga0450899_003418 | 3300042135 | Bacteria | 1708 |
| 553 | Ga0450889_000272 | 3300042144 | Bacteria | 5774 |
| 554 | Ga0439434_0002500 | 3300042435 | Bacteria | 5351 |
| 555 | Ga0439459_0009766 | 3300042438 | Bacteria | 1662 |
| 556 | Ga0439464_0000115 | 3300042439 | Bacteria | 12413 |
| 557 | Ga0450918_001116 | 3300042531 | Bacteria | 5509 |
| 558 | Ga0451577_0002525 | 3300042876 | Bacteria | 21654 |
| 559 | Ga0451577_0003205 | 3300042876 | Bacteria | 18390 |
| 560 | Ga0466969_0000008 | 3300044656 | Bacteria | 139607 |
| 561 | Ga0466969_0022986 | 3300044656 | Bacteria | 3214 |
| 562 | Ga0466969_0059150 | 3300044656 | Bacteria | 1863 |
| 563 | Ga0466972_0001296 | 3300044658 | Bacteria | 12078 |
| 564 | Ga0466972_0055870 | 3300044658 | Bacteria | 1898 |
| 565 | Ga0453683_0060822 | 3300044673 | Bacteria | 2362 |
| 566 | Ga0466966_0005386 | 3300044684 | Bacteria | 8409 |
| 567 | Ga0466966_0006083 | 3300044684 | Bacteria | 7973 |
| 568 | Ga0466961_0002340 | 3300044693 | Bacteria | 11780 |
| 569 | Ga0466961_0087499 | 3300044693 | Bacteria | 1968 |
| 570 | Ga0466963_0006900 | 3300044694 | Bacteria | 6757 |
| 571 | Ga0466963_0132303 | 3300044694 | Bacteria | 1724 |
| 572 | Ga0466964_0002210 | 3300044706 | Bacteria | 6882 |
| 573 | Ga0466964_0005549 | 3300044706 | Bacteria | 4684 |
| 574 | Ga0466964_0047611 | 3300044706 | Bacteria | 1751 |
| 575 | Ga0453684_0006310 | 3300044712 | Bacteria | 22635 |
| 576 | Ga0453684_0029590 | 3300044712 | Bacteria | 7769 |
| 577 | Ga0453684_0070482 | 3300044712 | Bacteria | 4427 |
| 578 | Ga0453684_0199202 | 3300044712 | Bacteria | 2335 |
| 579 | Ga0453684_0296868 | 3300044712 | Bacteria | 1838 |
| 580 | Ga0466971_0009997 | 3300044719 | Bacteria | 4143 |
| 581 | Ga0466971_0035059 | 3300044719 | Bacteria | 2249 |
| 582 | Ga0466968_0019130 | 3300044735 | Bacteria | 2754 |
| 583 | Ga0466970_0047285 | 3300044765 | Bacteria | 2292 |
| 584 | Ga0466970_0053682 | 3300044765 | Bacteria | 2152 |
| 585 | Ga0466957_0001869 | 3300044842 | Bacteria | 11135 |
| 586 | Ga0466959_0000192 | 3300045049 | Bacteria | 40028 |
| 587 | Ga0466959_0001900 | 3300045049 | Bacteria | 13149 |
| 588 | Ga0451576_0002088 | 3300045051 | Bacteria | 31196 |
| 589 | Ga0451576_0005708 | 3300045051 | Bacteria | 15524 |
| 590 | Ga0466958_0099407 | 3300045836 | Bacteria | 1807 |
| 591 | Ga0466967_0058942 | 3300045976 | Bacteria | 3395 |
| 592 | Ga0495592_0000131 | 3300046454 | Bacteria | 66382 |
| 593 | Ga0495638_0009224 | 3300046460 | Bacteria | 6936 |
| 594 | Ga0495651_0071139 | 3300046462 | Bacteria | 2645 |
| 595 | Ga0495650_0006757 | 3300046471 | Bacteria | 7095 |
| 596 | Ga0495580_0171128 | 3300046472 | Bacteria | 1502 |
| 597 | Ga0495583_0001389 | 3300046506 | Bacteria | 24734 |
| 598 | Ga0495606_0002457 | 3300046507 | Bacteria | 21484 |
| 599 | Ga0495606_0132686 | 3300046507 | Bacteria | 1479 |
| 600 | Ga0495610_0043787 | 3300046512 | Bacteria | 2227 |
| 601 | Ga0495630_0095737 | 3300046517 | Bacteria | 2245 |
| 602 | Ga0495632_0008499 | 3300046519 | Bacteria | 6292 |
| 603 | Ga0495632_0033623 | 3300046519 | Bacteria | 2630 |
| 604 | Ga0495586_0039823 | 3300046535 | Bacteria | 2527 |
| 605 | Ga0495621_0050246 | 3300046539 | Bacteria | 1490 |
| 606 | Ga0495597_0001155 | 3300046542 | Bacteria | 19882 |
| 607 | Ga0495645_0101203 | 3300046543 | Bacteria | 2049 |
| 608 | Ga0495633_0000563 | 3300046558 | Bacteria | 36212 |
| 609 | Ga0495656_0000090 | 3300046615 | Bacteria | 39387 |
| 610 | Ga0495668_0034249 | 3300046616 | Bacteria | 2851 |
| 611 | Ga0495625_0004803 | 3300046660 | Bacteria | 12637 |
| 612 | Ga0495625_0008201 | 3300046660 | Bacteria | 8942 |
| 613 | Ga0495625_0048427 | 3300046660 | Bacteria | 3060 |
| 614 | Ga0495646_0072592 | 3300046680 | Bacteria | 2024 |
| 615 | Ga0495647_0020866 | 3300046681 | Bacteria | 2355 |
| 616 | Ga0495658_0019055 | 3300046683 | Bacteria | 3577 |
| 617 | Ga0495669_0014353 | 3300046684 | Bacteria | 3386 |
| 618 | Ga0495624_0033178 | 3300046690 | Bacteria | 3345 |
| 619 | Ga0495649_0002836 | 3300046694 | Bacteria | 12028 |
| 620 | Ga0495589_0002215 | 3300046794 | Bacteria | 10937 |
| 621 | Ga0495660_0005511 | 3300046810 | Bacteria | 7585 |
| 622 | Ga0495676_0029355 | 3300047321 | Bacteria | 4683 |
| 623 | Ga0495683_0022972 | 3300047323 | Bacteria | 3206 |
| 624 | Ga0495687_001104 | 3300047443 | Bacteria | 26257 |
| 625 | Ga0495673_0056313 | 3300047469 | Bacteria | 1702 |
| 626 | Ga0495686_0024407 | 3300047472 | Bacteria | 3972 |
| 627 | Ga0496100_0043631 | 3300048903 | Bacteria | 2869 |
| 628 | Ga0496102_0014575 | 3300048905 | Bacteria | 6833 |
| 629 | Ga0496102_0018900 | 3300048905 | Bacteria | 6063 |
| 630 | Ga0496104_0115191 | 3300048907 | Bacteria | 2579 |
| 631 | Ga0496104_0122773 | 3300048907 | Bacteria | 2494 |
| 632 | Ga0496105_0035944 | 3300048908 | Bacteria | 4080 |
| 633 | Ga0496106_0014093 | 3300048909 | Bacteria | 5907 |
| 634 | Ga0496106_0098522 | 3300048909 | Bacteria | 2265 |
| 635 | Ga0496107_0001400 | 3300048910 | Bacteria | 14864 |
| 636 | Ga0496108_0072570 | 3300048911 | Bacteria | 2906 |
| 637 | Ga0496108_0126634 | 3300048911 | Bacteria | 2193 |
| 638 | Ga0496109_0027523 | 3300048912 | Bacteria | 5077 |
| 639 | Ga0496109_0189238 | 3300048912 | Bacteria | 1934 |
| 640 | Ga0496110_0023653 | 3300048913 | Bacteria | 5227 |
| 641 | Ga0496112_0020273 | 3300048915 | Bacteria | 6298 |
| 642 | Ga0496115_0049866 | 3300048918 | Bacteria | 3352 |
| 643 | Ga0496121_0007189 | 3300048924 | Bacteria | 13483 |
| 644 | Ga0496121_0021945 | 3300048924 | Bacteria | 6227 |
| 645 | Ga0496124_0000458 | 3300048927 | Bacteria | 70719 |
| 646 | Ga0496124_0005813 | 3300048927 | Bacteria | 13713 |
| 647 | Ga0496124_0050046 | 3300048927 | Bacteria | 3562 |
| 648 | Ga0496125_0013614 | 3300048928 | Bacteria | 7986 |
| 649 | Ga0496125_0023944 | 3300048928 | Bacteria | 5626 |
| 650 | Ga0501309_004185 | 3300049129 | Bacteria | 1672 |
| 651 | Ga0501298_010618 | 3300049521 | Bacteria | 1587 |
| 652 | Ga0501031_0081555 | 3300049568 | Bacteria | 2109 |
| 653 | Ga0501036_0007274 | 3300049572 | Bacteria | 9015 |
| 654 | Ga0501039_0005901 | 3300049575 | Bacteria | 9276 |
| 655 | Ga0501039_0039487 | 3300049575 | Bacteria | 3646 |
| 656 | Ga0501039_0208340 | 3300049575 | Bacteria | 1537 |
| 657 | Ga0501040_0002327 | 3300049576 | Bacteria | 12210 |
| 658 | Ga0501041_0032740 | 3300049577 | Bacteria | 3142 |
| 659 | Ga0501043_0000180 | 3300049579 | Bacteria | 56892 |
| 660 | Ga0501046_0000226 | 3300049580 | Bacteria | 58757 |
| 661 | Ga0501046_0067714 | 3300049580 | Bacteria | 2780 |
| 662 | Ga0501047_0000302 | 3300049581 | Bacteria | 56851 |
| 663 | Ga0501048_0002019 | 3300049582 | Bacteria | 15408 |
| 664 | Ga0501071_0008395 | 3300049587 | Bacteria | 6825 |
| 665 | Ga0501072_0053253 | 3300049588 | Bacteria | 3187 |
| 666 | Ga0501075_0002288 | 3300049591 | Bacteria | 12709 |
| 667 | Ga0501076_0003282 | 3300049592 | Bacteria | 11335 |
| 668 | Ga0501198_000012 | 3300049649 | Bacteria | 113529 |
| 669 | Ga0501211_000169 | 3300049658 | Bacteria | 5302 |
| 670 | Ga0501222_000010 | 3300049662 | Bacteria | 113536 |
| 671 | Ga0501222_003695 | 3300049662 | Bacteria | 2080 |
| 672 | Ga0501223_006660 | 3300049663 | Bacteria | 2383 |
| 673 | Ga0501235_003241 | 3300049669 | Bacteria | 3509 |
| 674 | Ga0501253_002035 | 3300049683 | Bacteria | 2207 |
| 675 | Ga0501258_001467 | 3300049687 | Bacteria | 1939 |
| 676 | Ga0501079_0003524 | 3300049741 | Bacteria | 11502 |
| 677 | Ga0501080_0008520 | 3300049742 | Bacteria | 9298 |
| 678 | Ga0501081_0006056 | 3300049743 | Bacteria | 7835 |
| 679 | Ga0501232_001577 | 3300049757 | Bacteria | 1844 |
| 680 | Ga0501265_000929 | 3300049762 | Bacteria | 3287 |
| 681 | Ga0501267_000195 | 3300049764 | Bacteria | 4229 |
| 682 | Ga0501035_0074677 | 3300049822 | Bacteria | 2999 |
| 683 | Ga0501035_0239366 | 3300049822 | Bacteria | 1544 |
| 684 | Ga0501044_0187509 | 3300049823 | Bacteria | 2032 |
| 685 | Ga0501045_0019744 | 3300049824 | Bacteria | 4808 |
| 686 | Ga0501045_0029699 | 3300049824 | Bacteria | 3953 |
| 687 | nmdc:mga03683_24590_c1 | 3300050489 | Bacteria | 2358 |
| 688 | nmdc:mga03n38_14350_c1 | 3300050490 | Bacteria | 3034 |
| 689 | nmdc:mga00v17_141311_c1 | 3300050491 | Bacteria | 1544 |
| 690 | nmdc:mga0yw44_120231_c1 | 3300050492 | Bacteria | 1691 |
| 691 | nmdc:mga0yw44_17520_c1 | 3300050492 | Bacteria | 3900 |
| 692 | nmdc:mga0k408_10110_c1 | 3300050493 | Bacteria | 5099 |
| 693 | nmdc:mga0k408_103181_c1 | 3300050493 | Bacteria | 1682 |
| 694 | nmdc:mga0k408_103692_c1 | 3300050493 | Bacteria | 1678 |
| 695 | nmdc:mga0k408_1099_c1 | 3300050493 | Bacteria | 14817 |
| 696 | nmdc:mga0k408_1168_c1 | 3300050493 | Bacteria | 14359 |
| 697 | nmdc:mga0k408_143880_c1 | 3300050493 | Bacteria | 1419 |
| 698 | nmdc:mga0k408_1809_c1 | 3300050493 | Bacteria | 11476 |
| 699 | nmdc:mga0k408_1875_c1 | 3300050493 | Bacteria | 11271 |
| 700 | nmdc:mga0k408_22532_c1 | 3300050493 | Bacteria | 3547 |
| 701 | nmdc:mga0k408_2385_c2 | 3300050493 | Bacteria | 8224 |
| 702 | nmdc:mga0k408_24236_c1 | 3300050493 | Bacteria | 3429 |
| 703 | nmdc:mga0k408_24423_c1 | 3300050493 | Bacteria | 1544 |
| 704 | nmdc:mga0k408_254_c1 | 3300050493 | Bacteria | 29029 |
| 705 | nmdc:mga0k408_29676_c1 | 3300050493 | Bacteria | 3115 |
| 706 | nmdc:mga0k408_31829_c1 | 3300050493 | Bacteria | 3014 |
| 707 | nmdc:mga0k408_37675_c1 | 3300050493 | Bacteria | 2776 |
| 708 | nmdc:mga0k408_5093_c1 | 3300050493 | Bacteria | 6962 |
| 709 | nmdc:mga0k408_56079_c1 | 3300050493 | Bacteria | 2286 |
| 710 | nmdc:mga0k408_56699_c1 | 3300050493 | Bacteria | 2274 |
| 711 | nmdc:mga0k408_67904_c1 | 3300050493 | Bacteria | 2079 |
| 712 | nmdc:mga0k408_7723_c1 | 3300050493 | Bacteria | 5749 |
| 713 | nmdc:mga0k408_77971_c1 | 3300050493 | Bacteria | 1938 |
| 714 | nmdc:mga0k408_81748_c1 | 3300050493 | Bacteria | 1892 |
| 715 | nmdc:mga0k408_83233_c1 | 3300050493 | Bacteria | 1876 |
| 716 | nmdc:mga0k408_84399_c1 | 3300050493 | Bacteria | 1863 |
| 717 | nmdc:mga06z11_110720_c1 | 3300050494 | Bacteria | 1520 |
| 718 | nmdc:mga06z11_7713_c1 | 3300050494 | Bacteria | 4445 |
| 719 | nmdc:mga04h51_1437_c1 | 3300050495 | Bacteria | 5513 |
| 720 | nmdc:mga07m45_1257_c1 | 3300050496 | Bacteria | 11522 |
| 721 | nmdc:mga07m45_136_c1 | 3300050496 | Bacteria | 27318 |
| 722 | nmdc:mga07m45_16746_c1 | 3300050496 | Bacteria | 3927 |
| 723 | nmdc:mga07m45_18170_c1 | 3300050496 | Bacteria | 3790 |
| 724 | nmdc:mga07m45_38970_c2 | 3300050496 | Bacteria | 2298 |
| 725 | nmdc:mga07m45_44013_c1 | 3300050496 | Bacteria | 2504 |
| 726 | nmdc:mga07m45_4448_c1 | 3300050496 | Bacteria | 5866 |
| 727 | nmdc:mga07m45_6340_c1 | 3300050496 | Bacteria | 5972 |
| 728 | nmdc:mga07m45_9539_c1 | 3300050496 | Bacteria | 5040 |
| 729 | nmdc:mga05p37_51575_c1 | 3300050507 | Bacteria | 5058 |
| 730 | nmdc:mga09592_11811_c1 | 3300050508 | Bacteria | 7103 |
| 731 | nmdc:mga0qj67_127566_c1 | 3300050509 | Bacteria | 2059 |
| 732 | nmdc:mga08y16_297876_c1 | 3300050511 | Bacteria | 1663 |
| 733 | nmdc:mga0n895_81799_c1 | 3300050512 | Bacteria | 3218 |
| 734 | nmdc:mga0sz30_7999_c1 | 3300050516 | Bacteria | 3980 |
| 735 | Ga0500610_0003177 | 3300053079 | Bacteria | 6251 |
| 736 | Ga0500635_0000210 | 3300053080 | Bacteria | 28403 |
| 737 | Ga0500578_0001060 | 3300053086 | Bacteria | 29908 |
| 738 | Ga0500578_0127433 | 3300053086 | Bacteria | 1598 |
| 739 | Ga0500646_0004472 | 3300053090 | Bacteria | 3538 |
| 740 | Ga0500651_0011159 | 3300053093 | Bacteria | 5408 |
| 741 | Ga0500651_0027376 | 3300053093 | Bacteria | 3585 |
| 742 | Ga0500650_0045114 | 3300053098 | Bacteria | 2041 |
| 743 | Ga0500593_000472 | 3300053117 | Bacteria | 15997 |
| 744 | Ga0500594_0002285 | 3300053118 | Bacteria | 4151 |
| 745 | Ga0500628_000967 | 3300053129 | Bacteria | 5055 |
| 746 | Ga0500642_0000805 | 3300053130 | Bacteria | 9200 |
| 747 | Ga0500652_000299 | 3300053131 | Bacteria | 18083 |
| 748 | Ga0500658_0001952 | 3300053134 | Bacteria | 8074 |
| 749 | Ga0500559_0000019 | 3300053136 | Bacteria | 134862 |
| 750 | Ga0500559_0004852 | 3300053136 | Bacteria | 6279 |
| 751 | Ga0500568_0003790 | 3300053139 | Bacteria | 8274 |
| 752 | Ga0500568_0004895 | 3300053139 | Bacteria | 7053 |
| 753 | Ga0500568_0008380 | 3300053139 | Bacteria | 4986 |
| 754 | Ga0500604_0011120 | 3300053151 | Bacteria | 2413 |
| 755 | Ga0500604_0015822 | 3300053151 | Bacteria | 2071 |
| 756 | Ga0500619_000127 | 3300053154 | Bacteria | 19880 |
| 757 | Ga0500622_0000125 | 3300053156 | Bacteria | 81109 |
| 758 | Ga0500622_0000788 | 3300053156 | Bacteria | 27492 |
| 759 | Ga0500622_0001196 | 3300053156 | Bacteria | 21359 |
| 760 | Ga0500622_0014200 | 3300053156 | Bacteria | 4281 |
| 761 | Ga0500634_0012693 | 3300053161 | Bacteria | 4397 |
| 762 | Ga0500636_0009748 | 3300053177 | Bacteria | 5594 |
| 763 | Ga0500645_003758 | 3300053730 | Bacteria | 6050 |
| 764 | Ga0500587_000142 | 3300053739 | Bacteria | 6857 |
| 765 | Ga0500587_004256 | 3300053739 | Bacteria | 1972 |
| 766 | Ga0501084_0004224 | 3300054114 | Bacteria | 11703 |
| 767 | Ga0590071_000494 | 3300059421 | Bacteria | 11506 |
| 768 | Ga0590074_004355 | 3300059423 | Bacteria | 2342 |
| 769 | Ga0466962_0013216 | 3300061719 | Bacteria | 3970 |
| 770 | Ga0466962_0013706 | 3300061719 | Bacteria | 3902 |
| 771 | Ga0530510_0001033 | 3300061734 | Bacteria | 18419 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035695 | Ga0373927_0243128 | Ga0373927_0243128_21_1097 | 321 |
| 2 | 3300013306 | Ga0163162_10256447 | Ga0163162_102564472 | 346 |
| 3 | 3300006946 | Ga0079104_1000001 | Ga0079104_100000181 | 351 |
| 4 | 3300025303 | Ga0209051_1011018 | Ga0209051_10110182 | 351 |
| 5 | 3300027111 | Ga0209281_1000057 | Ga0209281_1000057235 | 351 |
| 6 | 3300003775 | Ga0055524_1000070 | Ga0055524_1000070103 | 354 |
| 7 | 3300025291 | Ga0209675_1005904 | Ga0209675_10059045 | 354 |
| 8 | 3300025299 | Ga0209256_1000015 | Ga0209256_1000015278 | 354 |
| 9 | 3300045051 | Ga0451576_0002088 | Ga0451576_0002088_4312_5532 | 354 |
| 10 | 3300053151 | Ga0500604_0015822 | Ga0500604_0015822_185_1402 | 356 |
| 11 | 3300002773 | JGI25152J39213_1000892 | JGI25152J39213_100089215 | 358 |
| 12 | 3300002774 | JGI25150J39212_1006922 | JGI25150J39212_10069222 | 358 |
| 13 | 3300003215 | JGI25153J46596_10000420 | JGI25153J46596_1000042015 | 358 |
| 14 | 3300003215 | JGI25153J46596_10001641 | JGI25153J46596_100016412 | 358 |
| 15 | 3300003771 | Ga0055526_1006651 | Ga0055526_10066512 | 358 |
| 16 | 3300005262 | Ga0065165_1001958 | Ga0065165_10019582 | 358 |
| 17 | 3300005344 | Ga0070661_100001368 | Ga0070661_1000013688 | 358 |
| 18 | 3300005366 | Ga0070659_100000400 | Ga0070659_10000040023 | 358 |
| 19 | 3300005564 | Ga0070664_100004137 | Ga0070664_1000041376 | 358 |
| 20 | 3300006051 | Ga0075364_10120282 | Ga0075364_101202822 | 358 |
| 21 | 3300006177 | Ga0075362_10003380 | Ga0075362_100033805 | 358 |
| 22 | 3300006353 | Ga0075370_10002528 | Ga0075370_100025289 | 358 |
| 23 | 3300025245 | Ga0207425_1000221 | Ga0207425_100022124 | 358 |
| 24 | 3300025258 | Ga0209129_1000012 | Ga0209129_1000012152 | 358 |
| 25 | 3300025258 | Ga0209129_1007833 | Ga0209129_10078332 | 358 |
| 26 | 3300025273 | Ga0209673_1002136 | Ga0209673_10021368 | 358 |
| 27 | 3300025295 | Ga0209564_1000022 | Ga0209564_1000022362 | 358 |
| 28 | 3300025297 | Ga0209758_1000124 | Ga0209758_100012499 | 358 |
| 29 | 3300025297 | Ga0209758_1000659 | Ga0209758_10006595 | 358 |
| 30 | 3300025299 | Ga0209256_1017844 | Ga0209256_10178442 | 358 |
| 31 | 3300025920 | Ga0207649_10003258 | Ga0207649_100032582 | 358 |
| 32 | 3300025932 | Ga0207690_10001638 | Ga0207690_1000163812 | 358 |
| 33 | 3300025945 | Ga0207679_10000320 | Ga0207679_100003202 | 358 |
| 34 | 3300027866 | Ga0209813_10015368 | Ga0209813_100153682 | 358 |
| 35 | 3300039447 | Ga0436361_0750298 | Ga0436361_0750298_19270_20475 | 358 |
| 36 | 3300041443 | Ga0451789_0776084 | Ga0451789_0776084_712_1935 | 358 |
| 37 | 3300041458 | Ga0451798_0151095 | Ga0451798_0151095_1033_2256 | 358 |
| 38 | 3300041512 | Ga0451853_2309212 | Ga0451853_2309212_385_1608 | 358 |
| 39 | 3300050489 | nmdc:mga03683_24590_c1 | nmdc:mga03683_24590_c1_717_1940 | 358 |
| 40 | 3300050490 | nmdc:mga03n38_14350_c1 | nmdc:mga03n38_14350_c1_455_1678 | 358 |
| 41 | 3300050491 | nmdc:mga00v17_141311_c1 | nmdc:mga00v17_141311_c1_260_1483 | 358 |
| 42 | 3300050492 | nmdc:mga0yw44_120231_c1 | nmdc:mga0yw44_120231_c1_62_1285 | 358 |
| 43 | 3300050493 | nmdc:mga0k408_22532_c1 | nmdc:mga0k408_22532_c1_237_1460 | 358 |
| 44 | 3300050496 | nmdc:mga07m45_44013_c1 | nmdc:mga07m45_44013_c1_129_1349 | 358 |
| 45 | 3300053086 | Ga0500578_0127433 | Ga0500578_0127433_196_1419 | 358 |
| 46 | 3300053090 | Ga0500646_0004472 | Ga0500646_0004472_2009_3232 | 358 |
| 47 | 3300053093 | Ga0500651_0011159 | Ga0500651_0011159_2748_3971 | 358 |
| 48 | 3300053098 | Ga0500650_0045114 | Ga0500650_0045114_695_1918 | 358 |
| 49 | 3300053129 | Ga0500628_000967 | Ga0500628_000967_1681_2904 | 358 |
| 50 | 3300053130 | Ga0500642_0000805 | Ga0500642_0000805_5563_6786 | 358 |
| 51 | 3300053131 | Ga0500652_000299 | Ga0500652_000299_7951_9174 | 358 |
| 52 | 3300053151 | Ga0500604_0011120 | Ga0500604_0011120_617_1840 | 358 |
| 53 | 3300053156 | Ga0500622_0000125 | Ga0500622_0000125_10209_11432 | 358 |
| 54 | 3300006948 | Ga0099826_10077697 | Ga0099826_100776972 | 360 |
| 55 | 3300031730 | Ga0307516_10016330 | Ga0307516_100163304 | 360 |
| 56 | 3300048928 | Ga0496125_0013614 | Ga0496125_0013614_778_1956 | 360 |
| 57 | 3300049579 | Ga0501043_0000180 | Ga0501043_0000180_3766_4989 | 360 |
| 58 | 3300049580 | Ga0501046_0000226 | Ga0501046_0000226_3665_4888 | 360 |
| 59 | 3300049581 | Ga0501047_0000302 | Ga0501047_0000302_51921_53144 | 360 |
| 60 | 3300049582 | Ga0501048_0002019 | Ga0501048_0002019_10573_11796 | 360 |
| 61 | 3300049823 | Ga0501044_0187509 | Ga0501044_0187509_189_1412 | 360 |
| 62 | 3300049824 | Ga0501045_0019744 | Ga0501045_0019744_2935_4158 | 360 |
| 63 | 3300050493 | nmdc:mga0k408_67904_c1 | nmdc:mga0k408_67904_c1_494_1720 | 360 |
| 64 | 3300050496 | nmdc:mga07m45_6340_c1 | nmdc:mga07m45_6340_c1_4253_5479 | 360 |
| 65 | 3300021361 | Ga0213872_10000067 | Ga0213872_1000006761 | 361 |
| 66 | 3300003791 | Ga0055530_10001971 | Ga0055530_1000197110 | 362 |
| 67 | 3300003792 | Ga0055540_1000013 | Ga0055540_1000013131 | 362 |
| 68 | 3300003794 | Ga0055531_10007051 | Ga0055531_100070514 | 362 |
| 69 | 3300025298 | Ga0209050_1001261 | Ga0209050_100126127 | 362 |
| 70 | 3300025303 | Ga0209051_1000022 | Ga0209051_1000022136 | 362 |
| 71 | 3300025304 | Ga0209257_1000030 | Ga0209257_1000030334 | 362 |
| 72 | 3300031730 | Ga0307516_10001691 | Ga0307516_1000169113 | 362 |
| 73 | 3300059421 | Ga0590071_000494 | Ga0590071_000494_3286_4512 | 362 |
| 74 | 3300059423 | Ga0590074_004355 | Ga0590074_004355_658_1884 | 362 |
| 75 | 3300002704 | JGI25155J39150_1000022 | JGI25155J39150_100002288 | 363 |
| 76 | 3300002705 | JGI25156J39149_1000005 | JGI25156J39149_100000580 | 363 |
| 77 | 3300002738 | JGI25154J39366_1000017 | JGI25154J39366_100001772 | 363 |
| 78 | 3300002741 | JGI25157J39369_1000003 | JGI25157J39369_100000388 | 363 |
| 79 | 3300005618 | Ga0068864_100101421 | Ga0068864_1001014212 | 363 |
| 80 | 3300009177 | Ga0105248_10000507 | Ga0105248_1000050745 | 363 |
| 81 | 3300025206 | Ga0209435_100002 | Ga0209435_100002195 | 363 |
| 82 | 3300025246 | Ga0209646_1000001 | Ga0209646_10000012338 | 363 |
| 83 | 3300025250 | Ga0209026_1000001 | Ga0209026_1000001995 | 363 |
| 84 | 3300025256 | Ga0209759_1000001 | Ga0209759_10000011969 | 363 |
| 85 | 3300025931 | Ga0207644_10012254 | Ga0207644_100122543 | 363 |
| 86 | 3300031250 | Ga0265331_10010440 | Ga0265331_100104402 | 363 |
| 87 | 3300031251 | Ga0265327_10000035 | Ga0265327_10000035212 | 363 |
| 88 | 3300048907 | Ga0496104_0115191 | Ga0496104_0115191_506_1726 | 363 |
| 89 | 3300048911 | Ga0496108_0126634 | Ga0496108_0126634_10_1230 | 363 |
| 90 | 3300048915 | Ga0496112_0020273 | Ga0496112_0020273_4653_5873 | 363 |
| 91 | 3300031548 | Ga0307408_100008274 | Ga0307408_1000082744 | 364 |
| 92 | 3300039110 | Ga0400487_51885 | Ga0400487_51885_3013_4251 | 364 |
| 93 | 3300048912 | Ga0496109_0027523 | Ga0496109_0027523_2536_3753 | 364 |
| 94 | 3300021361 | Ga0213872_10000202 | Ga0213872_1000020226 | 365 |
| 95 | 3300037471 | Ga0395905_0075957 | Ga0395905_0075957_1789_3000 | 365 |
| 96 | 3300039447 | Ga0436361_0379569 | Ga0436361_0379569_28225_29448 | 365 |
| 97 | 3300044712 | Ga0453684_0006310 | Ga0453684_0006310_7818_9026 | 365 |
| 98 | 3300048905 | Ga0496102_0014575 | Ga0496102_0014575_873_2093 | 365 |
| 99 | 3300049822 | Ga0501035_0239366 | Ga0501035_0239366_114_1331 | 365 |
| 100 | 3300003187 | JGI25151J46595_10009446 | JGI25151J46595_100094461 | 366 |
| 101 | 3300003781 | Ga0055536_1017428 | Ga0055536_10174281 | 366 |
| 102 | 3300005295 | Ga0065707_10125111 | Ga0065707_101251112 | 366 |
| 103 | 3300005457 | Ga0070662_100036944 | Ga0070662_1000369442 | 366 |
| 104 | 3300005539 | Ga0068853_100082267 | Ga0068853_1000822673 | 366 |
| 105 | 3300005616 | Ga0068852_100058097 | Ga0068852_1000580972 | 366 |
| 106 | 3300006051 | Ga0075364_10005356 | Ga0075364_100053564 | 366 |
| 107 | 3300006195 | Ga0075366_10013284 | Ga0075366_100132847 | 366 |
| 108 | 3300006195 | Ga0075366_10060378 | Ga0075366_100603782 | 366 |
| 109 | 3300009093 | Ga0105240_10005235 | Ga0105240_100052359 | 366 |
| 110 | 3300009545 | Ga0105237_10002475 | Ga0105237_1000247513 | 366 |
| 111 | 3300010375 | Ga0105239_10001374 | Ga0105239_1000137434 | 366 |
| 112 | 3300025258 | Ga0209129_1009954 | Ga0209129_10099542 | 366 |
| 113 | 3300025292 | Ga0209676_1004490 | Ga0209676_10044905 | 366 |
| 114 | 3300025294 | Ga0209025_1014696 | Ga0209025_10146962 | 366 |
| 115 | 3300025295 | Ga0209564_1009909 | Ga0209564_10099094 | 366 |
| 116 | 3300025913 | Ga0207695_10012572 | Ga0207695_1001257210 | 366 |
| 117 | 3300025914 | Ga0207671_10009202 | Ga0207671_100092028 | 366 |
| 118 | 3300025931 | Ga0207644_10178504 | Ga0207644_101785042 | 366 |
| 119 | 3300025933 | Ga0207706_10012561 | Ga0207706_100125618 | 366 |
| 120 | 3300026041 | Ga0207639_10074445 | Ga0207639_100744451 | 366 |
| 121 | 3300026116 | Ga0207674_10008473 | Ga0207674_100084732 | 366 |
| 122 | 3300026142 | Ga0207698_10135176 | Ga0207698_101351762 | 366 |
| 123 | 3300028794 | Ga0307515_10051550 | Ga0307515_100515504 | 366 |
| 124 | 3300031456 | Ga0307513_10233390 | Ga0307513_102333902 | 366 |
| 125 | 3300031730 | Ga0307516_10018452 | Ga0307516_100184527 | 366 |
| 126 | 3300031911 | Ga0307412_10137171 | Ga0307412_101371712 | 366 |
| 127 | 3300032002 | Ga0307416_100111213 | Ga0307416_1001112131 | 366 |
| 128 | 3300037068 | Ga0373925_0004978 | Ga0373925_0004978_7606_8835 | 366 |
| 129 | 3300042121 | Ga0450919_000054 | Ga0450919_000054_1728_2945 | 366 |
| 130 | 3300042531 | Ga0450918_001116 | Ga0450918_001116_1592_2809 | 366 |
| 131 | 3300044658 | Ga0466972_0055870 | Ga0466972_0055870_553_1773 | 366 |
| 132 | 3300046519 | Ga0495632_0008499 | Ga0495632_0008499_3711_4928 | 366 |
| 133 | 3300046810 | Ga0495660_0005511 | Ga0495660_0005511_4693_5910 | 366 |
| 134 | 3300050493 | nmdc:mga0k408_10110_c1 | nmdc:mga0k408_10110_c1_2314_3534 | 366 |
| 135 | 3300050493 | nmdc:mga0k408_103181_c1 | nmdc:mga0k408_103181_c1_213_1442 | 366 |
| 136 | 3300050493 | nmdc:mga0k408_254_c1 | nmdc:mga0k408_254_c1_7015_8235 | 366 |
| 137 | 3300050493 | nmdc:mga0k408_56079_c1 | nmdc:mga0k408_56079_c1_386_1606 | 366 |
| 138 | 3300050496 | nmdc:mga07m45_38970_c2 | nmdc:mga07m45_38970_c2_282_1502 | 366 |
| 139 | 3300053134 | Ga0500658_0001952 | Ga0500658_0001952_4737_5954 | 366 |
| 140 | 3300001979 | JGI24740J21852_10009684 | JGI24740J21852_100096844 | 367 |
| 141 | 3300006195 | Ga0075366_10001345 | Ga0075366_100013459 | 367 |
| 142 | 3300006195 | Ga0075366_10093630 | Ga0075366_100936302 | 367 |
| 143 | 3300006353 | Ga0075370_10086415 | Ga0075370_100864152 | 367 |
| 144 | 3300006846 | Ga0075430_100083338 | Ga0075430_1000833382 | 367 |
| 145 | 3300013308 | Ga0157375_10143599 | Ga0157375_101435992 | 367 |
| 146 | 3300025986 | Ga0207658_10006443 | Ga0207658_100064433 | 367 |
| 147 | 3300027876 | Ga0209974_10000240 | Ga0209974_100002409 | 367 |
| 148 | 3300028794 | Ga0307515_10000354 | Ga0307515_1000035438 | 367 |
| 149 | 3300028794 | Ga0307515_10007796 | Ga0307515_1000779618 | 367 |
| 150 | 3300028794 | Ga0307515_10022668 | Ga0307515_100226689 | 367 |
| 151 | 3300028794 | Ga0307515_10028135 | Ga0307515_100281357 | 367 |
| 152 | 3300031456 | Ga0307513_10002583 | Ga0307513_1000258315 | 367 |
| 153 | 3300031456 | Ga0307513_10108518 | Ga0307513_101085183 | 367 |
| 154 | 3300031616 | Ga0307508_10000043 | Ga0307508_1000004367 | 367 |
| 155 | 3300031649 | Ga0307514_10118284 | Ga0307514_101182842 | 367 |
| 156 | 3300037068 | Ga0373925_0222076 | Ga0373925_0222076_90_1310 | 367 |
| 157 | 3300039447 | Ga0436361_0644805 | Ga0436361_0644805_1173_2393 | 367 |
| 158 | 3300041460 | Ga0451802_1906811 | Ga0451802_1906811_745_1971 | 367 |
| 159 | 3300044656 | Ga0466969_0000008 | Ga0466969_0000008_15157_16371 | 367 |
| 160 | 3300044658 | Ga0466972_0001296 | Ga0466972_0001296_4720_5940 | 367 |
| 161 | 3300044706 | Ga0466964_0047611 | Ga0466964_0047611_66_1286 | 367 |
| 162 | 3300044712 | Ga0453684_0199202 | Ga0453684_0199202_487_1707 | 367 |
| 163 | 3300046660 | Ga0495625_0048427 | Ga0495625_0048427_1566_2792 | 367 |
| 164 | 3300048905 | Ga0496102_0018900 | Ga0496102_0018900_915_2144 | 367 |
| 165 | 3300049649 | Ga0501198_000012 | Ga0501198_000012_27075_28298 | 367 |
| 166 | 3300049662 | Ga0501222_000010 | Ga0501222_000010_27081_28304 | 367 |
| 167 | 3300050493 | nmdc:mga0k408_1875_c1 | nmdc:mga0k408_1875_c1_6090_7307 | 367 |
| 168 | 3300050493 | nmdc:mga0k408_24423_c1 | nmdc:mga0k408_24423_c1_270_1490 | 367 |
| 169 | 3300050493 | nmdc:mga0k408_81748_c1 | nmdc:mga0k408_81748_c1_621_1847 | 367 |
| 170 | 3300050493 | nmdc:mga0k408_83233_c1 | nmdc:mga0k408_83233_c1_326_1552 | 367 |
| 171 | 3300050508 | nmdc:mga09592_11811_c1 | nmdc:mga09592_11811_c1_5242_6465 | 367 |
| 172 | 3300050509 | nmdc:mga0qj67_127566_c1 | nmdc:mga0qj67_127566_c1_505_1728 | 367 |
| 173 | 3300053154 | Ga0500619_000127 | Ga0500619_000127_3278_4498 | 367 |
| 174 | 3300053739 | Ga0500587_000142 | Ga0500587_000142_2250_3476 | 367 |
| 175 | 3300005355 | Ga0070671_100084720 | Ga0070671_1000847202 | 368 |
| 176 | 3300005467 | Ga0070706_100002083 | Ga0070706_10000208319 | 368 |
| 177 | 3300005564 | Ga0070664_100003718 | Ga0070664_1000037182 | 368 |
| 178 | 3300005617 | Ga0068859_100052468 | Ga0068859_1000524686 | 368 |
| 179 | 3300005618 | Ga0068864_100034295 | Ga0068864_1000342955 | 368 |
| 180 | 3300005841 | Ga0068863_100066221 | Ga0068863_1000662214 | 368 |
| 181 | 3300005843 | Ga0068860_100089309 | Ga0068860_1000893092 | 368 |
| 182 | 3300006038 | Ga0075365_10002764 | Ga0075365_100027642 | 368 |
| 183 | 3300006042 | Ga0075368_10007078 | Ga0075368_100070782 | 368 |
| 184 | 3300006048 | Ga0075363_100001729 | Ga0075363_1000017295 | 368 |
| 185 | 3300006051 | Ga0075364_10011648 | Ga0075364_100116484 | 368 |
| 186 | 3300006177 | Ga0075362_10000284 | Ga0075362_100002845 | 368 |
| 187 | 3300006178 | Ga0075367_10002511 | Ga0075367_100025119 | 368 |
| 188 | 3300006178 | Ga0075367_10015326 | Ga0075367_100153261 | 368 |
| 189 | 3300006178 | Ga0075367_10114122 | Ga0075367_101141221 | 368 |
| 190 | 3300006186 | Ga0075369_10001928 | Ga0075369_100019285 | 368 |
| 191 | 3300006195 | Ga0075366_10001564 | Ga0075366_100015644 | 368 |
| 192 | 3300006195 | Ga0075366_10010991 | Ga0075366_100109913 | 368 |
| 193 | 3300006353 | Ga0075370_10000616 | Ga0075370_100006168 | 368 |
| 194 | 3300006353 | Ga0075370_10001109 | Ga0075370_100011095 | 368 |
| 195 | 3300006353 | Ga0075370_10004121 | Ga0075370_100041212 | 368 |
| 196 | 3300006353 | Ga0075370_10027497 | Ga0075370_100274971 | 368 |
| 197 | 3300006353 | Ga0075370_10039435 | Ga0075370_100394352 | 368 |
| 198 | 3300006931 | Ga0097620_100052468 | Ga0097620_1000524681 | 368 |
| 199 | 3300011119 | Ga0105246_10141331 | Ga0105246_101413312 | 368 |
| 200 | 3300013308 | Ga0157375_10232100 | Ga0157375_102321002 | 368 |
| 201 | 3300021361 | Ga0213872_10000131 | Ga0213872_1000013156 | 368 |
| 202 | 3300025910 | Ga0207684_10004207 | Ga0207684_100042075 | 368 |
| 203 | 3300025931 | Ga0207644_10121935 | Ga0207644_101219351 | 368 |
| 204 | 3300025945 | Ga0207679_10014305 | Ga0207679_100143052 | 368 |
| 205 | 3300026088 | Ga0207641_10013425 | Ga0207641_100134258 | 368 |
| 206 | 3300026095 | Ga0207676_10083434 | Ga0207676_100834342 | 368 |
| 207 | 3300027866 | Ga0209813_10002855 | Ga0209813_100028552 | 368 |
| 208 | 3300028786 | Ga0307517_10001109 | Ga0307517_1000110948 | 368 |
| 209 | 3300028786 | Ga0307517_10080174 | Ga0307517_100801742 | 368 |
| 210 | 3300028794 | Ga0307515_10132811 | Ga0307515_101328111 | 368 |
| 211 | 3300031507 | Ga0307509_10015315 | Ga0307509_100153154 | 368 |
| 212 | 3300031548 | Ga0307408_100000023 | Ga0307408_100000023204 | 368 |
| 213 | 3300031616 | Ga0307508_10001327 | Ga0307508_1000132711 | 368 |
| 214 | 3300031852 | Ga0307410_10045313 | Ga0307410_100453132 | 368 |
| 215 | 3300032004 | Ga0307414_10125348 | Ga0307414_101253482 | 368 |
| 216 | 3300033180 | Ga0307510_10024047 | Ga0307510_100240474 | 368 |
| 217 | 3300033180 | Ga0307510_10025385 | Ga0307510_100253854 | 368 |
| 218 | 3300035691 | Ga0373931_0041306 | Ga0373931_0041306_722_1942 | 368 |
| 219 | 3300039447 | Ga0436361_0745691 | Ga0436361_0745691_36147_37367 | 368 |
| 220 | 3300039447 | Ga0436361_0843250 | Ga0436361_0843250_207_1427 | 368 |
| 221 | 3300042128 | Ga0450897_001473 | Ga0450897_001473_97_1308 | 368 |
| 222 | 3300044712 | Ga0453684_0029590 | Ga0453684_0029590_828_2054 | 368 |
| 223 | 3300046454 | Ga0495592_0000131 | Ga0495592_0000131_6713_7933 | 368 |
| 224 | 3300046460 | Ga0495638_0009224 | Ga0495638_0009224_5120_6340 | 368 |
| 225 | 3300046512 | Ga0495610_0043787 | Ga0495610_0043787_251_1471 | 368 |
| 226 | 3300046517 | Ga0495630_0095737 | Ga0495630_0095737_876_2096 | 368 |
| 227 | 3300046660 | Ga0495625_0004803 | Ga0495625_0004803_11271_12488 | 368 |
| 228 | 3300046690 | Ga0495624_0033178 | Ga0495624_0033178_1160_2380 | 368 |
| 229 | 3300047321 | Ga0495676_0029355 | Ga0495676_0029355_2824_4044 | 368 |
| 230 | 3300047443 | Ga0495687_001104 | Ga0495687_001104_10172_11392 | 368 |
| 231 | 3300048907 | Ga0496104_0122773 | Ga0496104_0122773_1205_2413 | 368 |
| 232 | 3300048908 | Ga0496105_0035944 | Ga0496105_0035944_2100_3308 | 368 |
| 233 | 3300049129 | Ga0501309_004185 | Ga0501309_004185_50_1270 | 368 |
| 234 | 3300050492 | nmdc:mga0yw44_17520_c1 | nmdc:mga0yw44_17520_c1_207_1427 | 368 |
| 235 | 3300050493 | nmdc:mga0k408_1809_c1 | nmdc:mga0k408_1809_c1_3283_4503 | 368 |
| 236 | 3300050493 | nmdc:mga0k408_37675_c1 | nmdc:mga0k408_37675_c1_854_2074 | 368 |
| 237 | 3300050493 | nmdc:mga0k408_7723_c1 | nmdc:mga0k408_7723_c1_80_1300 | 368 |
| 238 | 3300050493 | nmdc:mga0k408_77971_c1 | nmdc:mga0k408_77971_c1_39_1259 | 368 |
| 239 | 3300050493 | nmdc:mga0k408_84399_c1 | nmdc:mga0k408_84399_c1_327_1547 | 368 |
| 240 | 3300050494 | nmdc:mga06z11_110720_c1 | nmdc:mga06z11_110720_c1_272_1492 | 368 |
| 241 | 3300050494 | nmdc:mga06z11_7713_c1 | nmdc:mga06z11_7713_c1_1209_2429 | 368 |
| 242 | 3300050495 | nmdc:mga04h51_1437_c1 | nmdc:mga04h51_1437_c1_3288_4508 | 368 |
| 243 | 3300050496 | nmdc:mga07m45_1257_c1 | nmdc:mga07m45_1257_c1_4871_6091 | 368 |
| 244 | 3300050496 | nmdc:mga07m45_16746_c1 | nmdc:mga07m45_16746_c1_444_1664 | 368 |
| 245 | 3300050516 | nmdc:mga0sz30_7999_c1 | nmdc:mga0sz30_7999_c1_712_1932 | 368 |
| 246 | 3300053093 | Ga0500651_0027376 | Ga0500651_0027376_1863_3083 | 368 |
| 247 | 3300053118 | Ga0500594_0002285 | Ga0500594_0002285_2531_3751 | 368 |
| 248 | 3300053136 | Ga0500559_0000019 | Ga0500559_0000019_12079_13299 | 368 |
| 249 | 3300053139 | Ga0500568_0004895 | Ga0500568_0004895_2213_3430 | 368 |
| 250 | 3300053156 | Ga0500622_0000788 | Ga0500622_0000788_1126_2346 | 368 |
| 251 | 3300053739 | Ga0500587_004256 | Ga0500587_004256_386_1606 | 368 |
| 252 | 3300005338 | Ga0068868_100167694 | Ga0068868_1001676942 | 369 |
| 253 | 3300005434 | Ga0070709_10004984 | Ga0070709_100049849 | 369 |
| 254 | 3300005436 | Ga0070713_100196145 | Ga0070713_1001961451 | 369 |
| 255 | 3300005439 | Ga0070711_100007985 | Ga0070711_1000079854 | 369 |
| 256 | 3300005457 | Ga0070662_100031644 | Ga0070662_1000316442 | 369 |
| 257 | 3300005518 | Ga0070699_100095918 | Ga0070699_1000959181 | 369 |
| 258 | 3300005530 | Ga0070679_100118893 | Ga0070679_1001188932 | 369 |
| 259 | 3300005546 | Ga0070696_100052607 | Ga0070696_1000526072 | 369 |
| 260 | 3300005614 | Ga0068856_100082500 | Ga0068856_1000825002 | 369 |
| 261 | 3300006195 | Ga0075366_10001067 | Ga0075366_100010678 | 369 |
| 262 | 3300006195 | Ga0075366_10004269 | Ga0075366_100042695 | 369 |
| 263 | 3300006353 | Ga0075370_10031724 | Ga0075370_100317242 | 369 |
| 264 | 3300009545 | Ga0105237_10265039 | Ga0105237_102650392 | 369 |
| 265 | 3300013296 | Ga0157374_10008297 | Ga0157374_100082978 | 369 |
| 266 | 3300013297 | Ga0157378_10375486 | Ga0157378_103754861 | 369 |
| 267 | 3300013307 | Ga0157372_10081152 | Ga0157372_100811522 | 369 |
| 268 | 3300025906 | Ga0207699_10026054 | Ga0207699_100260543 | 369 |
| 269 | 3300025913 | Ga0207695_10233319 | Ga0207695_102333191 | 369 |
| 270 | 3300025929 | Ga0207664_10104915 | Ga0207664_101049152 | 369 |
| 271 | 3300025933 | Ga0207706_10007856 | Ga0207706_100078569 | 369 |
| 272 | 3300025937 | Ga0207669_10139330 | Ga0207669_101393302 | 369 |
| 273 | 3300026023 | Ga0207677_10081437 | Ga0207677_100814372 | 369 |
| 274 | 3300026078 | Ga0207702_10095711 | Ga0207702_100957112 | 369 |
| 275 | 3300028794 | Ga0307515_10002885 | Ga0307515_100028859 | 369 |
| 276 | 3300031344 | Ga0265316_10000217 | Ga0265316_1000021752 | 369 |
| 277 | 3300032005 | Ga0307411_10212264 | Ga0307411_102122642 | 369 |
| 278 | 3300042120 | Ga0450917_000566 | Ga0450917_000566_927_2150 | 369 |
| 279 | 3300042126 | Ga0450888_000038 | Ga0450888_000038_3064_4287 | 369 |
| 280 | 3300042127 | Ga0450890_004930 | Ga0450890_004930_19_1242 | 369 |
| 281 | 3300042129 | Ga0450891_000454 | Ga0450891_000454_644_1867 | 369 |
| 282 | 3300042130 | Ga0450892_000749 | Ga0450892_000749_651_1874 | 369 |
| 283 | 3300042144 | Ga0450889_000272 | Ga0450889_000272_3986_5209 | 369 |
| 284 | 3300044735 | Ga0466968_0019130 | Ga0466968_0019130_992_2212 | 369 |
| 285 | 3300046519 | Ga0495632_0033623 | Ga0495632_0033623_363_1586 | 369 |
| 286 | 3300046680 | Ga0495646_0072592 | Ga0495646_0072592_183_1409 | 369 |
| 287 | 3300046681 | Ga0495647_0020866 | Ga0495647_0020866_349_1575 | 369 |
| 288 | 3300046683 | Ga0495658_0019055 | Ga0495658_0019055_1349_2575 | 369 |
| 289 | 3300048912 | Ga0496109_0189238 | Ga0496109_0189238_546_1763 | 369 |
| 290 | 3300048913 | Ga0496110_0023653 | Ga0496110_0023653_2204_3421 | 369 |
| 291 | 3300048924 | Ga0496121_0021945 | Ga0496121_0021945_4409_5638 | 369 |
| 292 | 3300049572 | Ga0501036_0007274 | Ga0501036_0007274_6949_8178 | 369 |
| 293 | 3300049575 | Ga0501039_0005901 | Ga0501039_0005901_5287_6516 | 369 |
| 294 | 3300049576 | Ga0501040_0002327 | Ga0501040_0002327_1212_2441 | 369 |
| 295 | 3300049577 | Ga0501041_0032740 | Ga0501041_0032740_749_1978 | 369 |
| 296 | 3300049580 | Ga0501046_0067714 | Ga0501046_0067714_664_1893 | 369 |
| 297 | 3300049587 | Ga0501071_0008395 | Ga0501071_0008395_3346_4575 | 369 |
| 298 | 3300049591 | Ga0501075_0002288 | Ga0501075_0002288_10942_12171 | 369 |
| 299 | 3300049592 | Ga0501076_0003282 | Ga0501076_0003282_7545_8774 | 369 |
| 300 | 3300049658 | Ga0501211_000169 | Ga0501211_000169_4035_5258 | 369 |
| 301 | 3300049663 | Ga0501223_006660 | Ga0501223_006660_1111_2334 | 369 |
| 302 | 3300049669 | Ga0501235_003241 | Ga0501235_003241_1759_2982 | 369 |
| 303 | 3300049683 | Ga0501253_002035 | Ga0501253_002035_577_1800 | 369 |
| 304 | 3300049687 | Ga0501258_001467 | Ga0501258_001467_323_1546 | 369 |
| 305 | 3300049741 | Ga0501079_0003524 | Ga0501079_0003524_6687_7916 | 369 |
| 306 | 3300049742 | Ga0501080_0008520 | Ga0501080_0008520_7023_8252 | 369 |
| 307 | 3300049743 | Ga0501081_0006056 | Ga0501081_0006056_3869_5098 | 369 |
| 308 | 3300049757 | Ga0501232_001577 | Ga0501232_001577_308_1531 | 369 |
| 309 | 3300049764 | Ga0501267_000195 | Ga0501267_000195_2392_3615 | 369 |
| 310 | 3300049822 | Ga0501035_0074677 | Ga0501035_0074677_1006_2235 | 369 |
| 311 | 3300050493 | nmdc:mga0k408_1099_c1 | nmdc:mga0k408_1099_c1_5058_6281 | 369 |
| 312 | 3300050493 | nmdc:mga0k408_2385_c2 | nmdc:mga0k408_2385_c2_4173_5396 | 369 |
| 313 | 3300050493 | nmdc:mga0k408_5093_c1 | nmdc:mga0k408_5093_c1_2564_3769 | 369 |
| 314 | 3300053086 | Ga0500578_0001060 | Ga0500578_0001060_10421_11644 | 369 |
| 315 | 3300053730 | Ga0500645_003758 | Ga0500645_003758_3255_4472 | 369 |
| 316 | 3300054114 | Ga0501084_0004224 | Ga0501084_0004224_10232_11461 | 369 |
| 317 | 3300061734 | Ga0530510_0001033 | Ga0530510_0001033_5783_7012 | 369 |
| 318 | 3300003794 | Ga0055531_10000500 | Ga0055531_1000050034 | 370 |
| 319 | 3300005328 | Ga0070676_10006078 | Ga0070676_100060784 | 370 |
| 320 | 3300005330 | Ga0070690_100111163 | Ga0070690_1001111632 | 370 |
| 321 | 3300005335 | Ga0070666_10012271 | Ga0070666_100122713 | 370 |
| 322 | 3300005338 | Ga0068868_100019660 | Ga0068868_1000196606 | 370 |
| 323 | 3300005354 | Ga0070675_100000596 | Ga0070675_10000059613 | 370 |
| 324 | 3300005364 | Ga0070673_100004498 | Ga0070673_1000044987 | 370 |
| 325 | 3300005457 | Ga0070662_100118071 | Ga0070662_1001180712 | 370 |
| 326 | 3300005459 | Ga0068867_100030261 | Ga0068867_1000302614 | 370 |
| 327 | 3300005459 | Ga0068867_100090647 | Ga0068867_1000906472 | 370 |
| 328 | 3300005543 | Ga0070672_100016993 | Ga0070672_1000169936 | 370 |
| 329 | 3300005616 | Ga0068852_100067076 | Ga0068852_1000670762 | 370 |
| 330 | 3300005617 | Ga0068859_100030751 | Ga0068859_1000307512 | 370 |
| 331 | 3300005618 | Ga0068864_100000334 | Ga0068864_10000033415 | 370 |
| 332 | 3300005841 | Ga0068863_100001360 | Ga0068863_1000013605 | 370 |
| 333 | 3300005842 | Ga0068858_100001418 | Ga0068858_1000014189 | 370 |
| 334 | 3300006177 | Ga0075362_10005103 | Ga0075362_100051032 | 370 |
| 335 | 3300006195 | Ga0075366_10026442 | Ga0075366_100264423 | 370 |
| 336 | 3300006195 | Ga0075366_10133459 | Ga0075366_101334591 | 370 |
| 337 | 3300006353 | Ga0075370_10005371 | Ga0075370_100053713 | 370 |
| 338 | 3300006358 | Ga0068871_100049893 | Ga0068871_1000498932 | 370 |
| 339 | 3300006931 | Ga0097620_100030751 | Ga0097620_1000307516 | 370 |
| 340 | 3300009098 | Ga0105245_10243820 | Ga0105245_102438202 | 370 |
| 341 | 3300009148 | Ga0105243_10084620 | Ga0105243_100846202 | 370 |
| 342 | 3300009545 | Ga0105237_10029811 | Ga0105237_100298112 | 370 |
| 343 | 3300009551 | Ga0105238_10016263 | Ga0105238_100162638 | 370 |
| 344 | 3300013296 | Ga0157374_10180994 | Ga0157374_101809942 | 370 |
| 345 | 3300013307 | Ga0157372_10080852 | Ga0157372_100808522 | 370 |
| 346 | 3300014325 | Ga0163163_10004207 | Ga0163163_100042072 | 370 |
| 347 | 3300025304 | Ga0209257_1000131 | Ga0209257_10001316 | 370 |
| 348 | 3300025903 | Ga0207680_10003642 | Ga0207680_100036426 | 370 |
| 349 | 3300025907 | Ga0207645_10009688 | Ga0207645_100096882 | 370 |
| 350 | 3300025926 | Ga0207659_10000320 | Ga0207659_100003209 | 370 |
| 351 | 3300025933 | Ga0207706_10064488 | Ga0207706_100644883 | 370 |
| 352 | 3300025935 | Ga0207709_10068392 | Ga0207709_100683922 | 370 |
| 353 | 3300025940 | Ga0207691_10003014 | Ga0207691_100030142 | 370 |
| 354 | 3300025941 | Ga0207711_10013367 | Ga0207711_100133673 | 370 |
| 355 | 3300025960 | Ga0207651_10000288 | Ga0207651_100002889 | 370 |
| 356 | 3300025961 | Ga0207712_10098149 | Ga0207712_100981492 | 370 |
| 357 | 3300025986 | Ga0207658_10002018 | Ga0207658_100020189 | 370 |
| 358 | 3300026023 | Ga0207677_10090360 | Ga0207677_100903602 | 370 |
| 359 | 3300026035 | Ga0207703_10001527 | Ga0207703_1000152711 | 370 |
| 360 | 3300026088 | Ga0207641_10001785 | Ga0207641_1000178510 | 370 |
| 361 | 3300026089 | Ga0207648_10006990 | Ga0207648_100069907 | 370 |
| 362 | 3300026089 | Ga0207648_10020382 | Ga0207648_100203822 | 370 |
| 363 | 3300026095 | Ga0207676_10000211 | Ga0207676_1000021136 | 370 |
| 364 | 3300027614 | Ga0209970_1000052 | Ga0209970_10000528 | 370 |
| 365 | 3300027876 | Ga0209974_10022749 | Ga0209974_100227492 | 370 |
| 366 | 3300028794 | Ga0307515_10000062 | Ga0307515_1000006284 | 370 |
| 367 | 3300028794 | Ga0307515_10014391 | Ga0307515_100143914 | 370 |
| 368 | 3300031456 | Ga0307513_10002745 | Ga0307513_1000274521 | 370 |
| 369 | 3300031507 | Ga0307509_10013544 | Ga0307509_100135444 | 370 |
| 370 | 3300031507 | Ga0307509_10116595 | Ga0307509_101165952 | 370 |
| 371 | 3300033179 | Ga0307507_10091114 | Ga0307507_100911143 | 370 |
| 372 | 3300035086 | Ga0373934_0047653 | Ga0373934_0047653_423_1631 | 370 |
| 373 | 3300037312 | Ga0395899_0037827 | Ga0395899_0037827_217_1425 | 370 |
| 374 | 3300037466 | Ga0395898_0000880 | Ga0395898_0000880_40618_41838 | 370 |
| 375 | 3300037466 | Ga0395898_0012451 | Ga0395898_0012451_2803_4011 | 370 |
| 376 | 3300037471 | Ga0395905_0000151 | Ga0395905_0000151_33124_34347 | 370 |
| 377 | 3300038443 | Ga0395901_0001368 | Ga0395901_0001368_18196_19404 | 370 |
| 378 | 3300042008 | Ga0439450_002180 | Ga0439450_002180_871_2094 | 370 |
| 379 | 3300042435 | Ga0439434_0002500 | Ga0439434_0002500_553_1782 | 370 |
| 380 | 3300042439 | Ga0439464_0000115 | Ga0439464_0000115_6646_7869 | 370 |
| 381 | 3300044656 | Ga0466969_0022986 | Ga0466969_0022986_1541_2764 | 370 |
| 382 | 3300044656 | Ga0466969_0059150 | Ga0466969_0059150_602_1813 | 370 |
| 383 | 3300044684 | Ga0466966_0005386 | Ga0466966_0005386_5934_7157 | 370 |
| 384 | 3300044684 | Ga0466966_0006083 | Ga0466966_0006083_1260_2471 | 370 |
| 385 | 3300044693 | Ga0466961_0002340 | Ga0466961_0002340_1100_2323 | 370 |
| 386 | 3300044693 | Ga0466961_0087499 | Ga0466961_0087499_202_1413 | 370 |
| 387 | 3300044694 | Ga0466963_0006900 | Ga0466963_0006900_5143_6366 | 370 |
| 388 | 3300044694 | Ga0466963_0132303 | Ga0466963_0132303_103_1311 | 370 |
| 389 | 3300044706 | Ga0466964_0002210 | Ga0466964_0002210_5215_6426 | 370 |
| 390 | 3300044706 | Ga0466964_0005549 | Ga0466964_0005549_215_1438 | 370 |
| 391 | 3300044712 | Ga0453684_0296868 | Ga0453684_0296868_338_1570 | 370 |
| 392 | 3300044719 | Ga0466971_0009997 | Ga0466971_0009997_1673_2884 | 370 |
| 393 | 3300044719 | Ga0466971_0035059 | Ga0466971_0035059_481_1704 | 370 |
| 394 | 3300044765 | Ga0466970_0047285 | Ga0466970_0047285_406_1617 | 370 |
| 395 | 3300044765 | Ga0466970_0053682 | Ga0466970_0053682_292_1515 | 370 |
| 396 | 3300044842 | Ga0466957_0001869 | Ga0466957_0001869_1985_3196 | 370 |
| 397 | 3300045049 | Ga0466959_0000192 | Ga0466959_0000192_12185_13408 | 370 |
| 398 | 3300045049 | Ga0466959_0001900 | Ga0466959_0001900_6046_7257 | 370 |
| 399 | 3300045051 | Ga0451576_0005708 | Ga0451576_0005708_1550_2773 | 370 |
| 400 | 3300045836 | Ga0466958_0099407 | Ga0466958_0099407_464_1687 | 370 |
| 401 | 3300045976 | Ga0466967_0058942 | Ga0466967_0058942_392_1615 | 370 |
| 402 | 3300046462 | Ga0495651_0071139 | Ga0495651_0071139_525_1733 | 370 |
| 403 | 3300046506 | Ga0495583_0001389 | Ga0495583_0001389_4950_6161 | 370 |
| 404 | 3300046507 | Ga0495606_0002457 | Ga0495606_0002457_15699_16910 | 370 |
| 405 | 3300046507 | Ga0495606_0132686 | Ga0495606_0132686_149_1369 | 370 |
| 406 | 3300046542 | Ga0495597_0001155 | Ga0495597_0001155_11199_12407 | 370 |
| 407 | 3300046616 | Ga0495668_0034249 | Ga0495668_0034249_113_1324 | 370 |
| 408 | 3300046660 | Ga0495625_0008201 | Ga0495625_0008201_5453_6664 | 370 |
| 409 | 3300046684 | Ga0495669_0014353 | Ga0495669_0014353_1301_2512 | 370 |
| 410 | 3300046694 | Ga0495649_0002836 | Ga0495649_0002836_4655_5866 | 370 |
| 411 | 3300046794 | Ga0495589_0002215 | Ga0495589_0002215_5720_6931 | 370 |
| 412 | 3300047323 | Ga0495683_0022972 | Ga0495683_0022972_186_1397 | 370 |
| 413 | 3300047469 | Ga0495673_0056313 | Ga0495673_0056313_391_1611 | 370 |
| 414 | 3300048909 | Ga0496106_0098522 | Ga0496106_0098522_548_1768 | 370 |
| 415 | 3300050493 | nmdc:mga0k408_143880_c1 | nmdc:mga0k408_143880_c1_98_1321 | 370 |
| 416 | 3300050493 | nmdc:mga0k408_24236_c1 | nmdc:mga0k408_24236_c1_196_1419 | 370 |
| 417 | 3300050493 | nmdc:mga0k408_29676_c1 | nmdc:mga0k408_29676_c1_1437_2657 | 370 |
| 418 | 3300050496 | nmdc:mga07m45_136_c1 | nmdc:mga07m45_136_c1_13692_14900 | 370 |
| 419 | 3300050496 | nmdc:mga07m45_4448_c1 | nmdc:mga07m45_4448_c1_3890_5113 | 370 |
| 420 | 3300053080 | Ga0500635_0000210 | Ga0500635_0000210_22672_23880 | 370 |
| 421 | 3300053136 | Ga0500559_0004852 | Ga0500559_0004852_2748_3956 | 370 |
| 422 | 3300053139 | Ga0500568_0003790 | Ga0500568_0003790_5942_7189 | 370 |
| 423 | 3300053139 | Ga0500568_0008380 | Ga0500568_0008380_757_1977 | 370 |
| 424 | 3300053177 | Ga0500636_0009748 | Ga0500636_0009748_3544_4755 | 370 |
| 425 | 3300061719 | Ga0466962_0013216 | Ga0466962_0013216_2285_3496 | 370 |
| 426 | 3300061719 | Ga0466962_0013706 | Ga0466962_0013706_2059_3282 | 370 |
| 427 | iso_pu_bacteria | 2643221544 | 2643743065 | 370 |
| 428 | iso_pu_bacteria | 2643221639 | 2644218518 | 370 |
| 429 | iso_pu_bacteria | 2643221644 | 2644244717 | 370 |
| 430 | iso_pu_bacteria | 2643221646 | 2644260413 | 370 |
| 431 | iso_pu_bacteria | 2643221654 | 2644301269 | 370 |
| 432 | iso_pu_bacteria | 2738541337 | 2739055926 | 370 |
| 433 | iso_pu_bacteria | 2842718218 | 2842718709 | 370 |
| 434 | iso_pu_bacteria | 2894023352 | 2894024321 | 370 |
| 435 | 3300003162 | Ga0006778J45830_1017384 | Ga0006778J45830_10173844 | 371 |
| 436 | 3300003759 | Ga0055525_1000004 | Ga0055525_1000004192 | 371 |
| 437 | 3300005455 | Ga0070663_100000518 | Ga0070663_10000051810 | 371 |
| 438 | 3300005459 | Ga0068867_100000020 | Ga0068867_10000002056 | 371 |
| 439 | 3300005539 | Ga0068853_100054521 | Ga0068853_1000545214 | 371 |
| 440 | 3300005616 | Ga0068852_100023487 | Ga0068852_1000234872 | 371 |
| 441 | 3300005616 | Ga0068852_100152543 | Ga0068852_1001525431 | 371 |
| 442 | 3300009148 | Ga0105243_10001054 | Ga0105243_100010542 | 371 |
| 443 | 3300014745 | Ga0157377_10000032 | Ga0157377_1000003237 | 371 |
| 444 | 3300014968 | Ga0157379_10140653 | Ga0157379_101406532 | 371 |
| 445 | 3300021361 | Ga0213872_10000104 | Ga0213872_1000010430 | 371 |
| 446 | 3300025230 | Ga0209563_100013 | Ga0209563_100013192 | 371 |
| 447 | 3300025935 | Ga0207709_10000641 | Ga0207709_100006412 | 371 |
| 448 | 3300026067 | Ga0207678_10000837 | Ga0207678_1000083713 | 371 |
| 449 | 3300026089 | Ga0207648_10000172 | Ga0207648_1000017233 | 371 |
| 450 | 3300026142 | Ga0207698_10007606 | Ga0207698_100076067 | 371 |
| 451 | 3300026142 | Ga0207698_10173629 | Ga0207698_101736292 | 371 |
| 452 | 3300031507 | Ga0307509_10068367 | Ga0307509_100683672 | 371 |
| 453 | 3300031548 | Ga0307408_100083420 | Ga0307408_1000834202 | 371 |
| 454 | 3300031730 | Ga0307516_10000237 | Ga0307516_100002374 | 371 |
| 455 | 3300031731 | Ga0307405_10083139 | Ga0307405_100831392 | 371 |
| 456 | 3300035114 | Ga0373939_0000049 | Ga0373939_0000049_37707_38930 | 371 |
| 457 | 3300035691 | Ga0373931_0000092 | Ga0373931_0000092_39786_41009 | 371 |
| 458 | 3300037418 | Ga0395900_0000253 | Ga0395900_0000253_53135_54355 | 371 |
| 459 | 3300039447 | Ga0436361_0378401 | Ga0436361_0378401_1294_2514 | 371 |
| 460 | 3300041997 | Ga0439431_0001298 | Ga0439431_0001298_3489_4709 | 371 |
| 461 | 3300044712 | Ga0453684_0070482 | Ga0453684_0070482_1179_2399 | 371 |
| 462 | 3300049521 | Ga0501298_010618 | Ga0501298_010618_23_1246 | 371 |
| 463 | 3300049568 | Ga0501031_0081555 | Ga0501031_0081555_181_1398 | 371 |
| 464 | 3300049762 | Ga0501265_000929 | Ga0501265_000929_40_1263 | 371 |
| 465 | 3300053079 | Ga0500610_0003177 | Ga0500610_0003177_3191_4420 | 371 |
| 466 | 3300053117 | Ga0500593_000472 | Ga0500593_000472_10754_11983 | 371 |
| 467 | 3300053161 | Ga0500634_0012693 | Ga0500634_0012693_1024_2253 | 371 |
| 468 | iso_pu_bacteria | 2585428057 | 2587725333 | 371 |
| 469 | iso_pu_bacteria | 2585428058 | 2587731308 | 371 |
| 470 | iso_pu_bacteria | 2585428062 | 2587754066 | 371 |
| 471 | iso_pu_bacteria | 2588253510 | 2588290064 | 371 |
| 472 | iso_pu_bacteria | 2643221570 | 2643867756 | 371 |
| 473 | iso_pu_bacteria | 2643221585 | 2643932910 | 371 |
| 474 | iso_pu_bacteria | 2643221592 | 2643972784 | 371 |
| 475 | iso_pu_bacteria | 2643221609 | 2644062210 | 371 |
| 476 | iso_pu_bacteria | 2643221625 | 2644143369 | 371 |
| 477 | iso_pu_bacteria | 2643221648 | 2644276194 | 371 |
| 478 | iso_pu_bacteria | 2643221656 | 2644314160 | 371 |
| 479 | iso_pu_bacteria | 2643221660 | 2644340876 | 371 |
| 480 | iso_pu_bacteria | 2831864461 | 2831864648 | 371 |
| 481 | iso_pu_bacteria | 2886848708 | 2886852212 | 371 |
| 482 | iso_pu_bacteria | 2990710928 | 2990713934 | 371 |
| 483 | 3300005334 | Ga0068869_100002210 | Ga0068869_1000022108 | 372 |
| 484 | 3300005338 | Ga0068868_100001584 | Ga0068868_1000015848 | 372 |
| 485 | 3300005339 | Ga0070660_100038637 | Ga0070660_1000386374 | 372 |
| 486 | 3300005354 | Ga0070675_100003464 | Ga0070675_1000034648 | 372 |
| 487 | 3300005354 | Ga0070675_100088502 | Ga0070675_1000885022 | 372 |
| 488 | 3300005354 | Ga0070675_100113830 | Ga0070675_1001138302 | 372 |
| 489 | 3300005355 | Ga0070671_100021310 | Ga0070671_1000213102 | 372 |
| 490 | 3300005355 | Ga0070671_100244503 | Ga0070671_1002445031 | 372 |
| 491 | 3300005356 | Ga0070674_100095397 | Ga0070674_1000953972 | 372 |
| 492 | 3300005364 | Ga0070673_100256766 | Ga0070673_1002567662 | 372 |
| 493 | 3300005366 | Ga0070659_100006742 | Ga0070659_1000067422 | 372 |
| 494 | 3300005455 | Ga0070663_100014328 | Ga0070663_1000143287 | 372 |
| 495 | 3300005457 | Ga0070662_100000321 | Ga0070662_1000003212 | 372 |
| 496 | 3300005458 | Ga0070681_10020347 | Ga0070681_100203478 | 372 |
| 497 | 3300005530 | Ga0070679_100000726 | Ga0070679_10000072613 | 372 |
| 498 | 3300005539 | Ga0068853_100240990 | Ga0068853_1002409902 | 372 |
| 499 | 3300005543 | Ga0070672_100162201 | Ga0070672_1001622012 | 372 |
| 500 | 3300005548 | Ga0070665_100008338 | Ga0070665_1000083387 | 372 |
| 501 | 3300005578 | Ga0068854_100054800 | Ga0068854_1000548002 | 372 |
| 502 | 3300005616 | Ga0068852_100025824 | Ga0068852_1000258247 | 372 |
| 503 | 3300005617 | Ga0068859_100277212 | Ga0068859_1002772122 | 372 |
| 504 | 3300005618 | Ga0068864_100014003 | Ga0068864_1000140038 | 372 |
| 505 | 3300005719 | Ga0068861_100029493 | Ga0068861_1000294932 | 372 |
| 506 | 3300005834 | Ga0068851_10026998 | Ga0068851_100269983 | 372 |
| 507 | 3300005840 | Ga0068870_10092667 | Ga0068870_100926671 | 372 |
| 508 | 3300005842 | Ga0068858_100004761 | Ga0068858_1000047618 | 372 |
| 509 | 3300005843 | Ga0068860_100010883 | Ga0068860_1000108838 | 372 |
| 510 | 3300006353 | Ga0075370_10022925 | Ga0075370_100229251 | 372 |
| 511 | 3300006358 | Ga0068871_100030612 | Ga0068871_1000306124 | 372 |
| 512 | 3300006846 | Ga0075430_100030680 | Ga0075430_1000306806 | 372 |
| 513 | 3300006871 | Ga0075434_100254555 | Ga0075434_1002545552 | 372 |
| 514 | 3300006931 | Ga0097620_100277213 | Ga0097620_1002772132 | 372 |
| 515 | 3300009177 | Ga0105248_10008801 | Ga0105248_100088014 | 372 |
| 516 | 3300009177 | Ga0105248_10033741 | Ga0105248_100337417 | 372 |
| 517 | 3300013102 | Ga0157371_10049902 | Ga0157371_100499023 | 372 |
| 518 | 3300013296 | Ga0157374_10019867 | Ga0157374_100198672 | 372 |
| 519 | 3300013296 | Ga0157374_10309122 | Ga0157374_103091222 | 372 |
| 520 | 3300013306 | Ga0163162_10095213 | Ga0163162_100952132 | 372 |
| 521 | 3300017792 | Ga0163161_10018630 | Ga0163161_100186306 | 372 |
| 522 | 3300021384 | Ga0213876_10039904 | Ga0213876_100399043 | 372 |
| 523 | 3300025253 | Ga0209677_102491 | Ga0209677_1024913 | 372 |
| 524 | 3300025304 | Ga0209257_1019929 | Ga0209257_10199292 | 372 |
| 525 | 3300025321 | Ga0207656_10008962 | Ga0207656_100089622 | 372 |
| 526 | 3300025912 | Ga0207707_10055208 | Ga0207707_100552082 | 372 |
| 527 | 3300025918 | Ga0207662_10019082 | Ga0207662_100190822 | 372 |
| 528 | 3300025919 | Ga0207657_10063349 | Ga0207657_100633491 | 372 |
| 529 | 3300025921 | Ga0207652_10002099 | Ga0207652_100020992 | 372 |
| 530 | 3300025923 | Ga0207681_10086408 | Ga0207681_100864082 | 372 |
| 531 | 3300025924 | Ga0207694_10168735 | Ga0207694_101687352 | 372 |
| 532 | 3300025925 | Ga0207650_10236481 | Ga0207650_102364811 | 372 |
| 533 | 3300025926 | Ga0207659_10003450 | Ga0207659_100034508 | 372 |
| 534 | 3300025931 | Ga0207644_10001550 | Ga0207644_1000155017 | 372 |
| 535 | 3300025931 | Ga0207644_10057557 | Ga0207644_100575572 | 372 |
| 536 | 3300025932 | Ga0207690_10004656 | Ga0207690_100046564 | 372 |
| 537 | 3300025932 | Ga0207690_10128606 | Ga0207690_101286062 | 372 |
| 538 | 3300025933 | Ga0207706_10003929 | Ga0207706_100039297 | 372 |
| 539 | 3300025940 | Ga0207691_10093883 | Ga0207691_100938832 | 372 |
| 540 | 3300025941 | Ga0207711_10040439 | Ga0207711_100404394 | 372 |
| 541 | 3300025942 | Ga0207689_10000709 | Ga0207689_1000070929 | 372 |
| 542 | 3300025944 | Ga0207661_10018007 | Ga0207661_100180072 | 372 |
| 543 | 3300025945 | Ga0207679_10151457 | Ga0207679_101514572 | 372 |
| 544 | 3300025945 | Ga0207679_10158916 | Ga0207679_101589162 | 372 |
| 545 | 3300025949 | Ga0207667_10041642 | Ga0207667_100416425 | 372 |
| 546 | 3300026023 | Ga0207677_10005663 | Ga0207677_100056634 | 372 |
| 547 | 3300026035 | Ga0207703_10056732 | Ga0207703_100567324 | 372 |
| 548 | 3300026078 | Ga0207702_10071683 | Ga0207702_100716832 | 372 |
| 549 | 3300026089 | Ga0207648_10078353 | Ga0207648_100783533 | 372 |
| 550 | 3300026095 | Ga0207676_10057097 | Ga0207676_100570972 | 372 |
| 551 | 3300026116 | Ga0207674_10017562 | Ga0207674_100175629 | 372 |
| 552 | 3300026118 | Ga0207675_100000563 | Ga0207675_1000005639 | 372 |
| 553 | 3300026121 | Ga0207683_10081152 | Ga0207683_100811522 | 372 |
| 554 | 3300026142 | Ga0207698_10023324 | Ga0207698_100233243 | 372 |
| 555 | 3300026142 | Ga0207698_10203183 | Ga0207698_102031832 | 372 |
| 556 | 3300028379 | Ga0268266_10012086 | Ga0268266_100120867 | 372 |
| 557 | 3300028381 | Ga0268264_10039871 | Ga0268264_100398712 | 372 |
| 558 | 3300028794 | Ga0307515_10011216 | Ga0307515_100112169 | 372 |
| 559 | 3300031251 | Ga0265327_10004357 | Ga0265327_100043577 | 372 |
| 560 | 3300031665 | Ga0316575_10000446 | Ga0316575_100004464 | 372 |
| 561 | 3300031691 | Ga0316579_10000450 | Ga0316579_1000045013 | 372 |
| 562 | 3300031728 | Ga0316578_10002134 | Ga0316578_100021342 | 372 |
| 563 | 3300031730 | Ga0307516_10078944 | Ga0307516_100789442 | 372 |
| 564 | 3300031995 | Ga0307409_100077536 | Ga0307409_1000775362 | 372 |
| 565 | 3300032133 | Ga0316583_10013533 | Ga0316583_100135332 | 372 |
| 566 | 3300035118 | Ga0373954_0000065 | Ga0373954_0000065_3351_4574 | 372 |
| 567 | 3300035691 | Ga0373931_0018707 | Ga0373931_0018707_935_2161 | 372 |
| 568 | 3300035725 | Ga0373947_0017704 | Ga0373947_0017704_150_1373 | 372 |
| 569 | 3300036401 | Ga0373937_0000149 | Ga0373937_0000149_23790_25013 | 372 |
| 570 | 3300037471 | Ga0395905_0000483 | Ga0395905_0000483_12563_13780 | 372 |
| 571 | 3300037471 | Ga0395905_0029065 | Ga0395905_0029065_718_1941 | 372 |
| 572 | 3300039437 | Ga0436365_1030021 | Ga0436365_1030021_426_1652 | 372 |
| 573 | 3300039447 | Ga0436361_0369035 | Ga0436361_0369035_654_1874 | 372 |
| 574 | 3300042876 | Ga0451577_0002525 | Ga0451577_0002525_2124_3344 | 372 |
| 575 | 3300042876 | Ga0451577_0003205 | Ga0451577_0003205_12381_13601 | 372 |
| 576 | 3300046472 | Ga0495580_0171128 | Ga0495580_0171128_213_1436 | 372 |
| 577 | 3300046539 | Ga0495621_0050246 | Ga0495621_0050246_88_1311 | 372 |
| 578 | 3300046543 | Ga0495645_0101203 | Ga0495645_0101203_757_1980 | 372 |
| 579 | 3300046615 | Ga0495656_0000090 | Ga0495656_0000090_12671_13894 | 372 |
| 580 | 3300048903 | Ga0496100_0043631 | Ga0496100_0043631_644_1870 | 372 |
| 581 | 3300048909 | Ga0496106_0014093 | Ga0496106_0014093_944_2170 | 372 |
| 582 | 3300048910 | Ga0496107_0001400 | Ga0496107_0001400_8866_10092 | 372 |
| 583 | 3300048911 | Ga0496108_0072570 | Ga0496108_0072570_1041_2267 | 372 |
| 584 | 3300048918 | Ga0496115_0049866 | Ga0496115_0049866_833_2059 | 372 |
| 585 | 3300048924 | Ga0496121_0007189 | Ga0496121_0007189_5646_6863 | 372 |
| 586 | 3300049575 | Ga0501039_0039487 | Ga0501039_0039487_1934_3154 | 372 |
| 587 | 3300049588 | Ga0501072_0053253 | Ga0501072_0053253_607_1827 | 372 |
| 588 | 3300049662 | Ga0501222_003695 | Ga0501222_003695_47_1267 | 372 |
| 589 | 3300050493 | nmdc:mga0k408_103692_c1 | nmdc:mga0k408_103692_c1_246_1469 | 372 |
| 590 | 3300050496 | nmdc:mga07m45_9539_c1 | nmdc:mga07m45_9539_c1_1957_3180 | 372 |
| 591 | 3300050507 | nmdc:mga05p37_51575_c1 | nmdc:mga05p37_51575_c1_1353_2576 | 372 |
| 592 | 3300050511 | nmdc:mga08y16_297876_c1 | nmdc:mga08y16_297876_c1_393_1619 | 372 |
| 593 | 3300050512 | nmdc:mga0n895_81799_c1 | nmdc:mga0n895_81799_c1_1511_2737 | 372 |
| 594 | 3300053156 | Ga0500622_0014200 | Ga0500622_0014200_1104_2327 | 372 |
| 595 | 3300002705 | JGI25156J39149_1001576 | JGI25156J39149_10015767 | 373 |
| 596 | 3300002705 | JGI25156J39149_1011117 | JGI25156J39149_10111172 | 373 |
| 597 | 3300002738 | JGI25154J39366_1001005 | JGI25154J39366_10010058 | 373 |
| 598 | 3300002741 | JGI25157J39369_1000161 | JGI25157J39369_100016120 | 373 |
| 599 | 3300003752 | Ga0055539_1000819 | Ga0055539_10008198 | 373 |
| 600 | 3300003752 | Ga0055539_1001622 | Ga0055539_10016222 | 373 |
| 601 | 3300003756 | Ga0055533_1000016 | Ga0055533_100001620 | 373 |
| 602 | 3300003759 | Ga0055525_1000579 | Ga0055525_100057914 | 373 |
| 603 | 3300003761 | Ga0055535_1000165 | Ga0055535_100016530 | 373 |
| 604 | 3300003763 | Ga0055529_1000214 | Ga0055529_100021418 | 373 |
| 605 | 3300003763 | Ga0055529_1000405 | Ga0055529_10004059 | 373 |
| 606 | 3300003771 | Ga0055526_1002203 | Ga0055526_100220310 | 373 |
| 607 | 3300005262 | Ga0065165_1000684 | Ga0065165_100068424 | 373 |
| 608 | 3300005295 | Ga0065707_10082503 | Ga0065707_100825038 | 373 |
| 609 | 3300005327 | Ga0070658_10014951 | Ga0070658_100149516 | 373 |
| 610 | 3300005327 | Ga0070658_10019373 | Ga0070658_100193732 | 373 |
| 611 | 3300005327 | Ga0070658_10054588 | Ga0070658_100545883 | 373 |
| 612 | 3300005328 | Ga0070676_10009675 | Ga0070676_100096752 | 373 |
| 613 | 3300005330 | Ga0070690_100004971 | Ga0070690_1000049716 | 373 |
| 614 | 3300005334 | Ga0068869_100020143 | Ga0068869_1000201434 | 373 |
| 615 | 3300005339 | Ga0070660_100167864 | Ga0070660_1001678641 | 373 |
| 616 | 3300005356 | Ga0070674_100004331 | Ga0070674_1000043314 | 373 |
| 617 | 3300005364 | Ga0070673_100169486 | Ga0070673_1001694861 | 373 |
| 618 | 3300005459 | Ga0068867_100021134 | Ga0068867_1000211343 | 373 |
| 619 | 3300005539 | Ga0068853_100209625 | Ga0068853_1002096252 | 373 |
| 620 | 3300005563 | Ga0068855_100019854 | Ga0068855_1000198549 | 373 |
| 621 | 3300005563 | Ga0068855_100237808 | Ga0068855_1002378082 | 373 |
| 622 | 3300005577 | Ga0068857_100012908 | Ga0068857_1000129086 | 373 |
| 623 | 3300005578 | Ga0068854_100014737 | Ga0068854_1000147374 | 373 |
| 624 | 3300005614 | Ga0068856_100001351 | Ga0068856_10000135112 | 373 |
| 625 | 3300005616 | Ga0068852_100061831 | Ga0068852_1000618311 | 373 |
| 626 | 3300005617 | Ga0068859_100221010 | Ga0068859_1002210102 | 373 |
| 627 | 3300005834 | Ga0068851_10035671 | Ga0068851_100356712 | 373 |
| 628 | 3300005844 | Ga0068862_100053277 | Ga0068862_1000532772 | 373 |
| 629 | 3300006195 | Ga0075366_10010045 | Ga0075366_100100455 | 373 |
| 630 | 3300006195 | Ga0075366_10030762 | Ga0075366_100307623 | 373 |
| 631 | 3300006353 | Ga0075370_10000523 | Ga0075370_100005235 | 373 |
| 632 | 3300006353 | Ga0075370_10004682 | Ga0075370_100046822 | 373 |
| 633 | 3300006931 | Ga0097620_100221016 | Ga0097620_1002210162 | 373 |
| 634 | 3300009148 | Ga0105243_10024023 | Ga0105243_100240234 | 373 |
| 635 | 3300013297 | Ga0157378_10008827 | Ga0157378_100088278 | 373 |
| 636 | 3300025226 | Ga0209674_100041 | Ga0209674_100041362 | 373 |
| 637 | 3300025228 | Ga0209672_104321 | Ga0209672_1043212 | 373 |
| 638 | 3300025230 | Ga0209563_100043 | Ga0209563_100043362 | 373 |
| 639 | 3300025231 | Ga0207427_100381 | Ga0207427_10038113 | 373 |
| 640 | 3300025242 | Ga0209258_100270 | Ga0209258_10027031 | 373 |
| 641 | 3300025242 | Ga0209258_100659 | Ga0209258_10065911 | 373 |
| 642 | 3300025246 | Ga0209646_1000157 | Ga0209646_100015758 | 373 |
| 643 | 3300025250 | Ga0209026_1000006 | Ga0209026_100000620 | 373 |
| 644 | 3300025253 | Ga0209677_100711 | Ga0209677_10071115 | 373 |
| 645 | 3300025253 | Ga0209677_101037 | Ga0209677_1010372 | 373 |
| 646 | 3300025256 | Ga0209759_1000194 | Ga0209759_100019475 | 373 |
| 647 | 3300025256 | Ga0209759_1000424 | Ga0209759_100042430 | 373 |
| 648 | 3300025256 | Ga0209759_1000691 | Ga0209759_10006917 | 373 |
| 649 | 3300025256 | Ga0209759_1002749 | Ga0209759_10027496 | 373 |
| 650 | 3300025272 | Ga0209455_1000195 | Ga0209455_100019548 | 373 |
| 651 | 3300025273 | Ga0209673_1002759 | Ga0209673_100275910 | 373 |
| 652 | 3300025295 | Ga0209564_1000008 | Ga0209564_1000008279 | 373 |
| 653 | 3300025907 | Ga0207645_10002553 | Ga0207645_1000255312 | 373 |
| 654 | 3300025909 | Ga0207705_10011535 | Ga0207705_100115356 | 373 |
| 655 | 3300025909 | Ga0207705_10036505 | Ga0207705_100365052 | 373 |
| 656 | 3300025913 | Ga0207695_10149780 | Ga0207695_101497802 | 373 |
| 657 | 3300025924 | Ga0207694_10030708 | Ga0207694_100307081 | 373 |
| 658 | 3300025932 | Ga0207690_10035692 | Ga0207690_100356922 | 373 |
| 659 | 3300025932 | Ga0207690_10074416 | Ga0207690_100744163 | 373 |
| 660 | 3300025937 | Ga0207669_10078651 | Ga0207669_100786512 | 373 |
| 661 | 3300025942 | Ga0207689_10017725 | Ga0207689_100177256 | 373 |
| 662 | 3300025949 | Ga0207667_10059070 | Ga0207667_100590704 | 373 |
| 663 | 3300025960 | Ga0207651_10004392 | Ga0207651_100043928 | 373 |
| 664 | 3300026041 | Ga0207639_10028218 | Ga0207639_100282182 | 373 |
| 665 | 3300026078 | Ga0207702_10014223 | Ga0207702_100142232 | 373 |
| 666 | 3300026089 | Ga0207648_10009203 | Ga0207648_100092033 | 373 |
| 667 | 3300028380 | Ga0268265_10021176 | Ga0268265_100211764 | 373 |
| 668 | 3300028380 | Ga0268265_10073523 | Ga0268265_100735232 | 373 |
| 669 | 3300028666 | Ga0265336_10000189 | Ga0265336_1000018919 | 373 |
| 670 | 3300029957 | Ga0265324_10000255 | Ga0265324_1000025515 | 373 |
| 671 | 3300031548 | Ga0307408_100041905 | Ga0307408_1000419052 | 373 |
| 672 | 3300031649 | Ga0307514_10000522 | Ga0307514_1000052260 | 373 |
| 673 | 3300031730 | Ga0307516_10029700 | Ga0307516_100297006 | 373 |
| 674 | 3300031731 | Ga0307405_10019313 | Ga0307405_100193134 | 373 |
| 675 | 3300031852 | Ga0307410_10006646 | Ga0307410_100066463 | 373 |
| 676 | 3300031901 | Ga0307406_10008142 | Ga0307406_100081422 | 373 |
| 677 | 3300031911 | Ga0307412_10205631 | Ga0307412_102056311 | 373 |
| 678 | 3300031995 | Ga0307409_100004843 | Ga0307409_1000048434 | 373 |
| 679 | 3300032002 | Ga0307416_100013538 | Ga0307416_1000135385 | 373 |
| 680 | 3300032005 | Ga0307411_10057114 | Ga0307411_100571142 | 373 |
| 681 | 3300035691 | Ga0373931_0000552 | Ga0373931_0000552_13381_14601 | 373 |
| 682 | 3300037471 | Ga0395905_0013148 | Ga0395905_0013148_6416_7633 | 373 |
| 683 | 3300037471 | Ga0395905_0052487 | Ga0395905_0052487_1519_2739 | 373 |
| 684 | 3300037471 | Ga0395905_0171267 | Ga0395905_0171267_464_1690 | 373 |
| 685 | 3300042012 | Ga0439455_0010812 | Ga0439455_0010812_207_1427 | 373 |
| 686 | 3300042135 | Ga0450899_003418 | Ga0450899_003418_74_1291 | 373 |
| 687 | 3300044673 | Ga0453683_0060822 | Ga0453683_0060822_1020_2255 | 373 |
| 688 | 3300046471 | Ga0495650_0006757 | Ga0495650_0006757_3915_5132 | 373 |
| 689 | 3300046558 | Ga0495633_0000563 | Ga0495633_0000563_12093_13313 | 373 |
| 690 | 3300047472 | Ga0495686_0024407 | Ga0495686_0024407_796_2016 | 373 |
| 691 | 3300048927 | Ga0496124_0000458 | Ga0496124_0000458_45442_46671 | 373 |
| 692 | 3300048927 | Ga0496124_0050046 | Ga0496124_0050046_1256_2476 | 373 |
| 693 | 3300048928 | Ga0496125_0023944 | Ga0496125_0023944_122_1351 | 373 |
| 694 | 3300049575 | Ga0501039_0208340 | Ga0501039_0208340_87_1316 | 373 |
| 695 | 3300049824 | Ga0501045_0029699 | Ga0501045_0029699_58_1287 | 373 |
| 696 | 3300050493 | nmdc:mga0k408_1168_c1 | nmdc:mga0k408_1168_c1_3254_4474 | 373 |
| 697 | 3300050493 | nmdc:mga0k408_56699_c1 | nmdc:mga0k408_56699_c1_312_1532 | 373 |
| 698 | 3300050496 | nmdc:mga07m45_18170_c1 | nmdc:mga07m45_18170_c1_23_1258 | 373 |
| 699 | 2162886007 | SwRhRL2b_contig_2612269 | SwRhRL2b_0809.00007680 | 374 |
| 700 | 3300003322 | rootL2_10008162 | rootL2_1000816210 | 374 |
| 701 | 3300003323 | rootH1_10008605 | rootH1_100086052 | 374 |
| 702 | 3300003775 | Ga0055524_1003058 | Ga0055524_10030589 | 374 |
| 703 | 3300003775 | Ga0055524_1007833 | Ga0055524_10078332 | 374 |
| 704 | 3300003794 | Ga0055531_10007794 | Ga0055531_100077947 | 374 |
| 705 | 3300003794 | Ga0055531_10009798 | Ga0055531_100097982 | 374 |
| 706 | 3300004625 | Ga0055543_1002676 | Ga0055543_10026762 | 374 |
| 707 | 3300005262 | Ga0065165_1000290 | Ga0065165_10002909 | 374 |
| 708 | 3300005289 | Ga0065704_10075751 | Ga0065704_100757515 | 374 |
| 709 | 3300005290 | Ga0065712_10074677 | Ga0065712_100746773 | 374 |
| 710 | 3300005293 | Ga0065715_10091140 | Ga0065715_100911405 | 374 |
| 711 | 3300005331 | Ga0070670_100001440 | Ga0070670_10000144012 | 374 |
| 712 | 3300005347 | Ga0070668_100060188 | Ga0070668_1000601882 | 374 |
| 713 | 3300005353 | Ga0070669_100013295 | Ga0070669_1000132952 | 374 |
| 714 | 3300005354 | Ga0070675_100000897 | Ga0070675_10000089721 | 374 |
| 715 | 3300005355 | Ga0070671_100016897 | Ga0070671_1000168977 | 374 |
| 716 | 3300005356 | Ga0070674_100001095 | Ga0070674_10000109515 | 374 |
| 717 | 3300005356 | Ga0070674_100124483 | Ga0070674_1001244832 | 374 |
| 718 | 3300005364 | Ga0070673_100188200 | Ga0070673_1001882001 | 374 |
| 719 | 3300005367 | Ga0070667_100033941 | Ga0070667_1000339414 | 374 |
| 720 | 3300005367 | Ga0070667_100074671 | Ga0070667_1000746712 | 374 |
| 721 | 3300005456 | Ga0070678_100003986 | Ga0070678_1000039864 | 374 |
| 722 | 3300005457 | Ga0070662_100033616 | Ga0070662_1000336162 | 374 |
| 723 | 3300005459 | Ga0068867_100000345 | Ga0068867_1000003452 | 374 |
| 724 | 3300005459 | Ga0068867_100004939 | Ga0068867_10000493910 | 374 |
| 725 | 3300005543 | Ga0070672_100002357 | Ga0070672_1000023572 | 374 |
| 726 | 3300005543 | Ga0070672_100052383 | Ga0070672_1000523832 | 374 |
| 727 | 3300005564 | Ga0070664_100080251 | Ga0070664_1000802512 | 374 |
| 728 | 3300005617 | Ga0068859_100068165 | Ga0068859_1000681652 | 374 |
| 729 | 3300005618 | Ga0068864_100077961 | Ga0068864_1000779613 | 374 |
| 730 | 3300005718 | Ga0068866_10007309 | Ga0068866_100073096 | 374 |
| 731 | 3300005719 | Ga0068861_100006327 | Ga0068861_1000063272 | 374 |
| 732 | 3300005840 | Ga0068870_10087375 | Ga0068870_100873752 | 374 |
| 733 | 3300005841 | Ga0068863_100047246 | Ga0068863_1000472463 | 374 |
| 734 | 3300005843 | Ga0068860_100010504 | Ga0068860_1000105044 | 374 |
| 735 | 3300005844 | Ga0068862_100015539 | Ga0068862_1000155392 | 374 |
| 736 | 3300006195 | Ga0075366_10025491 | Ga0075366_100254912 | 374 |
| 737 | 3300006195 | Ga0075366_10035927 | Ga0075366_100359272 | 374 |
| 738 | 3300006353 | Ga0075370_10002323 | Ga0075370_100023237 | 374 |
| 739 | 3300006881 | Ga0068865_100062199 | Ga0068865_1000621992 | 374 |
| 740 | 3300006931 | Ga0097620_100068166 | Ga0097620_1000681662 | 374 |
| 741 | 3300006944 | Ga0099823_1000122 | Ga0099823_10001222 | 374 |
| 742 | 3300009148 | Ga0105243_10139220 | Ga0105243_101392201 | 374 |
| 743 | 3300009176 | Ga0105242_10005718 | Ga0105242_100057188 | 374 |
| 744 | 3300009553 | Ga0105249_10039696 | Ga0105249_100396963 | 374 |
| 745 | 3300009553 | Ga0105249_10113183 | Ga0105249_101131832 | 374 |
| 746 | 3300012497 | Ga0157319_1000005 | Ga0157319_1000005333 | 374 |
| 747 | 3300013297 | Ga0157378_10017312 | Ga0157378_100173122 | 374 |
| 748 | 3300013306 | Ga0163162_10001398 | Ga0163162_1000139810 | 374 |
| 749 | 3300013306 | Ga0163162_10033463 | Ga0163162_100334635 | 374 |
| 750 | 3300013308 | Ga0157375_10008199 | Ga0157375_100081995 | 374 |
| 751 | 3300014326 | Ga0157380_10017607 | Ga0157380_100176072 | 374 |
| 752 | 3300014969 | Ga0157376_10027064 | Ga0157376_100270642 | 374 |
| 753 | 3300017792 | Ga0163161_10042745 | Ga0163161_100427452 | 374 |
| 754 | 3300025273 | Ga0209673_1009600 | Ga0209673_10096003 | 374 |
| 755 | 3300025273 | Ga0209673_1020356 | Ga0209673_10203562 | 374 |
| 756 | 3300025298 | Ga0209050_1001940 | Ga0209050_100194014 | 374 |
| 757 | 3300025299 | Ga0209256_1002459 | Ga0209256_10024596 | 374 |
| 758 | 3300025299 | Ga0209256_1003797 | Ga0209256_10037974 | 374 |
| 759 | 3300025303 | Ga0209051_1002503 | Ga0209051_10025032 | 374 |
| 760 | 3300025304 | Ga0209257_1002950 | Ga0209257_10029507 | 374 |
| 761 | 3300025304 | Ga0209257_1008508 | Ga0209257_10085082 | 374 |
| 762 | 3300025907 | Ga0207645_10033716 | Ga0207645_100337163 | 374 |
| 763 | 3300025923 | Ga0207681_10016795 | Ga0207681_100167952 | 374 |
| 764 | 3300025925 | Ga0207650_10003695 | Ga0207650_100036954 | 374 |
| 765 | 3300025926 | Ga0207659_10000393 | Ga0207659_1000039321 | 374 |
| 766 | 3300025931 | Ga0207644_10000523 | Ga0207644_100005232 | 374 |
| 767 | 3300025934 | Ga0207686_10004376 | Ga0207686_100043762 | 374 |
| 768 | 3300025938 | Ga0207704_10001183 | Ga0207704_100011838 | 374 |
| 769 | 3300025940 | Ga0207691_10001174 | Ga0207691_1000117412 | 374 |
| 770 | 3300025940 | Ga0207691_10068627 | Ga0207691_100686273 | 374 |
| 771 | 3300025945 | Ga0207679_10016849 | Ga0207679_100168492 | 374 |
| 772 | 3300025960 | Ga0207651_10067546 | Ga0207651_100675462 | 374 |
| 773 | 3300025961 | Ga0207712_10041004 | Ga0207712_100410042 | 374 |
| 774 | 3300025961 | Ga0207712_10043840 | Ga0207712_100438402 | 374 |
| 775 | 3300026088 | Ga0207641_10093049 | Ga0207641_100930492 | 374 |
| 776 | 3300026089 | Ga0207648_10001516 | Ga0207648_1000151610 | 374 |
| 777 | 3300026089 | Ga0207648_10001958 | Ga0207648_100019584 | 374 |
| 778 | 3300026118 | Ga0207675_100021908 | Ga0207675_1000219082 | 374 |
| 779 | 3300026121 | Ga0207683_10002977 | Ga0207683_1000297714 | 374 |
| 780 | 3300027296 | Ga0209389_1000372 | Ga0209389_100037224 | 374 |
| 781 | 3300027876 | Ga0209974_10002936 | Ga0209974_100029366 | 374 |
| 782 | 3300028380 | Ga0268265_10010386 | Ga0268265_100103862 | 374 |
| 783 | 3300028381 | Ga0268264_10029170 | Ga0268264_100291705 | 374 |
| 784 | 3300031235 | Ga0265330_10000091 | Ga0265330_100000916 | 374 |
| 785 | 3300031238 | Ga0265332_10000028 | Ga0265332_10000028116 | 374 |
| 786 | 3300031241 | Ga0265325_10002488 | Ga0265325_1000248812 | 374 |
| 787 | 3300031548 | Ga0307408_100000557 | Ga0307408_10000055736 | 374 |
| 788 | 3300031711 | Ga0265314_10000054 | Ga0265314_10000054116 | 374 |
| 789 | 3300031901 | Ga0307406_10004659 | Ga0307406_100046595 | 374 |
| 790 | 3300042438 | Ga0439459_0009766 | Ga0439459_0009766_340_1578 | 374 |
| 791 | 3300046535 | Ga0495586_0039823 | Ga0495586_0039823_514_1743 | 374 |
| 792 | 3300048927 | Ga0496124_0005813 | Ga0496124_0005813_6708_7943 | 374 |
| 793 | 3300050493 | nmdc:mga0k408_31829_c1 | nmdc:mga0k408_31829_c1_1032_2261 | 374 |
| 794 | 3300053156 | Ga0500622_0001196 | Ga0500622_0001196_947_2182 | 374 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5nbg-assembly1.cif.gz_B | structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system | 0.9712 | 63 | 168 |
| 2whn-assembly2.cif.gz_B | n-terminal domain from the pilc type iv pilus biogenesis protein | 0.9695 | 61 | 162 |
| 2vmb-assembly2.cif.gz_B | the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae | 0.968 | 62 | 170 |
| 3c1q-assembly1.cif.gz_A | the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae | 0.9655 | 63 | 168 |
| 2vma-assembly1.cif.gz_A | the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae | 0.9571 | 63 | 174 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P36646_1_51_3.10.20.10 | Alpha Beta;Roll;Ubiquitin-like (UB roll); | 0.9814 | 11 | 55 | 3.10.20.10 |
| 2whnB00 | Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F | 0.9695 | 61 | 162 | 1.20.81.30 |
| af_P36646_249_359_1.20.81.30 | Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F | 0.9471 | 229 | 336 | 1.20.81.30 |
| af_P41441_261_365_1.20.81.30 | Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F | 0.9464 | 240 | 338 | 1.20.81.30 |
| af_P36646_52_165_1.20.81.30 | Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F | 0.9425 | 64 | 173 | 1.20.81.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Z9PV31-F1-model_v4 | Type II secretion system protein GspF domain-containing protein | 0.9514 | 62 | 158 |
GO:0005886
|
| AF-A0A7X7NEB4-F1-model_v4 | Type II secretion system F family protein | 0.9256 | 199 | 369 |
GO:0005886
GO:0015628 |
| AF-A0A7R8ZZ00-F1-model_v4 | Uncharacterized protein | 0.9062 | 216 | 356 |
GO:0005886
|
| AF-R9IRW6-F1-model_v4 | Type II secretion system protein GspF domain-containing protein | 0.8966 | 228 | 373 |
GO:0005886
GO:0015628 |
| AF-A0A2V6RTL4-F1-model_v4 | Type II secretion system protein GspF domain-containing protein | 0.8908 | 198 | 373 |
GO:0005886
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar