F481111

General Info

Members Datasets Scaffolds Average Seq Length
794 495 656 506

Family's Representative Sequence

Representative Sequence 3300046557|Ga0495622_0014150|Ga0495622_0014150_15_1388
Length 457
Sequence MRSLPGNTGIGQVRYPTAGSASSEEEAQPFYVNAPFGIILAHNGNLTNWQQLKDEMFRIDRRHINTNSDTEVMLNVLAHEVHTASTGLQLDPAAMFKAVTGVHRRVRGSYAIVSLISGYGLLGFRDPFGIRPLCIGKLETASGTEWMLASESVALEGIGFEFVRDVAPGEAIFIDFEGNFHAQQCAPNASLNPCIFELVYLARPDSVLDGVPVYNARLRMGDYLAEKILRVLPDDVKIDVVMPIPDSSRPAAMQVAAKLGVEYREGFFKNRYVGRTFIMPGQAVRKKSVRQKLNAMGIEFKGKTVLIVDDSIVRGTTSHEIVQMARDAGASKVIFASAAPPVKFPNVYGIDMPTRSELVAHGRSDEDVARLIGADFLVYQDVDALKNAIRDINPALKEFEASCFDGNYITGDVTTEYLDRIETARLAPSAQSDRDAASDAMDGGAARSQLHLQLSVE

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
10 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
11 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
12 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
13 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
14 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
15 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
16 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
17 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
18 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
19 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
20 2519103095 Burkholderia sp. KJ006 Isolate Nodule
21 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
22 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
23 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
24 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
25 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
26 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
27 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
28 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
29 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
30 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
31 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
32 2643221569 Achromobacter sp. Root565 Isolate Unclassified
33 2643221594 Achromobacter sp. Root170 Isolate Unclassified
34 2643221621 Achromobacter sp. Root83 Isolate Unclassified
35 2643221660 Methylibium sp. Root1272 Isolate Unclassified
36 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
37 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
38 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
39 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
40 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
41 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
42 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
43 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
44 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
45 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
46 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
47 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
48 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
49 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
50 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
51 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
52 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
53 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
54 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
55 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
56 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
57 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
58 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
59 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
60 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
61 2818991450 Burkholderia sp. 604 Isolate Unclassified
62 2818991452 Burkholderia cepacia 561 Isolate Unclassified
63 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
64 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
65 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
66 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
67 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
68 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
69 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
70 2855730933 Achromobacter sp. HZ28 Isolate Nodule
71 2855767633 Achromobacter sp. HZ34 Isolate Nodule
72 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
73 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
74 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
75 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
76 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
77 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
78 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
79 2858950400 Achromobacter sp. K91 Isolate Unclassified
80 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
81 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
82 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
83 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
84 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
85 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
86 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
87 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
88 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
89 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
90 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
91 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
92 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
93 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
94 2904564687 Burkholderia sp. 571 Isolate Unclassified
95 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
96 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
97 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
98 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
99 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
100 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
101 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
102 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
103 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
104 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
105 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
106 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
107 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
108 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
109 2928163908 Burkholderia sp. 567 Isolate Unclassified
110 2928170801 Burkholderia sp. 572 Isolate Unclassified
111 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
112 2928536128 Burkholderia sola 565 Isolate Unclassified
113 2941479691
114 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
115 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
116 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
117 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
118 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
119 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
120 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
121 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
122 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
123 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
124 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
125 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
126 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
127 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
128 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
129 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
130 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
131 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
132 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
133 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
134 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
135 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
136 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
137 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
138 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
139 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
140 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
141 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
142 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
143 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
144 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
145 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
146 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
147 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
148 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
149 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
150 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
151 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
152 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
153 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
154 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
155 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
156 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
157 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
158 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
159 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
160 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
161 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
162 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
163 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
164 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
165 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
166 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
167 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
168 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
169 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
170 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
171 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
172 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
173 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
174 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
175 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
176 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
177 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
178 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
179 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
180 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
181 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
182 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
183 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
184 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
185 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
186 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
187 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
188 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
189 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
190 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
191 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
192 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
193 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
194 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
195 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
196 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
197 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
198 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
199 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
200 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
201 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
202 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
203 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
204 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
205 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
206 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
207 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
208 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
209 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
210 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
211 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
212 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
213 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
214 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
215 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
216 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
217 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
218 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
219 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
220 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
221 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
222 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
223 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
224 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
225 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
226 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
227 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
234 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
236 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
237 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
240 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
241 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
242 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
244 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
245 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
246 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
247 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
248 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
250 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
251 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
298 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
299 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
300 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
301 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
302 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
303 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
306 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
307 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
308 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
309 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
310 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
311 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
312 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
313 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
314 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
315 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
316 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
317 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
318 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
319 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
320 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
321 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
322 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
323 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
324 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
325 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
326 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
327 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
328 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
329 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
330 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
331 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
332 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
333 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
334 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
335 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
336 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
337 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
338 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
339 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
340 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
341 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
342 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
343 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
344 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
345 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
346 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
347 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
348 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
349 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
350 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
351 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
352 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
353 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
354 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
355 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
356 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
357 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
358 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
359 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
360 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
361 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
362 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
363 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
364 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
365 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
366 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
367 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
368 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
369 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
370 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
371 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
372 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
373 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
374 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
375 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
376 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
377 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
378 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
379 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
380 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
381 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
382 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
383 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
384 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
385 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
386 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
387 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
388 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
389 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
390 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
391 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
392 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
393 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
394 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
395 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
396 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
397 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
398 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
399 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
400 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
401 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
402 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
403 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
404 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
405 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
406 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
407 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
408 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
409 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
410 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
411 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
412 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
413 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
414 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
415 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
416 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
417 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
418 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
419 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
420 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
421 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
422 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
423 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
424 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
425 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
426 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
427 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
428 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
429 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
430 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
431 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
432 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
433 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
434 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
435 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
436 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
437 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
438 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
439 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
440 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
441 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
442 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
443 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
444 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
445 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
446 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
447 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
448 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
449 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
450 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
451 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
452 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
453 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
454 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
455 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
456 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
458 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
459 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
461 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
462 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
463 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
464 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
465 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
466 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
467 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
468 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
469 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
470 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
471 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
472 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
473 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
474 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
475 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
476 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
477 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
478 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
479 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
480 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
481 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
482 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
483 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
484 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
485 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
486 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
487 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
488 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
489 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
490 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
491 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
492 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
493 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
494 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
495 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.49
Metatranscriptomes 0.13
Isolates 17.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.71
Nodule 3.53
Rhizoplane 3.9
Rhizosphere 67.51
Stem 0
Stem Tuber 0
Unclassified 14.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002596 3300001979 Bacteria 8146
2 JGI24740J21852_10016560 3300001979 Bacteria 2660
3 JGI24739J22299_10001146 3300001989 Bacteria 9894
4 JGI24739J22299_10008475 3300001989 Bacteria 3838
5 JGI24735J21928_10004922 3300002067 Bacteria 4454
6 JGI24738J21930_10000246 3300002075 Bacteria 14746
7 JGI25155J39150_1000443 3300002704 Bacteria 10800
8 JGI25155J39150_1000986 3300002704 Bacteria 3297
9 JGI25156J39149_1000701 3300002705 Bacteria 17867
10 JGI25156J39149_1004386 3300002705 Bacteria 4312
11 JGI25154J39366_1001059 3300002738 Bacteria 10891
12 JGI25154J39366_1001069 3300002738 Bacteria 10800
13 JGI25157J39369_1000206 3300002741 Bacteria 49227
14 JGI25151J46595_10000817 3300003187 Bacteria 24798
15 JGI25151J46595_10007162 3300003187 Bacteria 5497
16 JGI25165J46597_1001354 3300003214 Bacteria 13645
17 rootH2_10055217 3300003320 Bacteria 5804
18 JGI25160J50197_1000124 3300003354 Bacteria 69999
19 Ga0055538_1000054 3300003751 Bacteria 123566
20 Ga0055539_1000066 3300003752 Bacteria 136557
21 Ga0055533_1000076 3300003756 Bacteria 136557
22 Ga0055532_1000069 3300003758 Bacteria 138614
23 Ga0055532_1000097 3300003758 Bacteria 98781
24 Ga0055525_1000098 3300003759 Bacteria 136557
25 Ga0055527_1000034 3300003760 Bacteria 138614
26 Ga0055527_1002447 3300003760 Bacteria 3144
27 Ga0055527_1003152 3300003760 Bacteria 2534
28 Ga0055535_1000049 3300003761 Bacteria 138835
29 Ga0055535_1004424 3300003761 Bacteria 3419
30 Ga0055542_1000077 3300003762 Bacteria 138614
31 Ga0055542_1002875 3300003762 Bacteria 5112
32 Ga0055529_1000090 3300003763 Bacteria 138416
33 Ga0055529_1002530 3300003763 Bacteria 3477
34 Ga0055529_1002811 3300003763 Bacteria 3149
35 Ga0055537_1003621 3300003773 Bacteria 4692
36 Ga0055524_1002454 3300003775 Bacteria 9533
37 Ga0055536_1000087 3300003781 Bacteria 79591
38 Ga0055534_1004694 3300003784 Bacteria 3871
39 Ga0055534_1006299 3300003784 Bacteria 3008
40 Ga0055528_1000692 3300003790 Bacteria 24069
41 Ga0055541_1000056 3300003841 Bacteria 123566
42 Ga0065165_1000637 3300005262 Bacteria 50736
43 Ga0065712_10121624 3300005290 Bacteria 1662
44 Ga0065715_10131633 3300005293 Bacteria 2004
45 Ga0070658_10001459 3300005327 Bacteria 20146
46 Ga0070683_100017464 3300005329 Bacteria 6342
47 Ga0070666_10056883 3300005335 Bacteria 2642
48 Ga0070682_100051488 3300005337 Bacteria 2573
49 Ga0068868_100157558 3300005338 Bacteria 1873
50 Ga0070660_100000520 3300005339 Bacteria 25694
51 Ga0070660_100004784 3300005339 Bacteria 9361
52 Ga0070674_100001058 3300005356 Bacteria 14389
53 Ga0070673_100012268 3300005364 Bacteria 5877
54 Ga0070688_100001476 3300005365 Bacteria 11687
55 Ga0070659_100000072 3300005366 Bacteria 79387
56 Ga0070659_100011757 3300005366 Bacteria 6479
57 Ga0070659_100107147 3300005366 Bacteria 2253
58 Ga0070667_100061177 3300005367 Bacteria 3188
59 Ga0070714_100046810 3300005435 Bacteria 3671
60 Ga0070713_100000049 3300005436 Bacteria 74072
61 Ga0070713_100020002 3300005436 Bacteria 5124
62 Ga0070710_10013168 3300005437 Bacteria 4133
63 Ga0070711_100005372 3300005439 Bacteria 7662
64 Ga0070694_100095951 3300005444 Bacteria 2089
65 Ga0070708_100078202 3300005445 Bacteria 2990
66 Ga0070663_100015671 3300005455 Bacteria 4901
67 Ga0070663_100054750 3300005455 Bacteria 2853
68 Ga0070678_100004464 3300005456 Bacteria 7939
69 Ga0070678_100059370 3300005456 Bacteria 2811
70 Ga0068867_100136465 3300005459 Bacteria 1913
71 Ga0070706_100050123 3300005467 Bacteria 3853
72 Ga0070706_100089404 3300005467 Bacteria 2855
73 Ga0070706_100104435 3300005467 Bacteria 2635
74 Ga0070698_100025942 3300005471 Bacteria 6105
75 Ga0070698_100144730 3300005471 Bacteria 2327
76 Ga0070679_100121269 3300005530 Bacteria 2599
77 Ga0070684_100015567 3300005535 Bacteria 6199
78 Ga0070697_100005736 3300005536 Bacteria 9572
79 Ga0070697_100006228 3300005536 Bacteria 9239
80 Ga0068853_100160693 3300005539 Bacteria 2027
81 Ga0070696_100131067 3300005546 Bacteria 1824
82 Ga0070693_100074043 3300005547 Bacteria 2013
83 Ga0070665_100016607 3300005548 Bacteria 7378
84 Ga0070704_100011934 3300005549 Bacteria 5352
85 Ga0068855_100000821 3300005563 Bacteria 38427
86 Ga0068855_100013124 3300005563 Bacteria 9992
87 Ga0070664_100014348 3300005564 Bacteria 6460
88 Ga0068857_100065151 3300005577 Bacteria 3239
89 Ga0068854_100002366 3300005578 Bacteria 11627
90 Ga0068854_100005069 3300005578 Bacteria 8297
91 Ga0068854_100007690 3300005578 Bacteria 6890
92 Ga0070702_100056419 3300005615 Bacteria 2268
93 Ga0068859_100005320 3300005617 Bacteria 13086
94 Ga0068864_100009675 3300005618 Bacteria 7953
95 Ga0068866_10026222 3300005718 Bacteria 2749
96 Ga0068863_100012501 3300005841 Bacteria 8193
97 Ga0068858_100163218 3300005842 Bacteria 2098
98 Ga0075364_10000596 3300006051 Bacteria 18697
99 Ga0075364_10000694 3300006051 Bacteria 17598
100 Ga0070715_10038410 3300006163 Bacteria 1987
101 Ga0070712_100005143 3300006175 Bacteria 8097
102 Ga0070712_100145864 3300006175 Bacteria 1811
103 Ga0075366_10038872 3300006195 Bacteria 2811
104 Ga0097621_100190844 3300006237 Bacteria 1774
105 Ga0068871_100105244 3300006358 Bacteria 2367
106 Ga0075433_10020730 3300006852 Bacteria 5501
107 Ga0075434_100000054 3300006871 Bacteria 56191
108 Ga0075434_100001233 3300006871 Bacteria 21261
109 Ga0075436_100047780 3300006914 Bacteria 2952
110 Ga0097620_100005321 3300006931 Bacteria 13086
111 Ga0099826_10000015 3300006948 Bacteria 254837
112 Ga0075435_100000429 3300007076 Bacteria 25739
113 Ga0075435_100030199 3300007076 Bacteria 4259
114 Ga0105251_10000229 3300009011 Bacteria 56300
115 Ga0105240_10014632 3300009093 Bacteria 10706
116 Ga0105240_10084835 3300009093 Bacteria 3882
117 Ga0105245_10007193 3300009098 Bacteria 9752
118 Ga0105245_10048737 3300009098 Bacteria 3790
119 Ga0105247_10007989 3300009101 Bacteria 6464
120 Ga0105241_10002097 3300009174 Bacteria 15052
121 Ga0105241_10128725 3300009174 Bacteria 2047
122 Ga0105241_10150963 3300009174 Bacteria 1901
123 Ga0105242_10227438 3300009176 Bacteria 1670
124 Ga0105248_10175146 3300009177 Bacteria 2418
125 Ga0105237_10013930 3300009545 Bacteria 8414
126 Ga0105237_10026688 3300009545 Bacteria 5903
127 Ga0105238_10001204 3300009551 Bacteria 26075
128 Ga0105238_10026941 3300009551 Bacteria 5859
129 Ga0105238_10095315 3300009551 Bacteria 2963
130 Ga0105239_10005527 3300010375 Bacteria 14802
131 Ga0105239_10021865 3300010375 Bacteria 7051
132 Ga0157373_10004925 3300013100 Bacteria 10054
133 Ga0157371_10008808 3300013102 Bacteria 7993
134 Ga0157371_10041254 3300013102 Bacteria 3294
135 Ga0157370_10000515 3300013104 Bacteria 48256
136 Ga0157370_10003858 3300013104 Bacteria 17481
137 Ga0157370_10063190 3300013104 Bacteria 3509
138 Ga0157369_10000847 3300013105 Bacteria 39121
139 Ga0157369_10002528 3300013105 Bacteria 21860
140 Ga0157369_10010488 3300013105 Bacteria 10549
141 Ga0157369_10049957 3300013105 Bacteria 4531
142 Ga0157369_10142702 3300013105 Bacteria 2533
143 Ga0157374_10000081 3300013296 Bacteria 95406
144 Ga0157374_10112544 3300013296 Bacteria 2619
145 Ga0157378_10088572 3300013297 Bacteria 2809
146 Ga0163162_10006058 3300013306 Bacteria 11705
147 Ga0163162_10041381 3300013306 Bacteria 4610
148 Ga0157372_10001408 3300013307 Bacteria 25963
149 Ga0163163_10004197 3300014325 Bacteria 12275
150 Ga0157379_10032101 3300014968 Bacteria 4680
151 Ga0157376_10052457 3300014969 Bacteria 3391
152 Ga0157376_10074327 3300014969 Bacteria 2897
153 Ga0182007_10000599 3300015262 Bacteria 21100
154 Ga0182007_10018366 3300015262 Bacteria 2533
155 Ga0182005_1009595 3300015265 Bacteria 2810
156 Ga0183361_10029 3300016635 Bacteria 57317
157 Ga0213872_10000435 3300021361 Bacteria 34241
158 Ga0224712_10000001 3300022467 Bacteria 72814
159 Ga0209435_100040 3300025206 Bacteria 115475
160 Ga0209435_100659 3300025206 Bacteria 6143
161 Ga0209784_100002 3300025224 Bacteria 1753105
162 Ga0209566_100003 3300025225 Bacteria 1753105
163 Ga0209566_100361 3300025225 Bacteria 38145
164 Ga0209674_100004 3300025226 Bacteria 1753105
165 Ga0209674_100139 3300025226 Bacteria 110389
166 Ga0209674_100191 3300025226 Bacteria 66206
167 Ga0209674_100866 3300025226 Bacteria 9927
168 Ga0209672_100002 3300025228 Bacteria 1733325
169 Ga0209672_100015 3300025228 Bacteria 529352
170 Ga0209672_100050 3300025228 Bacteria 238103
171 Ga0209672_101329 3300025228 Bacteria 9413
172 Ga0209147_100003 3300025229 Bacteria 1733325
173 Ga0209147_100016 3300025229 Bacteria 527606
174 Ga0209147_100141 3300025229 Bacteria 115466
175 Ga0209147_102689 3300025229 Bacteria 4099
176 Ga0209563_100006 3300025230 Bacteria 1753105
177 Ga0209437_100229 3300025233 Bacteria 95900
178 Ga0209258_100026 3300025242 Bacteria 527606
179 Ga0209258_100077 3300025242 Bacteria 264510
180 Ga0209258_100346 3300025242 Bacteria 66811
181 Ga0209258_100590 3300025242 Bacteria 30015
182 Ga0209646_1000218 3300025246 Bacteria 62078
183 Ga0209646_1000235 3300025246 Bacteria 57627
184 Ga0209026_1000534 3300025250 Bacteria 26239
185 Ga0209026_1005395 3300025250 Bacteria 3454
186 Ga0209677_100003 3300025253 Bacteria 1753105
187 Ga0209677_107415 3300025253 Bacteria 2339
188 Ga0209148_1000006 3300025254 Bacteria 1733325
189 Ga0209148_1001067 3300025254 Bacteria 16758
190 Ga0209759_1000170 3300025256 Bacteria 110023
191 Ga0209759_1000225 3300025256 Bacteria 84464
192 Ga0209759_1000447 3300025256 Bacteria 47749
193 Ga0209759_1000528 3300025256 Bacteria 40580
194 Ga0209759_1000954 3300025256 Bacteria 20540
195 Ga0209759_1002856 3300025256 Bacteria 7284
196 Ga0209233_1000177 3300025261 Bacteria 141716
197 Ga0209565_1000635 3300025263 Bacteria 22863
198 Ga0209565_1005580 3300025263 Bacteria 3637
199 Ga0209455_1000140 3300025272 Bacteria 138610
200 Ga0209455_1000515 3300025272 Bacteria 27385
201 Ga0209455_1006972 3300025272 Bacteria 3261
202 Ga0209673_1000028 3300025273 Bacteria 358901
203 Ga0209675_1000892 3300025291 Bacteria 19171
204 Ga0209675_1000913 3300025291 Bacteria 18887
205 Ga0209676_1000012 3300025292 Bacteria 841431
206 Ga0209676_1003098 3300025292 Bacteria 10694
207 Ga0209025_1000018 3300025294 Bacteria 686898
208 Ga0209025_1000414 3300025294 Bacteria 85589
209 Ga0209025_1000542 3300025294 Bacteria 71039
210 Ga0209025_1000759 3300025294 Bacteria 53934
211 Ga0209564_1002062 3300025295 Bacteria 17292
212 Ga0209564_1002743 3300025295 Bacteria 13246
213 Ga0209564_1003018 3300025295 Bacteria 12027
214 Ga0209564_1003325 3300025295 Bacteria 11171
215 Ga0209564_1004112 3300025295 Bacteria 9148
216 Ga0209050_1007075 3300025298 Bacteria 6424
217 Ga0209256_1000572 3300025299 Bacteria 52594
218 Ga0207426_1000020 3300025302 Bacteria 558084
219 Ga0207656_10020282 3300025321 Bacteria 2640
220 Ga0207713_1000201 3300025735 Bacteria 82948
221 Ga0207692_10010382 3300025898 Bacteria 3923
222 Ga0207642_10002948 3300025899 Bacteria 5328
223 Ga0207680_10004468 3300025903 Bacteria 6636
224 Ga0207647_10000260 3300025904 Bacteria 43433
225 Ga0207647_10001426 3300025904 Bacteria 18317
226 Ga0207647_10014264 3300025904 Bacteria 5483
227 Ga0207647_10090016 3300025904 Bacteria 1831
228 Ga0207685_10019189 3300025905 Bacteria 2249
229 Ga0207699_10021878 3300025906 Bacteria 3455
230 Ga0207699_10060496 3300025906 Bacteria 2275
231 Ga0207705_10000385 3300025909 Bacteria 39464
232 Ga0207705_10076094 3300025909 Bacteria 2439
233 Ga0207684_10019953 3300025910 Bacteria 5728
234 Ga0207684_10119073 3300025910 Bacteria 2263
235 Ga0207707_10050298 3300025912 Bacteria 3631
236 Ga0207695_10010466 3300025913 Bacteria 11344
237 Ga0207695_10011254 3300025913 Bacteria 10849
238 Ga0207695_10016266 3300025913 Bacteria 8716
239 Ga0207695_10017010 3300025913 Bacteria 8484
240 Ga0207695_10032873 3300025913 Bacteria 5670
241 Ga0207671_10007892 3300025914 Bacteria 9137
242 Ga0207671_10017204 3300025914 Bacteria 5585
243 Ga0207693_10004538 3300025915 Bacteria 11723
244 Ga0207693_10031913 3300025915 Bacteria 4162
245 Ga0207663_10028620 3300025916 Bacteria 3263
246 Ga0207660_10008740 3300025917 Bacteria 6551
247 Ga0207657_10000119 3300025919 Bacteria 78609
248 Ga0207657_10000848 3300025919 Bacteria 32287
249 Ga0207657_10000938 3300025919 Bacteria 30847
250 Ga0207657_10003387 3300025919 Bacteria 17050
251 Ga0207649_10018322 3300025920 Bacteria 3979
252 Ga0207652_10024879 3300025921 Bacteria 4969
253 Ga0207652_10147588 3300025921 Bacteria 2105
254 Ga0207646_10051232 3300025922 Bacteria 3694
255 Ga0207694_10003665 3300025924 Bacteria 12151
256 Ga0207694_10038649 3300025924 Bacteria 3670
257 Ga0207694_10073606 3300025924 Bacteria 2673
258 Ga0207687_10003283 3300025927 Bacteria 10945
259 Ga0207687_10010145 3300025927 Bacteria 6160
260 Ga0207700_10000123 3300025928 Bacteria 45894
261 Ga0207700_10014289 3300025928 Bacteria 5197
262 Ga0207664_10041976 3300025929 Bacteria 3567
263 Ga0207644_10034402 3300025931 Bacteria 3545
264 Ga0207690_10000008 3300025932 Bacteria 366090
265 Ga0207686_10001864 3300025934 Bacteria 11712
266 Ga0207665_10020402 3300025939 Bacteria 4355
267 Ga0207711_10002829 3300025941 Bacteria 15246
268 Ga0207689_10043523 3300025942 Bacteria 3712
269 Ga0207661_10022469 3300025944 Bacteria 4752
270 Ga0207679_10018983 3300025945 Bacteria 4614
271 Ga0207667_10000112 3300025949 Bacteria 131462
272 Ga0207667_10001036 3300025949 Bacteria 35365
273 Ga0207667_10004873 3300025949 Bacteria 16391
274 Ga0207667_10007532 3300025949 Bacteria 13067
275 Ga0207667_10012896 3300025949 Bacteria 9603
276 Ga0207651_10001059 3300025960 Bacteria 12186
277 Ga0207651_10096787 3300025960 Bacteria 2178
278 Ga0207640_10028912 3300025981 Bacteria 3395
279 Ga0207640_10043009 3300025981 Bacteria 2884
280 Ga0207658_10048942 3300025986 Bacteria 3103
281 Ga0207677_10000186 3300026023 Bacteria 49949
282 Ga0207677_10014253 3300026023 Bacteria 4636
283 Ga0207703_10003780 3300026035 Bacteria 12583
284 Ga0207678_10005901 3300026067 Bacteria 10914
285 Ga0207702_10191046 3300026078 Bacteria 1892
286 Ga0207641_10007033 3300026088 Bacteria 9401
287 Ga0207648_10095433 3300026089 Bacteria 2601
288 Ga0207676_10000455 3300026095 Bacteria 34474
289 Ga0207674_10002813 3300026116 Bacteria 21656
290 Ga0207674_10006719 3300026116 Bacteria 13503
291 Ga0207674_10075534 3300026116 Bacteria 3379
292 Ga0207683_10000768 3300026121 Bacteria 29179
293 Ga0207698_10041221 3300026142 Bacteria 3438
294 Ga0209371_1000172 3300027312 Bacteria 96352
295 Ga0209371_1006474 3300027312 Bacteria 4329
296 Ga0210000_1000111 3300027462 Bacteria 11349
297 Ga0209999_1000362 3300027543 Bacteria 6892
298 Ga0209970_1003306 3300027614 Bacteria 2716
299 Ga0209282_1000033 3300027666 Bacteria 141940
300 Ga0209974_10002164 3300027876 Bacteria 7178
301 Ga0268266_10190719 3300028379 Bacteria 1871
302 Ga0268264_10005450 3300028381 Bacteria 10781
303 Ga0268264_10096476 3300028381 Bacteria 2561
304 Ga0265336_10000293 3300028666 Bacteria 34148
305 Ga0265338_10000120 3300028800 Bacteria 145451
306 Ga0265338_10003187 3300028800 Bacteria 23409
307 Ga0265324_10001505 3300029957 Bacteria 13181
308 Ga0268256_1000144 3300030500 Bacteria 96352
309 Ga0268256_1004605 3300030500 Bacteria 5656
310 Ga0265330_10001738 3300031235 Bacteria 12261
311 Ga0265325_10003555 3300031241 Bacteria 10116
312 Ga0265329_10001775 3300031242 Bacteria 10254
313 Ga0265331_10000810 3300031250 Bacteria 25854
314 Ga0265327_10003804 3300031251 Bacteria 13966
315 Ga0265327_10016285 3300031251 Bacteria 4732
316 Ga0265316_10012761 3300031344 Bacteria 7508
317 Ga0265316_10092332 3300031344 Bacteria 2308
318 Ga0265314_10026879 3300031711 Bacteria 4318
319 Ga0265342_10066681 3300031712 Bacteria 2108
320 Ga0307405_10033144 3300031731 Bacteria 3060
321 Ga0307413_10004493 3300031824 Bacteria 6078
322 Ga0307410_10002309 3300031852 Bacteria 9162
323 Ga0307406_10023899 3300031901 Bacteria 3643
324 Ga0307407_10000560 3300031903 Bacteria 11679
325 Ga0307412_10000064 3300031911 Bacteria 125607
326 Ga0307412_10000775 3300031911 Bacteria 18441
327 Ga0307412_10069039 3300031911 Bacteria 2405
328 Ga0307412_10074548 3300031911 Bacteria 2325
329 Ga0307409_100003151 3300031995 Bacteria 8866
330 Ga0307409_100003309 3300031995 Bacteria 8714
331 Ga0307416_100009923 3300032002 Bacteria 6265
332 Ga0307416_100012868 3300032002 Bacteria 5660
333 Ga0307416_100021834 3300032002 Bacteria 4606
334 Ga0307411_10002764 3300032005 Bacteria 7888
335 Ga0307415_100008237 3300032126 Bacteria 5768
336 Ga0373944_0022410 3300035089 Bacteria 1835
337 Ga0373923_0003740 3300035111 Bacteria 4934
338 Ga0373953_0004438 3300035117 Bacteria 4472
339 Ga0373953_0007991 3300035117 Bacteria 3572
340 Ga0373954_0000356 3300035118 Bacteria 16908
341 Ga0373956_0002862 3300035119 Bacteria 6986
342 Ga0373943_0057113 3300035170 Bacteria 1938
343 Ga0373955_0014859 3300035172 Bacteria 3799
344 Ga0373924_0008784 3300035410 Bacteria 3684
345 Ga0373927_0010296 3300035695 Bacteria 6244
346 Ga0373933_0015018 3300035724 Bacteria 4315
347 Ga0373947_0059729 3300035725 Bacteria 2312
348 Ga0373937_0000698 3300036401 Bacteria 29303
349 Ga0373937_0144817 3300036401 Bacteria 2224
350 Ga0395899_0000097 3300037312 Bacteria 152056
351 Ga0395899_0018716 3300037312 Bacteria 5263
352 Ga0395899_0073647 3300037312 Bacteria 2497
353 Ga0395899_0133360 3300037312 Bacteria 1772
354 Ga0395900_0000015 3300037418 Bacteria 384313
355 Ga0395900_0000395 3300037418 Bacteria 63065
356 Ga0395900_0018169 3300037418 Bacteria 7174
357 Ga0395900_0032795 3300037418 Bacteria 5342
358 Ga0395900_0116999 3300037418 Bacteria 2735
359 Ga0395900_0284746 3300037418 Bacteria 1643
360 Ga0395898_0000407 3300037466 Bacteria 93281
361 Ga0395898_0008219 3300037466 Bacteria 11035
362 Ga0395898_0017565 3300037466 Bacteria 7301
363 Ga0395898_0031397 3300037466 Bacteria 5307
364 Ga0395898_0060868 3300037466 Bacteria 3668
365 Ga0395898_0109926 3300037466 Bacteria 2642
366 Ga0395905_0000052 3300037471 Bacteria 215018
367 Ga0395905_0007912 3300037471 Bacteria 10515
368 Ga0395905_0019841 3300037471 Bacteria 6370
369 Ga0395901_0000034 3300038443 Bacteria 230365
370 Ga0395901_0000286 3300038443 Bacteria 62586
371 Ga0395901_0000749 3300038443 Bacteria 36580
372 Ga0395901_0005216 3300038443 Bacteria 13116
373 Ga0395901_0047689 3300038443 Bacteria 4447
374 Ga0436361_0215157 3300039447 Bacteria 166868
375 Ga0436361_0287674 3300039447 Bacteria 12176
376 Ga0436361_0462368 3300039447 Bacteria 6394
377 Ga0436361_0866712 3300039447 Bacteria 1642
378 Ga0439448_0000090 3300042005 Bacteria 16149
379 Ga0439460_0012908 3300042461 Bacteria 2177
380 Ga0451577_0015023 3300042876 Bacteria 7204
381 Ga0466969_0000058 3300044656 Bacteria 58556
382 Ga0466972_0000372 3300044658 Bacteria 24152
383 Ga0466966_0000056 3300044684 Bacteria 81439
384 Ga0466966_0001358 3300044684 Bacteria 15729
385 Ga0466966_0004514 3300044684 Bacteria 9184
386 Ga0466966_0091225 3300044684 Bacteria 1891
387 Ga0466961_0000651 3300044693 Bacteria 21862
388 Ga0466961_0001394 3300044693 Bacteria 14968
389 Ga0466961_0084198 3300044693 Bacteria 2011
390 Ga0466963_0010033 3300044694 Bacteria 5726
391 Ga0466971_0000153 3300044719 Bacteria 25681
392 Ga0466971_0016502 3300044719 Bacteria 3259
393 Ga0466970_0003101 3300044765 Bacteria 8063
394 Ga0466957_0001504 3300044842 Bacteria 12235
395 Ga0466957_0021153 3300044842 Bacteria 3831
396 Ga0466959_0005338 3300045049 Bacteria 8788
397 Ga0466959_0009834 3300045049 Bacteria 6814
398 Ga0466959_0014547 3300045049 Bacteria 5723
399 Ga0466959_0022928 3300045049 Bacteria 4615
400 Ga0466959_0065508 3300045049 Bacteria 2636
401 Ga0451576_0002583 3300045051 Bacteria 26652
402 Ga0466958_0002594 3300045836 Bacteria 9124
403 Ga0466958_0003108 3300045836 Bacteria 8527
404 Ga0466958_0019114 3300045836 Bacteria 3986
405 Ga0466958_0094502 3300045836 Bacteria 1852
406 Ga0466958_0124318 3300045836 Bacteria 1617
407 Ga0466967_0000948 3300045976 Bacteria 15662
408 Ga0466967_0171316 3300045976 Bacteria 2043
409 Ga0495592_0001574 3300046454 Bacteria 15941
410 Ga0495592_0009940 3300046454 Bacteria 7164
411 Ga0495603_0009381 3300046455 Bacteria 5913
412 Ga0495590_0000793 3300046457 Bacteria 14392
413 Ga0495590_0007602 3300046457 Bacteria 4167
414 Ga0495591_001444 3300046458 Bacteria 14751
415 Ga0495629_0000127 3300046459 Bacteria 66745
416 Ga0495629_0000603 3300046459 Bacteria 29262
417 Ga0495629_0005148 3300046459 Bacteria 9782
418 Ga0495629_0007698 3300046459 Bacteria 7926
419 Ga0495638_0008272 3300046460 Bacteria 7387
420 Ga0495651_0016250 3300046462 Bacteria 5764
421 Ga0495651_0017264 3300046462 Bacteria 5590
422 Ga0495651_0069926 3300046462 Bacteria 2672
423 Ga0495653_0012400 3300046463 Bacteria 6959
424 Ga0495653_0025135 3300046463 Bacteria 4790
425 Ga0495653_0048303 3300046463 Bacteria 3285
426 Ga0495650_0001004 3300046471 Bacteria 31821
427 Ga0495650_0010678 3300046471 Bacteria 5106
428 Ga0495650_0011780 3300046471 Bacteria 4754
429 Ga0495580_0000446 3300046472 Bacteria 34126
430 Ga0495580_0006193 3300046472 Bacteria 9783
431 Ga0495580_0006454 3300046472 Bacteria 9547
432 Ga0495580_0018687 3300046472 Bacteria 5158
433 Ga0495580_0076340 3300046472 Bacteria 2337
434 Ga0495582_0003454 3300046473 Bacteria 8906
435 Ga0495582_0007276 3300046473 Bacteria 6134
436 Ga0495582_0019282 3300046473 Bacteria 3730
437 Ga0495605_0000944 3300046474 Bacteria 19826
438 Ga0495605_0002148 3300046474 Bacteria 12329
439 Ga0495639_0010646 3300046475 Bacteria 3959
440 Ga0495662_0005145 3300046476 Bacteria 6556
441 Ga0495664_0001378 3300046477 Bacteria 12828
442 Ga0495664_0016362 3300046477 Bacteria 4223
443 Ga0495664_0049960 3300046477 Bacteria 2482
444 Ga0495584_0029159 3300046491 Bacteria 2797
445 Ga0495585_0020609 3300046492 Bacteria 3790
446 Ga0495596_0004771 3300046500 Bacteria 6524
447 Ga0495607_0000920 3300046501 Bacteria 27401
448 Ga0495607_0014638 3300046501 Bacteria 5100
449 Ga0495583_0009098 3300046506 Bacteria 5973
450 Ga0495606_0008796 3300046507 Bacteria 8668
451 Ga0495606_0018566 3300046507 Bacteria 5207
452 Ga0495606_0030524 3300046507 Bacteria 3765
453 Ga0495606_0043950 3300046507 Bacteria 2975
454 Ga0495608_0004348 3300046511 Bacteria 10150
455 Ga0495608_0007243 3300046511 Bacteria 7844
456 Ga0495608_0008287 3300046511 Bacteria 7297
457 Ga0495610_0011050 3300046512 Bacteria 5549
458 Ga0495616_0026345 3300046513 Bacteria 3096
459 Ga0495618_0002566 3300046514 Bacteria 11637
460 Ga0495618_0092069 3300046514 Bacteria 1938
461 Ga0495620_0006423 3300046515 Bacteria 6461
462 Ga0495628_0006996 3300046516 Bacteria 9783
463 Ga0495628_0019645 3300046516 Bacteria 5581
464 Ga0495628_0020514 3300046516 Bacteria 5448
465 Ga0495630_0008675 3300046517 Bacteria 7298
466 Ga0495630_0025632 3300046517 Bacteria 4362
467 Ga0495631_0013056 3300046518 Bacteria 4040
468 Ga0495643_0018390 3300046522 Bacteria 4063
469 Ga0495666_0002990 3300046526 Bacteria 8483
470 Ga0495666_0003686 3300046526 Bacteria 7740
471 Ga0495642_0003027 3300046528 Bacteria 6696
472 Ga0495642_0006836 3300046528 Bacteria 4373
473 Ga0495652_0025290 3300046529 Bacteria 5254
474 Ga0495652_0027133 3300046529 Bacteria 5048
475 Ga0495652_0041335 3300046529 Bacteria 3980
476 Ga0495665_0000847 3300046531 Bacteria 16030
477 Ga0495665_0010583 3300046531 Bacteria 4993
478 Ga0495640_0006605 3300046533 Bacteria 9150
479 Ga0495640_0008055 3300046533 Bacteria 8279
480 Ga0495640_0015844 3300046533 Bacteria 5657
481 Ga0495640_0093499 3300046533 Bacteria 1981
482 Ga0495586_0006070 3300046535 Bacteria 6458
483 Ga0495586_0006153 3300046535 Bacteria 6416
484 Ga0495586_0050474 3300046535 Bacteria 2251
485 Ga0495587_0041775 3300046536 Bacteria 2735
486 Ga0495645_0005494 3300046543 Bacteria 8710
487 Ga0495645_0010213 3300046543 Bacteria 6576
488 Ga0495645_0056773 3300046543 Bacteria 2843
489 Ga0495622_0000569 3300046557 Bacteria 22171
490 Ga0495622_0014150 3300046557 Bacteria 3704
491 Ga0495622_0054335 3300046557 Bacteria 1858
492 Ga0495667_0026442 3300046559 Bacteria 3911
493 Ga0495634_0010806 3300046642 Bacteria 6678
494 Ga0495634_0011287 3300046642 Bacteria 6505
495 Ga0495611_0060611 3300046648 Bacteria 1719
496 Ga0495635_0003456 3300046663 Bacteria 10914
497 Ga0495635_0020482 3300046663 Bacteria 4607
498 Ga0495635_0034320 3300046663 Bacteria 3519
499 Ga0495661_0010904 3300046665 Bacteria 6178
500 Ga0495661_0012334 3300046665 Bacteria 5770
501 Ga0495661_0023351 3300046665 Bacteria 4015
502 Ga0495661_0023539 3300046665 Bacteria 3997
503 Ga0495661_0075614 3300046665 Bacteria 1957
504 Ga0495599_0012327 3300046678 Bacteria 5265
505 Ga0495623_0000742 3300046679 Bacteria 21853
506 Ga0495623_0022023 3300046679 Bacteria 4116
507 Ga0495646_0021802 3300046680 Bacteria 4046
508 Ga0495646_0065387 3300046680 Bacteria 2153
509 Ga0495647_0000713 3300046681 Bacteria 9888
510 Ga0495658_0024965 3300046683 Bacteria 3190
511 Ga0495613_0001487 3300046689 Bacteria 17856
512 Ga0495613_0011603 3300046689 Bacteria 6548
513 Ga0495624_0001035 3300046690 Bacteria 21877
514 Ga0495624_0014858 3300046690 Bacteria 5273
515 Ga0495624_0039164 3300046690 Bacteria 3039
516 Ga0495624_0079618 3300046690 Bacteria 2031
517 Ga0495670_0002124 3300046691 Bacteria 9785
518 Ga0495670_0031397 3300046691 Bacteria 2639
519 Ga0495671_0002174 3300046692 Bacteria 12496
520 Ga0495671_0014053 3300046692 Bacteria 4317
521 Ga0495649_0001361 3300046694 Bacteria 18572
522 Ga0495589_0034227 3300046794 Bacteria 2551
523 Ga0495589_0042731 3300046794 Bacteria 2258
524 Ga0495600_0003804 3300046809 Bacteria 8941
525 Ga0495600_0010741 3300046809 Bacteria 5692
526 Ga0495600_0011875 3300046809 Bacteria 5438
527 Ga0495660_0038435 3300046810 Bacteria 2661
528 Ga0495581_0005065 3300047315 Bacteria 7629
529 Ga0495581_0005314 3300047315 Bacteria 7451
530 Ga0495581_0014880 3300047315 Bacteria 4513
531 Ga0495581_0024524 3300047315 Bacteria 3495
532 Ga0495604_0005920 3300047317 Bacteria 9699
533 Ga0495604_0012609 3300047317 Bacteria 6725
534 Ga0495604_0015142 3300047317 Bacteria 6154
535 Ga0495604_0020119 3300047317 Bacteria 5333
536 Ga0495604_0038821 3300047317 Bacteria 3746
537 Ga0495674_0009162 3300047319 Bacteria 9407
538 Ga0495674_0021737 3300047319 Bacteria 5928
539 Ga0495674_0052252 3300047319 Bacteria 3597
540 Ga0495674_0129522 3300047319 Bacteria 2126
541 Ga0495674_0139640 3300047319 Bacteria 2037
542 Ga0495672_0002479 3300047320 Bacteria 16940
543 Ga0495672_0017301 3300047320 Bacteria 4825
544 Ga0495672_0046469 3300047320 Bacteria 2589
545 Ga0495680_0009277 3300047322 Bacteria 8862
546 Ga0495680_0021006 3300047322 Bacteria 5473
547 Ga0495680_0024094 3300047322 Bacteria 5052
548 Ga0495680_0026135 3300047322 Bacteria 4819
549 Ga0495680_0173834 3300047322 Bacteria 1558
550 Ga0495683_0001648 3300047323 Bacteria 14287
551 Ga0495683_0023295 3300047323 Bacteria 3182
552 Ga0495683_0034569 3300047323 Bacteria 2570
553 Ga0495687_000021 3300047443 Bacteria 334681
554 Ga0495675_0002109 3300047444 Bacteria 11864
555 Ga0495679_000104 3300047446 Bacteria 76092
556 Ga0495679_000319 3300047446 Bacteria 38298
557 Ga0495679_001217 3300047446 Bacteria 15271
558 Ga0495685_010554 3300047447 Bacteria 3101
559 Ga0495673_0003469 3300047469 Bacteria 10376
560 Ga0495684_0032175 3300047471 Bacteria 4025
561 Ga0495686_0000359 3300047472 Bacteria 73907
562 Ga0495593_0008241 3300047673 Bacteria 6064
563 Ga0495602_0003039 3300048088 Bacteria 17222
564 Ga0495602_0010240 3300048088 Bacteria 9728
565 Ga0495602_0017115 3300048088 Bacteria 7272
566 Ga0495602_0085482 3300048088 Bacteria 2636
567 Ga0495602_0119776 3300048088 Bacteria 2120
568 Ga0495614_0004883 3300048089 Bacteria 6047
569 Ga0495614_0005108 3300048089 Bacteria 5920
570 Ga0495614_0035098 3300048089 Bacteria 2155
571 Ga0495626_0017527 3300048091 Bacteria 3613
572 Ga0495626_0019380 3300048091 Bacteria 3405
573 Ga0496100_0000962 3300048903 Bacteria 13800
574 Ga0496100_0022937 3300048903 Bacteria 3784
575 Ga0496101_0001410 3300048904 Bacteria 14375
576 Ga0496101_0009353 3300048904 Bacteria 6440
577 Ga0496101_0039728 3300048904 Bacteria 3348
578 Ga0496102_0000804 3300048905 Bacteria 30518
579 Ga0496102_0011420 3300048905 Bacteria 7657
580 Ga0496102_0031498 3300048905 Bacteria 4757
581 Ga0496102_0053855 3300048905 Bacteria 3667
582 Ga0496103_0001211 3300048906 Bacteria 17697
583 Ga0496103_0002846 3300048906 Bacteria 10759
584 Ga0496104_0003415 3300048907 Bacteria 13703
585 Ga0496104_0159829 3300048907 Bacteria 2161
586 Ga0496104_0176998 3300048907 Bacteria 2043
587 Ga0496105_0004826 3300048908 Bacteria 10186
588 Ga0496105_0021028 3300048908 Bacteria 5277
589 Ga0496110_0010877 3300048913 Bacteria 7418
590 Ga0496110_0103338 3300048913 Bacteria 2556
591 Ga0496112_0008063 3300048915 Bacteria 9401
592 Ga0496112_0238561 3300048915 Bacteria 1771
593 Ga0496114_0004112 3300048917 Bacteria 11253
594 Ga0496114_0083934 3300048917 Bacteria 2696
595 Ga0496115_0019334 3300048918 Bacteria 5240
596 Ga0496115_0069597 3300048918 Bacteria 2851
597 Ga0496115_0077316 3300048918 Bacteria 2706
598 Ga0496116_0005618 3300048919 Bacteria 11553
599 Ga0496116_0018648 3300048919 Bacteria 5338
600 Ga0496117_0000524 3300048920 Bacteria 63297
601 Ga0496117_0007587 3300048920 Bacteria 10547
602 Ga0496118_0000495 3300048921 Bacteria 65385
603 Ga0496118_0003624 3300048921 Bacteria 19174
604 Ga0496118_0006160 3300048921 Bacteria 13302
605 Ga0496118_0038595 3300048921 Bacteria 3824
606 Ga0496118_0054079 3300048921 Bacteria 3044
607 Ga0496120_0004850 3300048923 Bacteria 10995
608 Ga0496121_0000124 3300048924 Bacteria 170427
609 Ga0496121_0001969 3300048924 Bacteria 32683
610 Ga0496121_0004727 3300048924 Bacteria 17990
611 Ga0496121_0008459 3300048924 Bacteria 12085
612 Ga0496121_0042820 3300048924 Bacteria 3931
613 Ga0496122_0000316 3300048925 Bacteria 106100
614 Ga0496122_0022894 3300048925 Bacteria 5531
615 Ga0496123_0001951 3300048926 Bacteria 26821
616 Ga0496123_0002396 3300048926 Bacteria 23432
617 Ga0496124_0000004 3300048927 Bacteria 976131
618 Ga0496125_0000570 3300048928 Bacteria 63252
619 Ga0496125_0003177 3300048928 Bacteria 20359
620 Ga0496125_0005396 3300048928 Bacteria 14250
621 Ga0496125_0042600 3300048928 Bacteria 3864
622 Ga0496125_0097232 3300048928 Bacteria 2182
623 Ga0496126_0000032 3300048929 Bacteria 372456
624 Ga0496126_0002561 3300048929 Bacteria 24317
625 Ga0496126_0002719 3300048929 Bacteria 23384
626 Ga0496126_0003005 3300048929 Bacteria 21885
627 Ga0496126_0135571 3300048929 Bacteria 2124
628 Ga0501034_0000268 3300049571 Bacteria 94149
629 Ga0501036_0226362 3300049572 Bacteria 1569
630 Ga0501047_0013466 3300049581 Bacteria 7751
631 Ga0501077_0034797 3300049593 Bacteria 3206
632 Ga0501222_005090 3300049662 Bacteria 1780
633 Ga0501035_0004652 3300049822 Bacteria 13024
634 Ga0501035_0010645 3300049822 Bacteria 8517
635 Ga0501035_0029634 3300049822 Bacteria 4991
636 Ga0501044_0001867 3300049823 Bacteria 24425
637 Ga0501044_0004766 3300049823 Bacteria 15174
638 nmdc:mga00v17_2968_c1 3300050491 Bacteria 8711
639 nmdc:mga00v17_29765_c1 3300050491 Bacteria 3206
640 nmdc:mga0k408_64399_c1 3300050493 Bacteria 2133
641 nmdc:mga0n895_1154_c1 3300050512 Bacteria 19332
642 nmdc:mga0n895_122978_c1 3300050512 Bacteria 2617
643 nmdc:mga0n895_54377_c1 3300050512 Bacteria 3938
644 nmdc:mga0rr50_15984_c1 3300050513 Bacteria 4970
645 nmdc:mga0rr50_59068_c1 3300050513 Bacteria 2877
646 nmdc:mga08x19_33013_c1 3300050514 Bacteria 3265
647 nmdc:mga0a205_51286_c1 3300050515 Bacteria 3983
648 Ga0495601_0113833 3300053077 Bacteria 1753
649 Ga0495612_0035062 3300053078 Bacteria 2033
650 Ga0495595_0037337 3300053084 Bacteria 2208
651 Ga0495619_0010296 3300053085 Bacteria 5886
652 Ga0500646_0003672 3300053090 Bacteria 3930
653 Ga0500593_000120 3300053117 Bacteria 30583
654 Ga0500634_0043696 3300053161 Bacteria 2427
655 Ga0466962_0000381 3300061719 Bacteria 19141
656 Ga0466962_0001507 3300061719 Bacteria 10868

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0284746 Ga0395900_0284746_14_1360 446
2 3300037466 Ga0395898_0109926 Ga0395898_0109926_1282_2628 446
3 3300046535 Ga0495586_0050474 Ga0495586_0050474_864_2210 446
4 3300046665 Ga0495661_0023539 Ga0495661_0023539_2619_3965 446
5 3300046665 Ga0495661_0075614 Ga0495661_0075614_591_1940 446
6 3300047320 Ga0495672_0046469 Ga0495672_0046469_1232_2578 446
7 3300048917 Ga0496114_0083934 Ga0496114_0083934_20_1387 454
8 3300046557 Ga0495622_0014150 Ga0495622_0014150_15_1388 456
9 iso_pu_bacteria 2857547612 2857552575 458
10 3300049572 Ga0501036_0226362 Ga0501036_0226362_152_1540 460
11 3300047317 Ga0495604_0015142 Ga0495604_0015142_4729_6117 461
12 3300048903 Ga0496100_0022937 Ga0496100_0022937_2360_3748 461
13 3300050493 nmdc:mga0k408_64399_c1 nmdc:mga0k408_64399_c1_28_1419 461
14 iso_pu_bacteria 2885080285 2885080644 461
15 3300001979 JGI24740J21852_10016560 JGI24740J21852_100165602 462
16 3300046648 Ga0495611_0060611 Ga0495611_0060611_37_1431 462
17 3300046691 Ga0495670_0002124 Ga0495670_0002124_48_1442 462
18 3300046518 Ga0495631_0013056 Ga0495631_0013056_46_1446 464
19 3300046507 Ga0495606_0008796 Ga0495606_0008796_27_1433 465
20 3300046507 Ga0495606_0018566 Ga0495606_0018566_27_1433 465
21 3300046557 Ga0495622_0054335 Ga0495622_0054335_14_1417 465
22 3300046691 Ga0495670_0031397 Ga0495670_0031397_20_1423 465
23 3300048928 Ga0496125_0097232 Ga0496125_0097232_744_2147 465
24 3300045836 Ga0466958_0124318 Ga0466958_0124318_193_1599 468
25 3300039447 Ga0436361_0462368 Ga0436361_0462368_4537_6057 471
26 3300046473 Ga0495582_0019282 Ga0495582_0019282_16_1437 473
27 3300046514 Ga0495618_0092069 Ga0495618_0092069_483_1904 473
28 3300046533 Ga0495640_0093499 Ga0495640_0093499_542_1963 473
29 3300047319 Ga0495674_0129522 Ga0495674_0129522_685_2106 473
30 3300047322 Ga0495680_0026135 Ga0495680_0026135_1505_3028 473
31 3300049822 Ga0501035_0004652 Ga0501035_0004652_2285_3727 478
32 3300049823 Ga0501044_0004766 Ga0501044_0004766_990_2432 478
33 iso_pu_bacteria 2852646457 2852648181 480
34 iso_pu_bacteria 2945968032 2945970210 480
35 iso_pu_bacteria 8048746797 8048749270 480
36 3300047319 Ga0495674_0139640 Ga0495674_0139640_41_1498 485
37 3300050491 nmdc:mga00v17_29765_c1 nmdc:mga00v17_29765_c1_313_1773 486
38 3300046522 Ga0495643_0018390 Ga0495643_0018390_2328_3803 489
39 3300046528 Ga0495642_0003027 Ga0495642_0003027_5048_6523 489
40 3300046665 Ga0495661_0010904 Ga0495661_0010904_3266_4741 489
41 3300050491 nmdc:mga00v17_2968_c1 nmdc:mga00v17_2968_c1_4972_6447 489
42 iso_pu_bacteria 8002392321 8002394460 489
43 iso_pu_bacteria 2739367655 2739612671 490
44 iso_pu_bacteria 2881927736 2881928329 490
45 iso_pu_bacteria 2887375801 2887379428 490
46 iso_pu_bacteria 2857576091 2857579856 492
47 3300005444 Ga0070694_100095951 Ga0070694_1000959512 495
48 3300046454 Ga0495592_0001574 Ga0495592_0001574_9089_10606 495
49 3300046476 Ga0495662_0005145 Ga0495662_0005145_1945_3462 495
50 3300046511 Ga0495608_0004348 Ga0495608_0004348_2393_3910 495
51 3300046516 Ga0495628_0006996 Ga0495628_0006996_5395_6912 495
52 3300046517 Ga0495630_0025632 Ga0495630_0025632_396_1913 495
53 3300046533 Ga0495640_0006605 Ga0495640_0006605_2825_4342 495
54 3300046535 Ga0495586_0006153 Ga0495586_0006153_1924_3441 495
55 3300046642 Ga0495634_0010806 Ga0495634_0010806_3788_5305 495
56 3300046663 Ga0495635_0034320 Ga0495635_0034320_1427_2944 495
57 3300046683 Ga0495658_0024965 Ga0495658_0024965_1544_3061 495
58 3300046689 Ga0495613_0001487 Ga0495613_0001487_2948_4465 495
59 3300046809 Ga0495600_0010741 Ga0495600_0010741_2452_3969 495
60 3300047317 Ga0495604_0005920 Ga0495604_0005920_803_2320 495
61 3300053077 Ga0495601_0113833 Ga0495601_0113833_168_1685 495
62 3300053084 Ga0495595_0037337 Ga0495595_0037337_600_2117 495
63 3300009176 Ga0105242_10227438 Ga0105242_102274381 496
64 3300053161 Ga0500634_0043696 Ga0500634_0043696_237_1739 496
65 3300005290 Ga0065712_10121624 Ga0065712_101216241 497
66 3300005293 Ga0065715_10131633 Ga0065715_101316331 497
67 3300005335 Ga0070666_10056883 Ga0070666_100568833 497
68 3300005337 Ga0070682_100051488 Ga0070682_1000514882 497
69 3300005338 Ga0068868_100157558 Ga0068868_1001575582 497
70 3300005356 Ga0070674_100001058 Ga0070674_1000010583 497
71 3300005364 Ga0070673_100012268 Ga0070673_1000122683 497
72 3300005365 Ga0070688_100001476 Ga0070688_1000014762 497
73 3300005366 Ga0070659_100107147 Ga0070659_1001071471 497
74 3300005436 Ga0070713_100020002 Ga0070713_1000200025 497
75 3300005437 Ga0070710_10013168 Ga0070710_100131684 497
76 3300005439 Ga0070711_100005372 Ga0070711_1000053728 497
77 3300005456 Ga0070678_100004464 Ga0070678_1000044644 497
78 3300005459 Ga0068867_100136465 Ga0068867_1001364651 497
79 3300005467 Ga0070706_100089404 Ga0070706_1000894042 497
80 3300005530 Ga0070679_100121269 Ga0070679_1001212691 497
81 3300005539 Ga0068853_100160693 Ga0068853_1001606931 497
82 3300005546 Ga0070696_100131067 Ga0070696_1001310671 497
83 3300005547 Ga0070693_100074043 Ga0070693_1000740431 497
84 3300005548 Ga0070665_100016607 Ga0070665_1000166078 497
85 3300005578 Ga0068854_100002366 Ga0068854_1000023661 497
86 3300005615 Ga0070702_100056419 Ga0070702_1000564191 497
87 3300005617 Ga0068859_100005320 Ga0068859_1000053203 497
88 3300005618 Ga0068864_100009675 Ga0068864_1000096752 497
89 3300005718 Ga0068866_10026222 Ga0068866_100262221 497
90 3300005841 Ga0068863_100012501 Ga0068863_1000125013 497
91 3300005842 Ga0068858_100163218 Ga0068858_1001632182 497
92 3300006163 Ga0070715_10038410 Ga0070715_100384102 497
93 3300006175 Ga0070712_100005143 Ga0070712_1000051438 497
94 3300006175 Ga0070712_100145864 Ga0070712_1001458641 497
95 3300006237 Ga0097621_100190844 Ga0097621_1001908441 497
96 3300006358 Ga0068871_100105244 Ga0068871_1001052441 497
97 3300006931 Ga0097620_100005321 Ga0097620_1000053213 497
98 3300007076 Ga0075435_100030199 Ga0075435_1000301992 497
99 3300009098 Ga0105245_10007193 Ga0105245_100071931 497
100 3300009098 Ga0105245_10048737 Ga0105245_100487371 497
101 3300009101 Ga0105247_10007989 Ga0105247_100079897 497
102 3300009174 Ga0105241_10128725 Ga0105241_101287251 497
103 3300009174 Ga0105241_10150963 Ga0105241_101509632 497
104 3300009551 Ga0105238_10095315 Ga0105238_100953153 497
105 3300013296 Ga0157374_10112544 Ga0157374_101125442 497
106 3300013297 Ga0157378_10088572 Ga0157378_100885723 497
107 3300013306 Ga0163162_10041381 Ga0163162_100413815 497
108 3300014325 Ga0163163_10004197 Ga0163163_1000419711 497
109 3300014968 Ga0157379_10032101 Ga0157379_100321015 497
110 3300014969 Ga0157376_10052457 Ga0157376_100524571 497
111 3300014969 Ga0157376_10074327 Ga0157376_100743273 497
112 3300025898 Ga0207692_10010382 Ga0207692_100103821 497
113 3300025899 Ga0207642_10002948 Ga0207642_100029482 497
114 3300025903 Ga0207680_10004468 Ga0207680_100044688 497
115 3300025905 Ga0207685_10019189 Ga0207685_100191892 497
116 3300025906 Ga0207699_10021878 Ga0207699_100218781 497
117 3300025906 Ga0207699_10060496 Ga0207699_100604962 497
118 3300025915 Ga0207693_10004538 Ga0207693_1000453810 497
119 3300025915 Ga0207693_10031913 Ga0207693_100319131 497
120 3300025916 Ga0207663_10028620 Ga0207663_100286202 497
121 3300025919 Ga0207657_10003387 Ga0207657_1000338714 497
122 3300025921 Ga0207652_10147588 Ga0207652_101475882 497
123 3300025927 Ga0207687_10003283 Ga0207687_100032839 497
124 3300025927 Ga0207687_10010145 Ga0207687_100101455 497
125 3300025928 Ga0207700_10014289 Ga0207700_100142894 497
126 3300025931 Ga0207644_10034402 Ga0207644_100344021 497
127 3300025934 Ga0207686_10001864 Ga0207686_1000186410 497
128 3300025939 Ga0207665_10020402 Ga0207665_100204021 497
129 3300025941 Ga0207711_10002829 Ga0207711_100028293 497
130 3300025942 Ga0207689_10043523 Ga0207689_100435231 497
131 3300025960 Ga0207651_10001059 Ga0207651_100010593 497
132 3300025981 Ga0207640_10028912 Ga0207640_100289122 497
133 3300026023 Ga0207677_10000186 Ga0207677_1000018648 497
134 3300026023 Ga0207677_10014253 Ga0207677_100142533 497
135 3300026035 Ga0207703_10003780 Ga0207703_1000378012 497
136 3300026078 Ga0207702_10191046 Ga0207702_101910462 497
137 3300026088 Ga0207641_10007033 Ga0207641_100070334 497
138 3300026089 Ga0207648_10095433 Ga0207648_100954332 497
139 3300026095 Ga0207676_10000455 Ga0207676_1000045537 497
140 3300026116 Ga0207674_10006719 Ga0207674_1000671912 497
141 3300026121 Ga0207683_10000768 Ga0207683_1000076824 497
142 3300028381 Ga0268264_10005450 Ga0268264_100054505 497
143 3300028381 Ga0268264_10096476 Ga0268264_100964761 497
144 3300035089 Ga0373944_0022410 Ga0373944_0022410_159_1655 497
145 3300035111 Ga0373923_0003740 Ga0373923_0003740_151_1647 497
146 3300035117 Ga0373953_0004438 Ga0373953_0004438_1280_2776 497
147 3300035119 Ga0373956_0002862 Ga0373956_0002862_4522_6018 497
148 3300035170 Ga0373943_0057113 Ga0373943_0057113_278_1774 497
149 3300035172 Ga0373955_0014859 Ga0373955_0014859_1253_2749 497
150 3300035725 Ga0373947_0059729 Ga0373947_0059729_374_1870 497
151 3300046462 Ga0495651_0069926 Ga0495651_0069926_1054_2550 497
152 3300046472 Ga0495580_0006193 Ga0495580_0006193_7284_8780 497
153 3300046473 Ga0495582_0003454 Ga0495582_0003454_7196_8692 497
154 3300046475 Ga0495639_0010646 Ga0495639_0010646_2061_3557 497
155 3300046559 Ga0495667_0026442 Ga0495667_0026442_970_2466 497
156 3300046681 Ga0495647_0000713 Ga0495647_0000713_6454_7950 497
157 3300046689 Ga0495613_0011603 Ga0495613_0011603_4838_6334 497
158 3300047315 Ga0495581_0024524 Ga0495581_0024524_1737_3233 497
159 3300047322 Ga0495680_0173834 Ga0495680_0173834_27_1523 497
160 3300047471 Ga0495684_0032175 Ga0495684_0032175_672_2168 497
161 3300048088 Ga0495602_0085482 Ga0495602_0085482_441_1937 497
162 3300048905 Ga0496102_0053855 Ga0496102_0053855_1861_3357 497
163 3300048907 Ga0496104_0003415 Ga0496104_0003415_474_1970 497
164 3300048908 Ga0496105_0004826 Ga0496105_0004826_4900_6396 497
165 3300048913 Ga0496110_0103338 Ga0496110_0103338_615_2111 497
166 3300048915 Ga0496112_0008063 Ga0496112_0008063_3483_4979 497
167 3300048918 Ga0496115_0069597 Ga0496115_0069597_880_2376 497
168 3300050513 nmdc:mga0rr50_59068_c1 nmdc:mga0rr50_59068_c1_307_1803 497
169 3300053078 Ga0495612_0035062 Ga0495612_0035062_335_1831 497
170 3300053085 Ga0495619_0010296 Ga0495619_0010296_2681_4177 497
171 3300044693 Ga0466961_0000651 Ga0466961_0000651_12244_13755 498
172 3300045049 Ga0466959_0022928 Ga0466959_0022928_2783_4294 498
173 iso_pu_bacteria 8055225921 8055228153 498
174 iso_pu_bacteria 2643221660 2644337447 499
175 iso_pu_bacteria 2855730933 2855731453 499
176 iso_pu_bacteria 2855767633 2855768159 499
177 iso_pu_bacteria 2881412998 2881413671 499
178 3300005329 Ga0070683_100017464 Ga0070683_1000174645 500
179 3300005366 Ga0070659_100011757 Ga0070659_1000117575 500
180 3300005435 Ga0070714_100046810 Ga0070714_1000468103 500
181 3300005455 Ga0070663_100054750 Ga0070663_1000547501 500
182 3300005535 Ga0070684_100015567 Ga0070684_1000155674 500
183 3300005564 Ga0070664_100014348 Ga0070664_1000143482 500
184 3300005577 Ga0068857_100065151 Ga0068857_1000651513 500
185 3300005578 Ga0068854_100007690 Ga0068854_1000076905 500
186 3300009174 Ga0105241_10002097 Ga0105241_1000209717 500
187 3300013100 Ga0157373_10004925 Ga0157373_1000492512 500
188 3300013102 Ga0157371_10041254 Ga0157371_100412542 500
189 3300025321 Ga0207656_10020282 Ga0207656_100202821 500
190 3300025912 Ga0207707_10050298 Ga0207707_100502982 500
191 3300025917 Ga0207660_10008740 Ga0207660_100087405 500
192 3300025919 Ga0207657_10000848 Ga0207657_1000084828 500
193 3300025920 Ga0207649_10018322 Ga0207649_100183223 500
194 3300025921 Ga0207652_10024879 Ga0207652_100248793 500
195 3300025924 Ga0207694_10038649 Ga0207694_100386493 500
196 3300025929 Ga0207664_10041976 Ga0207664_100419762 500
197 3300025944 Ga0207661_10022469 Ga0207661_100224692 500
198 3300025945 Ga0207679_10018983 Ga0207679_100189833 500
199 3300025949 Ga0207667_10007532 Ga0207667_1000753212 500
200 3300025981 Ga0207640_10043009 Ga0207640_100430092 500
201 3300026067 Ga0207678_10005901 Ga0207678_100059014 500
202 3300026116 Ga0207674_10002813 Ga0207674_100028135 500
203 3300026142 Ga0207698_10041221 Ga0207698_100412213 500
204 3300031344 Ga0265316_10092332 Ga0265316_100923322 500
205 3300037471 Ga0395905_0000052 Ga0395905_0000052_195397_196902 500
206 3300045976 Ga0466967_0171316 Ga0466967_0171316_505_2010 500
207 3300048088 Ga0495602_0010240 Ga0495602_0010240_4989_6491 500
208 iso_pu_bacteria 2599185292 2599907026 500
209 iso_pu_bacteria 2643221569 2643863230 500
210 iso_pu_bacteria 2643221594 2643978636 500
211 iso_pu_bacteria 2643221621 2644121758 500
212 iso_pu_bacteria 2808606395 2809036607 500
213 iso_pu_bacteria 2857537821 2857541206 500
214 iso_pu_bacteria 2857542790 2857545900 500
215 iso_pu_bacteria 2858950400 2858953889 500
216 iso_pu_bacteria 2941479691 2941481079 500
217 3300005436 Ga0070713_100000049 Ga0070713_10000004927 501
218 3300005445 Ga0070708_100078202 Ga0070708_1000782022 501
219 3300005467 Ga0070706_100050123 Ga0070706_1000501231 501
220 3300005467 Ga0070706_100104435 Ga0070706_1001044353 501
221 3300005471 Ga0070698_100025942 Ga0070698_1000259423 501
222 3300005471 Ga0070698_100144730 Ga0070698_1001447301 501
223 3300005536 Ga0070697_100006228 Ga0070697_1000062286 501
224 3300005549 Ga0070704_100011934 Ga0070704_1000119342 501
225 3300006852 Ga0075433_10020730 Ga0075433_100207303 501
226 3300025910 Ga0207684_10019953 Ga0207684_100199531 501
227 3300025910 Ga0207684_10119073 Ga0207684_101190731 501
228 3300025922 Ga0207646_10051232 Ga0207646_100512322 501
229 3300025928 Ga0207700_10000123 Ga0207700_1000012340 501
230 3300031911 Ga0307412_10069039 Ga0307412_100690392 501
231 3300031995 Ga0307409_100003309 Ga0307409_1000033092 501
232 3300032002 Ga0307416_100009923 Ga0307416_1000099237 501
233 3300035695 Ga0373927_0010296 Ga0373927_0010296_2747_4258 501
234 3300050512 nmdc:mga0n895_54377_c1 nmdc:mga0n895_54377_c1_2022_3533 501
235 3300050513 nmdc:mga0rr50_15984_c1 nmdc:mga0rr50_15984_c1_25_1536 501
236 3300050515 nmdc:mga0a205_51286_c1 nmdc:mga0a205_51286_c1_1663_3174 501
237 iso_pu_bacteria 2511231003 2511251814 501
238 iso_pu_bacteria 2513237150 2513956539 501
239 iso_pu_bacteria 2513237165 2514044208 501
240 iso_pu_bacteria 2521172590 2521559223 501
241 iso_pu_bacteria 2551306416 2553004033 501
242 iso_pu_bacteria 2765235838 2765568607 501
243 iso_pu_bacteria 2818991445 2819595109 501
244 iso_pu_bacteria 2818991449 2819615730 501
245 iso_pu_bacteria 2834641062 2834644894 501
246 iso_pu_bacteria 2839094727 2839096512 501
247 iso_pu_bacteria 2858688981 2858699790 501
248 iso_pu_bacteria 2904439833 2904443591 501
249 iso_pu_bacteria 2904530477 2904532517 501
250 iso_pu_bacteria 2904584206 2904584986 501
251 iso_pu_bacteria 2904589729 2904593335 501
252 iso_pu_bacteria 2904601388 2904605529 501
253 iso_pu_bacteria 2919046199 2919048171 501
254 iso_pu_bacteria 2919079590 2919081302 501
255 iso_pu_bacteria 2923510766 2923512904 501
256 iso_pu_bacteria 2928130867 2928133751 501
257 iso_pu_bacteria 644736347 644748422 501
258 iso_pu_bacteria 8003400568 8003401753 501
259 3300031235 Ga0265330_10001738 Ga0265330_100017387 502
260 3300031241 Ga0265325_10003555 Ga0265325_100035556 502
261 3300031242 Ga0265329_10001775 Ga0265329_100017759 502
262 3300031250 Ga0265331_10000810 Ga0265331_1000081012 502
263 3300031251 Ga0265327_10003804 Ga0265327_100038042 502
264 3300031344 Ga0265316_10012761 Ga0265316_100127612 502
265 3300031711 Ga0265314_10026879 Ga0265314_100268794 502
266 3300031712 Ga0265342_10066681 Ga0265342_100666812 502
267 iso_pu_bacteria 2547132103 2547372238 502
268 iso_pu_bacteria 2843690924 2843693233 502
269 3300003187 JGI25151J46595_10000817 JGI25151J46595_100008177 503
270 3300006871 Ga0075434_100000054 Ga0075434_10000005441 503
271 3300006914 Ga0075436_100047780 Ga0075436_1000477804 503
272 3300007076 Ga0075435_100000429 Ga0075435_10000042919 503
273 3300025294 Ga0209025_1000018 Ga0209025_1000018498 503
274 3300031251 Ga0265327_10016285 Ga0265327_100162852 503
275 3300042461 Ga0439460_0012908 Ga0439460_0012908_207_1724 503
276 3300045976 Ga0466967_0000948 Ga0466967_0000948_11218_12729 503
277 3300046492 Ga0495585_0020609 Ga0495585_0020609_924_2438 503
278 3300046501 Ga0495607_0000920 Ga0495607_0000920_12615_14132 503
279 3300049581 Ga0501047_0013466 Ga0501047_0013466_4885_6402 503
280 3300049822 Ga0501035_0029634 Ga0501035_0029634_1580_3097 503
281 3300050512 nmdc:mga0n895_1154_c1 nmdc:mga0n895_1154_c1_6216_7727 503
282 3300050514 nmdc:mga08x19_33013_c1 nmdc:mga08x19_33013_c1_762_2273 503
283 3300005536 Ga0070697_100005736 Ga0070697_1000057366 504
284 3300006051 Ga0075364_10000596 Ga0075364_1000059612 504
285 3300006051 Ga0075364_10000694 Ga0075364_1000069414 504
286 3300006195 Ga0075366_10038872 Ga0075366_100388723 504
287 3300006871 Ga0075434_100001233 Ga0075434_1000012339 504
288 3300025292 Ga0209676_1003098 Ga0209676_10030982 504
289 3300025298 Ga0209050_1007075 Ga0209050_10070755 504
290 3300025960 Ga0207651_10096787 Ga0207651_100967872 504
291 3300028666 Ga0265336_10000293 Ga0265336_1000029316 504
292 3300029957 Ga0265324_10001505 Ga0265324_100015053 504
293 3300031731 Ga0307405_10033144 Ga0307405_100331442 504
294 3300031824 Ga0307413_10004493 Ga0307413_100044933 504
295 3300031852 Ga0307410_10002309 Ga0307410_100023098 504
296 3300031901 Ga0307406_10023899 Ga0307406_100238992 504
297 3300031903 Ga0307407_10000560 Ga0307407_100005603 504
298 3300031911 Ga0307412_10000775 Ga0307412_1000077512 504
299 3300031995 Ga0307409_100003151 Ga0307409_1000031518 504
300 3300032002 Ga0307416_100012868 Ga0307416_1000128684 504
301 3300032005 Ga0307411_10002764 Ga0307411_100027644 504
302 3300032126 Ga0307415_100008237 Ga0307415_1000082374 504
303 3300035117 Ga0373953_0007991 Ga0373953_0007991_498_2012 504
304 3300035118 Ga0373954_0000356 Ga0373954_0000356_8070_9587 504
305 3300035410 Ga0373924_0008784 Ga0373924_0008784_55_1572 504
306 3300035724 Ga0373933_0015018 Ga0373933_0015018_142_1659 504
307 3300036401 Ga0373937_0000698 Ga0373937_0000698_16424_17941 504
308 3300036401 Ga0373937_0144817 Ga0373937_0144817_225_1742 504
309 3300037418 Ga0395900_0032795 Ga0395900_0032795_3188_4705 504
310 3300037466 Ga0395898_0017565 Ga0395898_0017565_4968_6485 504
311 3300037471 Ga0395905_0007912 Ga0395905_0007912_2315_3835 504
312 3300038443 Ga0395901_0047689 Ga0395901_0047689_817_2334 504
313 3300039447 Ga0436361_0866712 Ga0436361_0866712_18_1550 504
314 3300042876 Ga0451577_0015023 Ga0451577_0015023_2858_4375 504
315 3300044658 Ga0466972_0000372 Ga0466972_0000372_1717_3234 504
316 3300044765 Ga0466970_0003101 Ga0466970_0003101_4103_5620 504
317 3300045049 Ga0466959_0005338 Ga0466959_0005338_2884_4401 504
318 3300045051 Ga0451576_0002583 Ga0451576_0002583_22270_23787 504
319 3300047322 Ga0495680_0021006 Ga0495680_0021006_3832_5349 504
320 3300048919 Ga0496116_0018648 Ga0496116_0018648_3087_4607 504
321 3300048920 Ga0496117_0007587 Ga0496117_0007587_1037_2557 504
322 3300048923 Ga0496120_0004850 Ga0496120_0004850_6202_7722 504
323 3300048924 Ga0496121_0000124 Ga0496121_0000124_105106_106626 504
324 3300048925 Ga0496122_0000316 Ga0496122_0000316_104535_106055 504
325 3300048926 Ga0496123_0002396 Ga0496123_0002396_7322_8842 504
326 3300048927 Ga0496124_0000004 Ga0496124_0000004_378781_380301 504
327 3300048928 Ga0496125_0000570 Ga0496125_0000570_11809_13329 504
328 3300048928 Ga0496125_0042600 Ga0496125_0042600_1946_3466 504
329 3300049593 Ga0501077_0034797 Ga0501077_0034797_730_2244 504
330 3300049662 Ga0501222_005090 Ga0501222_005090_214_1734 504
331 3300050512 nmdc:mga0n895_122978_c1 nmdc:mga0n895_122978_c1_435_1952 504
332 3300053117 Ga0500593_000120 Ga0500593_000120_4875_6398 504
333 3300002704 JGI25155J39150_1000443 JGI25155J39150_10004435 505
334 3300002704 JGI25155J39150_1000986 JGI25155J39150_10009863 505
335 3300002705 JGI25156J39149_1000701 JGI25156J39149_10007015 505
336 3300002705 JGI25156J39149_1004386 JGI25156J39149_10043862 505
337 3300002738 JGI25154J39366_1001059 JGI25154J39366_10010595 505
338 3300002738 JGI25154J39366_1001069 JGI25154J39366_10010695 505
339 3300002741 JGI25157J39369_1000206 JGI25157J39369_100020631 505
340 3300003751 Ga0055538_1000054 Ga0055538_100005431 505
341 3300003752 Ga0055539_1000066 Ga0055539_100006631 505
342 3300003756 Ga0055533_1000076 Ga0055533_100007631 505
343 3300003758 Ga0055532_1000097 Ga0055532_100009726 505
344 3300003759 Ga0055525_1000098 Ga0055525_100009831 505
345 3300003761 Ga0055535_1004424 Ga0055535_10044241 505
346 3300003841 Ga0055541_1000056 Ga0055541_100005631 505
347 3300005563 Ga0068855_100000821 Ga0068855_10000082129 505
348 3300005578 Ga0068854_100005069 Ga0068854_1000050697 505
349 3300006948 Ga0099826_10000015 Ga0099826_10000015178 505
350 3300009093 Ga0105240_10084835 Ga0105240_100848352 505
351 3300009545 Ga0105237_10013930 Ga0105237_100139302 505
352 3300009551 Ga0105238_10001204 Ga0105238_1000120415 505
353 3300010375 Ga0105239_10021865 Ga0105239_100218653 505
354 3300015265 Ga0182005_1009595 Ga0182005_10095951 505
355 3300021361 Ga0213872_10000435 Ga0213872_1000043518 505
356 3300025206 Ga0209435_100040 Ga0209435_10004058 505
357 3300025206 Ga0209435_100659 Ga0209435_1006592 505
358 3300025224 Ga0209784_100002 Ga0209784_1000021518 505
359 3300025225 Ga0209566_100003 Ga0209566_1000031518 505
360 3300025226 Ga0209674_100004 Ga0209674_1000041518 505
361 3300025229 Ga0209147_100141 Ga0209147_10014141 505
362 3300025230 Ga0209563_100006 Ga0209563_1000061518 505
363 3300025233 Ga0209437_100229 Ga0209437_10022945 505
364 3300025242 Ga0209258_100346 Ga0209258_10034621 505
365 3300025246 Ga0209646_1000218 Ga0209646_100021811 505
366 3300025246 Ga0209646_1000235 Ga0209646_100023544 505
367 3300025250 Ga0209026_1000534 Ga0209026_100053411 505
368 3300025250 Ga0209026_1005395 Ga0209026_10053952 505
369 3300025253 Ga0209677_100003 Ga0209677_1000031518 505
370 3300025256 Ga0209759_1000447 Ga0209759_100044711 505
371 3300025256 Ga0209759_1000954 Ga0209759_100095415 505
372 3300025272 Ga0209455_1000515 Ga0209455_100051520 505
373 3300025294 Ga0209025_1000759 Ga0209025_100075937 505
374 3300025913 Ga0207695_10016266 Ga0207695_100162665 505
375 3300025913 Ga0207695_10032873 Ga0207695_100328733 505
376 3300025914 Ga0207671_10017204 Ga0207671_100172042 505
377 3300025924 Ga0207694_10003665 Ga0207694_100036656 505
378 3300025949 Ga0207667_10000112 Ga0207667_100001125 505
379 3300026116 Ga0207674_10075534 Ga0207674_100755343 505
380 3300027462 Ga0210000_1000111 Ga0210000_10001116 505
381 3300027543 Ga0209999_1000362 Ga0209999_10003625 505
382 3300027614 Ga0209970_1003306 Ga0209970_10033062 505
383 3300027666 Ga0209282_1000033 Ga0209282_100003365 505
384 3300027876 Ga0209974_10002164 Ga0209974_100021646 505
385 3300039447 Ga0436361_0215157 Ga0436361_0215157_82302_83834 505
386 3300046474 Ga0495605_0002148 Ga0495605_0002148_7616_9145 505
387 3300046507 Ga0495606_0030524 Ga0495606_0030524_39_1565 505
388 3300046692 Ga0495671_0002174 Ga0495671_0002174_3042_4571 505
389 3300047447 Ga0495685_010554 Ga0495685_010554_1034_2563 505
390 3300048918 Ga0496115_0019334 Ga0496115_0019334_413_1939 505
391 3300048924 Ga0496121_0008459 Ga0496121_0008459_7708_9237 505
392 3300048926 Ga0496123_0001951 Ga0496123_0001951_13078_14607 505
393 3300048928 Ga0496125_0003177 Ga0496125_0003177_10794_12314 505
394 3300049571 Ga0501034_0000268 Ga0501034_0000268_22979_24508 505
395 3300049822 Ga0501035_0010645 Ga0501035_0010645_5510_7033 505
396 3300049823 Ga0501044_0001867 Ga0501044_0001867_10025_11548 505
397 3300053090 Ga0500646_0003672 Ga0500646_0003672_1970_3490 505
398 iso_pu_bacteria 2721755763 2723877115 505
399 3300003187 JGI25151J46595_10007162 JGI25151J46595_100071622 506
400 3300003773 Ga0055537_1003621 Ga0055537_10036215 506
401 3300003775 Ga0055524_1002454 Ga0055524_10024545 506
402 3300003781 Ga0055536_1000087 Ga0055536_100008762 506
403 3300003784 Ga0055534_1004694 Ga0055534_10046943 506
404 3300003784 Ga0055534_1006299 Ga0055534_10062992 506
405 3300025263 Ga0209565_1000635 Ga0209565_10006356 506
406 3300025291 Ga0209675_1000892 Ga0209675_100089213 506
407 3300025291 Ga0209675_1000913 Ga0209675_10009139 506
408 3300025292 Ga0209676_1000012 Ga0209676_1000012330 506
409 3300025294 Ga0209025_1000414 Ga0209025_100041472 506
410 3300025294 Ga0209025_1000542 Ga0209025_100054263 506
411 3300025295 Ga0209564_1002062 Ga0209564_100206211 506
412 3300025295 Ga0209564_1002743 Ga0209564_10027437 506
413 3300025295 Ga0209564_1003325 Ga0209564_10033257 506
414 3300025299 Ga0209256_1000572 Ga0209256_10005723 506
415 iso_pu_bacteria 2519103095 2519461980 506
416 iso_pu_bacteria 2582581311 2585290203 506
417 iso_pu_bacteria 2599185239 2599735387 506
418 iso_pu_bacteria 2599185240 2599748563 506
419 iso_pu_bacteria 2599185355 2600210449 506
420 iso_pu_bacteria 2675903129 2676746654 506
421 iso_pu_bacteria 2808606384 2808967904 506
422 iso_pu_bacteria 2808606390 2809002735 506
423 iso_pu_bacteria 2808606391 2809010013 506
424 iso_pu_bacteria 2816332253 2817258838 506
425 iso_pu_bacteria 2816332256 2817280733 506
426 iso_pu_bacteria 2816332286 2817454760 506
427 iso_pu_bacteria 2818991452 2819630593 506
428 iso_pu_bacteria 2863421361 2863426084 506
429 iso_pu_bacteria 2870068957 2870075040 506
430 iso_pu_bacteria 2904564687 2904565319 506
431 iso_pu_bacteria 2904571731 2904571985 506
432 iso_pu_bacteria 2928157003 2928157487 506
433 iso_pu_bacteria 2928163908 2928165301 506
434 iso_pu_bacteria 2928170801 2928174363 506
435 iso_pu_bacteria 2928536128 2928537303 506
436 iso_pu_bacteria 2981990288 2981990468 506
437 iso_pu_bacteria 641736154 642419946 506
438 iso_pu_bacteria 8018845410 8018846469 506
439 iso_pu_bacteria 8020807995 8020808457 506
440 iso_pu_bacteria 8020938398 8020944030 506
441 iso_pu_bacteria 8020945358 8020948625 506
442 iso_pu_bacteria 8020953355 8020956133 506
443 iso_pu_bacteria 8021120328 8021120874 506
444 iso_pu_bacteria 8039098773 8039100561 506
445 iso_pu_bacteria 8040167225 8040168150 506
446 iso_pu_bacteria 8040173305 8040174415 506
447 iso_pu_bacteria 2734482258 2735818320 507
448 3300044693 Ga0466961_0084198 Ga0466961_0084198_227_1765 508
449 3300001989 JGI24739J22299_10008475 JGI24739J22299_100084753 510
450 3300003760 Ga0055527_1002447 Ga0055527_10024473 510
451 3300003762 Ga0055542_1002875 Ga0055542_10028753 510
452 3300003763 Ga0055529_1002530 Ga0055529_10025304 510
453 3300003763 Ga0055529_1002811 Ga0055529_10028113 510
454 3300003790 Ga0055528_1000692 Ga0055528_10006926 510
455 3300005339 Ga0070660_100000520 Ga0070660_10000052012 510
456 3300005366 Ga0070659_100000072 Ga0070659_10000007227 510
457 3300005455 Ga0070663_100015671 Ga0070663_1000156712 510
458 3300009551 Ga0105238_10026941 Ga0105238_100269413 510
459 3300015262 Ga0182007_10018366 Ga0182007_100183662 510
460 3300025225 Ga0209566_100361 Ga0209566_10036124 510
461 3300025226 Ga0209674_100866 Ga0209674_1008666 510
462 3300025228 Ga0209672_100015 Ga0209672_100015430 510
463 3300025228 Ga0209672_100050 Ga0209672_100050217 510
464 3300025229 Ga0209147_100016 Ga0209147_10001633 510
465 3300025229 Ga0209147_102689 Ga0209147_1026893 510
466 3300025242 Ga0209258_100026 Ga0209258_100026430 510
467 3300025242 Ga0209258_100590 Ga0209258_10059029 510
468 3300025254 Ga0209148_1001067 Ga0209148_10010672 510
469 3300025263 Ga0209565_1005580 Ga0209565_10055803 510
470 3300025272 Ga0209455_1006972 Ga0209455_10069722 510
471 3300025273 Ga0209673_1000028 Ga0209673_1000028144 510
472 3300025295 Ga0209564_1004112 Ga0209564_10041126 510
473 3300025904 Ga0207647_10001426 Ga0207647_100014269 510
474 3300025913 Ga0207695_10010466 Ga0207695_100104668 510
475 3300025913 Ga0207695_10017010 Ga0207695_100170105 510
476 3300025919 Ga0207657_10000119 Ga0207657_1000011926 510
477 3300025932 Ga0207690_10000008 Ga0207690_1000000827 510
478 3300025949 Ga0207667_10012896 Ga0207667_100128964 510
479 3300027312 Ga0209371_1000172 Ga0209371_100017286 510
480 3300030500 Ga0268256_1000144 Ga0268256_10001442 510
481 iso_pu_bacteria 2501025501 2501076447 510
482 iso_pu_bacteria 2501025502 2501079881 510
483 iso_pu_bacteria 2501025504 2501412113 510
484 iso_pu_bacteria 2510917013 2511087775 510
485 iso_pu_bacteria 2510917014 2511101731 510
486 iso_pu_bacteria 2510917015 2511107761 510
487 iso_pu_bacteria 2513237082 2513553463 510
488 iso_pu_bacteria 2513237083 2513559611 510
489 iso_pu_bacteria 2515154189 2516018048 510
490 iso_pu_bacteria 2856287931 2856289752 510
491 iso_pu_bacteria 2857357740 2857363209 510
492 iso_pu_bacteria 2883087390 2883088353 510
493 iso_pu_bacteria 8003955200 8003956546 510
494 iso_pu_bacteria 2513237166 2514054440 511
495 iso_pu_bacteria 2515154123 2515690291 511
496 iso_pu_bacteria 2562617112 2563058376 511
497 iso_pu_bacteria 2600255067 2600814068 511
498 iso_pu_bacteria 2711768613 2713475085 511
499 iso_pu_bacteria 2744054900 2746090734 511
500 iso_pu_bacteria 2744054901 2746092405 511
501 iso_pu_bacteria 2791355137 2792836237 511
502 iso_pu_bacteria 2842324504 2842326083 511
503 iso_pu_bacteria 2842348783 2842351397 511
504 iso_pu_bacteria 2842454564 2842455403 511
505 iso_pu_bacteria 2904615490 2904616068 511
506 iso_pu_bacteria 2921643360 2921652525 511
507 iso_pu_bacteria 642555112 642596135 511
508 iso_pu_bacteria 2508501125 2509130922 512
509 iso_pu_bacteria 2510065045 2510248190 512
510 iso_pu_bacteria 2512047030 2512349881 512
511 iso_pu_bacteria 2513237151 2513962754 512
512 iso_pu_bacteria 2515154122 2515684988 512
513 iso_pu_bacteria 2526164713 2527079638 512
514 iso_pu_bacteria 2718217991 2719643381 512
515 iso_pu_bacteria 2738541296 2738823665 512
516 iso_pu_bacteria 2738541298 2738836071 512
517 iso_pu_bacteria 2738541306 2738877601 512
518 iso_pu_bacteria 2738543002 2739189292 512
519 iso_pu_bacteria 2738543008 2739224194 512
520 iso_pu_bacteria 2751185846 2753567434 512
521 iso_pu_bacteria 2818991450 2819623801 512
522 iso_pu_bacteria 2885270888 2885276511 512
523 iso_pu_bacteria 2900634093 2900639415 512
524 iso_pu_bacteria 2902682994 2902684019 512
525 iso_pu_bacteria 2904483920 2904490314 512
526 iso_pu_bacteria 2919527303 2919533484 512
527 iso_pu_bacteria 2928108538 2928112911 512
528 iso_pu_bacteria 2928135762 2928139840 512
529 iso_pu_bacteria 2928503688 2928506997 512
530 iso_pu_bacteria 2945934425 2945941042 512
531 iso_pu_bacteria 2990703756 2990708086 512
532 iso_pu_bacteria 641736151 642421903 512
533 iso_pu_bacteria 642555113 642617862 512
534 iso_pu_bacteria 8055266321 8055271008 512
535 iso_pu_bacteria 8055301274 8055307214 512
536 3300047320 Ga0495672_0002479 Ga0495672_0002479_14465_16009 514
537 3300002067 JGI24735J21928_10004922 JGI24735J21928_100049222 515
538 3300003320 rootH2_10055217 rootH2_100552174 515
539 3300003354 JGI25160J50197_1000124 JGI25160J50197_100012424 515
540 3300003760 Ga0055527_1003152 Ga0055527_10031522 515
541 3300005262 Ga0065165_1000637 Ga0065165_10006374 515
542 3300005327 Ga0070658_10001459 Ga0070658_100014599 515
543 3300005339 Ga0070660_100004784 Ga0070660_1000047842 515
544 3300005456 Ga0070678_100059370 Ga0070678_1000593702 515
545 3300005563 Ga0068855_100013124 Ga0068855_1000131242 515
546 3300009093 Ga0105240_10014632 Ga0105240_100146325 515
547 3300009177 Ga0105248_10175146 Ga0105248_101751462 515
548 3300009545 Ga0105237_10026688 Ga0105237_100266884 515
549 3300010375 Ga0105239_10005527 Ga0105239_100055275 515
550 3300013102 Ga0157371_10008808 Ga0157371_100088086 515
551 3300013104 Ga0157370_10000515 Ga0157370_1000051511 515
552 3300013104 Ga0157370_10003858 Ga0157370_100038587 515
553 3300013104 Ga0157370_10063190 Ga0157370_100631904 515
554 3300013105 Ga0157369_10000847 Ga0157369_100008475 515
555 3300013105 Ga0157369_10002528 Ga0157369_100025289 515
556 3300013105 Ga0157369_10010488 Ga0157369_100104886 515
557 3300013296 Ga0157374_10000081 Ga0157374_1000008179 515
558 3300013306 Ga0163162_10006058 Ga0163162_100060587 515
559 3300013307 Ga0157372_10001408 Ga0157372_1000140811 515
560 3300016635 Ga0183361_10029 Ga0183361_1002919 515
561 3300022467 Ga0224712_10000001 Ga0224712_1000000111 515
562 3300025228 Ga0209672_101329 Ga0209672_1013298 515
563 3300025256 Ga0209759_1002856 Ga0209759_10028565 515
564 3300025295 Ga0209564_1003018 Ga0209564_100301810 515
565 3300025302 Ga0207426_1000020 Ga0207426_1000020499 515
566 3300025904 Ga0207647_10000260 Ga0207647_1000026010 515
567 3300025904 Ga0207647_10090016 Ga0207647_100900161 515
568 3300025909 Ga0207705_10000385 Ga0207705_1000038519 515
569 3300025909 Ga0207705_10076094 Ga0207705_100760942 515
570 3300025913 Ga0207695_10011254 Ga0207695_1001125410 515
571 3300025914 Ga0207671_10007892 Ga0207671_100078926 515
572 3300025919 Ga0207657_10000938 Ga0207657_1000093814 515
573 3300025924 Ga0207694_10073606 Ga0207694_100736063 515
574 3300025949 Ga0207667_10001036 Ga0207667_1000103615 515
575 3300025949 Ga0207667_10004873 Ga0207667_100048736 515
576 3300028379 Ga0268266_10190719 Ga0268266_101907191 515
577 3300028800 Ga0265338_10000120 Ga0265338_10000120142 515
578 3300031911 Ga0307412_10074548 Ga0307412_100745482 515
579 3300032002 Ga0307416_100021834 Ga0307416_1000218342 515
580 3300037312 Ga0395899_0000097 Ga0395899_0000097_33417_34964 515
581 3300037312 Ga0395899_0018716 Ga0395899_0018716_2229_3776 515
582 3300037312 Ga0395899_0073647 Ga0395899_0073647_523_2070 515
583 3300037312 Ga0395899_0133360 Ga0395899_0133360_14_1561 515
584 3300037418 Ga0395900_0000015 Ga0395900_0000015_264982_266529 515
585 3300037418 Ga0395900_0000395 Ga0395900_0000395_33417_34964 515
586 3300037418 Ga0395900_0018169 Ga0395900_0018169_762_2309 515
587 3300037418 Ga0395900_0116999 Ga0395900_0116999_181_1728 515
588 3300037466 Ga0395898_0000407 Ga0395898_0000407_33212_34759 515
589 3300037466 Ga0395898_0008219 Ga0395898_0008219_7509_9056 515
590 3300037466 Ga0395898_0031397 Ga0395898_0031397_1646_3193 515
591 3300037466 Ga0395898_0060868 Ga0395898_0060868_504_2051 515
592 3300037471 Ga0395905_0019841 Ga0395905_0019841_1884_3431 515
593 3300038443 Ga0395901_0000034 Ga0395901_0000034_149348_150895 515
594 3300038443 Ga0395901_0000286 Ga0395901_0000286_29945_31492 515
595 3300038443 Ga0395901_0000749 Ga0395901_0000749_22500_24047 515
596 3300038443 Ga0395901_0005216 Ga0395901_0005216_4688_6235 515
597 3300039447 Ga0436361_0287674 Ga0436361_0287674_6693_8351 515
598 3300042005 Ga0439448_0000090 Ga0439448_0000090_9833_11380 515
599 3300044656 Ga0466969_0000058 Ga0466969_0000058_20039_21586 515
600 3300044684 Ga0466966_0000056 Ga0466966_0000056_72295_73842 515
601 3300044684 Ga0466966_0001358 Ga0466966_0001358_4942_6489 515
602 3300044684 Ga0466966_0004514 Ga0466966_0004514_4803_6350 515
603 3300044684 Ga0466966_0091225 Ga0466966_0091225_146_1693 515
604 3300044693 Ga0466961_0001394 Ga0466961_0001394_5752_7299 515
605 3300044694 Ga0466963_0010033 Ga0466963_0010033_2152_3699 515
606 3300044719 Ga0466971_0000153 Ga0466971_0000153_14414_15961 515
607 3300044719 Ga0466971_0016502 Ga0466971_0016502_1537_3084 515
608 3300044842 Ga0466957_0001504 Ga0466957_0001504_236_1783 515
609 3300044842 Ga0466957_0021153 Ga0466957_0021153_1092_2639 515
610 3300045049 Ga0466959_0009834 Ga0466959_0009834_5219_6766 515
611 3300045049 Ga0466959_0014547 Ga0466959_0014547_2318_3865 515
612 3300045049 Ga0466959_0065508 Ga0466959_0065508_941_2488 515
613 3300045836 Ga0466958_0002594 Ga0466958_0002594_7373_8920 515
614 3300045836 Ga0466958_0003108 Ga0466958_0003108_3296_4843 515
615 3300045836 Ga0466958_0019114 Ga0466958_0019114_556_2103 515
616 3300045836 Ga0466958_0094502 Ga0466958_0094502_107_1654 515
617 3300046455 Ga0495603_0009381 Ga0495603_0009381_1945_3495 515
618 3300046457 Ga0495590_0000793 Ga0495590_0000793_7127_8674 515
619 3300046459 Ga0495629_0000603 Ga0495629_0000603_12779_14326 515
620 3300046460 Ga0495638_0008272 Ga0495638_0008272_3006_4553 515
621 3300046463 Ga0495653_0012400 Ga0495653_0012400_1828_3375 515
622 3300046471 Ga0495650_0001004 Ga0495650_0001004_14804_16351 515
623 3300046472 Ga0495580_0006454 Ga0495580_0006454_220_1767 515
624 3300046472 Ga0495580_0018687 Ga0495580_0018687_140_1690 515
625 3300046472 Ga0495580_0076340 Ga0495580_0076340_521_2068 515
626 3300046474 Ga0495605_0000944 Ga0495605_0000944_17668_19215 515
627 3300046477 Ga0495664_0016362 Ga0495664_0016362_1657_3204 515
628 3300046491 Ga0495584_0029159 Ga0495584_0029159_368_1915 515
629 3300046501 Ga0495607_0014638 Ga0495607_0014638_2965_4512 515
630 3300046506 Ga0495583_0009098 Ga0495583_0009098_536_2086 515
631 3300046507 Ga0495606_0043950 Ga0495606_0043950_430_1977 515
632 3300046513 Ga0495616_0026345 Ga0495616_0026345_202_1752 515
633 3300046516 Ga0495628_0020514 Ga0495628_0020514_1328_2875 515
634 3300046528 Ga0495642_0006836 Ga0495642_0006836_2301_3848 515
635 3300046529 Ga0495652_0041335 Ga0495652_0041335_449_1996 515
636 3300046531 Ga0495665_0000847 Ga0495665_0000847_1819_3366 515
637 3300046543 Ga0495645_0005494 Ga0495645_0005494_2320_3867 515
638 3300046543 Ga0495645_0056773 Ga0495645_0056773_334_1881 515
639 3300046663 Ga0495635_0020482 Ga0495635_0020482_1237_2784 515
640 3300046679 Ga0495623_0022023 Ga0495623_0022023_2151_3698 515
641 3300046680 Ga0495646_0021802 Ga0495646_0021802_1070_2617 515
642 3300046690 Ga0495624_0079618 Ga0495624_0079618_168_1715 515
643 3300046794 Ga0495589_0042731 Ga0495589_0042731_413_1960 515
644 3300046810 Ga0495660_0038435 Ga0495660_0038435_903_2450 515
645 3300047315 Ga0495581_0014880 Ga0495581_0014880_2133_3680 515
646 3300047317 Ga0495604_0012609 Ga0495604_0012609_1906_3453 515
647 3300047319 Ga0495674_0009162 Ga0495674_0009162_6365_7912 515
648 3300047319 Ga0495674_0052252 Ga0495674_0052252_749_2299 515
649 3300047320 Ga0495672_0017301 Ga0495672_0017301_970_2520 515
650 3300047322 Ga0495680_0024094 Ga0495680_0024094_192_1739 515
651 3300047323 Ga0495683_0001648 Ga0495683_0001648_2374_3921 515
652 3300047443 Ga0495687_000021 Ga0495687_000021_305036_306583 515
653 3300047469 Ga0495673_0003469 Ga0495673_0003469_8058_9608 515
654 3300047472 Ga0495686_0000359 Ga0495686_0000359_14340_15887 515
655 3300047673 Ga0495593_0008241 Ga0495593_0008241_3186_4733 515
656 3300048088 Ga0495602_0119776 Ga0495602_0119776_333_1880 515
657 3300048903 Ga0496100_0000962 Ga0496100_0000962_12104_13654 515
658 3300048904 Ga0496101_0001410 Ga0496101_0001410_12666_14216 515
659 3300048904 Ga0496101_0009353 Ga0496101_0009353_1096_2646 515
660 3300048904 Ga0496101_0039728 Ga0496101_0039728_672_2219 515
661 3300048905 Ga0496102_0000804 Ga0496102_0000804_13263_14813 515
662 3300048905 Ga0496102_0011420 Ga0496102_0011420_3806_5353 515
663 3300048905 Ga0496102_0031498 Ga0496102_0031498_2626_4173 515
664 3300048906 Ga0496103_0001211 Ga0496103_0001211_1004_2554 515
665 3300048906 Ga0496103_0002846 Ga0496103_0002846_8812_10359 515
666 3300048907 Ga0496104_0159829 Ga0496104_0159829_65_1615 515
667 3300048907 Ga0496104_0176998 Ga0496104_0176998_71_1621 515
668 3300048908 Ga0496105_0021028 Ga0496105_0021028_1162_2709 515
669 3300048913 Ga0496110_0010877 Ga0496110_0010877_3321_4868 515
670 3300048915 Ga0496112_0238561 Ga0496112_0238561_80_1630 515
671 3300048917 Ga0496114_0004112 Ga0496114_0004112_6425_7972 515
672 3300048918 Ga0496115_0077316 Ga0496115_0077316_1115_2665 515
673 3300048919 Ga0496116_0005618 Ga0496116_0005618_3522_5069 515
674 3300048920 Ga0496117_0000524 Ga0496117_0000524_46649_48199 515
675 3300048921 Ga0496118_0000495 Ga0496118_0000495_17340_18890 515
676 3300048921 Ga0496118_0006160 Ga0496118_0006160_10176_11723 515
677 3300048921 Ga0496118_0054079 Ga0496118_0054079_543_2090 515
678 3300048924 Ga0496121_0001969 Ga0496121_0001969_19030_20580 515
679 3300048924 Ga0496121_0042820 Ga0496121_0042820_167_1717 515
680 3300048925 Ga0496122_0022894 Ga0496122_0022894_402_1949 515
681 3300048928 Ga0496125_0005396 Ga0496125_0005396_8896_10443 515
682 3300048929 Ga0496126_0000032 Ga0496126_0000032_191966_193513 515
683 3300048929 Ga0496126_0002561 Ga0496126_0002561_19112_20716 515
684 3300048929 Ga0496126_0135571 Ga0496126_0135571_523_2070 515
685 3300061719 Ga0466962_0000381 Ga0466962_0000381_17333_18880 515
686 3300061719 Ga0466962_0001507 Ga0466962_0001507_2545_4092 515
687 iso_pu_bacteria 2904434214 2904436783 515
688 3300001979 JGI24740J21852_10002596 JGI24740J21852_100025963 516
689 3300001989 JGI24739J22299_10001146 JGI24739J22299_100011466 516
690 3300002075 JGI24738J21930_10000246 JGI24738J21930_100002465 516
691 3300003214 JGI25165J46597_1001354 JGI25165J46597_10013541 516
692 3300003758 Ga0055532_1000069 Ga0055532_100006968 516
693 3300003760 Ga0055527_1000034 Ga0055527_100003468 516
694 3300003761 Ga0055535_1000049 Ga0055535_100004968 516
695 3300003762 Ga0055542_1000077 Ga0055542_100007765 516
696 3300003763 Ga0055529_1000090 Ga0055529_100009067 516
697 3300005367 Ga0070667_100061177 Ga0070667_1000611771 516
698 3300009011 Ga0105251_10000229 Ga0105251_1000022936 516
699 3300013105 Ga0157369_10049957 Ga0157369_100499574 516
700 3300013105 Ga0157369_10142702 Ga0157369_101427021 516
701 3300015262 Ga0182007_10000599 Ga0182007_100005999 516
702 3300025226 Ga0209674_100139 Ga0209674_10013961 516
703 3300025226 Ga0209674_100191 Ga0209674_10019124 516
704 3300025228 Ga0209672_100002 Ga0209672_1000021412 516
705 3300025229 Ga0209147_100003 Ga0209147_1000031412 516
706 3300025242 Ga0209258_100077 Ga0209258_10007767 516
707 3300025253 Ga0209677_107415 Ga0209677_1074151 516
708 3300025254 Ga0209148_1000006 Ga0209148_10000061412 516
709 3300025256 Ga0209759_1000170 Ga0209759_100017061 516
710 3300025256 Ga0209759_1000225 Ga0209759_100022550 516
711 3300025256 Ga0209759_1000528 Ga0209759_100052827 516
712 3300025261 Ga0209233_1000177 Ga0209233_100017761 516
713 3300025272 Ga0209455_1000140 Ga0209455_100014063 516
714 3300025735 Ga0207713_1000201 Ga0207713_100020132 516
715 3300025904 Ga0207647_10014264 Ga0207647_100142644 516
716 3300025986 Ga0207658_10048942 Ga0207658_100489422 516
717 3300027312 Ga0209371_1006474 Ga0209371_10064743 516
718 3300028800 Ga0265338_10003187 Ga0265338_1000318712 516
719 3300030500 Ga0268256_1004605 Ga0268256_10046054 516
720 3300031911 Ga0307412_10000064 Ga0307412_1000006450 516
721 3300046454 Ga0495592_0009940 Ga0495592_0009940_1002_2552 516
722 3300046457 Ga0495590_0007602 Ga0495590_0007602_1634_3184 516
723 3300046458 Ga0495591_001444 Ga0495591_001444_12365_13915 516
724 3300046459 Ga0495629_0000127 Ga0495629_0000127_12815_14365 516
725 3300046459 Ga0495629_0005148 Ga0495629_0005148_7316_8866 516
726 3300046459 Ga0495629_0007698 Ga0495629_0007698_4298_5848 516
727 3300046462 Ga0495651_0016250 Ga0495651_0016250_834_2384 516
728 3300046462 Ga0495651_0017264 Ga0495651_0017264_946_2496 516
729 3300046463 Ga0495653_0025135 Ga0495653_0025135_649_2199 516
730 3300046463 Ga0495653_0048303 Ga0495653_0048303_844_2394 516
731 3300046471 Ga0495650_0010678 Ga0495650_0010678_3005_4555 516
732 3300046471 Ga0495650_0011780 Ga0495650_0011780_2044_3594 516
733 3300046472 Ga0495580_0000446 Ga0495580_0000446_5684_7234 516
734 3300046473 Ga0495582_0007276 Ga0495582_0007276_755_2305 516
735 3300046477 Ga0495664_0001378 Ga0495664_0001378_8041_9591 516
736 3300046477 Ga0495664_0049960 Ga0495664_0049960_173_1723 516
737 3300046500 Ga0495596_0004771 Ga0495596_0004771_4046_5596 516
738 3300046511 Ga0495608_0007243 Ga0495608_0007243_4541_6091 516
739 3300046511 Ga0495608_0008287 Ga0495608_0008287_851_2401 516
740 3300046512 Ga0495610_0011050 Ga0495610_0011050_3849_5399 516
741 3300046514 Ga0495618_0002566 Ga0495618_0002566_4872_6422 516
742 3300046515 Ga0495620_0006423 Ga0495620_0006423_988_2538 516
743 3300046516 Ga0495628_0019645 Ga0495628_0019645_84_1634 516
744 3300046517 Ga0495630_0008675 Ga0495630_0008675_897_2447 516
745 3300046526 Ga0495666_0002990 Ga0495666_0002990_513_2063 516
746 3300046526 Ga0495666_0003686 Ga0495666_0003686_174_1724 516
747 3300046529 Ga0495652_0025290 Ga0495652_0025290_3137_4687 516
748 3300046529 Ga0495652_0027133 Ga0495652_0027133_3032_4582 516
749 3300046531 Ga0495665_0010583 Ga0495665_0010583_3009_4559 516
750 3300046533 Ga0495640_0008055 Ga0495640_0008055_2243_3793 516
751 3300046533 Ga0495640_0015844 Ga0495640_0015844_2377_3927 516
752 3300046535 Ga0495586_0006070 Ga0495586_0006070_4314_5864 516
753 3300046536 Ga0495587_0041775 Ga0495587_0041775_317_1867 516
754 3300046543 Ga0495645_0010213 Ga0495645_0010213_591_2141 516
755 3300046557 Ga0495622_0000569 Ga0495622_0000569_926_2539 516
756 3300046642 Ga0495634_0011287 Ga0495634_0011287_4782_6332 516
757 3300046663 Ga0495635_0003456 Ga0495635_0003456_2110_3660 516
758 3300046665 Ga0495661_0012334 Ga0495661_0012334_3645_5195 516
759 3300046665 Ga0495661_0023351 Ga0495661_0023351_1649_3199 516
760 3300046678 Ga0495599_0012327 Ga0495599_0012327_1456_3006 516
761 3300046679 Ga0495623_0000742 Ga0495623_0000742_20025_21575 516
762 3300046680 Ga0495646_0065387 Ga0495646_0065387_346_1896 516
763 3300046690 Ga0495624_0001035 Ga0495624_0001035_104_1654 516
764 3300046690 Ga0495624_0014858 Ga0495624_0014858_2464_4014 516
765 3300046690 Ga0495624_0039164 Ga0495624_0039164_312_1862 516
766 3300046692 Ga0495671_0014053 Ga0495671_0014053_1529_3079 516
767 3300046694 Ga0495649_0001361 Ga0495649_0001361_5873_7423 516
768 3300046794 Ga0495589_0034227 Ga0495589_0034227_881_2431 516
769 3300046809 Ga0495600_0003804 Ga0495600_0003804_5157_6707 516
770 3300046809 Ga0495600_0011875 Ga0495600_0011875_3424_4974 516
771 3300047315 Ga0495581_0005065 Ga0495581_0005065_5365_6915 516
772 3300047315 Ga0495581_0005314 Ga0495581_0005314_2035_3585 516
773 3300047317 Ga0495604_0020119 Ga0495604_0020119_1300_2850 516
774 3300047317 Ga0495604_0038821 Ga0495604_0038821_1654_3204 516
775 3300047319 Ga0495674_0021737 Ga0495674_0021737_1868_3418 516
776 3300047322 Ga0495680_0009277 Ga0495680_0009277_4176_5726 516
777 3300047323 Ga0495683_0023295 Ga0495683_0023295_1365_2915 516
778 3300047323 Ga0495683_0034569 Ga0495683_0034569_963_2513 516
779 3300047444 Ga0495675_0002109 Ga0495675_0002109_8080_9630 516
780 3300047446 Ga0495679_000104 Ga0495679_000104_61767_63317 516
781 3300047446 Ga0495679_000319 Ga0495679_000319_2313_3863 516
782 3300047446 Ga0495679_001217 Ga0495679_001217_4549_6099 516
783 3300048088 Ga0495602_0003039 Ga0495602_0003039_14029_15579 516
784 3300048088 Ga0495602_0017115 Ga0495602_0017115_1600_3150 516
785 3300048089 Ga0495614_0004883 Ga0495614_0004883_434_1984 516
786 3300048089 Ga0495614_0005108 Ga0495614_0005108_1907_3457 516
787 3300048089 Ga0495614_0035098 Ga0495614_0035098_590_2140 516
788 3300048091 Ga0495626_0017527 Ga0495626_0017527_934_2484 516
789 3300048091 Ga0495626_0019380 Ga0495626_0019380_69_1619 516
790 3300048921 Ga0496118_0003624 Ga0496118_0003624_14547_16097 516
791 3300048921 Ga0496118_0038595 Ga0496118_0038595_2009_3559 516
792 3300048924 Ga0496121_0004727 Ga0496121_0004727_15566_17176 516
793 3300048929 Ga0496126_0002719 Ga0496126_0002719_20330_21880 516
794 3300048929 Ga0496126_0003005 Ga0496126_0003005_685_2295 516

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13537

GATase_7

Glutamine amidotransferase domain

18

157

0.91

PF00156

Pribosyltran

Phosphoribosyl transferase domain

214

341

0.82

PF13522

GATase_6

Glutamine amidotransferase domain

3

151

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
8w7d-assembly1.cif.gz_B crystal structure of ecppat-fr901483 complex 0.9693 2 480
1ecb-assembly2.cif.gz_D escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase complexed with 2 gmp, 1 mg per subunit 0.9679 2 481
8w7d-assembly1.cif.gz_D crystal structure of ecppat-fr901483 complex 0.9664 2 480
8w7d-assembly1.cif.gz_B crystal structure of ecppat-fr901483 complex 0.9652 2 480
1ecb-assembly2.cif.gz_D escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase complexed with 2 gmp, 1 mg per subunit 0.9639 2 481
ID Description Score Start End Superfamily
af_P87171_221_328_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9701 359 395 3.40.50.2020
1ecfA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9609 278 445 3.40.50.2020
1eccB01 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9529 2 492 3.60.20.10
1eccB01 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9473 2 492 3.60.20.10
1ecfA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9403 278 445 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A2I7N4G6-F1-model_v4 Amidophosphoribosyltransferase (ATase) (EC 2.4.2.14) (Glutamine phosphoribosylpyrophosphate amidotransferase) (GPATase) 0.9795 1 481 GO:0004044
GO:0006189
GO:0009113
AF-A0A350ZZK4-F1-model_v4 Amidophosphoribosyltransferase 0.9788 1 308 GO:0016757
AF-A0A3D4TTE0-F1-model_v4 Amidophosphoribosyltransferase 0.9773 109 238 GO:0016757
AF-A0A350ZZK4-F1-model_v4 Amidophosphoribosyltransferase 0.9756 1 308 GO:0016757
AF-A0A259PQ36-F1-model_v4 Amidophosphoribosyltransferase 0.9745 1 292 GO:0016757

Feature Viewer

pLDDT pTM Quality
86.32 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map