F481122

General Info

Members Datasets Scaffolds Average Seq Length
795 236 1590 156

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100066384|Ga0070669_1000663842
Length 167
Sequence MDMVTGMDVVQNYGWLIVIVLALVVAFLLFRPRQRVRLTDSAPVRPHMQQSKRAEGRGLAGEAAAATSDVTGQLLGAPVRRELAGGSVPGDDFCRMKGVGPKFADALHTLGFNRFEQLAHLTPTEIERLDGQLGAFSGRLARDRVAQQADYLARNDIDGYEQTFGRL

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
183 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
184 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
189 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
200 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
201 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
202 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
209 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
210 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
213 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
216 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
217 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
218 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.77
Rhizosphere 97.23
Stem 0
Stem Tuber 0
Unclassified 5.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100066384 3300005353 Bacteria 2659
2 JGI24736J21556_1011017 3300001904 Bacteria 1473
3 JGI24747J21853_1010869 3300001978 Bacteria 915
4 JGI24740J21852_10004149 3300001979 Bacteria 6255
5 JGI24740J21852_10014344 3300001979 Bacteria 2926
6 JGI24739J22299_10003637 3300001989 Bacteria 5887
7 JGI24739J22299_10009865 3300001989 Bacteria 3550
8 JGI24739J22299_10017023 3300001989 Bacteria 2626
9 JGI24739J22299_10054152 3300001989 Unclassified 1286
10 JGI24737J22298_10001142 3300001990 Bacteria 9352
11 JGI24737J22298_10002230 3300001990 Bacteria 6910
12 JGI24737J22298_10008532 3300001990 Bacteria 3427
13 JGI24737J22298_10070802 3300001990 Bacteria 1041
14 JGI24735J21928_10016182 3300002067 Bacteria 2319
15 JGI24735J21928_10047091 3300002067 Bacteria 1250
16 JGI24750J21931_1018490 3300002070 Unclassified 960
17 JGI24745J21846_1009001 3300002073 Unclassified 1128
18 JGI24748J21848_1017038 3300002074 Unclassified 869
19 JGI24738J21930_10001221 3300002075 Bacteria 7217
20 JGI24738J21930_10004432 3300002075 Bacteria 3440
21 JGI24034J26672_10002153 3300002239 Bacteria 2685
22 Ga0065715_10253725 3300005293 Bacteria 1159
23 Ga0070658_10002368 3300005327 Bacteria 15812
24 Ga0070658_10004321 3300005327 Bacteria 11607
25 Ga0070658_10017631 3300005327 Bacteria 5711
26 Ga0070658_10021815 3300005327 Bacteria 5133
27 Ga0070658_10046899 3300005327 Bacteria 3496
28 Ga0070676_10009122 3300005328 Bacteria 5366
29 Ga0070676_10016276 3300005328 Bacteria 4110
30 Ga0070676_10157577 3300005328 Bacteria 1458
31 Ga0070683_100011282 3300005329 Bacteria 7714
32 Ga0070683_100026339 3300005329 Bacteria 5234
33 Ga0070683_100310855 3300005329 Bacteria 1500
34 Ga0070683_101771961 3300005329 Bacteria 594
35 Ga0070690_100477420 3300005330 Bacteria 929
36 Ga0070690_100935271 3300005330 Bacteria 680
37 Ga0070690_101034409 3300005330 Unclassified 648
38 Ga0070670_100015599 3300005331 Bacteria 6525
39 Ga0070670_100057321 3300005331 Bacteria 3344
40 Ga0070670_100134282 3300005331 Bacteria 2138
41 Ga0070670_100227074 3300005331 Bacteria 1625
42 Ga0070670_100303126 3300005331 Bacteria 1398
43 Ga0070670_100578035 3300005331 Bacteria 1004
44 Ga0070677_10018029 3300005333 Bacteria 2538
45 Ga0070677_10065743 3300005333 Bacteria 1510
46 Ga0068869_100001204 3300005334 Bacteria 15210
47 Ga0068869_100433617 3300005334 Unclassified 1086
48 Ga0068869_100459731 3300005334 Unclassified 1056
49 Ga0070666_10003007 3300005335 Bacteria 10225
50 Ga0070666_10004343 3300005335 Bacteria 8631
51 Ga0070666_10010255 3300005335 Bacteria 5856
52 Ga0070666_10025126 3300005335 Bacteria 3882
53 Ga0070680_100137913 3300005336 Bacteria 2044
54 Ga0070682_100009611 3300005337 Bacteria 5474
55 Ga0070682_100034100 3300005337 Bacteria 3097
56 Ga0070682_100132126 3300005337 Bacteria 1691
57 Ga0070682_100158941 3300005337 Bacteria 1559
58 Ga0070682_100516071 3300005337 Bacteria 929
59 Ga0070682_101171143 3300005337 Unclassified 647
60 Ga0068868_100008744 3300005338 Bacteria 7253
61 Ga0068868_100024903 3300005338 Bacteria 4544
62 Ga0068868_100126959 3300005338 Bacteria 2085
63 Ga0068868_100315438 3300005338 Bacteria 1331
64 Ga0068868_100440890 3300005338 Bacteria 1131
65 Ga0070660_100000707 3300005339 Bacteria 22075
66 Ga0070660_100002605 3300005339 Bacteria 12382
67 Ga0070660_100010336 3300005339 Bacteria 6592
68 Ga0070660_100017344 3300005339 Bacteria 5247
69 Ga0070660_100027251 3300005339 Bacteria 4262
70 Ga0070660_100029310 3300005339 Bacteria 4124
71 Ga0070660_100043082 3300005339 Bacteria 3448
72 Ga0070660_100087739 3300005339 Bacteria 2448
73 Ga0070660_100139947 3300005339 Bacteria 1941
74 Ga0070660_100196674 3300005339 Bacteria 1635
75 Ga0070660_100264514 3300005339 Bacteria 1405
76 Ga0070660_100601374 3300005339 Bacteria 919
77 Ga0070689_100061465 3300005340 Bacteria 2922
78 Ga0070689_100185031 3300005340 Bacteria 1694
79 Ga0070689_100865447 3300005340 Bacteria 798
80 Ga0070691_10330500 3300005341 Bacteria 841
81 Ga0070661_100000101 3300005344 Bacteria 70279
82 Ga0070661_100021284 3300005344 Bacteria 4629
83 Ga0070661_100050591 3300005344 Bacteria 3040
84 Ga0070661_100323171 3300005344 Bacteria 1205
85 Ga0070661_100612887 3300005344 Bacteria 881
86 Ga0070692_10014214 3300005345 Bacteria 3732
87 Ga0070668_100003013 3300005347 Bacteria 12454
88 Ga0070668_100028225 3300005347 Bacteria 4261
89 Ga0070668_100047377 3300005347 Bacteria 3305
90 Ga0070668_100951460 3300005347 Bacteria 770
91 Ga0070669_100000586 3300005353 Bacteria 27126
92 Ga0070669_100019826 3300005353 Bacteria 4806
93 Ga0070669_100126419 3300005353 Bacteria 1956
94 Ga0070675_100106045 3300005354 Bacteria 2372
95 Ga0070675_100116297 3300005354 Bacteria 2268
96 Ga0070671_100004297 3300005355 Bacteria 11276
97 Ga0070671_100008668 3300005355 Bacteria 8159
98 Ga0070671_100019486 3300005355 Bacteria 5523
99 Ga0070671_100021423 3300005355 Bacteria 5277
100 Ga0070671_100047215 3300005355 Bacteria 3582
101 Ga0070674_100181629 3300005356 Bacteria 1612
102 Ga0070674_100352987 3300005356 Bacteria 1188
103 Ga0070673_100002689 3300005364 Bacteria 10890
104 Ga0070673_100015397 3300005364 Bacteria 5370
105 Ga0070673_100146087 3300005364 Bacteria 1999
106 Ga0070673_100172936 3300005364 Bacteria 1844
107 Ga0070673_100193667 3300005364 Bacteria 1747
108 Ga0070673_100431045 3300005364 Bacteria 1183
109 Ga0070673_100909639 3300005364 Bacteria 816
110 Ga0070659_100000045 3300005366 Bacteria 101520
111 Ga0070659_100001641 3300005366 Bacteria 16121
112 Ga0070659_100002860 3300005366 Bacteria 12286
113 Ga0070659_100019107 3300005366 Bacteria 5183
114 Ga0070659_100021139 3300005366 Bacteria 4951
115 Ga0070659_100028950 3300005366 Bacteria 4279
116 Ga0070659_100037756 3300005366 Bacteria 3766
117 Ga0070659_100044678 3300005366 Bacteria 3469
118 Ga0070659_100047199 3300005366 Bacteria 3377
119 Ga0070659_100073070 3300005366 Bacteria 2730
120 Ga0070659_100099714 3300005366 Bacteria 2337
121 Ga0070667_100012215 3300005367 Bacteria 7104
122 Ga0070667_100014809 3300005367 Bacteria 6442
123 Ga0070667_100044346 3300005367 Bacteria 3734
124 Ga0070667_100239156 3300005367 Bacteria 1621
125 Ga0070667_100377545 3300005367 Bacteria 1287
126 Ga0070667_100497275 3300005367 Bacteria 1117
127 Ga0070709_10011406 3300005434 Bacteria 4953
128 Ga0070714_100017781 3300005435 Bacteria 5764
129 Ga0070714_100038579 3300005435 Bacteria 4016
130 Ga0070714_100164829 3300005435 Bacteria 2008
131 Ga0070714_100460517 3300005435 Bacteria 1209
132 Ga0070714_100497261 3300005435 Bacteria 1163
133 Ga0070713_100095262 3300005436 Bacteria 2567
134 Ga0070713_101148747 3300005436 Bacteria 751
135 Ga0070701_10575874 3300005438 Bacteria 742
136 Ga0070701_10720970 3300005438 Bacteria 673
137 Ga0070694_100016905 3300005444 Bacteria 4600
138 Ga0070694_100199703 3300005444 Bacteria 1490
139 Ga0070663_100003510 3300005455 Bacteria 9053
140 Ga0070663_100025119 3300005455 Bacteria 4020
141 Ga0070663_100058913 3300005455 Bacteria 2759
142 Ga0070663_100114736 3300005455 Bacteria 2028
143 Ga0070663_100151992 3300005455 Bacteria 1776
144 Ga0070663_100187969 3300005455 Bacteria 1606
145 Ga0070663_100205452 3300005455 Bacteria 1539
146 Ga0070663_100527422 3300005455 Bacteria 984
147 Ga0070678_100193257 3300005456 Bacteria 1675
148 Ga0070662_100000036 3300005457 Bacteria 77190
149 Ga0070662_100002851 3300005457 Bacteria 10717
150 Ga0070662_100006598 3300005457 Bacteria 7491
151 Ga0070662_100031286 3300005457 Bacteria 3734
152 Ga0070662_100111720 3300005457 Bacteria 2082
153 Ga0070662_100224009 3300005457 Bacteria 1502
154 Ga0070662_100560825 3300005457 Bacteria 958
155 Ga0070662_100692088 3300005457 Bacteria 862
156 Ga0070681_10067243 3300005458 Bacteria 3552
157 Ga0070681_10403768 3300005458 Bacteria 1278
158 Ga0070681_10903066 3300005458 Bacteria 802
159 Ga0068867_100001360 3300005459 Bacteria 16886
160 Ga0068867_100014025 3300005459 Bacteria 5677
161 Ga0068867_100065310 3300005459 Bacteria 2708
162 Ga0068867_100130154 3300005459 Bacteria 1955
163 Ga0068867_100836040 3300005459 Unclassified 824
164 Ga0070685_10060544 3300005466 Bacteria 2214
165 Ga0070706_100082724 3300005467 Bacteria 2974
166 Ga0070679_100137711 3300005530 Bacteria 2422
167 Ga0070679_100600454 3300005530 Bacteria 1044
168 Ga0070684_100031557 3300005535 Bacteria 4511
169 Ga0070684_100191277 3300005535 Bacteria 1862
170 Ga0070684_100930864 3300005535 Bacteria 815
171 Ga0070684_101055845 3300005535 Bacteria 763
172 Ga0068853_100000059 3300005539 Bacteria 78301
173 Ga0068853_100002189 3300005539 Bacteria 14573
174 Ga0068853_100054236 3300005539 Bacteria 3454
175 Ga0068853_100145133 3300005539 Bacteria 2132
176 Ga0068853_100165904 3300005539 Bacteria 1996
177 Ga0068853_100306112 3300005539 Unclassified 1470
178 Ga0068853_100360470 3300005539 Bacteria 1354
179 Ga0068853_100915482 3300005539 Bacteria 842
180 Ga0068853_101546608 3300005539 Bacteria 642
181 Ga0070672_100001067 3300005543 Bacteria 16705
182 Ga0070672_100070973 3300005543 Bacteria 2769
183 Ga0070672_100116908 3300005543 Bacteria 2179
184 Ga0070672_100385074 3300005543 Bacteria 1200
185 Ga0070686_100490244 3300005544 Bacteria 952
186 Ga0070686_101161953 3300005544 Bacteria 640
187 Ga0070695_100297043 3300005545 Bacteria 1192
188 Ga0070695_100374120 3300005545 Bacteria 1073
189 Ga0070696_100005040 3300005546 Bacteria 8824
190 Ga0070696_100195499 3300005546 Bacteria 1507
191 Ga0070696_100197756 3300005546 Bacteria 1499
192 Ga0070696_100280466 3300005546 Bacteria 1270
193 Ga0070693_100010656 3300005547 Bacteria 4610
194 Ga0070693_100112185 3300005547 Bacteria 1679
195 Ga0070693_100192532 3300005547 Bacteria 1320
196 Ga0070693_100387860 3300005547 Bacteria 965
197 Ga0070693_100462568 3300005547 Bacteria 893
198 Ga0070665_100001939 3300005548 Bacteria 23328
199 Ga0070665_100016195 3300005548 Bacteria 7480
200 Ga0070665_100021070 3300005548 Bacteria 6554
201 Ga0070665_100197869 3300005548 Bacteria 2010
202 Ga0070665_100522148 3300005548 Bacteria 1199
203 Ga0070665_101458620 3300005548 Bacteria 693
204 Ga0070665_101772415 3300005548 Bacteria 624
205 Ga0070704_100660399 3300005549 Bacteria 924
206 Ga0068855_100002788 3300005563 Bacteria 21511
207 Ga0068855_100008706 3300005563 Bacteria 12268
208 Ga0068855_100582078 3300005563 Bacteria 1209
209 Ga0070664_100000027 3300005564 Bacteria 90881
210 Ga0070664_100009763 3300005564 Bacteria 7777
211 Ga0070664_100020358 3300005564 Bacteria 5463
212 Ga0070664_100022533 3300005564 Bacteria 5195
213 Ga0070664_100025064 3300005564 Bacteria 4942
214 Ga0070664_100032786 3300005564 Bacteria 4346
215 Ga0070664_100052991 3300005564 Bacteria 3437
216 Ga0070664_100230847 3300005564 Bacteria 1659
217 Ga0070664_101705703 3300005564 Unclassified 597
218 Ga0068857_100000338 3300005577 Bacteria 32330
219 Ga0068857_100036208 3300005577 Bacteria 4373
220 Ga0068857_100069669 3300005577 Bacteria 3132
221 Ga0068857_100109855 3300005577 Bacteria 2478
222 Ga0068857_100297878 3300005577 Bacteria 1486
223 Ga0068857_100541972 3300005577 Bacteria 1095
224 Ga0068854_100003108 3300005578 Bacteria 10326
225 Ga0068854_100006902 3300005578 Bacteria 7242
226 Ga0068854_100011498 3300005578 Bacteria 5766
227 Ga0068854_100029408 3300005578 Bacteria 3803
228 Ga0068854_100470454 3300005578 Bacteria 1053
229 Ga0068856_100000699 3300005614 Bacteria 36354
230 Ga0068856_100107442 3300005614 Bacteria 2786
231 Ga0068856_102076454 3300005614 Unclassified 578
232 Ga0068852_100000647 3300005616 Bacteria 22808
233 Ga0068852_100001883 3300005616 Bacteria 14288
234 Ga0068852_100015749 3300005616 Bacteria 5878
235 Ga0068852_100026751 3300005616 Bacteria 4695
236 Ga0068852_100091561 3300005616 Bacteria 2721
237 Ga0068852_100131887 3300005616 Bacteria 2302
238 Ga0068852_100165719 3300005616 Bacteria 2067
239 Ga0068852_100404930 3300005616 Bacteria 1343
240 Ga0068852_100481346 3300005616 Bacteria 1233
241 Ga0068859_100028239 3300005617 Bacteria 5624
242 Ga0068859_100136456 3300005617 Bacteria 2526
243 Ga0068859_101157257 3300005617 Bacteria 851
244 Ga0068864_100003779 3300005618 Bacteria 12491
245 Ga0068864_100010362 3300005618 Bacteria 7698
246 Ga0068864_100017251 3300005618 Bacteria 6020
247 Ga0068864_100375899 3300005618 Bacteria 1345
248 Ga0068864_100421740 3300005618 Bacteria 1271
249 Ga0068866_10077447 3300005718 Bacteria 1776
250 Ga0068861_100037371 3300005719 Bacteria 3610
251 Ga0068861_100416888 3300005719 Bacteria 1195
252 Ga0068861_100723752 3300005719 Bacteria 927
253 Ga0068851_10011434 3300005834 Bacteria 4163
254 Ga0068851_10020033 3300005834 Bacteria 3235
255 Ga0068851_10048928 3300005834 Bacteria 2143
256 Ga0068851_10049043 3300005834 Bacteria 2141
257 Ga0068851_10053966 3300005834 Bacteria 2047
258 Ga0068851_10106077 3300005834 Bacteria 1496
259 Ga0068851_10119199 3300005834 Bacteria 1416
260 Ga0068863_100004975 3300005841 Bacteria 13100
261 Ga0068863_100014486 3300005841 Bacteria 7593
262 Ga0068863_100082545 3300005841 Bacteria 3046
263 Ga0068863_100334832 3300005841 Bacteria 1472
264 Ga0068858_100020405 3300005842 Bacteria 6196
265 Ga0068858_100090155 3300005842 Bacteria 2853
266 Ga0068858_100224353 3300005842 Bacteria 1780
267 Ga0068860_100004974 3300005843 Bacteria 13548
268 Ga0068860_100008094 3300005843 Bacteria 10470
269 Ga0068860_100040215 3300005843 Bacteria 4470
270 Ga0068860_100051299 3300005843 Bacteria 3926
271 Ga0068860_100172698 3300005843 Bacteria 2088
272 Ga0068860_100751997 3300005843 Bacteria 986
273 Ga0068862_100001250 3300005844 Bacteria 23893
274 Ga0068862_100044935 3300005844 Bacteria 3768
275 Ga0068862_100073993 3300005844 Bacteria 2944
276 Ga0068862_100096116 3300005844 Bacteria 2585
277 Ga0068862_100177236 3300005844 Bacteria 1911
278 Ga0070716_100030875 3300006173 Bacteria 2912
279 Ga0070712_100036332 3300006175 Bacteria 3351
280 Ga0097621_100134132 3300006237 Bacteria 2110
281 Ga0097621_100237738 3300006237 Bacteria 1592
282 Ga0097621_100249766 3300006237 Bacteria 1553
283 Ga0068871_100061511 3300006358 Bacteria 3067
284 Ga0068871_100359456 3300006358 Bacteria 1289
285 Ga0075428_100087387 3300006844 Bacteria 3401
286 Ga0075428_100512877 3300006844 Bacteria 1282
287 Ga0075431_100781362 3300006847 Bacteria 929
288 Ga0075433_10177765 3300006852 Bacteria 1893
289 Ga0075434_100262983 3300006871 Bacteria 1744
290 Ga0068865_100010731 3300006881 Bacteria 5710
291 Ga0097620_100028239 3300006931 Bacteria 5624
292 Ga0097620_100136452 3300006931 Bacteria 2526
293 Ga0097620_101157272 3300006931 Bacteria 851
294 Ga0105251_10257644 3300009011 Unclassified 787
295 Ga0105240_10496850 3300009093 Bacteria 1357
296 Ga0105240_10543941 3300009093 Bacteria 1286
297 Ga0105245_10000128 3300009098 Bacteria 72249
298 Ga0105245_11196940 3300009098 Unclassified 808
299 Ga0105247_10163273 3300009101 Bacteria 1476
300 Ga0114129_10154627 3300009147 Bacteria 3137
301 Ga0105243_10059857 3300009148 Bacteria 3041
302 Ga0105243_10169541 3300009148 Bacteria 1889
303 Ga0105243_10467695 3300009148 Bacteria 1187
304 Ga0105241_10011856 3300009174 Bacteria 6404
305 Ga0105241_10119475 3300009174 Bacteria 2120
306 Ga0105242_10055260 3300009176 Bacteria 3248
307 Ga0105248_10001529 3300009177 Bacteria 25755
308 Ga0105248_10018199 3300009177 Bacteria 7760
309 Ga0105248_10047934 3300009177 Bacteria 4792
310 Ga0105248_10234882 3300009177 Bacteria 2064
311 Ga0105248_10818079 3300009177 Bacteria 1051
312 Ga0105238_10103490 3300009551 Bacteria 2828
313 Ga0105238_10473024 3300009551 Bacteria 1252
314 Ga0105238_11656675 3300009551 Bacteria 670
315 Ga0105249_10008508 3300009553 Bacteria 8945
316 Ga0105249_10091967 3300009553 Bacteria 2839
317 Ga0105249_10686175 3300009553 Bacteria 1083
318 Ga0105239_10144028 3300010375 Bacteria 2657
319 Ga0105239_10415976 3300010375 Bacteria 1522
320 Ga0105239_12568141 3300010375 Bacteria 594
321 Ga0105246_10018165 3300011119 Bacteria 4479
322 Ga0105246_10069433 3300011119 Bacteria 2474
323 Ga0105246_12400660 3300011119 Unclassified 517
324 Ga0157373_10014869 3300013100 Bacteria 5699
325 Ga0157373_10018108 3300013100 Bacteria 5128
326 Ga0157373_10309539 3300013100 Bacteria 1122
327 Ga0157373_11189393 3300013100 Unclassified 574
328 Ga0157371_10004039 3300013102 Bacteria 12981
329 Ga0157371_10007577 3300013102 Bacteria 8760
330 Ga0157371_10039464 3300013102 Bacteria 3376
331 Ga0157371_10057055 3300013102 Bacteria 2769
332 Ga0157371_10106048 3300013102 Bacteria 1994
333 Ga0157371_10165039 3300013102 Bacteria 1582
334 Ga0157371_10174222 3300013102 Bacteria 1538
335 Ga0157371_10237046 3300013102 Bacteria 1312
336 Ga0157371_10294887 3300013102 Bacteria 1173
337 Ga0157370_10971526 3300013104 Bacteria 770
338 Ga0157369_10009511 3300013105 Bacteria 11112
339 Ga0157369_10079791 3300013105 Bacteria 3505
340 Ga0157369_10110860 3300013105 Bacteria 2917
341 Ga0157369_10361174 3300013105 Bacteria 1508
342 Ga0157374_10042575 3300013296 Bacteria 4189
343 Ga0157374_10145176 3300013296 Bacteria 2305
344 Ga0157378_10007423 3300013297 Bacteria 9576
345 Ga0157378_10132834 3300013297 Bacteria 2306
346 Ga0157378_10425660 3300013297 Bacteria 1313
347 Ga0163162_10039677 3300013306 Bacteria 4706
348 Ga0163162_10100110 3300013306 Bacteria 2990
349 Ga0163162_10630095 3300013306 Bacteria 1197
350 Ga0157372_10036624 3300013307 Bacteria 5408
351 Ga0157372_10043148 3300013307 Bacteria 4992
352 Ga0157372_11157021 3300013307 Bacteria 894
353 Ga0157372_11613165 3300013307 Unclassified 747
354 Ga0157372_11658107 3300013307 Bacteria 736
355 Ga0157375_10456985 3300013308 Bacteria 1442
356 Ga0157375_10592757 3300013308 Bacteria 1268
357 Ga0157375_11953908 3300013308 Bacteria 697
358 Ga0163163_10000187 3300014325 Bacteria 63661
359 Ga0163163_10428912 3300014325 Bacteria 1381
360 Ga0182008_10171143 3300014497 Bacteria 1096
361 Ga0157377_10005209 3300014745 Bacteria 6087
362 Ga0157377_10148532 3300014745 Bacteria 1447
363 Ga0157379_10032218 3300014968 Bacteria 4672
364 Ga0157379_10032755 3300014968 Bacteria 4634
365 Ga0157376_10285466 3300014969 Bacteria 1556
366 Ga0157376_11867066 3300014969 Bacteria 637
367 Ga0207673_1009632 3300025290 Unclassified 1236
368 Ga0207697_10000461 3300025315 Bacteria 22887
369 Ga0207697_10004406 3300025315 Bacteria 6730
370 Ga0207697_10242837 3300025315 Bacteria 796
371 Ga0207656_10034081 3300025321 Bacteria 2124
372 Ga0207656_10039243 3300025321 Bacteria 2002
373 Ga0207656_10059218 3300025321 Bacteria 1675
374 Ga0207656_10163826 3300025321 Bacteria 1059
375 Ga0207656_10307198 3300025321 Bacteria 786
376 Ga0207682_10060014 3300025893 Bacteria 1590
377 Ga0207642_10393651 3300025899 Bacteria 827
378 Ga0207688_10000063 3300025901 Bacteria 38711
379 Ga0207688_10128921 3300025901 Bacteria 1481
380 Ga0207688_10579992 3300025901 Unclassified 706
381 Ga0207680_10001103 3300025903 Bacteria 12733
382 Ga0207680_10021121 3300025903 Bacteria 3517
383 Ga0207647_10000227 3300025904 Bacteria 46631
384 Ga0207647_10006423 3300025904 Bacteria 8544
385 Ga0207647_10026763 3300025904 Bacteria 3769
386 Ga0207647_10038668 3300025904 Bacteria 3015
387 Ga0207647_10040903 3300025904 Bacteria 2917
388 Ga0207647_10066148 3300025904 Bacteria 2193
389 Ga0207699_10164019 3300025906 Bacteria 1481
390 Ga0207645_10009350 3300025907 Bacteria 6786
391 Ga0207645_10013637 3300025907 Bacteria 5469
392 Ga0207645_10017225 3300025907 Bacteria 4772
393 Ga0207645_10136558 3300025907 Bacteria 1597
394 Ga0207645_10271084 3300025907 Bacteria 1125
395 Ga0207643_10576959 3300025908 Bacteria 723
396 Ga0207705_10002358 3300025909 Bacteria 14604
397 Ga0207705_10010170 3300025909 Bacteria 6846
398 Ga0207705_10058315 3300025909 Bacteria 2785
399 Ga0207705_10075566 3300025909 Bacteria 2447
400 Ga0207705_10137978 3300025909 Unclassified 1819
401 Ga0207684_10350218 3300025910 Bacteria 1271
402 Ga0207654_10065663 3300025911 Bacteria 2137
403 Ga0207654_10238369 3300025911 Bacteria 1214
404 Ga0207707_10722377 3300025912 Bacteria 835
405 Ga0207695_10383395 3300025913 Bacteria 1291
406 Ga0207671_10640651 3300025914 Unclassified 846
407 Ga0207693_10085477 3300025915 Bacteria 2471
408 Ga0207662_10156302 3300025918 Bacteria 1454
409 Ga0207657_10002137 3300025919 Bacteria 21415
410 Ga0207657_10010539 3300025919 Bacteria 9216
411 Ga0207657_10012153 3300025919 Bacteria 8507
412 Ga0207657_10016688 3300025919 Bacteria 7075
413 Ga0207657_10018684 3300025919 Bacteria 6607
414 Ga0207657_10035538 3300025919 Bacteria 4467
415 Ga0207657_10040435 3300025919 Bacteria 4131
416 Ga0207657_10044305 3300025919 Bacteria 3912
417 Ga0207657_10107575 3300025919 Bacteria 2307
418 Ga0207657_10247054 3300025919 Bacteria 1423
419 Ga0207657_10391588 3300025919 Bacteria 1093
420 Ga0207649_10000680 3300025920 Bacteria 22565
421 Ga0207649_10012257 3300025920 Bacteria 4751
422 Ga0207649_10012575 3300025920 Bacteria 4701
423 Ga0207649_10149640 3300025920 Bacteria 1606
424 Ga0207649_10314767 3300025920 Bacteria 1148
425 Ga0207649_10731402 3300025920 Bacteria 769
426 Ga0207649_10812379 3300025920 Bacteria 730
427 Ga0207649_10838517 3300025920 Bacteria 719
428 Ga0207652_10304273 3300025921 Bacteria 1439
429 Ga0207652_11248789 3300025921 Unclassified 645
430 Ga0207681_10023221 3300025923 Bacteria 3964
431 Ga0207681_10062180 3300025923 Bacteria 2569
432 Ga0207694_10095363 3300025924 Bacteria 2352
433 Ga0207694_10103506 3300025924 Bacteria 2258
434 Ga0207694_10208150 3300025924 Bacteria 1593
435 Ga0207650_10116157 3300025925 Bacteria 2078
436 Ga0207650_10130650 3300025925 Bacteria 1965
437 Ga0207650_10211080 3300025925 Bacteria 1559
438 Ga0207650_10364181 3300025925 Bacteria 1191
439 Ga0207650_10479650 3300025925 Bacteria 1038
440 Ga0207650_11003755 3300025925 Bacteria 710
441 Ga0207659_10447474 3300025926 Bacteria 1087
442 Ga0207659_10584099 3300025926 Bacteria 952
443 Ga0207687_10003689 3300025927 Bacteria 10311
444 Ga0207687_10039592 3300025927 Bacteria 3228
445 Ga0207700_10095666 3300025928 Bacteria 2356
446 Ga0207664_10015360 3300025929 Bacteria 5553
447 Ga0207664_10042352 3300025929 Bacteria 3553
448 Ga0207664_10197801 3300025929 Bacteria 1734
449 Ga0207664_10833330 3300025929 Bacteria 829
450 Ga0207644_10005108 3300025931 Bacteria 8570
451 Ga0207644_10024036 3300025931 Bacteria 4179
452 Ga0207644_10024893 3300025931 Bacteria 4112
453 Ga0207644_10043303 3300025931 Bacteria 3194
454 Ga0207690_10000080 3300025932 Bacteria 82082
455 Ga0207690_10006498 3300025932 Bacteria 6931
456 Ga0207690_10024623 3300025932 Bacteria 3771
457 Ga0207690_10028241 3300025932 Bacteria 3555
458 Ga0207690_10043085 3300025932 Bacteria 2968
459 Ga0207690_10043684 3300025932 Bacteria 2951
460 Ga0207690_10055706 3300025932 Bacteria 2664
461 Ga0207690_10068275 3300025932 Bacteria 2441
462 Ga0207690_10086678 3300025932 Bacteria 2201
463 Ga0207690_10090953 3300025932 Bacteria 2156
464 Ga0207690_10261821 3300025932 Bacteria 1340
465 Ga0207690_10794544 3300025932 Bacteria 782
466 Ga0207706_10008913 3300025933 Bacteria 9233
467 Ga0207706_10009958 3300025933 Bacteria 8711
468 Ga0207706_10013324 3300025933 Bacteria 7481
469 Ga0207706_10025933 3300025933 Bacteria 5248
470 Ga0207706_10033346 3300025933 Bacteria 4584
471 Ga0207706_10053913 3300025933 Bacteria 3549
472 Ga0207706_10148426 3300025933 Unclassified 2062
473 Ga0207706_10190201 3300025933 Bacteria 1802
474 Ga0207706_10229967 3300025933 Bacteria 1623
475 Ga0207706_10580549 3300025933 Bacteria 964
476 Ga0207706_10582610 3300025933 Bacteria 962
477 Ga0207686_10014527 3300025934 Bacteria 4385
478 Ga0207670_10436342 3300025936 Bacteria 1054
479 Ga0207669_10060300 3300025937 Bacteria 2325
480 Ga0207669_10067901 3300025937 Bacteria 2224
481 Ga0207704_10016711 3300025938 Bacteria 3780
482 Ga0207665_10039724 3300025939 Bacteria 3137
483 Ga0207691_10000447 3300025940 Bacteria 40805
484 Ga0207691_10037018 3300025940 Bacteria 4520
485 Ga0207691_10132847 3300025940 Bacteria 2197
486 Ga0207691_10577524 3300025940 Bacteria 952
487 Ga0207711_10001739 3300025941 Bacteria 19976
488 Ga0207711_10003621 3300025941 Bacteria 13365
489 Ga0207711_10004550 3300025941 Bacteria 11798
490 Ga0207711_10486360 3300025941 Bacteria 1150
491 Ga0207711_10596662 3300025941 Bacteria 1030
492 Ga0207689_10001047 3300025942 Bacteria 26563
493 Ga0207689_10017662 3300025942 Bacteria 6029
494 Ga0207689_10024379 3300025942 Bacteria 5076
495 Ga0207689_10043608 3300025942 Bacteria 3708
496 Ga0207689_10449275 3300025942 Bacteria 1077
497 Ga0207661_10007627 3300025944 Bacteria 7694
498 Ga0207661_10012982 3300025944 Bacteria 6079
499 Ga0207679_10001226 3300025945 Bacteria 16305
500 Ga0207679_10011179 3300025945 Bacteria 5799
501 Ga0207679_10011770 3300025945 Bacteria 5683
502 Ga0207679_10024588 3300025945 Bacteria 4131
503 Ga0207679_10065070 3300025945 Bacteria 2727
504 Ga0207679_10078356 3300025945 Bacteria 2517
505 Ga0207679_10222002 3300025945 Bacteria 1590
506 Ga0207679_10289335 3300025945 Bacteria 1408
507 Ga0207679_10703204 3300025945 Bacteria 917
508 Ga0207667_10013651 3300025949 Bacteria 9285
509 Ga0207667_10126148 3300025949 Bacteria 2636
510 Ga0207667_10484247 3300025949 Bacteria 1256
511 Ga0207667_10974833 3300025949 Bacteria 836
512 Ga0207651_10030901 3300025960 Bacteria 3417
513 Ga0207651_10043572 3300025960 Bacteria 2996
514 Ga0207651_10154537 3300025960 Bacteria 1790
515 Ga0207651_10218495 3300025960 Bacteria 1539
516 Ga0207651_10623596 3300025960 Bacteria 945
517 Ga0207651_10863244 3300025960 Bacteria 805
518 Ga0207651_11309321 3300025960 Bacteria 651
519 Ga0207712_10001416 3300025961 Bacteria 16364
520 Ga0207712_10184710 3300025961 Bacteria 1641
521 Ga0207668_10001204 3300025972 Bacteria 15359
522 Ga0207668_10021749 3300025972 Bacteria 4094
523 Ga0207668_10286297 3300025972 Bacteria 1354
524 Ga0207668_11306965 3300025972 Bacteria 653
525 Ga0207640_10003003 3300025981 Bacteria 9075
526 Ga0207640_10024726 3300025981 Bacteria 3628
527 Ga0207640_10089234 3300025981 Bacteria 2131
528 Ga0207640_10094998 3300025981 Bacteria 2075
529 Ga0207640_10224195 3300025981 Bacteria 1441
530 Ga0207640_10414887 3300025981 Bacteria 1100
531 Ga0207640_10725652 3300025981 Unclassified 854
532 Ga0207658_10011037 3300025986 Bacteria 6149
533 Ga0207658_10114035 3300025986 Bacteria 2142
534 Ga0207658_10115496 3300025986 Bacteria 2130
535 Ga0207658_10248096 3300025986 Bacteria 1511
536 Ga0207658_10267106 3300025986 Bacteria 1460
537 Ga0207677_10004522 3300026023 Bacteria 7480
538 Ga0207677_10079659 3300026023 Bacteria 2343
539 Ga0207677_10332327 3300026023 Bacteria 1267
540 Ga0207677_10381667 3300026023 Bacteria 1189
541 Ga0207703_10002385 3300026035 Bacteria 16335
542 Ga0207703_10012883 3300026035 Bacteria 6521
543 Ga0207703_10067119 3300026035 Bacteria 2952
544 Ga0207703_10636858 3300026035 Bacteria 1011
545 Ga0207703_10804696 3300026035 Unclassified 897
546 Ga0207639_10042008 3300026041 Bacteria 3425
547 Ga0207639_10103460 3300026041 Bacteria 2307
548 Ga0207639_10148443 3300026041 Bacteria 1961
549 Ga0207639_10153906 3300026041 Bacteria 1929
550 Ga0207639_10269943 3300026041 Unclassified 1492
551 Ga0207639_10302230 3300026041 Bacteria 1415
552 Ga0207639_10387062 3300026041 Bacteria 1257
553 Ga0207639_11189654 3300026041 Bacteria 715
554 Ga0207678_10000995 3300026067 Bacteria 25820
555 Ga0207678_10002822 3300026067 Bacteria 15762
556 Ga0207678_10002879 3300026067 Bacteria 15626
557 Ga0207678_10022196 3300026067 Bacteria 5562
558 Ga0207678_10066618 3300026067 Bacteria 3092
559 Ga0207678_10108925 3300026067 Bacteria 2363
560 Ga0207678_10132307 3300026067 Bacteria 2128
561 Ga0207678_10166452 3300026067 Bacteria 1882
562 Ga0207678_10707841 3300026067 Bacteria 887
563 Ga0207702_10006848 3300026078 Bacteria 9776
564 Ga0207702_10154521 3300026078 Bacteria 2090
565 Ga0207702_10216338 3300026078 Bacteria 1784
566 Ga0207702_10432133 3300026078 Bacteria 1275
567 Ga0207641_10046090 3300026088 Bacteria 3674
568 Ga0207641_10076781 3300026088 Bacteria 2889
569 Ga0207641_10283463 3300026088 Bacteria 1559
570 Ga0207648_10010576 3300026089 Bacteria 8730
571 Ga0207648_10018445 3300026089 Bacteria 6318
572 Ga0207648_10048881 3300026089 Bacteria 3703
573 Ga0207648_10104445 3300026089 Bacteria 2485
574 Ga0207676_10003397 3300026095 Bacteria 11248
575 Ga0207676_10007577 3300026095 Bacteria 7702
576 Ga0207676_10019693 3300026095 Bacteria 4927
577 Ga0207676_10068788 3300026095 Bacteria 2833
578 Ga0207676_10271836 3300026095 Bacteria 1535
579 Ga0207674_10001201 3300026116 Bacteria 33701
580 Ga0207674_10025321 3300026116 Bacteria 6330
581 Ga0207674_10029023 3300026116 Bacteria 5831
582 Ga0207674_10031785 3300026116 Bacteria 5541
583 Ga0207674_10036138 3300026116 Bacteria 5151
584 Ga0207674_10041496 3300026116 Bacteria 4759
585 Ga0207674_10075858 3300026116 Bacteria 3371
586 Ga0207674_10413505 3300026116 Bacteria 1303
587 Ga0207675_100065112 3300026118 Bacteria 3407
588 Ga0207675_100242602 3300026118 Bacteria 1742
589 Ga0207675_100275364 3300026118 Bacteria 1634
590 Ga0207675_100711267 3300026118 Bacteria 1014
591 Ga0207683_10049659 3300026121 Bacteria 3673
592 Ga0207698_10000759 3300026142 Bacteria 18757
593 Ga0207698_10008695 3300026142 Bacteria 6436
594 Ga0207698_10026299 3300026142 Bacteria 4115
595 Ga0207698_10099864 3300026142 Bacteria 2402
596 Ga0207698_10109354 3300026142 Bacteria 2313
597 Ga0207698_10211696 3300026142 Bacteria 1744
598 Ga0207698_10371548 3300026142 Bacteria 1357
599 Ga0207698_10535478 3300026142 Bacteria 1145
600 Ga0207698_10732288 3300026142 Bacteria 986
601 Ga0209974_10078390 3300027876 Bacteria 1134
602 Ga0268266_10002361 3300028379 Bacteria 20409
603 Ga0268266_10004023 3300028379 Bacteria 14210
604 Ga0268266_10010769 3300028379 Bacteria 7967
605 Ga0268266_10023554 3300028379 Bacteria 5240
606 Ga0268266_10050869 3300028379 Bacteria 3556
607 Ga0268266_10389121 3300028379 Unclassified 1316
608 Ga0268266_10826992 3300028379 Unclassified 895
609 Ga0268266_10967128 3300028379 Bacteria 824
610 Ga0268265_10004187 3300028380 Bacteria 10096
611 Ga0268265_10029456 3300028380 Bacteria 3940
612 Ga0268265_10436634 3300028380 Bacteria 1219
613 Ga0268265_10554422 3300028380 Bacteria 1091
614 Ga0268265_11154961 3300028380 Bacteria 770
615 Ga0268264_10001852 3300028381 Bacteria 19235
616 Ga0268264_10007537 3300028381 Bacteria 9079
617 Ga0268264_10018222 3300028381 Bacteria 5743
618 Ga0307408_100079789 3300031548 Bacteria 2443
619 Ga0307413_10333182 3300031824 Bacteria 1164
620 Ga0307410_10180690 3300031852 Bacteria 1597
621 Ga0307406_10212390 3300031901 Bacteria 1432
622 Ga0307412_10063274 3300031911 Bacteria 2495
623 Ga0307416_100360989 3300032002 Bacteria 1475
624 Ga0307415_100034228 3300032126 Bacteria 3305
625 Ga0307415_101232889 3300032126 Unclassified 706
626 Ga0373948_0023884 3300034817 Bacteria 1189
627 Ga0373950_0044882 3300034818 Bacteria 854
628 Ga0373940_0020360 3300035088 Bacteria 1685
629 Ga0373954_0043865 3300035118 Bacteria 2086
630 Ga0373960_0016968 3300035121 Bacteria 1880
631 Ga0373943_0163119 3300035170 Bacteria 1215
632 Ga0373955_0011298 3300035172 Bacteria 4249
633 Ga0373961_0064771 3300035241 Bacteria 1118
634 Ga0373931_0001553 3300035691 Bacteria 9906
635 Ga0373931_0062816 3300035691 Bacteria 2006
636 Ga0373935_0028236 3300035692 Bacteria 3468
637 Ga0373933_1075421 3300035724 Unclassified 530
638 Ga0373937_0047029 3300036401 Bacteria 3947
639 Ga0395899_0009605 3300037312 Bacteria 7423
640 Ga0395899_0032663 3300037312 Bacteria 3911
641 Ga0395899_0039338 3300037312 Bacteria 3540
642 Ga0395899_0042268 3300037312 Bacteria 3403
643 Ga0395899_0075085 3300037312 Bacteria 2469
644 Ga0395899_0091964 3300037312 Bacteria 2197
645 Ga0395899_0125529 3300037312 Bacteria 1835
646 Ga0395899_0142405 3300037312 Unclassified 1705
647 Ga0395899_0197765 3300037312 Bacteria 1403
648 Ga0395899_0210052 3300037312 Bacteria 1353
649 Ga0395899_0211408 3300037312 Bacteria 1348
650 Ga0395899_0262075 3300037312 Unclassified 1182
651 Ga0395899_0266370 3300037312 Bacteria 1170
652 Ga0395899_0327787 3300037312 Bacteria 1029
653 Ga0395900_0004031 3300037418 Bacteria 15678
654 Ga0395900_0004032 3300037418 Bacteria 15677
655 Ga0395900_0014648 3300037418 Bacteria 7997
656 Ga0395900_0025662 3300037418 Bacteria 6032
657 Ga0395900_0032363 3300037418 Bacteria 5378
658 Ga0395900_0033846 3300037418 Bacteria 5258
659 Ga0395900_0042529 3300037418 Bacteria 4682
660 Ga0395900_0043340 3300037418 Bacteria 4638
661 Ga0395900_0059746 3300037418 Bacteria 3925
662 Ga0395900_0069672 3300037418 Bacteria 3615
663 Ga0395900_0076875 3300037418 Bacteria 3430
664 Ga0395900_0078923 3300037418 Bacteria 3382
665 Ga0395900_0089175 3300037418 Bacteria 3170
666 Ga0395900_0093021 3300037418 Bacteria 3097
667 Ga0395900_0103478 3300037418 Bacteria 2924
668 Ga0395900_0134144 3300037418 Bacteria 2536
669 Ga0395900_0167973 3300037418 Bacteria 2235
670 Ga0395900_0277669 3300037418 Bacteria 1668
671 Ga0395900_0323648 3300037418 Bacteria 1521
672 Ga0395900_0479418 3300037418 Bacteria 1197
673 Ga0395900_0488032 3300037418 Bacteria 1184
674 Ga0395900_0510471 3300037418 Bacteria 1151
675 Ga0395900_0551267 3300037418 Bacteria 1097
676 Ga0395900_0805916 3300037418 Bacteria 867
677 Ga0395900_0806968 3300037418 Bacteria 866
678 Ga0395900_0830737 3300037418 Bacteria 850
679 Ga0395900_0894650 3300037418 Bacteria 811
680 Ga0395898_0040213 3300037466 Bacteria 4625
681 Ga0395898_0076852 3300037466 Bacteria 3223
682 Ga0395898_0088933 3300037466 Bacteria 2973
683 Ga0395898_0104072 3300037466 Bacteria 2723
684 Ga0395898_0136943 3300037466 Bacteria 2344
685 Ga0395898_0143081 3300037466 Bacteria 2289
686 Ga0395898_0218335 3300037466 Bacteria 1819
687 Ga0395898_0325009 3300037466 Bacteria 1467
688 Ga0395898_0335791 3300037466 Bacteria 1441
689 Ga0395898_0467645 3300037466 Bacteria 1200
690 Ga0395898_0510473 3300037466 Bacteria 1143
691 Ga0395905_0000215 3300037471 Bacteria 89274
692 Ga0395905_0004471 3300037471 Bacteria 14507
693 Ga0395905_0005025 3300037471 Bacteria 13623
694 Ga0395905_0053250 3300037471 Bacteria 3787
695 Ga0395905_0055217 3300037471 Bacteria 3717
696 Ga0395905_0071411 3300037471 Bacteria 3254
697 Ga0395905_0159666 3300037471 Bacteria 2119
698 Ga0395905_0191274 3300037471 Bacteria 1919
699 Ga0395905_0245030 3300037471 Bacteria 1674
700 Ga0395905_0258315 3300037471 Bacteria 1626
701 Ga0395905_0390419 3300037471 Bacteria 1286
702 Ga0395905_0413342 3300037471 Bacteria 1244
703 Ga0395905_0679803 3300037471 Bacteria 932
704 Ga0395905_0706893 3300037471 Bacteria 910
705 Ga0395905_0737285 3300037471 Unclassified 887
706 Ga0395905_0799247 3300037471 Bacteria 846
707 Ga0395905_0923213 3300037471 Bacteria 776
708 Ga0395905_0942179 3300037471 Bacteria 766
709 Ga0395905_0943827 3300037471 Bacteria 765
710 Ga0395901_0001382 3300038443 Bacteria 25390
711 Ga0395901_0004157 3300038443 Bacteria 14604
712 Ga0395901_0020490 3300038443 Bacteria 6768
713 Ga0395901_0021354 3300038443 Bacteria 6633
714 Ga0395901_0046460 3300038443 Bacteria 4510
715 Ga0395901_0049423 3300038443 Bacteria 4369
716 Ga0395901_0163001 3300038443 Bacteria 2341
717 Ga0395901_0180492 3300038443 Unclassified 2214
718 Ga0395901_0207338 3300038443 Bacteria 2053
719 Ga0395901_0223995 3300038443 Bacteria 1965
720 Ga0395901_0289656 3300038443 Bacteria 1699
721 Ga0395901_0474838 3300038443 Bacteria 1276
722 Ga0395901_0537810 3300038443 Bacteria 1185
723 Ga0395901_0785937 3300038443 Unclassified 942
724 Ga0395901_0992569 3300038443 Unclassified 816
725 Ga0395901_1468543 3300038443 Bacteria 638
726 Ga0450905_006398 3300042142 Bacteria 1593
727 Ga0450889_003843 3300042144 Bacteria 1482
728 Ga0439458_0114995 3300042157 Bacteria 706
729 Ga0466969_0003374 3300044656 Bacteria 8509
730 Ga0466969_0090342 3300044656 Bacteria 1452
731 Ga0466965_0328355 3300044683 Bacteria 834
732 Ga0466966_0007713 3300044684 Bacteria 7126
733 Ga0466966_0172323 3300044684 Bacteria 1315
734 Ga0466961_0090680 3300044693 Bacteria 1930
735 Ga0466961_0438152 3300044693 Bacteria 791
736 Ga0466963_0001535 3300044694 Bacteria 12521
737 Ga0466963_0022684 3300044694 Bacteria 3978
738 Ga0466963_0060445 3300044694 Bacteria 2531
739 Ga0466963_0467669 3300044694 Bacteria 890
740 Ga0466963_0507543 3300044694 Bacteria 851
741 Ga0466964_0064190 3300044706 Bacteria 1536
742 Ga0466971_0001407 3300044719 Bacteria 10108
743 Ga0466968_0543479 3300044735 Bacteria 582
744 Ga0466970_0079843 3300044765 Bacteria 1767
745 Ga0466970_0230447 3300044765 Unclassified 1035
746 Ga0466957_0008952 3300044842 Bacteria 5706
747 Ga0466957_0029977 3300044842 Bacteria 3247
748 Ga0466957_0198653 3300044842 Bacteria 1316
749 Ga0466957_0270013 3300044842 Bacteria 1135
750 Ga0466959_0213630 3300045049 Bacteria 1340
751 Ga0466958_0077578 3300045836 Bacteria 2040
752 Ga0466967_0000100 3300045976 Bacteria 31122
753 Ga0466967_0001609 3300045976 Bacteria 13321
754 Ga0466967_0145715 3300045976 Bacteria 2209
755 Ga0466967_0157624 3300045976 Bacteria 2128
756 Ga0466967_0173621 3300045976 Bacteria 2029
757 Ga0466967_0233141 3300045976 Bacteria 1753
758 Ga0466967_0261939 3300045976 Bacteria 1654
759 Ga0466967_0281056 3300045976 Bacteria 1597
760 Ga0466967_0519023 3300045976 Bacteria 1170
761 Ga0466967_1344160 3300045976 Bacteria 712
762 Ga0495642_0184170 3300046528 Bacteria 909
763 Ga0495623_0124206 3300046679 Bacteria 1551
764 Ga0495669_0097622 3300046684 Bacteria 1362
765 Ga0495669_0110470 3300046684 Bacteria 1283
766 Ga0495669_0276429 3300046684 Bacteria 808
767 Ga0495685_035560 3300047447 Bacteria 1712
768 Ga0495602_0061315 3300048088 Bacteria 3272
769 Ga0496102_0640914 3300048905 Bacteria 986
770 Ga0496104_0127556 3300048907 Bacteria 2443
771 Ga0496105_0347087 3300048908 Bacteria 1186
772 Ga0496106_0021614 3300048909 Bacteria 4777
773 Ga0496107_0025949 3300048910 Bacteria 4152
774 Ga0496107_0033690 3300048910 Bacteria 3666
775 Ga0496107_0346109 3300048910 Bacteria 1106
776 Ga0496107_0404954 3300048910 Unclassified 1014
777 Ga0496108_0048420 3300048911 Bacteria 3554
778 Ga0496109_0028337 3300048912 Bacteria 5008
779 Ga0496109_0494389 3300048912 Bacteria 1155
780 Ga0496109_0517390 3300048912 Bacteria 1126
781 Ga0496109_0604506 3300048912 Unclassified 1033
782 Ga0496110_0336449 3300048913 Bacteria 1375
783 Ga0496111_0025003 3300048914 Bacteria 4212
784 Ga0496111_0174788 3300048914 Unclassified 1596
785 Ga0496112_0004969 3300048915 Bacteria 11399
786 Ga0496112_0373313 3300048915 Bacteria 1368
787 Ga0496113_0021349 3300048916 Bacteria 4566
788 Ga0496113_0350092 3300048916 Bacteria 1185
789 Ga0496113_1324758 3300048916 Bacteria 559
790 Ga0496114_0000029 3300048917 Bacteria 175132
791 Ga0501067_0006187 3300049583 Bacteria 6637
792 Ga0501080_0007332 3300049742 Bacteria 9954
793 nmdc:mga0n895_204031_c1 3300050512 Bacteria 2007
794 nmdc:mga0a205_56925_c1 3300050515 Bacteria 3775
795 Ga0466962_0020168 3300061719 Bacteria 3203
796 Ga0070669_100066384
797 JGI24736J21556_1011017
798 JGI24747J21853_1010869
799 JGI24740J21852_10004149
800 JGI24740J21852_10014344
801 JGI24739J22299_10003637
802 JGI24739J22299_10009865
803 JGI24739J22299_10017023
804 JGI24739J22299_10054152
805 JGI24737J22298_10001142
806 JGI24737J22298_10002230
807 JGI24737J22298_10008532
808 JGI24737J22298_10070802
809 JGI24735J21928_10016182
810 JGI24735J21928_10047091
811 JGI24750J21931_1018490
812 JGI24745J21846_1009001
813 JGI24748J21848_1017038
814 JGI24738J21930_10001221
815 JGI24738J21930_10004432
816 JGI24034J26672_10002153
817 Ga0065715_10253725
818 Ga0070658_10002368
819 Ga0070658_10004321
820 Ga0070658_10017631
821 Ga0070658_10021815
822 Ga0070658_10046899
823 Ga0070676_10009122
824 Ga0070676_10016276
825 Ga0070676_10157577
826 Ga0070683_100011282
827 Ga0070683_100026339
828 Ga0070683_100310855
829 Ga0070683_101771961
830 Ga0070690_100477420
831 Ga0070690_100935271
832 Ga0070690_101034409
833 Ga0070670_100015599
834 Ga0070670_100057321
835 Ga0070670_100134282
836 Ga0070670_100227074
837 Ga0070670_100303126
838 Ga0070670_100578035
839 Ga0070677_10018029
840 Ga0070677_10065743
841 Ga0068869_100001204
842 Ga0068869_100433617
843 Ga0068869_100459731
844 Ga0070666_10003007
845 Ga0070666_10004343
846 Ga0070666_10010255
847 Ga0070666_10025126
848 Ga0070680_100137913
849 Ga0070682_100009611
850 Ga0070682_100034100
851 Ga0070682_100132126
852 Ga0070682_100158941
853 Ga0070682_100516071
854 Ga0070682_101171143
855 Ga0068868_100008744
856 Ga0068868_100024903
857 Ga0068868_100126959
858 Ga0068868_100315438
859 Ga0068868_100440890
860 Ga0070660_100000707
861 Ga0070660_100002605
862 Ga0070660_100010336
863 Ga0070660_100017344
864 Ga0070660_100027251
865 Ga0070660_100029310
866 Ga0070660_100043082
867 Ga0070660_100087739
868 Ga0070660_100139947
869 Ga0070660_100196674
870 Ga0070660_100264514
871 Ga0070660_100601374
872 Ga0070689_100061465
873 Ga0070689_100185031
874 Ga0070689_100865447
875 Ga0070691_10330500
876 Ga0070661_100000101
877 Ga0070661_100021284
878 Ga0070661_100050591
879 Ga0070661_100323171
880 Ga0070661_100612887
881 Ga0070692_10014214
882 Ga0070668_100003013
883 Ga0070668_100028225
884 Ga0070668_100047377
885 Ga0070668_100951460
886 Ga0070669_100000586
887 Ga0070669_100019826
888 Ga0070669_100126419
889 Ga0070675_100106045
890 Ga0070675_100116297
891 Ga0070671_100004297
892 Ga0070671_100008668
893 Ga0070671_100019486
894 Ga0070671_100021423
895 Ga0070671_100047215
896 Ga0070674_100181629
897 Ga0070674_100352987
898 Ga0070673_100002689
899 Ga0070673_100015397
900 Ga0070673_100146087
901 Ga0070673_100172936
902 Ga0070673_100193667
903 Ga0070673_100431045
904 Ga0070673_100909639
905 Ga0070659_100000045
906 Ga0070659_100001641
907 Ga0070659_100002860
908 Ga0070659_100019107
909 Ga0070659_100021139
910 Ga0070659_100028950
911 Ga0070659_100037756
912 Ga0070659_100044678
913 Ga0070659_100047199
914 Ga0070659_100073070
915 Ga0070659_100099714
916 Ga0070667_100012215
917 Ga0070667_100014809
918 Ga0070667_100044346
919 Ga0070667_100239156
920 Ga0070667_100377545
921 Ga0070667_100497275
922 Ga0070709_10011406
923 Ga0070714_100017781
924 Ga0070714_100038579
925 Ga0070714_100164829
926 Ga0070714_100460517
927 Ga0070714_100497261
928 Ga0070713_100095262
929 Ga0070713_101148747
930 Ga0070701_10575874
931 Ga0070701_10720970
932 Ga0070694_100016905
933 Ga0070694_100199703
934 Ga0070663_100003510
935 Ga0070663_100025119
936 Ga0070663_100058913
937 Ga0070663_100114736
938 Ga0070663_100151992
939 Ga0070663_100187969
940 Ga0070663_100205452
941 Ga0070663_100527422
942 Ga0070678_100193257
943 Ga0070662_100000036
944 Ga0070662_100002851
945 Ga0070662_100006598
946 Ga0070662_100031286
947 Ga0070662_100111720
948 Ga0070662_100224009
949 Ga0070662_100560825
950 Ga0070662_100692088
951 Ga0070681_10067243
952 Ga0070681_10403768
953 Ga0070681_10903066
954 Ga0068867_100001360
955 Ga0068867_100014025
956 Ga0068867_100065310
957 Ga0068867_100130154
958 Ga0068867_100836040
959 Ga0070685_10060544
960 Ga0070706_100082724
961 Ga0070679_100137711
962 Ga0070679_100600454
963 Ga0070684_100031557
964 Ga0070684_100191277
965 Ga0070684_100930864
966 Ga0070684_101055845
967 Ga0068853_100000059
968 Ga0068853_100002189
969 Ga0068853_100054236
970 Ga0068853_100145133
971 Ga0068853_100165904
972 Ga0068853_100306112
973 Ga0068853_100360470
974 Ga0068853_100915482
975 Ga0068853_101546608
976 Ga0070672_100001067
977 Ga0070672_100070973
978 Ga0070672_100116908
979 Ga0070672_100385074
980 Ga0070686_100490244
981 Ga0070686_101161953
982 Ga0070695_100297043
983 Ga0070695_100374120
984 Ga0070696_100005040
985 Ga0070696_100195499
986 Ga0070696_100197756
987 Ga0070696_100280466
988 Ga0070693_100010656
989 Ga0070693_100112185
990 Ga0070693_100192532
991 Ga0070693_100387860
992 Ga0070693_100462568
993 Ga0070665_100001939
994 Ga0070665_100016195
995 Ga0070665_100021070
996 Ga0070665_100197869
997 Ga0070665_100522148
998 Ga0070665_101458620
999 Ga0070665_101772415
1000 Ga0070704_100660399
1001 Ga0068855_100002788
1002 Ga0068855_100008706
1003 Ga0068855_100582078
1004 Ga0070664_100000027
1005 Ga0070664_100009763
1006 Ga0070664_100020358
1007 Ga0070664_100022533
1008 Ga0070664_100025064
1009 Ga0070664_100032786
1010 Ga0070664_100052991
1011 Ga0070664_100230847
1012 Ga0070664_101705703
1013 Ga0068857_100000338
1014 Ga0068857_100036208
1015 Ga0068857_100069669
1016 Ga0068857_100109855
1017 Ga0068857_100297878
1018 Ga0068857_100541972
1019 Ga0068854_100003108
1020 Ga0068854_100006902
1021 Ga0068854_100011498
1022 Ga0068854_100029408
1023 Ga0068854_100470454
1024 Ga0068856_100000699
1025 Ga0068856_100107442
1026 Ga0068856_102076454
1027 Ga0068852_100000647
1028 Ga0068852_100001883
1029 Ga0068852_100015749
1030 Ga0068852_100026751
1031 Ga0068852_100091561
1032 Ga0068852_100131887
1033 Ga0068852_100165719
1034 Ga0068852_100404930
1035 Ga0068852_100481346
1036 Ga0068859_100028239
1037 Ga0068859_100136456
1038 Ga0068859_101157257
1039 Ga0068864_100003779
1040 Ga0068864_100010362
1041 Ga0068864_100017251
1042 Ga0068864_100375899
1043 Ga0068864_100421740
1044 Ga0068866_10077447
1045 Ga0068861_100037371
1046 Ga0068861_100416888
1047 Ga0068861_100723752
1048 Ga0068851_10011434
1049 Ga0068851_10020033
1050 Ga0068851_10048928
1051 Ga0068851_10049043
1052 Ga0068851_10053966
1053 Ga0068851_10106077
1054 Ga0068851_10119199
1055 Ga0068863_100004975
1056 Ga0068863_100014486
1057 Ga0068863_100082545
1058 Ga0068863_100334832
1059 Ga0068858_100020405
1060 Ga0068858_100090155
1061 Ga0068858_100224353
1062 Ga0068860_100004974
1063 Ga0068860_100008094
1064 Ga0068860_100040215
1065 Ga0068860_100051299
1066 Ga0068860_100172698
1067 Ga0068860_100751997
1068 Ga0068862_100001250
1069 Ga0068862_100044935
1070 Ga0068862_100073993
1071 Ga0068862_100096116
1072 Ga0068862_100177236
1073 Ga0070716_100030875
1074 Ga0070712_100036332
1075 Ga0097621_100134132
1076 Ga0097621_100237738
1077 Ga0097621_100249766
1078 Ga0068871_100061511
1079 Ga0068871_100359456
1080 Ga0075428_100087387
1081 Ga0075428_100512877
1082 Ga0075431_100781362
1083 Ga0075433_10177765
1084 Ga0075434_100262983
1085 Ga0068865_100010731
1086 Ga0097620_100028239
1087 Ga0097620_100136452
1088 Ga0097620_101157272
1089 Ga0105251_10257644
1090 Ga0105240_10496850
1091 Ga0105240_10543941
1092 Ga0105245_10000128
1093 Ga0105245_11196940
1094 Ga0105247_10163273
1095 Ga0114129_10154627
1096 Ga0105243_10059857
1097 Ga0105243_10169541
1098 Ga0105243_10467695
1099 Ga0105241_10011856
1100 Ga0105241_10119475
1101 Ga0105242_10055260
1102 Ga0105248_10001529
1103 Ga0105248_10018199
1104 Ga0105248_10047934
1105 Ga0105248_10234882
1106 Ga0105248_10818079
1107 Ga0105238_10103490
1108 Ga0105238_10473024
1109 Ga0105238_11656675
1110 Ga0105249_10008508
1111 Ga0105249_10091967
1112 Ga0105249_10686175
1113 Ga0105239_10144028
1114 Ga0105239_10415976
1115 Ga0105239_12568141
1116 Ga0105246_10018165
1117 Ga0105246_10069433
1118 Ga0105246_12400660
1119 Ga0157373_10014869
1120 Ga0157373_10018108
1121 Ga0157373_10309539
1122 Ga0157373_11189393
1123 Ga0157371_10004039
1124 Ga0157371_10007577
1125 Ga0157371_10039464
1126 Ga0157371_10057055
1127 Ga0157371_10106048
1128 Ga0157371_10165039
1129 Ga0157371_10174222
1130 Ga0157371_10237046
1131 Ga0157371_10294887
1132 Ga0157370_10971526
1133 Ga0157369_10009511
1134 Ga0157369_10079791
1135 Ga0157369_10110860
1136 Ga0157369_10361174
1137 Ga0157374_10042575
1138 Ga0157374_10145176
1139 Ga0157378_10007423
1140 Ga0157378_10132834
1141 Ga0157378_10425660
1142 Ga0163162_10039677
1143 Ga0163162_10100110
1144 Ga0163162_10630095
1145 Ga0157372_10036624
1146 Ga0157372_10043148
1147 Ga0157372_11157021
1148 Ga0157372_11613165
1149 Ga0157372_11658107
1150 Ga0157375_10456985
1151 Ga0157375_10592757
1152 Ga0157375_11953908
1153 Ga0163163_10000187
1154 Ga0163163_10428912
1155 Ga0182008_10171143
1156 Ga0157377_10005209
1157 Ga0157377_10148532
1158 Ga0157379_10032218
1159 Ga0157379_10032755
1160 Ga0157376_10285466
1161 Ga0157376_11867066
1162 Ga0207673_1009632
1163 Ga0207697_10000461
1164 Ga0207697_10004406
1165 Ga0207697_10242837
1166 Ga0207656_10034081
1167 Ga0207656_10039243
1168 Ga0207656_10059218
1169 Ga0207656_10163826
1170 Ga0207656_10307198
1171 Ga0207682_10060014
1172 Ga0207642_10393651
1173 Ga0207688_10000063
1174 Ga0207688_10128921
1175 Ga0207688_10579992
1176 Ga0207680_10001103
1177 Ga0207680_10021121
1178 Ga0207647_10000227
1179 Ga0207647_10006423
1180 Ga0207647_10026763
1181 Ga0207647_10038668
1182 Ga0207647_10040903
1183 Ga0207647_10066148
1184 Ga0207699_10164019
1185 Ga0207645_10009350
1186 Ga0207645_10013637
1187 Ga0207645_10017225
1188 Ga0207645_10136558
1189 Ga0207645_10271084
1190 Ga0207643_10576959
1191 Ga0207705_10002358
1192 Ga0207705_10010170
1193 Ga0207705_10058315
1194 Ga0207705_10075566
1195 Ga0207705_10137978
1196 Ga0207684_10350218
1197 Ga0207654_10065663
1198 Ga0207654_10238369
1199 Ga0207707_10722377
1200 Ga0207695_10383395
1201 Ga0207671_10640651
1202 Ga0207693_10085477
1203 Ga0207662_10156302
1204 Ga0207657_10002137
1205 Ga0207657_10010539
1206 Ga0207657_10012153
1207 Ga0207657_10016688
1208 Ga0207657_10018684
1209 Ga0207657_10035538
1210 Ga0207657_10040435
1211 Ga0207657_10044305
1212 Ga0207657_10107575
1213 Ga0207657_10247054
1214 Ga0207657_10391588
1215 Ga0207649_10000680
1216 Ga0207649_10012257
1217 Ga0207649_10012575
1218 Ga0207649_10149640
1219 Ga0207649_10314767
1220 Ga0207649_10731402
1221 Ga0207649_10812379
1222 Ga0207649_10838517
1223 Ga0207652_10304273
1224 Ga0207652_11248789
1225 Ga0207681_10023221
1226 Ga0207681_10062180
1227 Ga0207694_10095363
1228 Ga0207694_10103506
1229 Ga0207694_10208150
1230 Ga0207650_10116157
1231 Ga0207650_10130650
1232 Ga0207650_10211080
1233 Ga0207650_10364181
1234 Ga0207650_10479650
1235 Ga0207650_11003755
1236 Ga0207659_10447474
1237 Ga0207659_10584099
1238 Ga0207687_10003689
1239 Ga0207687_10039592
1240 Ga0207700_10095666
1241 Ga0207664_10015360
1242 Ga0207664_10042352
1243 Ga0207664_10197801
1244 Ga0207664_10833330
1245 Ga0207644_10005108
1246 Ga0207644_10024036
1247 Ga0207644_10024893
1248 Ga0207644_10043303
1249 Ga0207690_10000080
1250 Ga0207690_10006498
1251 Ga0207690_10024623
1252 Ga0207690_10028241
1253 Ga0207690_10043085
1254 Ga0207690_10043684
1255 Ga0207690_10055706
1256 Ga0207690_10068275
1257 Ga0207690_10086678
1258 Ga0207690_10090953
1259 Ga0207690_10261821
1260 Ga0207690_10794544
1261 Ga0207706_10008913
1262 Ga0207706_10009958
1263 Ga0207706_10013324
1264 Ga0207706_10025933
1265 Ga0207706_10033346
1266 Ga0207706_10053913
1267 Ga0207706_10148426
1268 Ga0207706_10190201
1269 Ga0207706_10229967
1270 Ga0207706_10580549
1271 Ga0207706_10582610
1272 Ga0207686_10014527
1273 Ga0207670_10436342
1274 Ga0207669_10060300
1275 Ga0207669_10067901
1276 Ga0207704_10016711
1277 Ga0207665_10039724
1278 Ga0207691_10000447
1279 Ga0207691_10037018
1280 Ga0207691_10132847
1281 Ga0207691_10577524
1282 Ga0207711_10001739
1283 Ga0207711_10003621
1284 Ga0207711_10004550
1285 Ga0207711_10486360
1286 Ga0207711_10596662
1287 Ga0207689_10001047
1288 Ga0207689_10017662
1289 Ga0207689_10024379
1290 Ga0207689_10043608
1291 Ga0207689_10449275
1292 Ga0207661_10007627
1293 Ga0207661_10012982
1294 Ga0207679_10001226
1295 Ga0207679_10011179
1296 Ga0207679_10011770
1297 Ga0207679_10024588
1298 Ga0207679_10065070
1299 Ga0207679_10078356
1300 Ga0207679_10222002
1301 Ga0207679_10289335
1302 Ga0207679_10703204
1303 Ga0207667_10013651
1304 Ga0207667_10126148
1305 Ga0207667_10484247
1306 Ga0207667_10974833
1307 Ga0207651_10030901
1308 Ga0207651_10043572
1309 Ga0207651_10154537
1310 Ga0207651_10218495
1311 Ga0207651_10623596
1312 Ga0207651_10863244
1313 Ga0207651_11309321
1314 Ga0207712_10001416
1315 Ga0207712_10184710
1316 Ga0207668_10001204
1317 Ga0207668_10021749
1318 Ga0207668_10286297
1319 Ga0207668_11306965
1320 Ga0207640_10003003
1321 Ga0207640_10024726
1322 Ga0207640_10089234
1323 Ga0207640_10094998
1324 Ga0207640_10224195
1325 Ga0207640_10414887
1326 Ga0207640_10725652
1327 Ga0207658_10011037
1328 Ga0207658_10114035
1329 Ga0207658_10115496
1330 Ga0207658_10248096
1331 Ga0207658_10267106
1332 Ga0207677_10004522
1333 Ga0207677_10079659
1334 Ga0207677_10332327
1335 Ga0207677_10381667
1336 Ga0207703_10002385
1337 Ga0207703_10012883
1338 Ga0207703_10067119
1339 Ga0207703_10636858
1340 Ga0207703_10804696
1341 Ga0207639_10042008
1342 Ga0207639_10103460
1343 Ga0207639_10148443
1344 Ga0207639_10153906
1345 Ga0207639_10269943
1346 Ga0207639_10302230
1347 Ga0207639_10387062
1348 Ga0207639_11189654
1349 Ga0207678_10000995
1350 Ga0207678_10002822
1351 Ga0207678_10002879
1352 Ga0207678_10022196
1353 Ga0207678_10066618
1354 Ga0207678_10108925
1355 Ga0207678_10132307
1356 Ga0207678_10166452
1357 Ga0207678_10707841
1358 Ga0207702_10006848
1359 Ga0207702_10154521
1360 Ga0207702_10216338
1361 Ga0207702_10432133
1362 Ga0207641_10046090
1363 Ga0207641_10076781
1364 Ga0207641_10283463
1365 Ga0207648_10010576
1366 Ga0207648_10018445
1367 Ga0207648_10048881
1368 Ga0207648_10104445
1369 Ga0207676_10003397
1370 Ga0207676_10007577
1371 Ga0207676_10019693
1372 Ga0207676_10068788
1373 Ga0207676_10271836
1374 Ga0207674_10001201
1375 Ga0207674_10025321
1376 Ga0207674_10029023
1377 Ga0207674_10031785
1378 Ga0207674_10036138
1379 Ga0207674_10041496
1380 Ga0207674_10075858
1381 Ga0207674_10413505
1382 Ga0207675_100065112
1383 Ga0207675_100242602
1384 Ga0207675_100275364
1385 Ga0207675_100711267
1386 Ga0207683_10049659
1387 Ga0207698_10000759
1388 Ga0207698_10008695
1389 Ga0207698_10026299
1390 Ga0207698_10099864
1391 Ga0207698_10109354
1392 Ga0207698_10211696
1393 Ga0207698_10371548
1394 Ga0207698_10535478
1395 Ga0207698_10732288
1396 Ga0209974_10078390
1397 Ga0268266_10002361
1398 Ga0268266_10004023
1399 Ga0268266_10010769
1400 Ga0268266_10023554
1401 Ga0268266_10050869
1402 Ga0268266_10389121
1403 Ga0268266_10826992
1404 Ga0268266_10967128
1405 Ga0268265_10004187
1406 Ga0268265_10029456
1407 Ga0268265_10436634
1408 Ga0268265_10554422
1409 Ga0268265_11154961
1410 Ga0268264_10001852
1411 Ga0268264_10007537
1412 Ga0268264_10018222
1413 Ga0307408_100079789
1414 Ga0307413_10333182
1415 Ga0307410_10180690
1416 Ga0307406_10212390
1417 Ga0307412_10063274
1418 Ga0307416_100360989
1419 Ga0307415_100034228
1420 Ga0307415_101232889
1421 Ga0373948_0023884
1422 Ga0373950_0044882
1423 Ga0373940_0020360
1424 Ga0373954_0043865
1425 Ga0373960_0016968
1426 Ga0373943_0163119
1427 Ga0373955_0011298
1428 Ga0373961_0064771
1429 Ga0373931_0001553
1430 Ga0373931_0062816
1431 Ga0373935_0028236
1432 Ga0373933_1075421
1433 Ga0373937_0047029
1434 Ga0395899_0009605
1435 Ga0395899_0032663
1436 Ga0395899_0039338
1437 Ga0395899_0042268
1438 Ga0395899_0075085
1439 Ga0395899_0091964
1440 Ga0395899_0125529
1441 Ga0395899_0142405
1442 Ga0395899_0197765
1443 Ga0395899_0210052
1444 Ga0395899_0211408
1445 Ga0395899_0262075
1446 Ga0395899_0266370
1447 Ga0395899_0327787
1448 Ga0395900_0004031
1449 Ga0395900_0004032
1450 Ga0395900_0014648
1451 Ga0395900_0025662
1452 Ga0395900_0032363
1453 Ga0395900_0033846
1454 Ga0395900_0042529
1455 Ga0395900_0043340
1456 Ga0395900_0059746
1457 Ga0395900_0069672
1458 Ga0395900_0076875
1459 Ga0395900_0078923
1460 Ga0395900_0089175
1461 Ga0395900_0093021
1462 Ga0395900_0103478
1463 Ga0395900_0134144
1464 Ga0395900_0167973
1465 Ga0395900_0277669
1466 Ga0395900_0323648
1467 Ga0395900_0479418
1468 Ga0395900_0488032
1469 Ga0395900_0510471
1470 Ga0395900_0551267
1471 Ga0395900_0805916
1472 Ga0395900_0806968
1473 Ga0395900_0830737
1474 Ga0395900_0894650
1475 Ga0395898_0040213
1476 Ga0395898_0076852
1477 Ga0395898_0088933
1478 Ga0395898_0104072
1479 Ga0395898_0136943
1480 Ga0395898_0143081
1481 Ga0395898_0218335
1482 Ga0395898_0325009
1483 Ga0395898_0335791
1484 Ga0395898_0467645
1485 Ga0395898_0510473
1486 Ga0395905_0000215
1487 Ga0395905_0004471
1488 Ga0395905_0005025
1489 Ga0395905_0053250
1490 Ga0395905_0055217
1491 Ga0395905_0071411
1492 Ga0395905_0159666
1493 Ga0395905_0191274
1494 Ga0395905_0245030
1495 Ga0395905_0258315
1496 Ga0395905_0390419
1497 Ga0395905_0413342
1498 Ga0395905_0679803
1499 Ga0395905_0706893
1500 Ga0395905_0737285
1501 Ga0395905_0799247
1502 Ga0395905_0923213
1503 Ga0395905_0942179
1504 Ga0395905_0943827
1505 Ga0395901_0001382
1506 Ga0395901_0004157
1507 Ga0395901_0020490
1508 Ga0395901_0021354
1509 Ga0395901_0046460
1510 Ga0395901_0049423
1511 Ga0395901_0163001
1512 Ga0395901_0180492
1513 Ga0395901_0207338
1514 Ga0395901_0223995
1515 Ga0395901_0289656
1516 Ga0395901_0474838
1517 Ga0395901_0537810
1518 Ga0395901_0785937
1519 Ga0395901_0992569
1520 Ga0395901_1468543
1521 Ga0450905_006398
1522 Ga0450889_003843
1523 Ga0439458_0114995
1524 Ga0466969_0003374
1525 Ga0466969_0090342
1526 Ga0466965_0328355
1527 Ga0466966_0007713
1528 Ga0466966_0172323
1529 Ga0466961_0090680
1530 Ga0466961_0438152
1531 Ga0466963_0001535
1532 Ga0466963_0022684
1533 Ga0466963_0060445
1534 Ga0466963_0467669
1535 Ga0466963_0507543
1536 Ga0466964_0064190
1537 Ga0466971_0001407
1538 Ga0466968_0543479
1539 Ga0466970_0079843
1540 Ga0466970_0230447
1541 Ga0466957_0008952
1542 Ga0466957_0029977
1543 Ga0466957_0198653
1544 Ga0466957_0270013
1545 Ga0466959_0213630
1546 Ga0466958_0077578
1547 Ga0466967_0000100
1548 Ga0466967_0001609
1549 Ga0466967_0145715
1550 Ga0466967_0157624
1551 Ga0466967_0173621
1552 Ga0466967_0233141
1553 Ga0466967_0261939
1554 Ga0466967_0281056
1555 Ga0466967_0519023
1556 Ga0466967_1344160
1557 Ga0495642_0184170
1558 Ga0495623_0124206
1559 Ga0495669_0097622
1560 Ga0495669_0110470
1561 Ga0495669_0276429
1562 Ga0495685_035560
1563 Ga0495602_0061315
1564 Ga0496102_0640914
1565 Ga0496104_0127556
1566 Ga0496105_0347087
1567 Ga0496106_0021614
1568 Ga0496107_0025949
1569 Ga0496107_0033690
1570 Ga0496107_0346109
1571 Ga0496107_0404954
1572 Ga0496108_0048420
1573 Ga0496109_0028337
1574 Ga0496109_0494389
1575 Ga0496109_0517390
1576 Ga0496109_0604506
1577 Ga0496110_0336449
1578 Ga0496111_0025003
1579 Ga0496111_0174788
1580 Ga0496112_0004969
1581 Ga0496112_0373313
1582 Ga0496113_0021349
1583 Ga0496113_0350092
1584 Ga0496113_1324758
1585 Ga0496114_0000029
1586 Ga0501067_0006187
1587 Ga0501080_0007332
1588 nmdc:mga0n895_204031_c1
1589 nmdc:mga0a205_56925_c1
1590 Ga0466962_0020168

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map