F481145

General Info

Members Datasets Scaffolds Average Seq Length
795 275 792 125

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1072241|Ga0436364_1072241_476_865
Length 124
Sequence MPVSGLGPYDDTNVFAKILRGEIPSRRVYEDEWAVAFHDIAPQASTHVLVIPRGSYVSLADFAVKAPPDEIAGFFRAVAAVAKQLGLEEPGYRVLANMGRHPHFHVHVFGGQPLGPMLTARASP

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
3 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
4 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
5 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
6 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
85 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
101 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
167 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
189 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
192 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
193 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
194 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
195 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
196 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
197 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
198 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
199 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
200 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
201 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
202 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
203 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
204 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
205 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
206 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
207 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
208 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
209 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
210 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
211 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
212 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
213 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
214 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
219 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
225 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
226 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
227 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
228 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
229 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
230 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
231 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
232 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
233 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
234 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
235 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
236 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
237 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
238 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
254 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
255 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
256 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
257 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
258 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
259 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
260 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
261 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
265 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
266 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
267 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
268 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
269 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
270 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
271 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
272 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
275 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.13
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.78
Nodule 0
Rhizoplane 2.39
Rhizosphere 91.45
Stem 0
Stem Tuber 0
Unclassified 1.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214814960 2209111006 Bacteria 677
2 JGI24736J21556_1000939 3300001904 Bacteria 5362
3 JGI24741J21665_1019747 3300001915 Bacteria 1065
4 JGI24740J21852_10005216 3300001979 Bacteria 5518
5 JGI24737J22298_10055753 3300001990 Bacteria 1194
6 JGI24034J26672_10010588 3300002239 Bacteria 1373
7 JGI24751J29686_10011725 3300002459 Bacteria 1808
8 JGI25150J39212_1049317 3300002774 Bacteria 524
9 JGI25150J39212_1052103 3300002774 Bacteria 504
10 JGI25153J46596_10008965 3300003215 Bacteria 4714
11 Ga0055537_1000441 3300003773 Bacteria 26555
12 Ga0055537_1012581 3300003773 Bacteria 1641
13 Ga0055524_1000245 3300003775 Bacteria 56692
14 Ga0055530_10012116 3300003791 Bacteria 3033
15 Ga0055530_10075250 3300003791 Bacteria 720
16 Ga0055531_10002452 3300003794 Bacteria 12393
17 JGI25405J52794_10034577 3300003911 Bacteria 1056
18 Ga0055543_1011280 3300004625 Bacteria 1836
19 Ga0065165_1008746 3300005262 Bacteria 4670
20 Ga0065165_1032218 3300005262 Bacteria 1645
21 Ga0065712_10002451 3300005290 Bacteria 4489
22 Ga0065712_10100222 3300005290 Bacteria 2052
23 Ga0065715_10002752 3300005293 Bacteria 4808
24 Ga0065715_10028692 3300005293 Bacteria 1301
25 Ga0065715_10124416 3300005293 Bacteria 2155
26 Ga0070658_10002325 3300005327 Bacteria 15950
27 Ga0070658_10003674 3300005327 Bacteria 12564
28 Ga0070658_10005871 3300005327 Bacteria 9956
29 Ga0070658_10080815 3300005327 Bacteria 2670
30 Ga0070658_10111656 3300005327 Bacteria 2265
31 Ga0070658_10147544 3300005327 Bacteria 1968
32 Ga0070658_10343096 3300005327 Bacteria 1278
33 Ga0070658_10510952 3300005327 Bacteria 1038
34 Ga0070658_11014154 3300005327 Bacteria 722
35 Ga0070676_10005263 3300005328 Bacteria 6879
36 Ga0070683_100008142 3300005329 Bacteria 8904
37 Ga0070670_100003053 3300005331 Bacteria 13851
38 Ga0070670_100042043 3300005331 Bacteria 3928
39 Ga0070670_100238668 3300005331 Bacteria 1582
40 Ga0070670_100246219 3300005331 Bacteria 1557
41 Ga0070670_101432371 3300005331 Bacteria 634
42 Ga0070677_10000456 3300005333 Bacteria 14007
43 Ga0070677_10045304 3300005333 Bacteria 1754
44 Ga0070677_10307029 3300005333 Bacteria 808
45 Ga0070677_10521474 3300005333 Bacteria 647
46 Ga0070677_10622198 3300005333 Unclassified 600
47 Ga0070666_10008323 3300005335 Bacteria 6434
48 Ga0070680_100026295 3300005336 Bacteria 4654
49 Ga0070680_100338796 3300005336 Bacteria 1278
50 Ga0070680_100360438 3300005336 Bacteria 1237
51 Ga0070680_100382751 3300005336 Bacteria 1198
52 Ga0070680_101082462 3300005336 Bacteria 693
53 Ga0068868_100738943 3300005338 Bacteria 883
54 Ga0070660_100001300 3300005339 Bacteria 17017
55 Ga0070660_100003050 3300005339 Bacteria 11526
56 Ga0070660_100003201 3300005339 Bacteria 11252
57 Ga0070660_100014004 3300005339 Bacteria 5771
58 Ga0070660_100017015 3300005339 Bacteria 5292
59 Ga0070660_100031646 3300005339 Bacteria 3975
60 Ga0070660_100052189 3300005339 Bacteria 3151
61 Ga0070660_100086049 3300005339 Bacteria 2473
62 Ga0070660_100145343 3300005339 Bacteria 1904
63 Ga0070660_100173905 3300005339 Bacteria 1740
64 Ga0070660_100283912 3300005339 Bacteria 1355
65 Ga0070660_100515884 3300005339 Bacteria 995
66 Ga0070660_101235432 3300005339 Bacteria 634
67 Ga0070660_101580369 3300005339 Bacteria 558
68 Ga0070689_100604544 3300005340 Bacteria 950
69 Ga0070687_100226069 3300005343 Bacteria 1149
70 Ga0070661_100000009 3300005344 Bacteria 181351
71 Ga0070661_100005747 3300005344 Bacteria 8538
72 Ga0070661_100128588 3300005344 Bacteria 1901
73 Ga0070661_100511045 3300005344 Bacteria 963
74 Ga0070661_100784995 3300005344 Bacteria 781
75 Ga0070692_10007743 3300005345 Bacteria 4756
76 Ga0070692_10040842 3300005345 Bacteria 2374
77 Ga0070692_11182090 3300005345 Bacteria 544
78 Ga0070668_100000015 3300005347 Bacteria 106650
79 Ga0070668_100125549 3300005347 Bacteria 2055
80 Ga0070668_100410534 3300005347 Bacteria 1158
81 Ga0070668_100679438 3300005347 Bacteria 906
82 Ga0070669_100042765 3300005353 Bacteria 3298
83 Ga0070669_100051030 3300005353 Bacteria 3022
84 Ga0070669_100051768 3300005353 Bacteria 3003
85 Ga0070669_100086459 3300005353 Bacteria 2343
86 Ga0070669_100300753 3300005353 Bacteria 1290
87 Ga0070669_100303537 3300005353 Bacteria 1285
88 Ga0070669_100353272 3300005353 Bacteria 1194
89 Ga0070669_100437455 3300005353 Bacteria 1076
90 Ga0070669_101664383 3300005353 Bacteria 556
91 Ga0070675_100001728 3300005354 Bacteria 16125
92 Ga0070675_100003423 3300005354 Bacteria 12018
93 Ga0070675_100241199 3300005354 Bacteria 1579
94 Ga0070675_100383728 3300005354 Bacteria 1251
95 Ga0070671_100000322 3300005355 Bacteria 32627
96 Ga0070671_100012423 3300005355 Bacteria 6857
97 Ga0070671_100094864 3300005355 Bacteria 2501
98 Ga0070671_100386599 3300005355 Bacteria 1196
99 Ga0070671_100981292 3300005355 Bacteria 740
100 Ga0070674_100067301 3300005356 Bacteria 2519
101 Ga0070674_100078186 3300005356 Bacteria 2357
102 Ga0070674_100251530 3300005356 Bacteria 1388
103 Ga0070674_100446229 3300005356 Bacteria 1067
104 Ga0070674_100869687 3300005356 Bacteria 783
105 Ga0070673_100002044 3300005364 Bacteria 12181
106 Ga0070673_100074161 3300005364 Bacteria 2741
107 Ga0070673_100149011 3300005364 Bacteria 1980
108 Ga0070673_100337495 3300005364 Bacteria 1335
109 Ga0070673_100426871 3300005364 Bacteria 1189
110 Ga0070659_100000979 3300005366 Bacteria 20993
111 Ga0070659_100048521 3300005366 Bacteria 3336
112 Ga0070659_100059123 3300005366 Bacteria 3026
113 Ga0070659_100363038 3300005366 Bacteria 1217
114 Ga0070659_100590201 3300005366 Bacteria 954
115 Ga0070659_100743754 3300005366 Bacteria 850
116 Ga0070659_101741934 3300005366 Bacteria 557
117 Ga0070667_100000017 3300005367 Bacteria 230531
118 Ga0070667_100093954 3300005367 Bacteria 2583
119 Ga0070667_100262476 3300005367 Bacteria 1547
120 Ga0070663_100014045 3300005455 Bacteria 5130
121 Ga0070663_100032493 3300005455 Bacteria 3597
122 Ga0070663_100042039 3300005455 Bacteria 3210
123 Ga0070663_100395515 3300005455 Bacteria 1128
124 Ga0070663_101767648 3300005455 Bacteria 554
125 Ga0070678_100164276 3300005456 Bacteria 1802
126 Ga0070678_100181774 3300005456 Bacteria 1722
127 Ga0070678_100517362 3300005456 Bacteria 1055
128 Ga0070662_100018695 3300005457 Bacteria 4692
129 Ga0070662_100044388 3300005457 Bacteria 3184
130 Ga0070662_100222171 3300005457 Bacteria 1507
131 Ga0070662_100639341 3300005457 Bacteria 897
132 Ga0070662_100646677 3300005457 Bacteria 892
133 Ga0070681_10094424 3300005458 Bacteria 2940
134 Ga0070681_10748623 3300005458 Bacteria 894
135 Ga0070681_11067016 3300005458 Bacteria 728
136 Ga0068867_100177096 3300005459 Bacteria 1693
137 Ga0070679_100000404 3300005530 Bacteria 36798
138 Ga0070679_100054822 3300005530 Bacteria 3970
139 Ga0070679_100100813 3300005530 Bacteria 2874
140 Ga0070679_100111539 3300005530 Bacteria 2721
141 Ga0070679_100203743 3300005530 Bacteria 1943
142 Ga0070679_100503309 3300005530 Bacteria 1155
143 Ga0070679_100642577 3300005530 Bacteria 1004
144 Ga0070679_100974810 3300005530 Bacteria 792
145 Ga0070679_101814886 3300005530 Bacteria 558
146 Ga0070684_100338082 3300005535 Bacteria 1384
147 Ga0070684_101674257 3300005535 Bacteria 600
148 Ga0068853_100131472 3300005539 Bacteria 2241
149 Ga0068853_100242334 3300005539 Bacteria 1653
150 Ga0068853_100249839 3300005539 Bacteria 1627
151 Ga0068853_100946309 3300005539 Bacteria 828
152 Ga0070672_100019791 3300005543 Bacteria 4894
153 Ga0070672_100089851 3300005543 Bacteria 2476
154 Ga0070672_100639022 3300005543 Bacteria 929
155 Ga0070672_101207356 3300005543 Bacteria 674
156 Ga0070696_100918687 3300005546 Bacteria 727
157 Ga0070665_100060440 3300005548 Bacteria 3798
158 Ga0068855_100026818 3300005563 Bacteria 6893
159 Ga0068855_100039512 3300005563 Bacteria 5602
160 Ga0068855_100130375 3300005563 Bacteria 2872
161 Ga0070664_100014561 3300005564 Bacteria 6417
162 Ga0070664_100085974 3300005564 Bacteria 2717
163 Ga0070664_100128457 3300005564 Bacteria 2225
164 Ga0070664_100151187 3300005564 Bacteria 2050
165 Ga0070664_100835859 3300005564 Bacteria 862
166 Ga0068857_100081237 3300005577 Bacteria 2895
167 Ga0068857_100238406 3300005577 Bacteria 1665
168 Ga0068854_100003883 3300005578 Bacteria 9365
169 Ga0068854_100138268 3300005578 Bacteria 1867
170 Ga0068854_100321087 3300005578 Bacteria 1258
171 Ga0068854_100827485 3300005578 Bacteria 809
172 Ga0068856_100009497 3300005614 Bacteria 9445
173 Ga0068856_100399926 3300005614 Bacteria 1393
174 Ga0068856_100455097 3300005614 Bacteria 1301
175 Ga0068852_100008362 3300005616 Bacteria 7625
176 Ga0068852_100294561 3300005616 Bacteria 1569
177 Ga0068852_100425180 3300005616 Bacteria 1311
178 Ga0068859_100253494 3300005617 Bacteria 1850
179 Ga0068859_101603435 3300005617 Bacteria 719
180 Ga0068864_100006205 3300005618 Bacteria 9799
181 Ga0068864_100588810 3300005618 Bacteria 1078
182 Ga0068861_100043504 3300005719 Bacteria 3372
183 Ga0068870_10227811 3300005840 Bacteria 1144
184 Ga0068870_10437691 3300005840 Bacteria 859
185 Ga0068863_100016985 3300005841 Bacteria 6979
186 Ga0068863_100595975 3300005841 Bacteria 1093
187 Ga0068863_101340213 3300005841 Bacteria 723
188 Ga0068858_100001873 3300005842 Bacteria 21457
189 Ga0068858_100702362 3300005842 Bacteria 984
190 Ga0068860_100000056 3300005843 Bacteria 202751
191 Ga0068862_100000108 3300005844 Bacteria 99413
192 Ga0068862_100419206 3300005844 Bacteria 1256
193 Ga0068862_100814262 3300005844 Bacteria 913
194 Ga0081455_10000964 3300005937 Bacteria 36801
195 Ga0075365_10051703 3300006038 Bacteria 2715
196 Ga0075364_10149240 3300006051 Bacteria 1575
197 Ga0097621_101135506 3300006237 Bacteria 734
198 Ga0075370_10197398 3300006353 Bacteria 1186
199 Ga0075370_10251505 3300006353 Bacteria 1047
200 Ga0068871_101268827 3300006358 Bacteria 692
201 Ga0068865_100621950 3300006881 Bacteria 915
202 Ga0068865_101169459 3300006881 Bacteria 680
203 Ga0097620_100253502 3300006931 Bacteria 1850
204 Ga0097620_101603348 3300006931 Bacteria 719
205 Ga0105240_10073464 3300009093 Bacteria 4223
206 Ga0105240_10807730 3300009093 Bacteria 1015
207 Ga0105247_11104328 3300009101 Bacteria 626
208 Ga0105243_10027845 3300009148 Bacteria 4335
209 Ga0105243_10549280 3300009148 Bacteria 1103
210 Ga0105243_10981002 3300009148 Bacteria 846
211 Ga0105241_11216722 3300009174 Bacteria 714
212 Ga0105248_10008010 3300009177 Bacteria 11607
213 Ga0105248_10317465 3300009177 Bacteria 1755
214 Ga0105248_11374633 3300009177 Bacteria 799
215 Ga0105238_10221634 3300009551 Bacteria 1868
216 Ga0105238_10381912 3300009551 Bacteria 1400
217 Ga0105249_10609447 3300009553 Bacteria 1147
218 Ga0105239_10134418 3300010375 Bacteria 2753
219 Ga0157327_1020172 3300012512 Bacteria 744
220 Ga0157326_1002409 3300012513 Bacteria 2003
221 Ga0157373_10002525 3300013100 Bacteria 13931
222 Ga0157373_10023486 3300013100 Bacteria 4469
223 Ga0157373_10160641 3300013100 Bacteria 1581
224 Ga0157373_10227975 3300013100 Bacteria 1315
225 Ga0157373_10235618 3300013100 Bacteria 1293
226 Ga0157373_10273000 3300013100 Bacteria 1197
227 Ga0157373_10487429 3300013100 Bacteria 890
228 Ga0157373_10557542 3300013100 Bacteria 831
229 Ga0157371_10002615 3300013102 Bacteria 17091
230 Ga0157371_10008024 3300013102 Bacteria 8453
231 Ga0157371_10122835 3300013102 Bacteria 1847
232 Ga0157371_10272687 3300013102 Bacteria 1221
233 Ga0157371_10290586 3300013102 Bacteria 1182
234 Ga0157371_10299167 3300013102 Bacteria 1165
235 Ga0157371_11411167 3300013102 Bacteria 541
236 Ga0157370_10017735 3300013104 Bacteria 7177
237 Ga0157370_10475894 3300013104 Bacteria 1148
238 Ga0157370_10748203 3300013104 Bacteria 891
239 Ga0157369_10001135 3300013105 Bacteria 33313
240 Ga0157369_10003392 3300013105 Bacteria 18901
241 Ga0157369_10023242 3300013105 Bacteria 6907
242 Ga0157369_11164135 3300013105 Bacteria 787
243 Ga0157374_10068169 3300013296 Bacteria 3347
244 Ga0163162_10391762 3300013306 Bacteria 1522
245 Ga0157372_10093611 3300013307 Bacteria 3420
246 Ga0157372_10158636 3300013307 Bacteria 2614
247 Ga0157372_10176026 3300013307 Bacteria 2476
248 Ga0157372_10511932 3300013307 Bacteria 1399
249 Ga0157372_10652951 3300013307 Bacteria 1225
250 Ga0157375_10004286 3300013308 Bacteria 12369
251 Ga0157375_10450073 3300013308 Bacteria 1453
252 Ga0163163_10105952 3300014325 Bacteria 2837
253 Ga0163163_10197748 3300014325 Bacteria 2058
254 Ga0163163_10624305 3300014325 Bacteria 1141
255 Ga0157380_10008061 3300014326 Bacteria 7504
256 Ga0157380_10014874 3300014326 Bacteria 5703
257 Ga0157380_10052755 3300014326 Bacteria 3221
258 Ga0157380_10320287 3300014326 Bacteria 1437
259 Ga0157380_10499218 3300014326 Bacteria 1181
260 Ga0157380_11258657 3300014326 Bacteria 786
261 Ga0157379_11517235 3300014968 Bacteria 652
262 Ga0163161_10185712 3300017792 Bacteria 1596
263 Ga0163161_10663822 3300017792 Bacteria 865
264 Ga0163161_10685195 3300017792 Bacteria 852
265 Ga0206353_10796169 3300020082 Bacteria 722
266 Ga0213876_10001167 3300021384 Bacteria 16587
267 Ga0207425_1007318 3300025245 Bacteria 2924
268 Ga0209565_1000007 3300025263 Bacteria 784361
269 Ga0209565_1001004 3300025263 Bacteria 14505
270 Ga0209673_1001016 3300025273 Bacteria 33837
271 Ga0209673_1008645 3300025273 Bacteria 4510
272 Ga0209675_1013627 3300025291 Bacteria 2527
273 Ga0209564_1007139 3300025295 Bacteria 5828
274 Ga0209758_1007609 3300025297 Bacteria 7308
275 Ga0209758_1027150 3300025297 Bacteria 2455
276 Ga0209050_1014851 3300025298 Bacteria 3320
277 Ga0209050_1022518 3300025298 Bacteria 2254
278 Ga0209256_1000008 3300025299 Bacteria 975723
279 Ga0209257_1004536 3300025304 Bacteria 10641
280 Ga0207697_10072169 3300025315 Bacteria 1447
281 Ga0207697_10081771 3300025315 Bacteria 1361
282 Ga0207682_10001287 3300025893 Bacteria 11520
283 Ga0207682_10084148 3300025893 Bacteria 1368
284 Ga0207682_10126320 3300025893 Bacteria 1138
285 Ga0207688_10025725 3300025901 Bacteria 3234
286 Ga0207688_10123898 3300025901 Bacteria 1510
287 Ga0207680_10035897 3300025903 Bacteria 2851
288 Ga0207680_10071279 3300025903 Bacteria 2154
289 Ga0207680_10230023 3300025903 Bacteria 1274
290 Ga0207647_10013638 3300025904 Bacteria 5627
291 Ga0207645_10009100 3300025907 Bacteria 6889
292 Ga0207645_10091369 3300025907 Bacteria 1958
293 Ga0207705_10000002 3300025909 Bacteria 2046852
294 Ga0207705_10000673 3300025909 Bacteria 28381
295 Ga0207705_10001549 3300025909 Bacteria 18235
296 Ga0207705_10003314 3300025909 Bacteria 12245
297 Ga0207705_10008205 3300025909 Bacteria 7641
298 Ga0207705_10011618 3300025909 Bacteria 6364
299 Ga0207705_10022590 3300025909 Bacteria 4487
300 Ga0207705_10093196 3300025909 Bacteria 2208
301 Ga0207705_10108458 3300025909 Bacteria 2049
302 Ga0207705_10192605 3300025909 Bacteria 1542
303 Ga0207705_10226447 3300025909 Bacteria 1421
304 Ga0207654_10479424 3300025911 Bacteria 876
305 Ga0207707_10091266 3300025912 Bacteria 2662
306 Ga0207707_10113867 3300025912 Bacteria 2364
307 Ga0207707_10147539 3300025912 Bacteria 2057
308 Ga0207695_10033990 3300025913 Bacteria 5551
309 Ga0207695_10466074 3300025913 Bacteria 1146
310 Ga0207660_10347940 3300025917 Bacteria 1188
311 Ga0207660_10584302 3300025917 Bacteria 909
312 Ga0207662_11099122 3300025918 Bacteria 565
313 Ga0207657_10000267 3300025919 Bacteria 55426
314 Ga0207657_10001047 3300025919 Bacteria 29314
315 Ga0207657_10002051 3300025919 Bacteria 21802
316 Ga0207657_10006696 3300025919 Bacteria 11910
317 Ga0207657_10007422 3300025919 Bacteria 11246
318 Ga0207657_10012828 3300025919 Bacteria 8247
319 Ga0207657_10014570 3300025919 Bacteria 7662
320 Ga0207657_10176813 3300025919 Bacteria 1727
321 Ga0207657_10340107 3300025919 Bacteria 1184
322 Ga0207657_10641486 3300025919 Bacteria 827
323 Ga0207657_11136547 3300025919 Bacteria 596
324 Ga0207649_10000035 3300025920 Bacteria 134650
325 Ga0207649_10000883 3300025920 Bacteria 18965
326 Ga0207649_10024663 3300025920 Bacteria 3499
327 Ga0207649_10175925 3300025920 Bacteria 1494
328 Ga0207649_10684199 3300025920 Bacteria 795
329 Ga0207649_10984161 3300025920 Bacteria 663
330 Ga0207652_10000003 3300025921 Bacteria 502441
331 Ga0207652_10003472 3300025921 Bacteria 12998
332 Ga0207652_10077886 3300025921 Bacteria 2894
333 Ga0207652_10167542 3300025921 Bacteria 1970
334 Ga0207652_10393293 3300025921 Bacteria 1251
335 Ga0207652_11360386 3300025921 Bacteria 613
336 Ga0207652_11762310 3300025921 Bacteria 524
337 Ga0207646_10253259 3300025922 Bacteria 1591
338 Ga0207681_10011678 3300025923 Bacteria 5399
339 Ga0207681_10021928 3300025923 Bacteria 4067
340 Ga0207681_10035788 3300025923 Bacteria 3273
341 Ga0207681_10101263 3300025923 Bacteria 2078
342 Ga0207681_10109454 3300025923 Bacteria 2007
343 Ga0207681_10120914 3300025923 Bacteria 1920
344 Ga0207681_10245148 3300025923 Bacteria 1396
345 Ga0207681_10283158 3300025923 Bacteria 1306
346 Ga0207681_10365153 3300025923 Bacteria 1159
347 Ga0207681_10700767 3300025923 Bacteria 842
348 Ga0207681_11449649 3300025923 Bacteria 576
349 Ga0207694_10312398 3300025924 Bacteria 1296
350 Ga0207650_10001934 3300025925 Bacteria 14585
351 Ga0207650_10043272 3300025925 Bacteria 3305
352 Ga0207650_10062254 3300025925 Bacteria 2788
353 Ga0207650_10108624 3300025925 Bacteria 2145
354 Ga0207650_10770381 3300025925 Bacteria 815
355 Ga0207659_10005238 3300025926 Bacteria 7856
356 Ga0207659_10034621 3300025926 Bacteria 3484
357 Ga0207659_10097944 3300025926 Bacteria 2204
358 Ga0207659_10203911 3300025926 Bacteria 1581
359 Ga0207659_10317329 3300025926 Bacteria 1285
360 Ga0207664_10075480 3300025929 Bacteria 2726
361 Ga0207644_10000139 3300025931 Bacteria 51953
362 Ga0207644_10000941 3300025931 Bacteria 18539
363 Ga0207644_10011535 3300025931 Bacteria 5850
364 Ga0207644_10072575 3300025931 Bacteria 2521
365 Ga0207644_10306923 3300025931 Bacteria 1280
366 Ga0207690_10005772 3300025932 Bacteria 7320
367 Ga0207690_10024895 3300025932 Bacteria 3752
368 Ga0207690_10071454 3300025932 Bacteria 2394
369 Ga0207690_10203577 3300025932 Bacteria 1505
370 Ga0207690_10276295 3300025932 Bacteria 1307
371 Ga0207690_10385336 3300025932 Bacteria 1115
372 Ga0207690_11061535 3300025932 Bacteria 675
373 Ga0207706_10015013 3300025933 Bacteria 7012
374 Ga0207706_10033791 3300025933 Bacteria 4551
375 Ga0207706_10040493 3300025933 Bacteria 4129
376 Ga0207706_10104641 3300025933 Bacteria 2490
377 Ga0207706_10156056 3300025933 Bacteria 2007
378 Ga0207706_10189547 3300025933 Bacteria 1805
379 Ga0207706_10338541 3300025933 Bacteria 1309
380 Ga0207709_10015890 3300025935 Bacteria 4178
381 Ga0207669_10053204 3300025937 Bacteria 2437
382 Ga0207669_10135403 3300025937 Bacteria 1700
383 Ga0207669_10649969 3300025937 Bacteria 862
384 Ga0207669_10794792 3300025937 Bacteria 784
385 Ga0207704_10797757 3300025938 Bacteria 788
386 Ga0207691_10051024 3300025940 Bacteria 3784
387 Ga0207691_10058524 3300025940 Bacteria 3505
388 Ga0207691_10101086 3300025940 Bacteria 2573
389 Ga0207691_10145070 3300025940 Bacteria 2090
390 Ga0207691_10348873 3300025940 Bacteria 1266
391 Ga0207691_10684465 3300025940 Bacteria 865
392 Ga0207711_10009643 3300025941 Bacteria 8046
393 Ga0207711_10196874 3300025941 Bacteria 1838
394 Ga0207679_10006872 3300025945 Bacteria 7212
395 Ga0207679_10064344 3300025945 Bacteria 2741
396 Ga0207679_10140178 3300025945 Bacteria 1953
397 Ga0207679_10140809 3300025945 Bacteria 1949
398 Ga0207679_10742734 3300025945 Bacteria 892
399 Ga0207667_10007343 3300025949 Bacteria 13266
400 Ga0207667_10103026 3300025949 Bacteria 2944
401 Ga0207667_10119887 3300025949 Bacteria 2711
402 Ga0207667_10185042 3300025949 Bacteria 2139
403 Ga0207667_10408880 3300025949 Bacteria 1381
404 Ga0207667_10427562 3300025949 Bacteria 1347
405 Ga0207667_10518908 3300025949 Bacteria 1207
406 Ga0207651_10223256 3300025960 Bacteria 1524
407 Ga0207651_10292313 3300025960 Bacteria 1351
408 Ga0207651_10380190 3300025960 Bacteria 1196
409 Ga0207712_10387379 3300025961 Bacteria 1171
410 Ga0207668_10000012 3300025972 Bacteria 182541
411 Ga0207668_10056154 3300025972 Bacteria 2741
412 Ga0207668_10119773 3300025972 Bacteria 1991
413 Ga0207668_10197567 3300025972 Bacteria 1599
414 Ga0207668_10376308 3300025972 Bacteria 1194
415 Ga0207668_11963297 3300025972 Bacteria 527
416 Ga0207640_10001848 3300025981 Bacteria 11356
417 Ga0207640_10017338 3300025981 Bacteria 4213
418 Ga0207640_10111506 3300025981 Bacteria 1940
419 Ga0207640_10127334 3300025981 Bacteria 1835
420 Ga0207640_10191732 3300025981 Bacteria 1541
421 Ga0207640_10528316 3300025981 Bacteria 987
422 Ga0207658_10000011 3300025986 Bacteria 239620
423 Ga0207658_10002199 3300025986 Bacteria 14477
424 Ga0207658_10830996 3300025986 Bacteria 839
425 Ga0207677_10673209 3300026023 Bacteria 915
426 Ga0207703_10000474 3300026035 Bacteria 42009
427 Ga0207703_10849837 3300026035 Bacteria 873
428 Ga0207639_10125179 3300026041 Bacteria 2118
429 Ga0207639_10166856 3300026041 Bacteria 1861
430 Ga0207678_10000740 3300026067 Bacteria 29953
431 Ga0207678_10020475 3300026067 Bacteria 5801
432 Ga0207678_10091135 3300026067 Bacteria 2605
433 Ga0207678_10137931 3300026067 Bacteria 2081
434 Ga0207702_10014324 3300026078 Bacteria 6584
435 Ga0207702_10265240 3300026078 Bacteria 1618
436 Ga0207641_10000115 3300026088 Bacteria 118497
437 Ga0207641_10056518 3300026088 Bacteria 3335
438 Ga0207641_10157373 3300026088 Bacteria 2063
439 Ga0207641_11011083 3300026088 Bacteria 828
440 Ga0207641_11589248 3300026088 Bacteria 656
441 Ga0207648_10090261 3300026089 Bacteria 2677
442 Ga0207676_10034938 3300026095 Bacteria 3809
443 Ga0207676_10076556 3300026095 Bacteria 2704
444 Ga0207674_10018230 3300026116 Bacteria 7637
445 Ga0207674_10088834 3300026116 Bacteria 3083
446 Ga0207674_10180877 3300026116 Bacteria 2060
447 Ga0207674_10320405 3300026116 Bacteria 1499
448 Ga0207675_100019623 3300026118 Bacteria 6310
449 Ga0207675_100033901 3300026118 Bacteria 4758
450 Ga0207683_10202425 3300026121 Bacteria 1805
451 Ga0207683_10544541 3300026121 Bacteria 1073
452 Ga0207683_11179553 3300026121 Bacteria 710
453 Ga0207698_10149250 3300026142 Bacteria 2026
454 Ga0207698_10255992 3300026142 Bacteria 1605
455 Ga0207698_10880600 3300026142 Bacteria 902
456 Ga0209973_1067918 3300027252 Bacteria 555
457 Ga0209982_1077435 3300027552 Bacteria 547
458 Ga0209970_1028634 3300027614 Bacteria 962
459 Ga0209983_1042697 3300027665 Bacteria 983
460 Ga0209971_1050179 3300027682 Bacteria 1008
461 Ga0209971_1081903 3300027682 Bacteria 786
462 Ga0209974_10004110 3300027876 Bacteria 5201
463 Ga0209974_10007757 3300027876 Bacteria 3690
464 Ga0209974_10049059 3300027876 Bacteria 1416
465 Ga0209974_10105958 3300027876 Bacteria 986
466 Ga0209974_10157807 3300027876 Bacteria 822
467 Ga0268266_10032486 3300028379 Bacteria 4434
468 Ga0268265_10000442 3300028380 Bacteria 43732
469 Ga0268265_10177402 3300028380 Bacteria 1827
470 Ga0268264_10000089 3300028381 Bacteria 234760
471 Ga0316177_1184625 3300030731 Bacteria 565
472 Ga0316177_1200840 3300030731 Bacteria 1415
473 Ga0316182_1365612 3300030745 Bacteria 1317
474 Ga0316182_1391070 3300030745 Bacteria 1066
475 Ga0307408_100007529 3300031548 Bacteria 7197
476 Ga0307408_100049188 3300031548 Bacteria 3027
477 Ga0307408_100063963 3300031548 Bacteria 2693
478 Ga0307408_100104222 3300031548 Bacteria 2167
479 Ga0307408_100135353 3300031548 Bacteria 1927
480 Ga0307408_100198202 3300031548 Bacteria 1623
481 Ga0307408_100440006 3300031548 Bacteria 1128
482 Ga0307408_100702090 3300031548 Bacteria 909
483 Ga0307408_100709040 3300031548 Bacteria 905
484 Ga0307408_101130903 3300031548 Bacteria 728
485 Ga0307405_10007002 3300031731 Bacteria 5602
486 Ga0307405_10010274 3300031731 Bacteria 4839
487 Ga0307405_10070544 3300031731 Bacteria 2245
488 Ga0307405_10102744 3300031731 Bacteria 1920
489 Ga0307405_10157583 3300031731 Bacteria 1604
490 Ga0307405_10312412 3300031731 Bacteria 1197
491 Ga0307405_10347084 3300031731 Bacteria 1143
492 Ga0307405_10412948 3300031731 Bacteria 1060
493 Ga0307405_10649176 3300031731 Bacteria 867
494 Ga0307405_10833162 3300031731 Bacteria 775
495 Ga0307405_11792826 3300031731 Bacteria 545
496 Ga0307413_10005000 3300031824 Bacteria 5850
497 Ga0307413_10009008 3300031824 Bacteria 4750
498 Ga0307413_10016659 3300031824 Bacteria 3805
499 Ga0307413_10016920 3300031824 Bacteria 3785
500 Ga0307413_10070717 3300031824 Bacteria 2196
501 Ga0307413_10111440 3300031824 Bacteria 1832
502 Ga0307413_10141264 3300031824 Bacteria 1664
503 Ga0307413_10159596 3300031824 Bacteria 1582
504 Ga0307413_10211221 3300031824 Bacteria 1410
505 Ga0307413_10252342 3300031824 Bacteria 1309
506 Ga0307413_10353033 3300031824 Bacteria 1135
507 Ga0307413_10410158 3300031824 Bacteria 1064
508 Ga0307413_10803956 3300031824 Bacteria 790
509 Ga0307413_11022410 3300031824 Bacteria 710
510 Ga0307413_11713677 3300031824 Bacteria 561
511 Ga0307413_11887974 3300031824 Bacteria 536
512 Ga0307413_12183398 3300031824 Bacteria 502
513 Ga0307410_10005310 3300031852 Bacteria 6801
514 Ga0307410_10007253 3300031852 Bacteria 6055
515 Ga0307410_10012139 3300031852 Bacteria 4964
516 Ga0307410_10013692 3300031852 Bacteria 4743
517 Ga0307410_10032983 3300031852 Bacteria 3339
518 Ga0307410_10062654 3300031852 Bacteria 2549
519 Ga0307410_10138879 3300031852 Bacteria 1795
520 Ga0307410_10157463 3300031852 Bacteria 1698
521 Ga0307410_10160659 3300031852 Bacteria 1683
522 Ga0307410_10161892 3300031852 Bacteria 1678
523 Ga0307410_10203006 3300031852 Bacteria 1514
524 Ga0307410_10295103 3300031852 Bacteria 1277
525 Ga0307410_10386639 3300031852 Bacteria 1127
526 Ga0307410_10463528 3300031852 Bacteria 1036
527 Ga0307410_10497042 3300031852 Bacteria 1003
528 Ga0307410_10690560 3300031852 Bacteria 859
529 Ga0307410_11041606 3300031852 Bacteria 707
530 Ga0307406_10001811 3300031901 Bacteria 11673
531 Ga0307406_10046094 3300031901 Bacteria 2741
532 Ga0307406_10062115 3300031901 Bacteria 2415
533 Ga0307406_10062434 3300031901 Bacteria 2410
534 Ga0307406_10129411 3300031901 Bacteria 1769
535 Ga0307406_10186116 3300031901 Bacteria 1516
536 Ga0307406_10266902 3300031901 Bacteria 1298
537 Ga0307406_10476926 3300031901 Bacteria 1006
538 Ga0307407_10003820 3300031903 Bacteria 6272
539 Ga0307407_10009943 3300031903 Bacteria 4457
540 Ga0307407_10047675 3300031903 Bacteria 2433
541 Ga0307407_10088091 3300031903 Bacteria 1896
542 Ga0307407_10113279 3300031903 Bacteria 1706
543 Ga0307407_10128551 3300031903 Bacteria 1617
544 Ga0307407_10421815 3300031903 Bacteria 962
545 Ga0307407_10444656 3300031903 Bacteria 939
546 Ga0307407_10484726 3300031903 Bacteria 904
547 Ga0307407_10506759 3300031903 Bacteria 885
548 Ga0307407_10840137 3300031903 Bacteria 701
549 Ga0307412_10012591 3300031911 Bacteria 4935
550 Ga0307412_10032077 3300031911 Bacteria 3324
551 Ga0307412_10049840 3300031911 Bacteria 2760
552 Ga0307412_10050782 3300031911 Bacteria 2738
553 Ga0307412_10439102 3300031911 Bacteria 1072
554 Ga0307412_10958731 3300031911 Bacteria 753
555 Ga0307409_100005057 3300031995 Bacteria 7516
556 Ga0307409_100006744 3300031995 Bacteria 6791
557 Ga0307409_100023772 3300031995 Bacteria 4256
558 Ga0307409_100094437 3300031995 Bacteria 2461
559 Ga0307409_100154511 3300031995 Bacteria 1997
560 Ga0307409_100191240 3300031995 Bacteria 1822
561 Ga0307409_100279010 3300031995 Bacteria 1543
562 Ga0307409_100298139 3300031995 Bacteria 1498
563 Ga0307409_100321871 3300031995 Bacteria 1447
564 Ga0307409_100389879 3300031995 Bacteria 1327
565 Ga0307409_100493290 3300031995 Bacteria 1191
566 Ga0307409_100507196 3300031995 Bacteria 1176
567 Ga0307409_100550341 3300031995 Bacteria 1133
568 Ga0307409_100664535 3300031995 Bacteria 1037
569 Ga0307409_100785741 3300031995 Bacteria 958
570 Ga0307409_100807718 3300031995 Bacteria 946
571 Ga0307409_101645627 3300031995 Bacteria 670
572 Ga0307416_100005270 3300032002 Bacteria 7917
573 Ga0307416_100013797 3300032002 Bacteria 5506
574 Ga0307416_100028520 3300032002 Bacteria 4152
575 Ga0307416_100079022 3300032002 Bacteria 2771
576 Ga0307416_100155917 3300032002 Bacteria 2102
577 Ga0307416_100196172 3300032002 Bacteria 1910
578 Ga0307416_100247633 3300032002 Bacteria 1732
579 Ga0307416_100258564 3300032002 Bacteria 1700
580 Ga0307416_100337652 3300032002 Bacteria 1518
581 Ga0307416_100443765 3300032002 Bacteria 1348
582 Ga0307416_100610961 3300032002 Bacteria 1171
583 Ga0307416_100784535 3300032002 Bacteria 1047
584 Ga0307416_100943147 3300032002 Bacteria 964
585 Ga0307416_101912445 3300032002 Bacteria 697
586 Ga0307414_10013759 3300032004 Bacteria 4826
587 Ga0307414_10020128 3300032004 Bacteria 4152
588 Ga0307414_10023012 3300032004 Bacteria 3942
589 Ga0307414_10026600 3300032004 Bacteria 3726
590 Ga0307414_10091425 3300032004 Bacteria 2262
591 Ga0307414_10093212 3300032004 Bacteria 2244
592 Ga0307414_10110369 3300032004 Bacteria 2092
593 Ga0307414_10194175 3300032004 Bacteria 1645
594 Ga0307414_10197844 3300032004 Bacteria 1632
595 Ga0307414_10276676 3300032004 Bacteria 1408
596 Ga0307414_10486391 3300032004 Bacteria 1089
597 Ga0307414_10628157 3300032004 Bacteria 966
598 Ga0307414_10668114 3300032004 Bacteria 938
599 Ga0307414_10697660 3300032004 Bacteria 919
600 Ga0307414_10815686 3300032004 Bacteria 851
601 Ga0307414_11277706 3300032004 Bacteria 681
602 Ga0307414_11543583 3300032004 Bacteria 618
603 Ga0307414_12006670 3300032004 Bacteria 540
604 Ga0307411_10002032 3300032005 Bacteria 8676
605 Ga0307411_10006937 3300032005 Bacteria 5714
606 Ga0307411_10007469 3300032005 Bacteria 5572
607 Ga0307411_10046726 3300032005 Bacteria 2793
608 Ga0307411_10048566 3300032005 Bacteria 2751
609 Ga0307411_10074659 3300032005 Bacteria 2311
610 Ga0307411_10129911 3300032005 Bacteria 1839
611 Ga0307411_10168858 3300032005 Bacteria 1647
612 Ga0307411_10200966 3300032005 Bacteria 1530
613 Ga0307411_10206657 3300032005 Bacteria 1512
614 Ga0307411_10241681 3300032005 Bacteria 1414
615 Ga0307411_10306715 3300032005 Bacteria 1276
616 Ga0307411_10364325 3300032005 Bacteria 1183
617 Ga0307411_10384293 3300032005 Bacteria 1156
618 Ga0307411_10413587 3300032005 Bacteria 1118
619 Ga0307411_10584973 3300032005 Bacteria 957
620 Ga0307411_10712577 3300032005 Bacteria 875
621 Ga0307411_10860677 3300032005 Bacteria 803
622 Ga0307415_100009001 3300032126 Bacteria 5568
623 Ga0307415_100013739 3300032126 Bacteria 4736
624 Ga0307415_100013925 3300032126 Bacteria 4710
625 Ga0307415_100065000 3300032126 Bacteria 2540
626 Ga0307415_100101036 3300032126 Bacteria 2115
627 Ga0307415_100153265 3300032126 Bacteria 1776
628 Ga0307415_100209278 3300032126 Bacteria 1554
629 Ga0307415_100300570 3300032126 Bacteria 1329
630 Ga0307415_100686819 3300032126 Bacteria 922
631 Ga0307415_100825192 3300032126 Bacteria 848
632 Ga0307415_101163762 3300032126 Bacteria 725
633 Ga0307415_101322525 3300032126 Bacteria 683
634 Ga0307415_101351977 3300032126 Bacteria 676
635 Ga0307415_101754814 3300032126 Bacteria 600
636 Ga0307415_101946123 3300032126 Bacteria 571
637 Ga0373931_0632614 3300035691 Bacteria 702
638 Ga0316584_0098934 3300036712 Bacteria 2184
639 Ga0395899_0001291 3300037312 Bacteria 21622
640 Ga0395899_0006055 3300037312 Bacteria 9390
641 Ga0395899_0008125 3300037312 Bacteria 8083
642 Ga0395899_0009620 3300037312 Bacteria 7418
643 Ga0395899_0051014 3300037312 Bacteria 3071
644 Ga0395899_0478449 3300037312 Bacteria 811
645 Ga0395900_0000447 3300037418 Bacteria 59069
646 Ga0395900_0048606 3300037418 Bacteria 4369
647 Ga0395900_0192214 3300037418 Bacteria 2069
648 Ga0395900_0201328 3300037418 Bacteria 2014
649 Ga0395900_0207807 3300037418 Bacteria 1978
650 Ga0395900_0281463 3300037418 Bacteria 1655
651 Ga0395900_0475149 3300037418 Bacteria 1203
652 Ga0395900_0710973 3300037418 Bacteria 937
653 Ga0395900_1111318 3300037418 Bacteria 707
654 Ga0395898_0003866 3300037466 Bacteria 16551
655 Ga0395898_0014584 3300037466 Bacteria 8069
656 Ga0395898_0029335 3300037466 Bacteria 5512
657 Ga0395898_0040457 3300037466 Bacteria 4609
658 Ga0395898_0112915 3300037466 Bacteria 2604
659 Ga0395898_0974013 3300037466 Bacteria 785
660 Ga0395898_1745589 3300037466 Bacteria 544
661 Ga0395905_0048408 3300037471 Bacteria 3984
662 Ga0395905_0064672 3300037471 Bacteria 3423
663 Ga0395905_0146194 3300037471 Bacteria 2224
664 Ga0395905_0283835 3300037471 Bacteria 1542
665 Ga0395905_0595391 3300037471 Bacteria 1007
666 Ga0436364_1072241 3300037853 Bacteria 882
667 Ga0395901_0000324 3300038443 Bacteria 59134
668 Ga0395901_0082614 3300038443 Bacteria 3356
669 Ga0395901_0095428 3300038443 Bacteria 3116
670 Ga0395901_0117493 3300038443 Bacteria 2794
671 Ga0395901_0173346 3300038443 Bacteria 2263
672 Ga0395901_0207220 3300038443 Bacteria 2053
673 Ga0395901_0314867 3300038443 Bacteria 1620
674 Ga0395901_0728050 3300038443 Bacteria 987
675 Ga0395901_0817684 3300038443 Bacteria 919
676 Ga0395901_0911409 3300038443 Bacteria 860
677 Ga0395901_1495104 3300038443 Bacteria 631
678 Ga0395901_1724639 3300038443 Bacteria 577
679 Ga0237819_01073 3300038705 Bacteria 8100
680 Ga0237816_00317 3300039145 Bacteria 4136
681 Ga0436365_0821190 3300039437 Bacteria 17086
682 Ga0439436_0102831 3300041404 Bacteria 796
683 Ga0439461_0132397 3300041410 Bacteria 631
684 Ga0439465_0091417 3300041413 Bacteria 1041
685 Ga0439465_0406122 3300041413 Bacteria 519
686 Ga0451791_1297277 3300041451 Bacteria 811
687 Ga0451807_0700907 3300041486 Bacteria 998
688 Ga0451839_1017143 3300041496 Bacteria 568
689 Ga0451853_3500119 3300041512 Bacteria 2003
690 Ga0439431_0019707 3300041997 Bacteria 1605
691 Ga0439437_003145 3300042000 Bacteria 1779
692 Ga0439442_035210 3300042002 Bacteria 1047
693 Ga0439442_052509 3300042002 Bacteria 861
694 Ga0439443_006941 3300042003 Bacteria 1564
695 Ga0439445_0053200 3300042004 Bacteria 1096
696 Ga0439432_089397 3300042006 Bacteria 928
697 Ga0439449_0027057 3300042007 Bacteria 2141
698 Ga0439457_009705 3300042014 Bacteria 2234
699 Ga0439462_0001208 3300042015 Bacteria 5648
700 Ga0439462_0008646 3300042015 Bacteria 2571
701 Ga0439462_0056879 3300042015 Bacteria 1056
702 Ga0450912_001672 3300042116 Bacteria 1395
703 Ga0450895_014404 3300042132 Bacteria 699
704 Ga0450906_040534 3300042145 Bacteria 822
705 Ga0450910_048457 3300042147 Bacteria 698
706 Ga0439446_0107761 3300042156 Bacteria 886
707 Ga0450918_067659 3300042531 Bacteria 667
708 Ga0451577_0169758 3300042876 Bacteria 1966
709 Ga0466969_0011722 3300044656 Bacteria 4637
710 Ga0466966_0000077 3300044684 Bacteria 62463
711 Ga0466966_0017763 3300044684 Bacteria 4696
712 Ga0466961_0174410 3300044693 Bacteria 1336
713 Ga0466963_0039815 3300044694 Bacteria 3079
714 Ga0466963_0098772 3300044694 Bacteria 1996
715 Ga0466963_0732976 3300044694 Bacteria 697
716 Ga0466963_1203584 3300044694 Bacteria 532
717 Ga0466971_0004154 3300044719 Bacteria 6244
718 Ga0466970_0019762 3300044765 Bacteria 3495
719 Ga0466957_0042009 3300044842 Bacteria 2765
720 Ga0451576_2339543 3300045051 Bacteria 547
721 Ga0466958_0186073 3300045836 Bacteria 1319
722 Ga0466967_0092111 3300045976 Bacteria 2756
723 Ga0495627_151198 3300046453 Bacteria 648
724 Ga0495590_0093488 3300046457 Bacteria 1065
725 Ga0495585_0143699 3300046492 Bacteria 1248
726 Ga0495585_0220578 3300046492 Bacteria 957
727 Ga0495620_0119038 3300046515 Bacteria 1042
728 Ga0495663_0000982 3300046525 Bacteria 9423
729 Ga0495642_0033149 3300046528 Bacteria 2076
730 Ga0495598_0000608 3300046537 Bacteria 6771
731 Ga0495598_0019081 3300046537 Bacteria 1792
732 Ga0495598_0291928 3300046537 Bacteria 615
733 Ga0495621_0001412 3300046539 Bacteria 6225
734 Ga0495633_0004598 3300046558 Bacteria 8695
735 Ga0495656_0069667 3300046615 Bacteria 1559
736 Ga0495668_0036991 3300046616 Bacteria 2733
737 Ga0495669_0000720 3300046684 Bacteria 14382
738 Ga0495669_0025981 3300046684 Bacteria 2557
739 Ga0495670_0004022 3300046691 Bacteria 7208
740 Ga0495670_0148279 3300046691 Bacteria 1229
741 Ga0495670_0165353 3300046691 Bacteria 1164
742 Ga0495677_0002624 3300047445 Bacteria 7032
743 Ga0495681_0173254 3300047470 Bacteria 891
744 Ga0496101_0451971 3300048904 Bacteria 1014
745 Ga0496101_1049936 3300048904 Bacteria 640
746 Ga0496102_0548629 3300048905 Bacteria 1079
747 Ga0496107_0091378 3300048910 Bacteria 2225
748 Ga0496109_0029263 3300048912 Bacteria 4933
749 Ga0496109_0327980 3300048912 Bacteria 1445
750 Ga0496109_0431124 3300048912 Bacteria 1245
751 Ga0496110_0020611 3300048913 Bacteria 5569
752 Ga0496110_0385532 3300048913 Bacteria 1277
753 Ga0496110_0496755 3300048913 Bacteria 1111
754 Ga0496110_1386854 3300048913 Bacteria 612
755 Ga0496111_0004026 3300048914 Bacteria 9225
756 Ga0496111_0038086 3300048914 Bacteria 3444
757 Ga0496111_0543425 3300048914 Bacteria 853
758 Ga0496114_0007166 3300048917 Bacteria 8797
759 Ga0496114_0026588 3300048917 Bacteria 4739
760 Ga0496114_0051027 3300048917 Bacteria 3444
761 Ga0496121_0000201 3300048924 Bacteria 131246
762 Ga0495678_053954 3300049459 Bacteria 1541
763 Ga0501034_0897926 3300049571 Bacteria 774
764 Ga0501036_1392663 3300049572 Bacteria 569
765 Ga0501039_0256191 3300049575 Bacteria 1376
766 Ga0501046_0630292 3300049580 Bacteria 759
767 Ga0501047_0324564 3300049581 Bacteria 1379
768 Ga0501217_020403 3300049661 Bacteria 1556
769 Ga0501223_064886 3300049663 Bacteria 716
770 Ga0501227_124218 3300049665 Bacteria 699
771 Ga0501233_105980 3300049668 Bacteria 748
772 Ga0501242_075081 3300049674 Bacteria 535
773 Ga0501250_029957 3300049680 Bacteria 751
774 Ga0501225_0163585 3300049705 Bacteria 686
775 Ga0501225_0178328 3300049705 Bacteria 663
776 Ga0501268_058719 3300049765 Bacteria 758
777 Ga0501270_014900 3300049767 Bacteria 1102
778 Ga0501035_1088166 3300049822 Bacteria 625
779 Ga0501035_1496565 3300049822 Bacteria 515
780 Ga0501044_0398716 3300049823 Bacteria 1289
781 Ga0500643_009425 3300053087 Bacteria 3734
782 Ga0500566_0001993 3300053094 Bacteria 12051
783 Ga0500555_059971 3300053103 Bacteria 1025
784 Ga0500658_0085828 3300053134 Bacteria 1353
785 Ga0500559_0134801 3300053136 Bacteria 1154
786 Ga0500568_0382910 3300053139 Bacteria 509
787 Ga0500577_0268216 3300053142 Bacteria 743
788 Ga0500588_0020709 3300053146 Bacteria 1766
789 Ga0500604_0222523 3300053151 Bacteria 651
790 Ga0501084_1508003 3300054114 Bacteria 563
791 Ga0590077_044978 3300059426 Bacteria 986
792 Ga0466962_0002042 3300061719 Bacteria 9543

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_1072241 Ga0436364_1072241_476_865 120
2 iso_pu_bacteria 2643221541 2643726963 121
3 iso_pu_bacteria 2643221606 2644045996 121
4 iso_pu_bacteria 2643221671 2644393193 121
5 2209111006 2214814960 2213849001 125
6 3300001904 JGI24736J21556_1000939 JGI24736J21556_10009394 125
7 3300001915 JGI24741J21665_1019747 JGI24741J21665_10197473 125
8 3300001979 JGI24740J21852_10005216 JGI24740J21852_100052164 125
9 3300001990 JGI24737J22298_10055753 JGI24737J22298_100557532 125
10 3300002239 JGI24034J26672_10010588 JGI24034J26672_100105882 125
11 3300002459 JGI24751J29686_10011725 JGI24751J29686_100117253 125
12 3300002774 JGI25150J39212_1049317 JGI25150J39212_10493171 125
13 3300002774 JGI25150J39212_1052103 JGI25150J39212_10521031 125
14 3300003215 JGI25153J46596_10008965 JGI25153J46596_100089655 125
15 3300003773 Ga0055537_1000441 Ga0055537_10004419 125
16 3300003773 Ga0055537_1012581 Ga0055537_10125813 125
17 3300003775 Ga0055524_1000245 Ga0055524_100024545 125
18 3300003791 Ga0055530_10012116 Ga0055530_100121166 125
19 3300003791 Ga0055530_10075250 Ga0055530_100752501 125
20 3300003794 Ga0055531_10002452 Ga0055531_1000245214 125
21 3300003911 JGI25405J52794_10034577 JGI25405J52794_100345772 125
22 3300004625 Ga0055543_1011280 Ga0055543_10112804 125
23 3300005262 Ga0065165_1008746 Ga0065165_10087464 125
24 3300005262 Ga0065165_1032218 Ga0065165_10322182 125
25 3300005290 Ga0065712_10002451 Ga0065712_100024514 125
26 3300005290 Ga0065712_10100222 Ga0065712_101002223 125
27 3300005293 Ga0065715_10002752 Ga0065715_100027524 125
28 3300005293 Ga0065715_10028692 Ga0065715_100286922 125
29 3300005293 Ga0065715_10124416 Ga0065715_101244162 125
30 3300005327 Ga0070658_10002325 Ga0070658_100023255 125
31 3300005327 Ga0070658_10003674 Ga0070658_1000367412 125
32 3300005327 Ga0070658_10005871 Ga0070658_100058712 125
33 3300005327 Ga0070658_10080815 Ga0070658_100808153 125
34 3300005327 Ga0070658_10111656 Ga0070658_101116561 125
35 3300005327 Ga0070658_10147544 Ga0070658_101475443 125
36 3300005327 Ga0070658_10343096 Ga0070658_103430961 125
37 3300005327 Ga0070658_10510952 Ga0070658_105109521 125
38 3300005327 Ga0070658_11014154 Ga0070658_110141542 125
39 3300005328 Ga0070676_10005263 Ga0070676_100052632 125
40 3300005329 Ga0070683_100008142 Ga0070683_1000081429 125
41 3300005331 Ga0070670_100003053 Ga0070670_10000305313 125
42 3300005331 Ga0070670_100042043 Ga0070670_1000420433 125
43 3300005331 Ga0070670_100238668 Ga0070670_1002386683 125
44 3300005331 Ga0070670_100246219 Ga0070670_1002462192 125
45 3300005331 Ga0070670_101432371 Ga0070670_1014323712 125
46 3300005333 Ga0070677_10000456 Ga0070677_1000045613 125
47 3300005333 Ga0070677_10045304 Ga0070677_100453042 125
48 3300005333 Ga0070677_10307029 Ga0070677_103070292 125
49 3300005333 Ga0070677_10521474 Ga0070677_105214741 125
50 3300005333 Ga0070677_10622198 Ga0070677_106221981 125
51 3300005335 Ga0070666_10008323 Ga0070666_100083235 125
52 3300005336 Ga0070680_100026295 Ga0070680_1000262953 125
53 3300005336 Ga0070680_100338796 Ga0070680_1003387962 125
54 3300005336 Ga0070680_100360438 Ga0070680_1003604382 125
55 3300005336 Ga0070680_100382751 Ga0070680_1003827511 125
56 3300005336 Ga0070680_101082462 Ga0070680_1010824622 125
57 3300005338 Ga0068868_100738943 Ga0068868_1007389432 125
58 3300005339 Ga0070660_100001300 Ga0070660_1000013006 125
59 3300005339 Ga0070660_100003050 Ga0070660_1000030502 125
60 3300005339 Ga0070660_100003201 Ga0070660_10000320113 125
61 3300005339 Ga0070660_100014004 Ga0070660_1000140049 125
62 3300005339 Ga0070660_100017015 Ga0070660_1000170152 125
63 3300005339 Ga0070660_100031646 Ga0070660_1000316462 125
64 3300005339 Ga0070660_100052189 Ga0070660_1000521892 125
65 3300005339 Ga0070660_100086049 Ga0070660_1000860492 125
66 3300005339 Ga0070660_100145343 Ga0070660_1001453432 125
67 3300005339 Ga0070660_100173905 Ga0070660_1001739052 125
68 3300005339 Ga0070660_100283912 Ga0070660_1002839121 125
69 3300005339 Ga0070660_100515884 Ga0070660_1005158842 125
70 3300005339 Ga0070660_101235432 Ga0070660_1012354322 125
71 3300005339 Ga0070660_101580369 Ga0070660_1015803691 125
72 3300005340 Ga0070689_100604544 Ga0070689_1006045442 125
73 3300005343 Ga0070687_100226069 Ga0070687_1002260692 125
74 3300005344 Ga0070661_100000009 Ga0070661_10000000966 125
75 3300005344 Ga0070661_100005747 Ga0070661_1000057478 125
76 3300005344 Ga0070661_100128588 Ga0070661_1001285883 125
77 3300005344 Ga0070661_100511045 Ga0070661_1005110452 125
78 3300005344 Ga0070661_100784995 Ga0070661_1007849951 125
79 3300005345 Ga0070692_10007743 Ga0070692_100077433 125
80 3300005345 Ga0070692_10040842 Ga0070692_100408423 125
81 3300005345 Ga0070692_11182090 Ga0070692_111820902 125
82 3300005347 Ga0070668_100000015 Ga0070668_10000001585 125
83 3300005347 Ga0070668_100125549 Ga0070668_1001255493 125
84 3300005347 Ga0070668_100410534 Ga0070668_1004105342 125
85 3300005347 Ga0070668_100679438 Ga0070668_1006794382 125
86 3300005353 Ga0070669_100042765 Ga0070669_1000427652 125
87 3300005353 Ga0070669_100051030 Ga0070669_1000510303 125
88 3300005353 Ga0070669_100051768 Ga0070669_1000517683 125
89 3300005353 Ga0070669_100086459 Ga0070669_1000864592 125
90 3300005353 Ga0070669_100300753 Ga0070669_1003007532 125
91 3300005353 Ga0070669_100303537 Ga0070669_1003035372 125
92 3300005353 Ga0070669_100353272 Ga0070669_1003532722 125
93 3300005353 Ga0070669_100437455 Ga0070669_1004374552 125
94 3300005353 Ga0070669_101664383 Ga0070669_1016643831 125
95 3300005354 Ga0070675_100001728 Ga0070675_1000017284 125
96 3300005354 Ga0070675_100003423 Ga0070675_1000034233 125
97 3300005354 Ga0070675_100241199 Ga0070675_1002411992 125
98 3300005354 Ga0070675_100383728 Ga0070675_1003837282 125
99 3300005355 Ga0070671_100000322 Ga0070671_10000032217 125
100 3300005355 Ga0070671_100012423 Ga0070671_1000124232 125
101 3300005355 Ga0070671_100094864 Ga0070671_1000948642 125
102 3300005355 Ga0070671_100386599 Ga0070671_1003865992 125
103 3300005355 Ga0070671_100981292 Ga0070671_1009812922 125
104 3300005356 Ga0070674_100067301 Ga0070674_1000673012 125
105 3300005356 Ga0070674_100078186 Ga0070674_1000781862 125
106 3300005356 Ga0070674_100251530 Ga0070674_1002515302 125
107 3300005356 Ga0070674_100446229 Ga0070674_1004462292 125
108 3300005356 Ga0070674_100869687 Ga0070674_1008696872 125
109 3300005364 Ga0070673_100002044 Ga0070673_10000204414 125
110 3300005364 Ga0070673_100074161 Ga0070673_1000741612 125
111 3300005364 Ga0070673_100149011 Ga0070673_1001490112 125
112 3300005364 Ga0070673_100337495 Ga0070673_1003374952 125
113 3300005364 Ga0070673_100426871 Ga0070673_1004268712 125
114 3300005366 Ga0070659_100000979 Ga0070659_10000097914 125
115 3300005366 Ga0070659_100048521 Ga0070659_1000485215 125
116 3300005366 Ga0070659_100059123 Ga0070659_1000591233 125
117 3300005366 Ga0070659_100363038 Ga0070659_1003630382 125
118 3300005366 Ga0070659_100590201 Ga0070659_1005902011 125
119 3300005366 Ga0070659_100743754 Ga0070659_1007437541 125
120 3300005366 Ga0070659_101741934 Ga0070659_1017419341 125
121 3300005367 Ga0070667_100000017 Ga0070667_100000017115 125
122 3300005367 Ga0070667_100093954 Ga0070667_1000939542 125
123 3300005367 Ga0070667_100262476 Ga0070667_1002624762 125
124 3300005455 Ga0070663_100014045 Ga0070663_1000140454 125
125 3300005455 Ga0070663_100032493 Ga0070663_1000324934 125
126 3300005455 Ga0070663_100042039 Ga0070663_1000420393 125
127 3300005455 Ga0070663_100395515 Ga0070663_1003955151 125
128 3300005455 Ga0070663_101767648 Ga0070663_1017676482 125
129 3300005456 Ga0070678_100164276 Ga0070678_1001642763 125
130 3300005456 Ga0070678_100181774 Ga0070678_1001817742 125
131 3300005456 Ga0070678_100517362 Ga0070678_1005173622 125
132 3300005457 Ga0070662_100018695 Ga0070662_1000186952 125
133 3300005457 Ga0070662_100044388 Ga0070662_1000443882 125
134 3300005457 Ga0070662_100222171 Ga0070662_1002221712 125
135 3300005457 Ga0070662_100639341 Ga0070662_1006393412 125
136 3300005457 Ga0070662_100646677 Ga0070662_1006466771 125
137 3300005458 Ga0070681_10094424 Ga0070681_100944243 125
138 3300005458 Ga0070681_10748623 Ga0070681_107486232 125
139 3300005458 Ga0070681_11067016 Ga0070681_110670162 125
140 3300005459 Ga0068867_100177096 Ga0068867_1001770962 125
141 3300005530 Ga0070679_100000404 Ga0070679_1000004048 125
142 3300005530 Ga0070679_100054822 Ga0070679_1000548223 125
143 3300005530 Ga0070679_100100813 Ga0070679_1001008134 125
144 3300005530 Ga0070679_100111539 Ga0070679_1001115393 125
145 3300005530 Ga0070679_100203743 Ga0070679_1002037433 125
146 3300005530 Ga0070679_100503309 Ga0070679_1005033092 125
147 3300005530 Ga0070679_100642577 Ga0070679_1006425771 125
148 3300005530 Ga0070679_100974810 Ga0070679_1009748102 125
149 3300005530 Ga0070679_101814886 Ga0070679_1018148861 125
150 3300005535 Ga0070684_100338082 Ga0070684_1003380822 125
151 3300005535 Ga0070684_101674257 Ga0070684_1016742571 125
152 3300005539 Ga0068853_100131472 Ga0068853_1001314722 125
153 3300005539 Ga0068853_100242334 Ga0068853_1002423342 125
154 3300005539 Ga0068853_100249839 Ga0068853_1002498392 125
155 3300005539 Ga0068853_100946309 Ga0068853_1009463092 125
156 3300005543 Ga0070672_100019791 Ga0070672_1000197916 125
157 3300005543 Ga0070672_100089851 Ga0070672_1000898513 125
158 3300005543 Ga0070672_100639022 Ga0070672_1006390222 125
159 3300005543 Ga0070672_101207356 Ga0070672_1012073562 125
160 3300005546 Ga0070696_100918687 Ga0070696_1009186872 125
161 3300005548 Ga0070665_100060440 Ga0070665_1000604404 125
162 3300005563 Ga0068855_100026818 Ga0068855_1000268188 125
163 3300005563 Ga0068855_100039512 Ga0068855_1000395124 125
164 3300005563 Ga0068855_100130375 Ga0068855_1001303754 125
165 3300005564 Ga0070664_100014561 Ga0070664_1000145614 125
166 3300005564 Ga0070664_100085974 Ga0070664_1000859742 125
167 3300005564 Ga0070664_100128457 Ga0070664_1001284573 125
168 3300005564 Ga0070664_100151187 Ga0070664_1001511872 125
169 3300005564 Ga0070664_100835859 Ga0070664_1008358591 125
170 3300005577 Ga0068857_100081237 Ga0068857_1000812373 125
171 3300005577 Ga0068857_100238406 Ga0068857_1002384062 125
172 3300005578 Ga0068854_100003883 Ga0068854_1000038839 125
173 3300005578 Ga0068854_100138268 Ga0068854_1001382683 125
174 3300005578 Ga0068854_100321087 Ga0068854_1003210872 125
175 3300005578 Ga0068854_100827485 Ga0068854_1008274852 125
176 3300005614 Ga0068856_100009497 Ga0068856_1000094979 125
177 3300005614 Ga0068856_100399926 Ga0068856_1003999262 125
178 3300005614 Ga0068856_100455097 Ga0068856_1004550973 125
179 3300005616 Ga0068852_100008362 Ga0068852_1000083623 125
180 3300005616 Ga0068852_100294561 Ga0068852_1002945612 125
181 3300005616 Ga0068852_100425180 Ga0068852_1004251801 125
182 3300005617 Ga0068859_100253494 Ga0068859_1002534943 125
183 3300005617 Ga0068859_101603435 Ga0068859_1016034352 125
184 3300005618 Ga0068864_100006205 Ga0068864_10000620511 125
185 3300005618 Ga0068864_100588810 Ga0068864_1005888102 125
186 3300005719 Ga0068861_100043504 Ga0068861_1000435045 125
187 3300005840 Ga0068870_10227811 Ga0068870_102278112 125
188 3300005840 Ga0068870_10437691 Ga0068870_104376911 125
189 3300005841 Ga0068863_100016985 Ga0068863_1000169852 125
190 3300005841 Ga0068863_100595975 Ga0068863_1005959752 125
191 3300005841 Ga0068863_101340213 Ga0068863_1013402132 125
192 3300005842 Ga0068858_100001873 Ga0068858_1000018737 125
193 3300005842 Ga0068858_100702362 Ga0068858_1007023622 125
194 3300005843 Ga0068860_100000056 Ga0068860_100000056129 125
195 3300005844 Ga0068862_100000108 Ga0068862_10000010837 125
196 3300005844 Ga0068862_100419206 Ga0068862_1004192062 125
197 3300005844 Ga0068862_100814262 Ga0068862_1008142621 125
198 3300005937 Ga0081455_10000964 Ga0081455_1000096419 125
199 3300006038 Ga0075365_10051703 Ga0075365_100517033 125
200 3300006051 Ga0075364_10149240 Ga0075364_101492403 125
201 3300006237 Ga0097621_101135506 Ga0097621_1011355062 125
202 3300006353 Ga0075370_10197398 Ga0075370_101973981 125
203 3300006353 Ga0075370_10251505 Ga0075370_102515052 125
204 3300006358 Ga0068871_101268827 Ga0068871_1012688272 125
205 3300006881 Ga0068865_100621950 Ga0068865_1006219502 125
206 3300006881 Ga0068865_101169459 Ga0068865_1011694591 125
207 3300006931 Ga0097620_100253502 Ga0097620_1002535023 125
208 3300006931 Ga0097620_101603348 Ga0097620_1016033482 125
209 3300009093 Ga0105240_10073464 Ga0105240_100734644 125
210 3300009093 Ga0105240_10807730 Ga0105240_108077301 125
211 3300009101 Ga0105247_11104328 Ga0105247_111043282 125
212 3300009148 Ga0105243_10027845 Ga0105243_100278454 125
213 3300009148 Ga0105243_10549280 Ga0105243_105492802 125
214 3300009148 Ga0105243_10981002 Ga0105243_109810022 125
215 3300009174 Ga0105241_11216722 Ga0105241_112167222 125
216 3300009177 Ga0105248_10008010 Ga0105248_100080104 125
217 3300009177 Ga0105248_10317465 Ga0105248_103174653 125
218 3300009177 Ga0105248_11374633 Ga0105248_113746331 125
219 3300009551 Ga0105238_10221634 Ga0105238_102216342 125
220 3300009551 Ga0105238_10381912 Ga0105238_103819122 125
221 3300009553 Ga0105249_10609447 Ga0105249_106094473 125
222 3300010375 Ga0105239_10134418 Ga0105239_101344183 125
223 3300012512 Ga0157327_1020172 Ga0157327_10201722 125
224 3300012513 Ga0157326_1002409 Ga0157326_10024092 125
225 3300013100 Ga0157373_10002525 Ga0157373_100025259 125
226 3300013100 Ga0157373_10023486 Ga0157373_100234864 125
227 3300013100 Ga0157373_10160641 Ga0157373_101606413 125
228 3300013100 Ga0157373_10227975 Ga0157373_102279753 125
229 3300013100 Ga0157373_10235618 Ga0157373_102356182 125
230 3300013100 Ga0157373_10273000 Ga0157373_102730002 125
231 3300013100 Ga0157373_10487429 Ga0157373_104874292 125
232 3300013100 Ga0157373_10557542 Ga0157373_105575422 125
233 3300013102 Ga0157371_10002615 Ga0157371_1000261512 125
234 3300013102 Ga0157371_10008024 Ga0157371_100080243 125
235 3300013102 Ga0157371_10122835 Ga0157371_101228352 125
236 3300013102 Ga0157371_10272687 Ga0157371_102726872 125
237 3300013102 Ga0157371_10290586 Ga0157371_102905861 125
238 3300013102 Ga0157371_10299167 Ga0157371_102991671 125
239 3300013102 Ga0157371_11411167 Ga0157371_114111671 125
240 3300013104 Ga0157370_10017735 Ga0157370_100177351 125
241 3300013104 Ga0157370_10475894 Ga0157370_104758942 125
242 3300013104 Ga0157370_10748203 Ga0157370_107482032 125
243 3300013105 Ga0157369_10001135 Ga0157369_100011354 125
244 3300013105 Ga0157369_10003392 Ga0157369_100033923 125
245 3300013105 Ga0157369_10023242 Ga0157369_100232424 125
246 3300013105 Ga0157369_11164135 Ga0157369_111641352 125
247 3300013296 Ga0157374_10068169 Ga0157374_100681692 125
248 3300013306 Ga0163162_10391762 Ga0163162_103917622 125
249 3300013307 Ga0157372_10093611 Ga0157372_100936114 125
250 3300013307 Ga0157372_10158636 Ga0157372_101586361 125
251 3300013307 Ga0157372_10176026 Ga0157372_101760262 125
252 3300013307 Ga0157372_10511932 Ga0157372_105119323 125
253 3300013307 Ga0157372_10652951 Ga0157372_106529511 125
254 3300013308 Ga0157375_10004286 Ga0157375_1000428611 125
255 3300013308 Ga0157375_10450073 Ga0157375_104500731 125
256 3300014325 Ga0163163_10105952 Ga0163163_101059522 125
257 3300014325 Ga0163163_10197748 Ga0163163_101977484 125
258 3300014325 Ga0163163_10624305 Ga0163163_106243052 125
259 3300014326 Ga0157380_10008061 Ga0157380_100080612 125
260 3300014326 Ga0157380_10014874 Ga0157380_100148742 125
261 3300014326 Ga0157380_10052755 Ga0157380_100527552 125
262 3300014326 Ga0157380_10320287 Ga0157380_103202874 125
263 3300014326 Ga0157380_10499218 Ga0157380_104992181 125
264 3300014326 Ga0157380_11258657 Ga0157380_112586572 125
265 3300014968 Ga0157379_11517235 Ga0157379_115172352 125
266 3300017792 Ga0163161_10185712 Ga0163161_101857122 125
267 3300017792 Ga0163161_10663822 Ga0163161_106638221 125
268 3300017792 Ga0163161_10685195 Ga0163161_106851952 125
269 3300020082 Ga0206353_10796169 Ga0206353_107961692 125
270 3300021384 Ga0213876_10001167 Ga0213876_100011672 125
271 3300025245 Ga0207425_1007318 Ga0207425_10073182 125
272 3300025263 Ga0209565_1000007 Ga0209565_1000007329 125
273 3300025263 Ga0209565_1001004 Ga0209565_100100420 125
274 3300025273 Ga0209673_1001016 Ga0209673_100101616 125
275 3300025273 Ga0209673_1008645 Ga0209673_10086453 125
276 3300025291 Ga0209675_1013627 Ga0209675_10136272 125
277 3300025295 Ga0209564_1007139 Ga0209564_10071393 125
278 3300025297 Ga0209758_1007609 Ga0209758_10076092 125
279 3300025297 Ga0209758_1027150 Ga0209758_10271503 125
280 3300025298 Ga0209050_1014851 Ga0209050_10148513 125
281 3300025298 Ga0209050_1022518 Ga0209050_10225182 125
282 3300025299 Ga0209256_1000008 Ga0209256_1000008171 125
283 3300025304 Ga0209257_1004536 Ga0209257_10045365 125
284 3300025315 Ga0207697_10072169 Ga0207697_100721691 125
285 3300025315 Ga0207697_10081771 Ga0207697_100817711 125
286 3300025893 Ga0207682_10001287 Ga0207682_100012879 125
287 3300025893 Ga0207682_10084148 Ga0207682_100841482 125
288 3300025893 Ga0207682_10126320 Ga0207682_101263202 125
289 3300025901 Ga0207688_10025725 Ga0207688_100257253 125
290 3300025901 Ga0207688_10123898 Ga0207688_101238981 125
291 3300025903 Ga0207680_10035897 Ga0207680_100358973 125
292 3300025903 Ga0207680_10071279 Ga0207680_100712793 125
293 3300025903 Ga0207680_10230023 Ga0207680_102300231 125
294 3300025904 Ga0207647_10013638 Ga0207647_100136383 125
295 3300025907 Ga0207645_10009100 Ga0207645_100091007 125
296 3300025907 Ga0207645_10091369 Ga0207645_100913693 125
297 3300025909 Ga0207705_10000002 Ga0207705_10000002427 125
298 3300025909 Ga0207705_10000673 Ga0207705_1000067326 125
299 3300025909 Ga0207705_10001549 Ga0207705_1000154915 125
300 3300025909 Ga0207705_10003314 Ga0207705_100033149 125
301 3300025909 Ga0207705_10008205 Ga0207705_100082059 125
302 3300025909 Ga0207705_10011618 Ga0207705_100116182 125
303 3300025909 Ga0207705_10022590 Ga0207705_100225903 125
304 3300025909 Ga0207705_10093196 Ga0207705_100931962 125
305 3300025909 Ga0207705_10108458 Ga0207705_101084583 125
306 3300025909 Ga0207705_10192605 Ga0207705_101926054 125
307 3300025909 Ga0207705_10226447 Ga0207705_102264474 125
308 3300025911 Ga0207654_10479424 Ga0207654_104794242 125
309 3300025912 Ga0207707_10091266 Ga0207707_100912663 125
310 3300025912 Ga0207707_10113867 Ga0207707_101138672 125
311 3300025912 Ga0207707_10147539 Ga0207707_101475392 125
312 3300025913 Ga0207695_10033990 Ga0207695_100339904 125
313 3300025913 Ga0207695_10466074 Ga0207695_104660742 125
314 3300025917 Ga0207660_10347940 Ga0207660_103479401 125
315 3300025917 Ga0207660_10584302 Ga0207660_105843022 125
316 3300025918 Ga0207662_11099122 Ga0207662_110991221 125
317 3300025919 Ga0207657_10000267 Ga0207657_1000026725 125
318 3300025919 Ga0207657_10001047 Ga0207657_1000104710 125
319 3300025919 Ga0207657_10002051 Ga0207657_1000205124 125
320 3300025919 Ga0207657_10006696 Ga0207657_1000669611 125
321 3300025919 Ga0207657_10007422 Ga0207657_1000742212 125
322 3300025919 Ga0207657_10012828 Ga0207657_100128283 125
323 3300025919 Ga0207657_10014570 Ga0207657_1001457010 125
324 3300025919 Ga0207657_10176813 Ga0207657_101768132 125
325 3300025919 Ga0207657_10340107 Ga0207657_103401072 125
326 3300025919 Ga0207657_10641486 Ga0207657_106414861 125
327 3300025919 Ga0207657_11136547 Ga0207657_111365472 125
328 3300025920 Ga0207649_10000035 Ga0207649_10000035107 125
329 3300025920 Ga0207649_10000883 Ga0207649_100008833 125
330 3300025920 Ga0207649_10024663 Ga0207649_100246633 125
331 3300025920 Ga0207649_10175925 Ga0207649_101759251 125
332 3300025920 Ga0207649_10684199 Ga0207649_106841992 125
333 3300025920 Ga0207649_10984161 Ga0207649_109841612 125
334 3300025921 Ga0207652_10000003 Ga0207652_10000003469 125
335 3300025921 Ga0207652_10003472 Ga0207652_1000347214 125
336 3300025921 Ga0207652_10077886 Ga0207652_100778864 125
337 3300025921 Ga0207652_10167542 Ga0207652_101675424 125
338 3300025921 Ga0207652_10393293 Ga0207652_103932932 125
339 3300025921 Ga0207652_11360386 Ga0207652_113603861 125
340 3300025921 Ga0207652_11762310 Ga0207652_117623101 125
341 3300025922 Ga0207646_10253259 Ga0207646_102532593 125
342 3300025923 Ga0207681_10011678 Ga0207681_100116782 125
343 3300025923 Ga0207681_10021928 Ga0207681_100219287 125
344 3300025923 Ga0207681_10035788 Ga0207681_100357882 125
345 3300025923 Ga0207681_10101263 Ga0207681_101012633 125
346 3300025923 Ga0207681_10109454 Ga0207681_101094543 125
347 3300025923 Ga0207681_10120914 Ga0207681_101209142 125
348 3300025923 Ga0207681_10245148 Ga0207681_102451483 125
349 3300025923 Ga0207681_10283158 Ga0207681_102831582 125
350 3300025923 Ga0207681_10365153 Ga0207681_103651532 125
351 3300025923 Ga0207681_10700767 Ga0207681_107007672 125
352 3300025923 Ga0207681_11449649 Ga0207681_114496491 125
353 3300025924 Ga0207694_10312398 Ga0207694_103123982 125
354 3300025925 Ga0207650_10001934 Ga0207650_100019344 125
355 3300025925 Ga0207650_10043272 Ga0207650_100432722 125
356 3300025925 Ga0207650_10062254 Ga0207650_100622544 125
357 3300025925 Ga0207650_10108624 Ga0207650_101086243 125
358 3300025925 Ga0207650_10770381 Ga0207650_107703812 125
359 3300025926 Ga0207659_10005238 Ga0207659_100052383 125
360 3300025926 Ga0207659_10034621 Ga0207659_100346212 125
361 3300025926 Ga0207659_10097944 Ga0207659_100979443 125
362 3300025926 Ga0207659_10203911 Ga0207659_102039113 125
363 3300025926 Ga0207659_10317329 Ga0207659_103173292 125
364 3300025929 Ga0207664_10075480 Ga0207664_100754803 125
365 3300025931 Ga0207644_10000139 Ga0207644_1000013959 125
366 3300025931 Ga0207644_10000941 Ga0207644_100009412 125
367 3300025931 Ga0207644_10011535 Ga0207644_100115356 125
368 3300025931 Ga0207644_10072575 Ga0207644_100725751 125
369 3300025931 Ga0207644_10306923 Ga0207644_103069231 125
370 3300025932 Ga0207690_10005772 Ga0207690_100057723 125
371 3300025932 Ga0207690_10024895 Ga0207690_100248952 125
372 3300025932 Ga0207690_10071454 Ga0207690_100714541 125
373 3300025932 Ga0207690_10203577 Ga0207690_102035773 125
374 3300025932 Ga0207690_10276295 Ga0207690_102762952 125
375 3300025932 Ga0207690_10385336 Ga0207690_103853362 125
376 3300025932 Ga0207690_11061535 Ga0207690_110615352 125
377 3300025933 Ga0207706_10015013 Ga0207706_100150138 125
378 3300025933 Ga0207706_10033791 Ga0207706_100337915 125
379 3300025933 Ga0207706_10040493 Ga0207706_100404934 125
380 3300025933 Ga0207706_10104641 Ga0207706_101046412 125
381 3300025933 Ga0207706_10156056 Ga0207706_101560563 125
382 3300025933 Ga0207706_10189547 Ga0207706_101895471 125
383 3300025933 Ga0207706_10338541 Ga0207706_103385412 125
384 3300025935 Ga0207709_10015890 Ga0207709_100158903 125
385 3300025937 Ga0207669_10053204 Ga0207669_100532042 125
386 3300025937 Ga0207669_10135403 Ga0207669_101354033 125
387 3300025937 Ga0207669_10649969 Ga0207669_106499692 125
388 3300025937 Ga0207669_10794792 Ga0207669_107947922 125
389 3300025938 Ga0207704_10797757 Ga0207704_107977572 125
390 3300025940 Ga0207691_10051024 Ga0207691_100510243 125
391 3300025940 Ga0207691_10058524 Ga0207691_100585242 125
392 3300025940 Ga0207691_10101086 Ga0207691_101010862 125
393 3300025940 Ga0207691_10145070 Ga0207691_101450703 125
394 3300025940 Ga0207691_10348873 Ga0207691_103488732 125
395 3300025940 Ga0207691_10684465 Ga0207691_106844652 125
396 3300025941 Ga0207711_10009643 Ga0207711_100096433 125
397 3300025941 Ga0207711_10196874 Ga0207711_101968742 125
398 3300025945 Ga0207679_10006872 Ga0207679_100068723 125
399 3300025945 Ga0207679_10064344 Ga0207679_100643442 125
400 3300025945 Ga0207679_10140178 Ga0207679_101401782 125
401 3300025945 Ga0207679_10140809 Ga0207679_101408093 125
402 3300025945 Ga0207679_10742734 Ga0207679_107427342 125
403 3300025949 Ga0207667_10007343 Ga0207667_100073434 125
404 3300025949 Ga0207667_10103026 Ga0207667_101030263 125
405 3300025949 Ga0207667_10119887 Ga0207667_101198874 125
406 3300025949 Ga0207667_10185042 Ga0207667_101850422 125
407 3300025949 Ga0207667_10408880 Ga0207667_104088803 125
408 3300025949 Ga0207667_10427562 Ga0207667_104275623 125
409 3300025949 Ga0207667_10518908 Ga0207667_105189081 125
410 3300025960 Ga0207651_10223256 Ga0207651_102232562 125
411 3300025960 Ga0207651_10292313 Ga0207651_102923132 125
412 3300025960 Ga0207651_10380190 Ga0207651_103801902 125
413 3300025961 Ga0207712_10387379 Ga0207712_103873791 125
414 3300025972 Ga0207668_10000012 Ga0207668_10000012127 125
415 3300025972 Ga0207668_10056154 Ga0207668_100561542 125
416 3300025972 Ga0207668_10119773 Ga0207668_101197732 125
417 3300025972 Ga0207668_10197567 Ga0207668_101975672 125
418 3300025972 Ga0207668_10376308 Ga0207668_103763081 125
419 3300025972 Ga0207668_11963297 Ga0207668_119632971 125
420 3300025981 Ga0207640_10001848 Ga0207640_1000184811 125
421 3300025981 Ga0207640_10017338 Ga0207640_100173383 125
422 3300025981 Ga0207640_10111506 Ga0207640_101115062 125
423 3300025981 Ga0207640_10127334 Ga0207640_101273342 125
424 3300025981 Ga0207640_10191732 Ga0207640_101917322 125
425 3300025981 Ga0207640_10528316 Ga0207640_105283162 125
426 3300025986 Ga0207658_10000011 Ga0207658_10000011128 125
427 3300025986 Ga0207658_10002199 Ga0207658_100021999 125
428 3300025986 Ga0207658_10830996 Ga0207658_108309962 125
429 3300026023 Ga0207677_10673209 Ga0207677_106732092 125
430 3300026035 Ga0207703_10000474 Ga0207703_100004746 125
431 3300026035 Ga0207703_10849837 Ga0207703_108498372 125
432 3300026041 Ga0207639_10125179 Ga0207639_101251792 125
433 3300026041 Ga0207639_10166856 Ga0207639_101668563 125
434 3300026067 Ga0207678_10000740 Ga0207678_100007404 125
435 3300026067 Ga0207678_10020475 Ga0207678_100204752 125
436 3300026067 Ga0207678_10091135 Ga0207678_100911352 125
437 3300026067 Ga0207678_10137931 Ga0207678_101379314 125
438 3300026078 Ga0207702_10014324 Ga0207702_100143244 125
439 3300026078 Ga0207702_10265240 Ga0207702_102652403 125
440 3300026088 Ga0207641_10000115 Ga0207641_100001155 125
441 3300026088 Ga0207641_10056518 Ga0207641_100565182 125
442 3300026088 Ga0207641_10157373 Ga0207641_101573733 125
443 3300026088 Ga0207641_11011083 Ga0207641_110110832 125
444 3300026088 Ga0207641_11589248 Ga0207641_115892482 125
445 3300026089 Ga0207648_10090261 Ga0207648_100902612 125
446 3300026095 Ga0207676_10034938 Ga0207676_100349385 125
447 3300026095 Ga0207676_10076556 Ga0207676_100765563 125
448 3300026116 Ga0207674_10018230 Ga0207674_100182309 125
449 3300026116 Ga0207674_10088834 Ga0207674_100888343 125
450 3300026116 Ga0207674_10180877 Ga0207674_101808774 125
451 3300026116 Ga0207674_10320405 Ga0207674_103204051 125
452 3300026118 Ga0207675_100019623 Ga0207675_1000196232 125
453 3300026118 Ga0207675_100033901 Ga0207675_1000339015 125
454 3300026121 Ga0207683_10202425 Ga0207683_102024251 125
455 3300026121 Ga0207683_10544541 Ga0207683_105445412 125
456 3300026121 Ga0207683_11179553 Ga0207683_111795531 125
457 3300026142 Ga0207698_10149250 Ga0207698_101492502 125
458 3300026142 Ga0207698_10255992 Ga0207698_102559922 125
459 3300026142 Ga0207698_10880600 Ga0207698_108806002 125
460 3300027252 Ga0209973_1067918 Ga0209973_10679182 125
461 3300027552 Ga0209982_1077435 Ga0209982_10774351 125
462 3300027614 Ga0209970_1028634 Ga0209970_10286342 125
463 3300027665 Ga0209983_1042697 Ga0209983_10426972 125
464 3300027682 Ga0209971_1050179 Ga0209971_10501792 125
465 3300027682 Ga0209971_1081903 Ga0209971_10819032 125
466 3300027876 Ga0209974_10004110 Ga0209974_100041105 125
467 3300027876 Ga0209974_10007757 Ga0209974_100077572 125
468 3300027876 Ga0209974_10049059 Ga0209974_100490593 125
469 3300027876 Ga0209974_10105958 Ga0209974_101059581 125
470 3300027876 Ga0209974_10157807 Ga0209974_101578072 125
471 3300028379 Ga0268266_10032486 Ga0268266_100324862 125
472 3300028380 Ga0268265_10000442 Ga0268265_1000044240 125
473 3300028380 Ga0268265_10177402 Ga0268265_101774022 125
474 3300028381 Ga0268264_10000089 Ga0268264_10000089122 125
475 3300030731 Ga0316177_1184625 Ga0316177_11846252 125
476 3300030731 Ga0316177_1200840 Ga0316177_12008402 125
477 3300030745 Ga0316182_1365612 Ga0316182_13656122 125
478 3300030745 Ga0316182_1391070 Ga0316182_13910702 125
479 3300031548 Ga0307408_100007529 Ga0307408_1000075293 125
480 3300031548 Ga0307408_100049188 Ga0307408_1000491882 125
481 3300031548 Ga0307408_100063963 Ga0307408_1000639632 125
482 3300031548 Ga0307408_100104222 Ga0307408_1001042222 125
483 3300031548 Ga0307408_100135353 Ga0307408_1001353532 125
484 3300031548 Ga0307408_100198202 Ga0307408_1001982022 125
485 3300031548 Ga0307408_100440006 Ga0307408_1004400062 125
486 3300031548 Ga0307408_100702090 Ga0307408_1007020902 125
487 3300031548 Ga0307408_100709040 Ga0307408_1007090402 125
488 3300031548 Ga0307408_101130903 Ga0307408_1011309032 125
489 3300031731 Ga0307405_10007002 Ga0307405_100070022 125
490 3300031731 Ga0307405_10010274 Ga0307405_100102742 125
491 3300031731 Ga0307405_10070544 Ga0307405_100705442 125
492 3300031731 Ga0307405_10102744 Ga0307405_101027443 125
493 3300031731 Ga0307405_10157583 Ga0307405_101575832 125
494 3300031731 Ga0307405_10312412 Ga0307405_103124122 125
495 3300031731 Ga0307405_10347084 Ga0307405_103470842 125
496 3300031731 Ga0307405_10412948 Ga0307405_104129481 125
497 3300031731 Ga0307405_10649176 Ga0307405_106491762 125
498 3300031731 Ga0307405_10833162 Ga0307405_108331621 125
499 3300031731 Ga0307405_11792826 Ga0307405_117928262 125
500 3300031824 Ga0307413_10005000 Ga0307413_100050002 125
501 3300031824 Ga0307413_10009008 Ga0307413_100090082 125
502 3300031824 Ga0307413_10016659 Ga0307413_100166592 125
503 3300031824 Ga0307413_10016920 Ga0307413_100169205 125
504 3300031824 Ga0307413_10070717 Ga0307413_100707172 125
505 3300031824 Ga0307413_10111440 Ga0307413_101114402 125
506 3300031824 Ga0307413_10141264 Ga0307413_101412642 125
507 3300031824 Ga0307413_10159596 Ga0307413_101595963 125
508 3300031824 Ga0307413_10211221 Ga0307413_102112211 125
509 3300031824 Ga0307413_10252342 Ga0307413_102523422 125
510 3300031824 Ga0307413_10353033 Ga0307413_103530332 125
511 3300031824 Ga0307413_10410158 Ga0307413_104101582 125
512 3300031824 Ga0307413_10803956 Ga0307413_108039562 125
513 3300031824 Ga0307413_11022410 Ga0307413_110224102 125
514 3300031824 Ga0307413_11713677 Ga0307413_117136771 125
515 3300031824 Ga0307413_11887974 Ga0307413_118879741 125
516 3300031824 Ga0307413_12183398 Ga0307413_121833981 125
517 3300031852 Ga0307410_10005310 Ga0307410_100053107 125
518 3300031852 Ga0307410_10007253 Ga0307410_100072537 125
519 3300031852 Ga0307410_10012139 Ga0307410_100121397 125
520 3300031852 Ga0307410_10013692 Ga0307410_100136921 125
521 3300031852 Ga0307410_10032983 Ga0307410_100329833 125
522 3300031852 Ga0307410_10062654 Ga0307410_100626542 125
523 3300031852 Ga0307410_10138879 Ga0307410_101388792 125
524 3300031852 Ga0307410_10157463 Ga0307410_101574632 125
525 3300031852 Ga0307410_10160659 Ga0307410_101606593 125
526 3300031852 Ga0307410_10161892 Ga0307410_101618922 125
527 3300031852 Ga0307410_10203006 Ga0307410_102030062 125
528 3300031852 Ga0307410_10295103 Ga0307410_102951032 125
529 3300031852 Ga0307410_10386639 Ga0307410_103866392 125
530 3300031852 Ga0307410_10463528 Ga0307410_104635282 125
531 3300031852 Ga0307410_10497042 Ga0307410_104970422 125
532 3300031852 Ga0307410_10690560 Ga0307410_106905602 125
533 3300031852 Ga0307410_11041606 Ga0307410_110416062 125
534 3300031901 Ga0307406_10001811 Ga0307406_100018112 125
535 3300031901 Ga0307406_10046094 Ga0307406_100460943 125
536 3300031901 Ga0307406_10062115 Ga0307406_100621152 125
537 3300031901 Ga0307406_10062434 Ga0307406_100624342 125
538 3300031901 Ga0307406_10129411 Ga0307406_101294113 125
539 3300031901 Ga0307406_10186116 Ga0307406_101861163 125
540 3300031901 Ga0307406_10266902 Ga0307406_102669022 125
541 3300031901 Ga0307406_10476926 Ga0307406_104769261 125
542 3300031903 Ga0307407_10003820 Ga0307407_100038207 125
543 3300031903 Ga0307407_10009943 Ga0307407_100099432 125
544 3300031903 Ga0307407_10047675 Ga0307407_100476752 125
545 3300031903 Ga0307407_10088091 Ga0307407_100880914 125
546 3300031903 Ga0307407_10113279 Ga0307407_101132792 125
547 3300031903 Ga0307407_10128551 Ga0307407_101285512 125
548 3300031903 Ga0307407_10421815 Ga0307407_104218152 125
549 3300031903 Ga0307407_10444656 Ga0307407_104446562 125
550 3300031903 Ga0307407_10484726 Ga0307407_104847261 125
551 3300031903 Ga0307407_10506759 Ga0307407_105067591 125
552 3300031903 Ga0307407_10840137 Ga0307407_108401372 125
553 3300031911 Ga0307412_10012591 Ga0307412_100125914 125
554 3300031911 Ga0307412_10032077 Ga0307412_100320772 125
555 3300031911 Ga0307412_10049840 Ga0307412_100498402 125
556 3300031911 Ga0307412_10050782 Ga0307412_100507822 125
557 3300031911 Ga0307412_10439102 Ga0307412_104391022 125
558 3300031911 Ga0307412_10958731 Ga0307412_109587312 125
559 3300031995 Ga0307409_100005057 Ga0307409_1000050574 125
560 3300031995 Ga0307409_100006744 Ga0307409_1000067442 125
561 3300031995 Ga0307409_100023772 Ga0307409_1000237722 125
562 3300031995 Ga0307409_100094437 Ga0307409_1000944373 125
563 3300031995 Ga0307409_100154511 Ga0307409_1001545112 125
564 3300031995 Ga0307409_100191240 Ga0307409_1001912403 125
565 3300031995 Ga0307409_100279010 Ga0307409_1002790102 125
566 3300031995 Ga0307409_100298139 Ga0307409_1002981392 125
567 3300031995 Ga0307409_100321871 Ga0307409_1003218712 125
568 3300031995 Ga0307409_100389879 Ga0307409_1003898792 125
569 3300031995 Ga0307409_100493290 Ga0307409_1004932903 125
570 3300031995 Ga0307409_100507196 Ga0307409_1005071963 125
571 3300031995 Ga0307409_100550341 Ga0307409_1005503412 125
572 3300031995 Ga0307409_100664535 Ga0307409_1006645352 125
573 3300031995 Ga0307409_100785741 Ga0307409_1007857412 125
574 3300031995 Ga0307409_100807718 Ga0307409_1008077181 125
575 3300031995 Ga0307409_101645627 Ga0307409_1016456272 125
576 3300032002 Ga0307416_100005270 Ga0307416_1000052702 125
577 3300032002 Ga0307416_100013797 Ga0307416_1000137972 125
578 3300032002 Ga0307416_100028520 Ga0307416_1000285202 125
579 3300032002 Ga0307416_100079022 Ga0307416_1000790223 125
580 3300032002 Ga0307416_100155917 Ga0307416_1001559173 125
581 3300032002 Ga0307416_100196172 Ga0307416_1001961722 125
582 3300032002 Ga0307416_100247633 Ga0307416_1002476332 125
583 3300032002 Ga0307416_100258564 Ga0307416_1002585642 125
584 3300032002 Ga0307416_100337652 Ga0307416_1003376522 125
585 3300032002 Ga0307416_100443765 Ga0307416_1004437651 125
586 3300032002 Ga0307416_100610961 Ga0307416_1006109612 125
587 3300032002 Ga0307416_100784535 Ga0307416_1007845352 125
588 3300032002 Ga0307416_100943147 Ga0307416_1009431471 125
589 3300032002 Ga0307416_101912445 Ga0307416_1019124451 125
590 3300032004 Ga0307414_10013759 Ga0307414_100137595 125
591 3300032004 Ga0307414_10020128 Ga0307414_100201284 125
592 3300032004 Ga0307414_10023012 Ga0307414_100230126 125
593 3300032004 Ga0307414_10026600 Ga0307414_100266003 125
594 3300032004 Ga0307414_10091425 Ga0307414_100914253 125
595 3300032004 Ga0307414_10093212 Ga0307414_100932123 125
596 3300032004 Ga0307414_10110369 Ga0307414_101103692 125
597 3300032004 Ga0307414_10194175 Ga0307414_101941752 125
598 3300032004 Ga0307414_10197844 Ga0307414_101978443 125
599 3300032004 Ga0307414_10276676 Ga0307414_102766763 125
600 3300032004 Ga0307414_10486391 Ga0307414_104863912 125
601 3300032004 Ga0307414_10628157 Ga0307414_106281572 125
602 3300032004 Ga0307414_10668114 Ga0307414_106681142 125
603 3300032004 Ga0307414_10697660 Ga0307414_106976602 125
604 3300032004 Ga0307414_10815686 Ga0307414_108156861 125
605 3300032004 Ga0307414_11277706 Ga0307414_112777062 125
606 3300032004 Ga0307414_11543583 Ga0307414_115435831 125
607 3300032004 Ga0307414_12006670 Ga0307414_120066701 125
608 3300032005 Ga0307411_10002032 Ga0307411_100020329 125
609 3300032005 Ga0307411_10006937 Ga0307411_100069372 125
610 3300032005 Ga0307411_10007469 Ga0307411_100074694 125
611 3300032005 Ga0307411_10046726 Ga0307411_100467262 125
612 3300032005 Ga0307411_10048566 Ga0307411_100485662 125
613 3300032005 Ga0307411_10074659 Ga0307411_100746593 125
614 3300032005 Ga0307411_10129911 Ga0307411_101299113 125
615 3300032005 Ga0307411_10168858 Ga0307411_101688583 125
616 3300032005 Ga0307411_10200966 Ga0307411_102009662 125
617 3300032005 Ga0307411_10206657 Ga0307411_102066572 125
618 3300032005 Ga0307411_10241681 Ga0307411_102416812 125
619 3300032005 Ga0307411_10306715 Ga0307411_103067152 125
620 3300032005 Ga0307411_10364325 Ga0307411_103643252 125
621 3300032005 Ga0307411_10384293 Ga0307411_103842932 125
622 3300032005 Ga0307411_10413587 Ga0307411_104135872 125
623 3300032005 Ga0307411_10584973 Ga0307411_105849732 125
624 3300032005 Ga0307411_10712577 Ga0307411_107125772 125
625 3300032005 Ga0307411_10860677 Ga0307411_108606771 125
626 3300032126 Ga0307415_100009001 Ga0307415_1000090012 125
627 3300032126 Ga0307415_100013739 Ga0307415_1000137393 125
628 3300032126 Ga0307415_100013925 Ga0307415_1000139252 125
629 3300032126 Ga0307415_100065000 Ga0307415_1000650003 125
630 3300032126 Ga0307415_100101036 Ga0307415_1001010363 125
631 3300032126 Ga0307415_100153265 Ga0307415_1001532652 125
632 3300032126 Ga0307415_100209278 Ga0307415_1002092781 125
633 3300032126 Ga0307415_100300570 Ga0307415_1003005702 125
634 3300032126 Ga0307415_100686819 Ga0307415_1006868191 125
635 3300032126 Ga0307415_100825192 Ga0307415_1008251921 125
636 3300032126 Ga0307415_101163762 Ga0307415_1011637622 125
637 3300032126 Ga0307415_101322525 Ga0307415_1013225252 125
638 3300032126 Ga0307415_101351977 Ga0307415_1013519771 125
639 3300032126 Ga0307415_101754814 Ga0307415_1017548141 125
640 3300032126 Ga0307415_101946123 Ga0307415_1019461231 125
641 3300035691 Ga0373931_0632614 Ga0373931_0632614_249_626 125
642 3300036712 Ga0316584_0098934 Ga0316584_0098934_1677_2054 125
643 3300037312 Ga0395899_0001291 Ga0395899_0001291_8591_8968 125
644 3300037312 Ga0395899_0006055 Ga0395899_0006055_2667_3044 125
645 3300037312 Ga0395899_0008125 Ga0395899_0008125_5301_5678 125
646 3300037312 Ga0395899_0009620 Ga0395899_0009620_57_434 125
647 3300037312 Ga0395899_0051014 Ga0395899_0051014_480_857 125
648 3300037312 Ga0395899_0478449 Ga0395899_0478449_255_632 125
649 3300037418 Ga0395900_0000447 Ga0395900_0000447_36863_37240 125
650 3300037418 Ga0395900_0048606 Ga0395900_0048606_2074_2451 125
651 3300037418 Ga0395900_0192214 Ga0395900_0192214_641_1018 125
652 3300037418 Ga0395900_0201328 Ga0395900_0201328_283_660 125
653 3300037418 Ga0395900_0207807 Ga0395900_0207807_732_1109 125
654 3300037418 Ga0395900_0281463 Ga0395900_0281463_147_530 125
655 3300037418 Ga0395900_0475149 Ga0395900_0475149_775_1152 125
656 3300037418 Ga0395900_0710973 Ga0395900_0710973_300_677 125
657 3300037418 Ga0395900_1111318 Ga0395900_1111318_36_413 125
658 3300037466 Ga0395898_0003866 Ga0395898_0003866_4572_4949 125
659 3300037466 Ga0395898_0014584 Ga0395898_0014584_6930_7307 125
660 3300037466 Ga0395898_0029335 Ga0395898_0029335_2617_2994 125
661 3300037466 Ga0395898_0040457 Ga0395898_0040457_1919_2296 125
662 3300037466 Ga0395898_0112915 Ga0395898_0112915_732_1109 125
663 3300037466 Ga0395898_0974013 Ga0395898_0974013_346_723 125
664 3300037466 Ga0395898_1745589 Ga0395898_1745589_97_474 125
665 3300037471 Ga0395905_0048408 Ga0395905_0048408_153_530 125
666 3300037471 Ga0395905_0064672 Ga0395905_0064672_2478_2855 125
667 3300037471 Ga0395905_0146194 Ga0395905_0146194_629_1006 125
668 3300037471 Ga0395905_0283835 Ga0395905_0283835_390_767 125
669 3300037471 Ga0395905_0595391 Ga0395905_0595391_336_713 125
670 3300038443 Ga0395901_0000324 Ga0395901_0000324_36895_37272 125
671 3300038443 Ga0395901_0082614 Ga0395901_0082614_2882_3259 125
672 3300038443 Ga0395901_0095428 Ga0395901_0095428_1759_2136 125
673 3300038443 Ga0395901_0117493 Ga0395901_0117493_2074_2451 125
674 3300038443 Ga0395901_0173346 Ga0395901_0173346_1377_1754 125
675 3300038443 Ga0395901_0207220 Ga0395901_0207220_563_940 125
676 3300038443 Ga0395901_0314867 Ga0395901_0314867_774_1157 125
677 3300038443 Ga0395901_0728050 Ga0395901_0728050_552_929 125
678 3300038443 Ga0395901_0817684 Ga0395901_0817684_148_525 125
679 3300038443 Ga0395901_0911409 Ga0395901_0911409_357_734 125
680 3300038443 Ga0395901_1495104 Ga0395901_1495104_145_522 125
681 3300038443 Ga0395901_1724639 Ga0395901_1724639_156_533 125
682 3300038705 Ga0237819_01073 Ga0237819_01073_3099_3476 125
683 3300039145 Ga0237816_00317 Ga0237816_00317_828_1205 125
684 3300039437 Ga0436365_0821190 Ga0436365_0821190_695_1072 125
685 3300041404 Ga0439436_0102831 Ga0439436_0102831_189_566 125
686 3300041410 Ga0439461_0132397 Ga0439461_0132397_85_462 125
687 3300041413 Ga0439465_0091417 Ga0439465_0091417_397_774 125
688 3300041413 Ga0439465_0406122 Ga0439465_0406122_115_492 125
689 3300041451 Ga0451791_1297277 Ga0451791_1297277_163_540 125
690 3300041486 Ga0451807_0700907 Ga0451807_0700907_412_789 125
691 3300041496 Ga0451839_1017143 Ga0451839_1017143_121_498 125
692 3300041512 Ga0451853_3500119 Ga0451853_3500119_1198_1575 125
693 3300041997 Ga0439431_0019707 Ga0439431_0019707_705_1082 125
694 3300042000 Ga0439437_003145 Ga0439437_003145_853_1230 125
695 3300042002 Ga0439442_035210 Ga0439442_035210_24_401 125
696 3300042002 Ga0439442_052509 Ga0439442_052509_123_500 125
697 3300042003 Ga0439443_006941 Ga0439443_006941_731_1108 125
698 3300042004 Ga0439445_0053200 Ga0439445_0053200_13_390 125
699 3300042006 Ga0439432_089397 Ga0439432_089397_533_910 125
700 3300042007 Ga0439449_0027057 Ga0439449_0027057_1717_2094 125
701 3300042014 Ga0439457_009705 Ga0439457_009705_232_627 125
702 3300042015 Ga0439462_0001208 Ga0439462_0001208_4596_4973 125
703 3300042015 Ga0439462_0008646 Ga0439462_0008646_2120_2497 125
704 3300042015 Ga0439462_0056879 Ga0439462_0056879_449_889 125
705 3300042116 Ga0450912_001672 Ga0450912_001672_833_1210 125
706 3300042132 Ga0450895_014404 Ga0450895_014404_223_600 125
707 3300042145 Ga0450906_040534 Ga0450906_040534_427_804 125
708 3300042147 Ga0450910_048457 Ga0450910_048457_147_524 125
709 3300042156 Ga0439446_0107761 Ga0439446_0107761_497_874 125
710 3300042531 Ga0450918_067659 Ga0450918_067659_175_552 125
711 3300042876 Ga0451577_0169758 Ga0451577_0169758_741_1118 125
712 3300044656 Ga0466969_0011722 Ga0466969_0011722_1323_1700 125
713 3300044684 Ga0466966_0000077 Ga0466966_0000077_2598_2975 125
714 3300044684 Ga0466966_0017763 Ga0466966_0017763_3872_4249 125
715 3300044693 Ga0466961_0174410 Ga0466961_0174410_298_675 125
716 3300044694 Ga0466963_0039815 Ga0466963_0039815_987_1364 125
717 3300044694 Ga0466963_0098772 Ga0466963_0098772_517_894 125
718 3300044694 Ga0466963_0732976 Ga0466963_0732976_215_592 125
719 3300044694 Ga0466963_1203584 Ga0466963_1203584_11_388 125
720 3300044719 Ga0466971_0004154 Ga0466971_0004154_2948_3325 125
721 3300044765 Ga0466970_0019762 Ga0466970_0019762_1547_1924 125
722 3300044842 Ga0466957_0042009 Ga0466957_0042009_720_1097 125
723 3300045051 Ga0451576_2339543 Ga0451576_2339543_120_497 125
724 3300045836 Ga0466958_0186073 Ga0466958_0186073_25_402 125
725 3300045976 Ga0466967_0092111 Ga0466967_0092111_981_1358 125
726 3300046453 Ga0495627_151198 Ga0495627_151198_20_397 125
727 3300046457 Ga0495590_0093488 Ga0495590_0093488_521_898 125
728 3300046492 Ga0495585_0143699 Ga0495585_0143699_527_904 125
729 3300046492 Ga0495585_0220578 Ga0495585_0220578_284_661 125
730 3300046515 Ga0495620_0119038 Ga0495620_0119038_262_639 125
731 3300046525 Ga0495663_0000982 Ga0495663_0000982_864_1241 125
732 3300046528 Ga0495642_0033149 Ga0495642_0033149_171_548 125
733 3300046537 Ga0495598_0000608 Ga0495598_0000608_4775_5152 125
734 3300046537 Ga0495598_0019081 Ga0495598_0019081_92_469 125
735 3300046537 Ga0495598_0291928 Ga0495598_0291928_57_434 125
736 3300046539 Ga0495621_0001412 Ga0495621_0001412_2889_3266 125
737 3300046558 Ga0495633_0004598 Ga0495633_0004598_5778_6155 125
738 3300046615 Ga0495656_0069667 Ga0495656_0069667_831_1208 125
739 3300046616 Ga0495668_0036991 Ga0495668_0036991_836_1213 125
740 3300046684 Ga0495669_0000720 Ga0495669_0000720_3751_4128 125
741 3300046684 Ga0495669_0025981 Ga0495669_0025981_1546_1923 125
742 3300046691 Ga0495670_0004022 Ga0495670_0004022_4051_4428 125
743 3300046691 Ga0495670_0148279 Ga0495670_0148279_255_632 125
744 3300046691 Ga0495670_0165353 Ga0495670_0165353_516_902 125
745 3300047445 Ga0495677_0002624 Ga0495677_0002624_189_566 125
746 3300047470 Ga0495681_0173254 Ga0495681_0173254_49_426 125
747 3300048904 Ga0496101_0451971 Ga0496101_0451971_194_571 125
748 3300048904 Ga0496101_1049936 Ga0496101_1049936_169_546 125
749 3300048905 Ga0496102_0548629 Ga0496102_0548629_476_853 125
750 3300048910 Ga0496107_0091378 Ga0496107_0091378_122_499 125
751 3300048912 Ga0496109_0029263 Ga0496109_0029263_901_1278 125
752 3300048912 Ga0496109_0327980 Ga0496109_0327980_312_689 125
753 3300048912 Ga0496109_0431124 Ga0496109_0431124_747_1124 125
754 3300048913 Ga0496110_0020611 Ga0496110_0020611_3359_3736 125
755 3300048913 Ga0496110_0385532 Ga0496110_0385532_303_680 125
756 3300048913 Ga0496110_0496755 Ga0496110_0496755_402_779 125
757 3300048913 Ga0496110_1386854 Ga0496110_1386854_70_447 125
758 3300048914 Ga0496111_0004026 Ga0496111_0004026_747_1124 125
759 3300048914 Ga0496111_0038086 Ga0496111_0038086_368_745 125
760 3300048914 Ga0496111_0543425 Ga0496111_0543425_293_670 125
761 3300048917 Ga0496114_0007166 Ga0496114_0007166_7789_8166 125
762 3300048917 Ga0496114_0026588 Ga0496114_0026588_1894_2271 125
763 3300048917 Ga0496114_0051027 Ga0496114_0051027_1089_1466 125
764 3300048924 Ga0496121_0000201 Ga0496121_0000201_124680_125057 125
765 3300049459 Ga0495678_053954 Ga0495678_053954_363_740 125
766 3300049571 Ga0501034_0897926 Ga0501034_0897926_315_692 125
767 3300049572 Ga0501036_1392663 Ga0501036_1392663_90_467 125
768 3300049575 Ga0501039_0256191 Ga0501039_0256191_217_594 125
769 3300049580 Ga0501046_0630292 Ga0501046_0630292_162_539 125
770 3300049581 Ga0501047_0324564 Ga0501047_0324564_675_1052 125
771 3300049661 Ga0501217_020403 Ga0501217_020403_86_463 125
772 3300049663 Ga0501223_064886 Ga0501223_064886_245_622 125
773 3300049665 Ga0501227_124218 Ga0501227_124218_182_559 125
774 3300049668 Ga0501233_105980 Ga0501233_105980_93_470 125
775 3300049674 Ga0501242_075081 Ga0501242_075081_61_438 125
776 3300049680 Ga0501250_029957 Ga0501250_029957_333_710 125
777 3300049705 Ga0501225_0163585 Ga0501225_0163585_261_638 125
778 3300049705 Ga0501225_0178328 Ga0501225_0178328_56_433 125
779 3300049765 Ga0501268_058719 Ga0501268_058719_84_461 125
780 3300049767 Ga0501270_014900 Ga0501270_014900_61_438 125
781 3300049822 Ga0501035_1088166 Ga0501035_1088166_120_497 125
782 3300049822 Ga0501035_1496565 Ga0501035_1496565_29_406 125
783 3300049823 Ga0501044_0398716 Ga0501044_0398716_834_1211 125
784 3300053087 Ga0500643_009425 Ga0500643_009425_2663_3040 125
785 3300053094 Ga0500566_0001993 Ga0500566_0001993_4610_4987 125
786 3300053103 Ga0500555_059971 Ga0500555_059971_256_633 125
787 3300053134 Ga0500658_0085828 Ga0500658_0085828_199_576 125
788 3300053136 Ga0500559_0134801 Ga0500559_0134801_383_760 125
789 3300053139 Ga0500568_0382910 Ga0500568_0382910_103_480 125
790 3300053142 Ga0500577_0268216 Ga0500577_0268216_170_547 125
791 3300053146 Ga0500588_0020709 Ga0500588_0020709_556_933 125
792 3300053151 Ga0500604_0222523 Ga0500604_0222523_132_509 125
793 3300054114 Ga0501084_1508003 Ga0501084_1508003_139_516 125
794 3300059426 Ga0590077_044978 Ga0590077_044978_583_960 125
795 3300061719 Ga0466962_0002042 Ga0466962_0002042_7987_8364 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

20

114

0.95

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

12

121

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3omf-assembly1.cif.gz_A crystal structure of a histidine triad family protein from entamoeba histolytica, bound to amp 0.9105 14 120
6ypx-assembly1.cif.gz_AAA human histidine triad nucleotide-binding protein 2 (hhint2) refined to 2.11 a in c2221 space group 0.9014 14 119
6yqd-assembly1.cif.gz_AAA human histidine triad nucleotide-binding protein 2 (hhint2) refined to 1.41 a in p212121 space group 0.8955 23 119
1y23-assembly3.cif.gz_E crystal structure of a member of hit family of proteins from bacillus subtilis 0.8922 12 115
4zgl-assembly2.cif.gz_D hit like protein 0.8902 12 117
ID Description Score Start End Superfamily
3oxkA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9091 11 120 3.30.428.10
1y23A00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8935 12 115 3.30.428.10
4q61B00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8931 12 117 3.30.428.10
4njyA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8904 27 119 3.30.428.10
4q61B00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8849 12 117 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A845SAR8-F1-model_v4 HIT domain-containing protein 1.003 9 82 GO:0003824
AF-A0A3D3V702-F1-model_v4 Histidine triad nucleotide-binding protein 0.9956 7 92 GO:0003824
AF-A0A3D3V702-F1-model_v4 Histidine triad nucleotide-binding protein 0.9842 7 92 GO:0003824
AF-A0A7Y7CP82-F1-model_v4 Histidine triad nucleotide-binding protein 0.9839 7 110 GO:0003824
AF-A0A845S519-F1-model_v4 Histidine triad nucleotide-binding protein 0.9831 9 112 GO:0003824

Feature Viewer

pLDDT pTM Quality
93.08 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map