F481145
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 795 | 275 | 792 | 125 |
Family's Representative Sequence
| Representative Sequence | 3300037853|Ga0436364_1072241|Ga0436364_1072241_476_865 |
| Length | 124 |
| Sequence | MPVSGLGPYDDTNVFAKILRGEIPSRRVYEDEWAVAFHDIAPQASTHVLVIPRGSYVSLADFAVKAPPDEIAGFFRAVAAVAKQLGLEEPGYRVLANMGRHPHFHVHVFGGQPLGPMLTARASP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 3 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 4 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 5 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 6 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 7 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 10 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 18 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 85 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 100 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 167 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 168 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 169 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 170 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 171 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 172 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 173 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 174 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 178 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 179 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 180 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 182 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 183 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 184 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 187 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 188 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 189 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 190 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 191 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 192 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 193 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 194 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 197 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 198 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 199 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 200 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 201 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 202 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 203 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 204 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 205 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 206 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 207 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 208 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 209 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 210 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 211 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 212 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 213 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 214 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 215 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 216 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 217 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 218 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 219 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 220 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 221 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 222 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 223 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 224 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 241 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 242 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 244 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 245 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 246 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 247 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 254 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 255 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 256 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 257 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 258 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 259 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 260 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 261 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 262 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 265 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 266 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 267 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 268 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 269 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 270 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 271 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 272 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 273 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 275 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.5 |
| Metatranscriptomes | 0.13 |
| Isolates | 0.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.78 |
| Nodule | 0 |
| Rhizoplane | 2.39 |
| Rhizosphere | 91.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214814960 | 2209111006 | Bacteria | 677 |
| 2 | JGI24736J21556_1000939 | 3300001904 | Bacteria | 5362 |
| 3 | JGI24741J21665_1019747 | 3300001915 | Bacteria | 1065 |
| 4 | JGI24740J21852_10005216 | 3300001979 | Bacteria | 5518 |
| 5 | JGI24737J22298_10055753 | 3300001990 | Bacteria | 1194 |
| 6 | JGI24034J26672_10010588 | 3300002239 | Bacteria | 1373 |
| 7 | JGI24751J29686_10011725 | 3300002459 | Bacteria | 1808 |
| 8 | JGI25150J39212_1049317 | 3300002774 | Bacteria | 524 |
| 9 | JGI25150J39212_1052103 | 3300002774 | Bacteria | 504 |
| 10 | JGI25153J46596_10008965 | 3300003215 | Bacteria | 4714 |
| 11 | Ga0055537_1000441 | 3300003773 | Bacteria | 26555 |
| 12 | Ga0055537_1012581 | 3300003773 | Bacteria | 1641 |
| 13 | Ga0055524_1000245 | 3300003775 | Bacteria | 56692 |
| 14 | Ga0055530_10012116 | 3300003791 | Bacteria | 3033 |
| 15 | Ga0055530_10075250 | 3300003791 | Bacteria | 720 |
| 16 | Ga0055531_10002452 | 3300003794 | Bacteria | 12393 |
| 17 | JGI25405J52794_10034577 | 3300003911 | Bacteria | 1056 |
| 18 | Ga0055543_1011280 | 3300004625 | Bacteria | 1836 |
| 19 | Ga0065165_1008746 | 3300005262 | Bacteria | 4670 |
| 20 | Ga0065165_1032218 | 3300005262 | Bacteria | 1645 |
| 21 | Ga0065712_10002451 | 3300005290 | Bacteria | 4489 |
| 22 | Ga0065712_10100222 | 3300005290 | Bacteria | 2052 |
| 23 | Ga0065715_10002752 | 3300005293 | Bacteria | 4808 |
| 24 | Ga0065715_10028692 | 3300005293 | Bacteria | 1301 |
| 25 | Ga0065715_10124416 | 3300005293 | Bacteria | 2155 |
| 26 | Ga0070658_10002325 | 3300005327 | Bacteria | 15950 |
| 27 | Ga0070658_10003674 | 3300005327 | Bacteria | 12564 |
| 28 | Ga0070658_10005871 | 3300005327 | Bacteria | 9956 |
| 29 | Ga0070658_10080815 | 3300005327 | Bacteria | 2670 |
| 30 | Ga0070658_10111656 | 3300005327 | Bacteria | 2265 |
| 31 | Ga0070658_10147544 | 3300005327 | Bacteria | 1968 |
| 32 | Ga0070658_10343096 | 3300005327 | Bacteria | 1278 |
| 33 | Ga0070658_10510952 | 3300005327 | Bacteria | 1038 |
| 34 | Ga0070658_11014154 | 3300005327 | Bacteria | 722 |
| 35 | Ga0070676_10005263 | 3300005328 | Bacteria | 6879 |
| 36 | Ga0070683_100008142 | 3300005329 | Bacteria | 8904 |
| 37 | Ga0070670_100003053 | 3300005331 | Bacteria | 13851 |
| 38 | Ga0070670_100042043 | 3300005331 | Bacteria | 3928 |
| 39 | Ga0070670_100238668 | 3300005331 | Bacteria | 1582 |
| 40 | Ga0070670_100246219 | 3300005331 | Bacteria | 1557 |
| 41 | Ga0070670_101432371 | 3300005331 | Bacteria | 634 |
| 42 | Ga0070677_10000456 | 3300005333 | Bacteria | 14007 |
| 43 | Ga0070677_10045304 | 3300005333 | Bacteria | 1754 |
| 44 | Ga0070677_10307029 | 3300005333 | Bacteria | 808 |
| 45 | Ga0070677_10521474 | 3300005333 | Bacteria | 647 |
| 46 | Ga0070677_10622198 | 3300005333 | Unclassified | 600 |
| 47 | Ga0070666_10008323 | 3300005335 | Bacteria | 6434 |
| 48 | Ga0070680_100026295 | 3300005336 | Bacteria | 4654 |
| 49 | Ga0070680_100338796 | 3300005336 | Bacteria | 1278 |
| 50 | Ga0070680_100360438 | 3300005336 | Bacteria | 1237 |
| 51 | Ga0070680_100382751 | 3300005336 | Bacteria | 1198 |
| 52 | Ga0070680_101082462 | 3300005336 | Bacteria | 693 |
| 53 | Ga0068868_100738943 | 3300005338 | Bacteria | 883 |
| 54 | Ga0070660_100001300 | 3300005339 | Bacteria | 17017 |
| 55 | Ga0070660_100003050 | 3300005339 | Bacteria | 11526 |
| 56 | Ga0070660_100003201 | 3300005339 | Bacteria | 11252 |
| 57 | Ga0070660_100014004 | 3300005339 | Bacteria | 5771 |
| 58 | Ga0070660_100017015 | 3300005339 | Bacteria | 5292 |
| 59 | Ga0070660_100031646 | 3300005339 | Bacteria | 3975 |
| 60 | Ga0070660_100052189 | 3300005339 | Bacteria | 3151 |
| 61 | Ga0070660_100086049 | 3300005339 | Bacteria | 2473 |
| 62 | Ga0070660_100145343 | 3300005339 | Bacteria | 1904 |
| 63 | Ga0070660_100173905 | 3300005339 | Bacteria | 1740 |
| 64 | Ga0070660_100283912 | 3300005339 | Bacteria | 1355 |
| 65 | Ga0070660_100515884 | 3300005339 | Bacteria | 995 |
| 66 | Ga0070660_101235432 | 3300005339 | Bacteria | 634 |
| 67 | Ga0070660_101580369 | 3300005339 | Bacteria | 558 |
| 68 | Ga0070689_100604544 | 3300005340 | Bacteria | 950 |
| 69 | Ga0070687_100226069 | 3300005343 | Bacteria | 1149 |
| 70 | Ga0070661_100000009 | 3300005344 | Bacteria | 181351 |
| 71 | Ga0070661_100005747 | 3300005344 | Bacteria | 8538 |
| 72 | Ga0070661_100128588 | 3300005344 | Bacteria | 1901 |
| 73 | Ga0070661_100511045 | 3300005344 | Bacteria | 963 |
| 74 | Ga0070661_100784995 | 3300005344 | Bacteria | 781 |
| 75 | Ga0070692_10007743 | 3300005345 | Bacteria | 4756 |
| 76 | Ga0070692_10040842 | 3300005345 | Bacteria | 2374 |
| 77 | Ga0070692_11182090 | 3300005345 | Bacteria | 544 |
| 78 | Ga0070668_100000015 | 3300005347 | Bacteria | 106650 |
| 79 | Ga0070668_100125549 | 3300005347 | Bacteria | 2055 |
| 80 | Ga0070668_100410534 | 3300005347 | Bacteria | 1158 |
| 81 | Ga0070668_100679438 | 3300005347 | Bacteria | 906 |
| 82 | Ga0070669_100042765 | 3300005353 | Bacteria | 3298 |
| 83 | Ga0070669_100051030 | 3300005353 | Bacteria | 3022 |
| 84 | Ga0070669_100051768 | 3300005353 | Bacteria | 3003 |
| 85 | Ga0070669_100086459 | 3300005353 | Bacteria | 2343 |
| 86 | Ga0070669_100300753 | 3300005353 | Bacteria | 1290 |
| 87 | Ga0070669_100303537 | 3300005353 | Bacteria | 1285 |
| 88 | Ga0070669_100353272 | 3300005353 | Bacteria | 1194 |
| 89 | Ga0070669_100437455 | 3300005353 | Bacteria | 1076 |
| 90 | Ga0070669_101664383 | 3300005353 | Bacteria | 556 |
| 91 | Ga0070675_100001728 | 3300005354 | Bacteria | 16125 |
| 92 | Ga0070675_100003423 | 3300005354 | Bacteria | 12018 |
| 93 | Ga0070675_100241199 | 3300005354 | Bacteria | 1579 |
| 94 | Ga0070675_100383728 | 3300005354 | Bacteria | 1251 |
| 95 | Ga0070671_100000322 | 3300005355 | Bacteria | 32627 |
| 96 | Ga0070671_100012423 | 3300005355 | Bacteria | 6857 |
| 97 | Ga0070671_100094864 | 3300005355 | Bacteria | 2501 |
| 98 | Ga0070671_100386599 | 3300005355 | Bacteria | 1196 |
| 99 | Ga0070671_100981292 | 3300005355 | Bacteria | 740 |
| 100 | Ga0070674_100067301 | 3300005356 | Bacteria | 2519 |
| 101 | Ga0070674_100078186 | 3300005356 | Bacteria | 2357 |
| 102 | Ga0070674_100251530 | 3300005356 | Bacteria | 1388 |
| 103 | Ga0070674_100446229 | 3300005356 | Bacteria | 1067 |
| 104 | Ga0070674_100869687 | 3300005356 | Bacteria | 783 |
| 105 | Ga0070673_100002044 | 3300005364 | Bacteria | 12181 |
| 106 | Ga0070673_100074161 | 3300005364 | Bacteria | 2741 |
| 107 | Ga0070673_100149011 | 3300005364 | Bacteria | 1980 |
| 108 | Ga0070673_100337495 | 3300005364 | Bacteria | 1335 |
| 109 | Ga0070673_100426871 | 3300005364 | Bacteria | 1189 |
| 110 | Ga0070659_100000979 | 3300005366 | Bacteria | 20993 |
| 111 | Ga0070659_100048521 | 3300005366 | Bacteria | 3336 |
| 112 | Ga0070659_100059123 | 3300005366 | Bacteria | 3026 |
| 113 | Ga0070659_100363038 | 3300005366 | Bacteria | 1217 |
| 114 | Ga0070659_100590201 | 3300005366 | Bacteria | 954 |
| 115 | Ga0070659_100743754 | 3300005366 | Bacteria | 850 |
| 116 | Ga0070659_101741934 | 3300005366 | Bacteria | 557 |
| 117 | Ga0070667_100000017 | 3300005367 | Bacteria | 230531 |
| 118 | Ga0070667_100093954 | 3300005367 | Bacteria | 2583 |
| 119 | Ga0070667_100262476 | 3300005367 | Bacteria | 1547 |
| 120 | Ga0070663_100014045 | 3300005455 | Bacteria | 5130 |
| 121 | Ga0070663_100032493 | 3300005455 | Bacteria | 3597 |
| 122 | Ga0070663_100042039 | 3300005455 | Bacteria | 3210 |
| 123 | Ga0070663_100395515 | 3300005455 | Bacteria | 1128 |
| 124 | Ga0070663_101767648 | 3300005455 | Bacteria | 554 |
| 125 | Ga0070678_100164276 | 3300005456 | Bacteria | 1802 |
| 126 | Ga0070678_100181774 | 3300005456 | Bacteria | 1722 |
| 127 | Ga0070678_100517362 | 3300005456 | Bacteria | 1055 |
| 128 | Ga0070662_100018695 | 3300005457 | Bacteria | 4692 |
| 129 | Ga0070662_100044388 | 3300005457 | Bacteria | 3184 |
| 130 | Ga0070662_100222171 | 3300005457 | Bacteria | 1507 |
| 131 | Ga0070662_100639341 | 3300005457 | Bacteria | 897 |
| 132 | Ga0070662_100646677 | 3300005457 | Bacteria | 892 |
| 133 | Ga0070681_10094424 | 3300005458 | Bacteria | 2940 |
| 134 | Ga0070681_10748623 | 3300005458 | Bacteria | 894 |
| 135 | Ga0070681_11067016 | 3300005458 | Bacteria | 728 |
| 136 | Ga0068867_100177096 | 3300005459 | Bacteria | 1693 |
| 137 | Ga0070679_100000404 | 3300005530 | Bacteria | 36798 |
| 138 | Ga0070679_100054822 | 3300005530 | Bacteria | 3970 |
| 139 | Ga0070679_100100813 | 3300005530 | Bacteria | 2874 |
| 140 | Ga0070679_100111539 | 3300005530 | Bacteria | 2721 |
| 141 | Ga0070679_100203743 | 3300005530 | Bacteria | 1943 |
| 142 | Ga0070679_100503309 | 3300005530 | Bacteria | 1155 |
| 143 | Ga0070679_100642577 | 3300005530 | Bacteria | 1004 |
| 144 | Ga0070679_100974810 | 3300005530 | Bacteria | 792 |
| 145 | Ga0070679_101814886 | 3300005530 | Bacteria | 558 |
| 146 | Ga0070684_100338082 | 3300005535 | Bacteria | 1384 |
| 147 | Ga0070684_101674257 | 3300005535 | Bacteria | 600 |
| 148 | Ga0068853_100131472 | 3300005539 | Bacteria | 2241 |
| 149 | Ga0068853_100242334 | 3300005539 | Bacteria | 1653 |
| 150 | Ga0068853_100249839 | 3300005539 | Bacteria | 1627 |
| 151 | Ga0068853_100946309 | 3300005539 | Bacteria | 828 |
| 152 | Ga0070672_100019791 | 3300005543 | Bacteria | 4894 |
| 153 | Ga0070672_100089851 | 3300005543 | Bacteria | 2476 |
| 154 | Ga0070672_100639022 | 3300005543 | Bacteria | 929 |
| 155 | Ga0070672_101207356 | 3300005543 | Bacteria | 674 |
| 156 | Ga0070696_100918687 | 3300005546 | Bacteria | 727 |
| 157 | Ga0070665_100060440 | 3300005548 | Bacteria | 3798 |
| 158 | Ga0068855_100026818 | 3300005563 | Bacteria | 6893 |
| 159 | Ga0068855_100039512 | 3300005563 | Bacteria | 5602 |
| 160 | Ga0068855_100130375 | 3300005563 | Bacteria | 2872 |
| 161 | Ga0070664_100014561 | 3300005564 | Bacteria | 6417 |
| 162 | Ga0070664_100085974 | 3300005564 | Bacteria | 2717 |
| 163 | Ga0070664_100128457 | 3300005564 | Bacteria | 2225 |
| 164 | Ga0070664_100151187 | 3300005564 | Bacteria | 2050 |
| 165 | Ga0070664_100835859 | 3300005564 | Bacteria | 862 |
| 166 | Ga0068857_100081237 | 3300005577 | Bacteria | 2895 |
| 167 | Ga0068857_100238406 | 3300005577 | Bacteria | 1665 |
| 168 | Ga0068854_100003883 | 3300005578 | Bacteria | 9365 |
| 169 | Ga0068854_100138268 | 3300005578 | Bacteria | 1867 |
| 170 | Ga0068854_100321087 | 3300005578 | Bacteria | 1258 |
| 171 | Ga0068854_100827485 | 3300005578 | Bacteria | 809 |
| 172 | Ga0068856_100009497 | 3300005614 | Bacteria | 9445 |
| 173 | Ga0068856_100399926 | 3300005614 | Bacteria | 1393 |
| 174 | Ga0068856_100455097 | 3300005614 | Bacteria | 1301 |
| 175 | Ga0068852_100008362 | 3300005616 | Bacteria | 7625 |
| 176 | Ga0068852_100294561 | 3300005616 | Bacteria | 1569 |
| 177 | Ga0068852_100425180 | 3300005616 | Bacteria | 1311 |
| 178 | Ga0068859_100253494 | 3300005617 | Bacteria | 1850 |
| 179 | Ga0068859_101603435 | 3300005617 | Bacteria | 719 |
| 180 | Ga0068864_100006205 | 3300005618 | Bacteria | 9799 |
| 181 | Ga0068864_100588810 | 3300005618 | Bacteria | 1078 |
| 182 | Ga0068861_100043504 | 3300005719 | Bacteria | 3372 |
| 183 | Ga0068870_10227811 | 3300005840 | Bacteria | 1144 |
| 184 | Ga0068870_10437691 | 3300005840 | Bacteria | 859 |
| 185 | Ga0068863_100016985 | 3300005841 | Bacteria | 6979 |
| 186 | Ga0068863_100595975 | 3300005841 | Bacteria | 1093 |
| 187 | Ga0068863_101340213 | 3300005841 | Bacteria | 723 |
| 188 | Ga0068858_100001873 | 3300005842 | Bacteria | 21457 |
| 189 | Ga0068858_100702362 | 3300005842 | Bacteria | 984 |
| 190 | Ga0068860_100000056 | 3300005843 | Bacteria | 202751 |
| 191 | Ga0068862_100000108 | 3300005844 | Bacteria | 99413 |
| 192 | Ga0068862_100419206 | 3300005844 | Bacteria | 1256 |
| 193 | Ga0068862_100814262 | 3300005844 | Bacteria | 913 |
| 194 | Ga0081455_10000964 | 3300005937 | Bacteria | 36801 |
| 195 | Ga0075365_10051703 | 3300006038 | Bacteria | 2715 |
| 196 | Ga0075364_10149240 | 3300006051 | Bacteria | 1575 |
| 197 | Ga0097621_101135506 | 3300006237 | Bacteria | 734 |
| 198 | Ga0075370_10197398 | 3300006353 | Bacteria | 1186 |
| 199 | Ga0075370_10251505 | 3300006353 | Bacteria | 1047 |
| 200 | Ga0068871_101268827 | 3300006358 | Bacteria | 692 |
| 201 | Ga0068865_100621950 | 3300006881 | Bacteria | 915 |
| 202 | Ga0068865_101169459 | 3300006881 | Bacteria | 680 |
| 203 | Ga0097620_100253502 | 3300006931 | Bacteria | 1850 |
| 204 | Ga0097620_101603348 | 3300006931 | Bacteria | 719 |
| 205 | Ga0105240_10073464 | 3300009093 | Bacteria | 4223 |
| 206 | Ga0105240_10807730 | 3300009093 | Bacteria | 1015 |
| 207 | Ga0105247_11104328 | 3300009101 | Bacteria | 626 |
| 208 | Ga0105243_10027845 | 3300009148 | Bacteria | 4335 |
| 209 | Ga0105243_10549280 | 3300009148 | Bacteria | 1103 |
| 210 | Ga0105243_10981002 | 3300009148 | Bacteria | 846 |
| 211 | Ga0105241_11216722 | 3300009174 | Bacteria | 714 |
| 212 | Ga0105248_10008010 | 3300009177 | Bacteria | 11607 |
| 213 | Ga0105248_10317465 | 3300009177 | Bacteria | 1755 |
| 214 | Ga0105248_11374633 | 3300009177 | Bacteria | 799 |
| 215 | Ga0105238_10221634 | 3300009551 | Bacteria | 1868 |
| 216 | Ga0105238_10381912 | 3300009551 | Bacteria | 1400 |
| 217 | Ga0105249_10609447 | 3300009553 | Bacteria | 1147 |
| 218 | Ga0105239_10134418 | 3300010375 | Bacteria | 2753 |
| 219 | Ga0157327_1020172 | 3300012512 | Bacteria | 744 |
| 220 | Ga0157326_1002409 | 3300012513 | Bacteria | 2003 |
| 221 | Ga0157373_10002525 | 3300013100 | Bacteria | 13931 |
| 222 | Ga0157373_10023486 | 3300013100 | Bacteria | 4469 |
| 223 | Ga0157373_10160641 | 3300013100 | Bacteria | 1581 |
| 224 | Ga0157373_10227975 | 3300013100 | Bacteria | 1315 |
| 225 | Ga0157373_10235618 | 3300013100 | Bacteria | 1293 |
| 226 | Ga0157373_10273000 | 3300013100 | Bacteria | 1197 |
| 227 | Ga0157373_10487429 | 3300013100 | Bacteria | 890 |
| 228 | Ga0157373_10557542 | 3300013100 | Bacteria | 831 |
| 229 | Ga0157371_10002615 | 3300013102 | Bacteria | 17091 |
| 230 | Ga0157371_10008024 | 3300013102 | Bacteria | 8453 |
| 231 | Ga0157371_10122835 | 3300013102 | Bacteria | 1847 |
| 232 | Ga0157371_10272687 | 3300013102 | Bacteria | 1221 |
| 233 | Ga0157371_10290586 | 3300013102 | Bacteria | 1182 |
| 234 | Ga0157371_10299167 | 3300013102 | Bacteria | 1165 |
| 235 | Ga0157371_11411167 | 3300013102 | Bacteria | 541 |
| 236 | Ga0157370_10017735 | 3300013104 | Bacteria | 7177 |
| 237 | Ga0157370_10475894 | 3300013104 | Bacteria | 1148 |
| 238 | Ga0157370_10748203 | 3300013104 | Bacteria | 891 |
| 239 | Ga0157369_10001135 | 3300013105 | Bacteria | 33313 |
| 240 | Ga0157369_10003392 | 3300013105 | Bacteria | 18901 |
| 241 | Ga0157369_10023242 | 3300013105 | Bacteria | 6907 |
| 242 | Ga0157369_11164135 | 3300013105 | Bacteria | 787 |
| 243 | Ga0157374_10068169 | 3300013296 | Bacteria | 3347 |
| 244 | Ga0163162_10391762 | 3300013306 | Bacteria | 1522 |
| 245 | Ga0157372_10093611 | 3300013307 | Bacteria | 3420 |
| 246 | Ga0157372_10158636 | 3300013307 | Bacteria | 2614 |
| 247 | Ga0157372_10176026 | 3300013307 | Bacteria | 2476 |
| 248 | Ga0157372_10511932 | 3300013307 | Bacteria | 1399 |
| 249 | Ga0157372_10652951 | 3300013307 | Bacteria | 1225 |
| 250 | Ga0157375_10004286 | 3300013308 | Bacteria | 12369 |
| 251 | Ga0157375_10450073 | 3300013308 | Bacteria | 1453 |
| 252 | Ga0163163_10105952 | 3300014325 | Bacteria | 2837 |
| 253 | Ga0163163_10197748 | 3300014325 | Bacteria | 2058 |
| 254 | Ga0163163_10624305 | 3300014325 | Bacteria | 1141 |
| 255 | Ga0157380_10008061 | 3300014326 | Bacteria | 7504 |
| 256 | Ga0157380_10014874 | 3300014326 | Bacteria | 5703 |
| 257 | Ga0157380_10052755 | 3300014326 | Bacteria | 3221 |
| 258 | Ga0157380_10320287 | 3300014326 | Bacteria | 1437 |
| 259 | Ga0157380_10499218 | 3300014326 | Bacteria | 1181 |
| 260 | Ga0157380_11258657 | 3300014326 | Bacteria | 786 |
| 261 | Ga0157379_11517235 | 3300014968 | Bacteria | 652 |
| 262 | Ga0163161_10185712 | 3300017792 | Bacteria | 1596 |
| 263 | Ga0163161_10663822 | 3300017792 | Bacteria | 865 |
| 264 | Ga0163161_10685195 | 3300017792 | Bacteria | 852 |
| 265 | Ga0206353_10796169 | 3300020082 | Bacteria | 722 |
| 266 | Ga0213876_10001167 | 3300021384 | Bacteria | 16587 |
| 267 | Ga0207425_1007318 | 3300025245 | Bacteria | 2924 |
| 268 | Ga0209565_1000007 | 3300025263 | Bacteria | 784361 |
| 269 | Ga0209565_1001004 | 3300025263 | Bacteria | 14505 |
| 270 | Ga0209673_1001016 | 3300025273 | Bacteria | 33837 |
| 271 | Ga0209673_1008645 | 3300025273 | Bacteria | 4510 |
| 272 | Ga0209675_1013627 | 3300025291 | Bacteria | 2527 |
| 273 | Ga0209564_1007139 | 3300025295 | Bacteria | 5828 |
| 274 | Ga0209758_1007609 | 3300025297 | Bacteria | 7308 |
| 275 | Ga0209758_1027150 | 3300025297 | Bacteria | 2455 |
| 276 | Ga0209050_1014851 | 3300025298 | Bacteria | 3320 |
| 277 | Ga0209050_1022518 | 3300025298 | Bacteria | 2254 |
| 278 | Ga0209256_1000008 | 3300025299 | Bacteria | 975723 |
| 279 | Ga0209257_1004536 | 3300025304 | Bacteria | 10641 |
| 280 | Ga0207697_10072169 | 3300025315 | Bacteria | 1447 |
| 281 | Ga0207697_10081771 | 3300025315 | Bacteria | 1361 |
| 282 | Ga0207682_10001287 | 3300025893 | Bacteria | 11520 |
| 283 | Ga0207682_10084148 | 3300025893 | Bacteria | 1368 |
| 284 | Ga0207682_10126320 | 3300025893 | Bacteria | 1138 |
| 285 | Ga0207688_10025725 | 3300025901 | Bacteria | 3234 |
| 286 | Ga0207688_10123898 | 3300025901 | Bacteria | 1510 |
| 287 | Ga0207680_10035897 | 3300025903 | Bacteria | 2851 |
| 288 | Ga0207680_10071279 | 3300025903 | Bacteria | 2154 |
| 289 | Ga0207680_10230023 | 3300025903 | Bacteria | 1274 |
| 290 | Ga0207647_10013638 | 3300025904 | Bacteria | 5627 |
| 291 | Ga0207645_10009100 | 3300025907 | Bacteria | 6889 |
| 292 | Ga0207645_10091369 | 3300025907 | Bacteria | 1958 |
| 293 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 294 | Ga0207705_10000673 | 3300025909 | Bacteria | 28381 |
| 295 | Ga0207705_10001549 | 3300025909 | Bacteria | 18235 |
| 296 | Ga0207705_10003314 | 3300025909 | Bacteria | 12245 |
| 297 | Ga0207705_10008205 | 3300025909 | Bacteria | 7641 |
| 298 | Ga0207705_10011618 | 3300025909 | Bacteria | 6364 |
| 299 | Ga0207705_10022590 | 3300025909 | Bacteria | 4487 |
| 300 | Ga0207705_10093196 | 3300025909 | Bacteria | 2208 |
| 301 | Ga0207705_10108458 | 3300025909 | Bacteria | 2049 |
| 302 | Ga0207705_10192605 | 3300025909 | Bacteria | 1542 |
| 303 | Ga0207705_10226447 | 3300025909 | Bacteria | 1421 |
| 304 | Ga0207654_10479424 | 3300025911 | Bacteria | 876 |
| 305 | Ga0207707_10091266 | 3300025912 | Bacteria | 2662 |
| 306 | Ga0207707_10113867 | 3300025912 | Bacteria | 2364 |
| 307 | Ga0207707_10147539 | 3300025912 | Bacteria | 2057 |
| 308 | Ga0207695_10033990 | 3300025913 | Bacteria | 5551 |
| 309 | Ga0207695_10466074 | 3300025913 | Bacteria | 1146 |
| 310 | Ga0207660_10347940 | 3300025917 | Bacteria | 1188 |
| 311 | Ga0207660_10584302 | 3300025917 | Bacteria | 909 |
| 312 | Ga0207662_11099122 | 3300025918 | Bacteria | 565 |
| 313 | Ga0207657_10000267 | 3300025919 | Bacteria | 55426 |
| 314 | Ga0207657_10001047 | 3300025919 | Bacteria | 29314 |
| 315 | Ga0207657_10002051 | 3300025919 | Bacteria | 21802 |
| 316 | Ga0207657_10006696 | 3300025919 | Bacteria | 11910 |
| 317 | Ga0207657_10007422 | 3300025919 | Bacteria | 11246 |
| 318 | Ga0207657_10012828 | 3300025919 | Bacteria | 8247 |
| 319 | Ga0207657_10014570 | 3300025919 | Bacteria | 7662 |
| 320 | Ga0207657_10176813 | 3300025919 | Bacteria | 1727 |
| 321 | Ga0207657_10340107 | 3300025919 | Bacteria | 1184 |
| 322 | Ga0207657_10641486 | 3300025919 | Bacteria | 827 |
| 323 | Ga0207657_11136547 | 3300025919 | Bacteria | 596 |
| 324 | Ga0207649_10000035 | 3300025920 | Bacteria | 134650 |
| 325 | Ga0207649_10000883 | 3300025920 | Bacteria | 18965 |
| 326 | Ga0207649_10024663 | 3300025920 | Bacteria | 3499 |
| 327 | Ga0207649_10175925 | 3300025920 | Bacteria | 1494 |
| 328 | Ga0207649_10684199 | 3300025920 | Bacteria | 795 |
| 329 | Ga0207649_10984161 | 3300025920 | Bacteria | 663 |
| 330 | Ga0207652_10000003 | 3300025921 | Bacteria | 502441 |
| 331 | Ga0207652_10003472 | 3300025921 | Bacteria | 12998 |
| 332 | Ga0207652_10077886 | 3300025921 | Bacteria | 2894 |
| 333 | Ga0207652_10167542 | 3300025921 | Bacteria | 1970 |
| 334 | Ga0207652_10393293 | 3300025921 | Bacteria | 1251 |
| 335 | Ga0207652_11360386 | 3300025921 | Bacteria | 613 |
| 336 | Ga0207652_11762310 | 3300025921 | Bacteria | 524 |
| 337 | Ga0207646_10253259 | 3300025922 | Bacteria | 1591 |
| 338 | Ga0207681_10011678 | 3300025923 | Bacteria | 5399 |
| 339 | Ga0207681_10021928 | 3300025923 | Bacteria | 4067 |
| 340 | Ga0207681_10035788 | 3300025923 | Bacteria | 3273 |
| 341 | Ga0207681_10101263 | 3300025923 | Bacteria | 2078 |
| 342 | Ga0207681_10109454 | 3300025923 | Bacteria | 2007 |
| 343 | Ga0207681_10120914 | 3300025923 | Bacteria | 1920 |
| 344 | Ga0207681_10245148 | 3300025923 | Bacteria | 1396 |
| 345 | Ga0207681_10283158 | 3300025923 | Bacteria | 1306 |
| 346 | Ga0207681_10365153 | 3300025923 | Bacteria | 1159 |
| 347 | Ga0207681_10700767 | 3300025923 | Bacteria | 842 |
| 348 | Ga0207681_11449649 | 3300025923 | Bacteria | 576 |
| 349 | Ga0207694_10312398 | 3300025924 | Bacteria | 1296 |
| 350 | Ga0207650_10001934 | 3300025925 | Bacteria | 14585 |
| 351 | Ga0207650_10043272 | 3300025925 | Bacteria | 3305 |
| 352 | Ga0207650_10062254 | 3300025925 | Bacteria | 2788 |
| 353 | Ga0207650_10108624 | 3300025925 | Bacteria | 2145 |
| 354 | Ga0207650_10770381 | 3300025925 | Bacteria | 815 |
| 355 | Ga0207659_10005238 | 3300025926 | Bacteria | 7856 |
| 356 | Ga0207659_10034621 | 3300025926 | Bacteria | 3484 |
| 357 | Ga0207659_10097944 | 3300025926 | Bacteria | 2204 |
| 358 | Ga0207659_10203911 | 3300025926 | Bacteria | 1581 |
| 359 | Ga0207659_10317329 | 3300025926 | Bacteria | 1285 |
| 360 | Ga0207664_10075480 | 3300025929 | Bacteria | 2726 |
| 361 | Ga0207644_10000139 | 3300025931 | Bacteria | 51953 |
| 362 | Ga0207644_10000941 | 3300025931 | Bacteria | 18539 |
| 363 | Ga0207644_10011535 | 3300025931 | Bacteria | 5850 |
| 364 | Ga0207644_10072575 | 3300025931 | Bacteria | 2521 |
| 365 | Ga0207644_10306923 | 3300025931 | Bacteria | 1280 |
| 366 | Ga0207690_10005772 | 3300025932 | Bacteria | 7320 |
| 367 | Ga0207690_10024895 | 3300025932 | Bacteria | 3752 |
| 368 | Ga0207690_10071454 | 3300025932 | Bacteria | 2394 |
| 369 | Ga0207690_10203577 | 3300025932 | Bacteria | 1505 |
| 370 | Ga0207690_10276295 | 3300025932 | Bacteria | 1307 |
| 371 | Ga0207690_10385336 | 3300025932 | Bacteria | 1115 |
| 372 | Ga0207690_11061535 | 3300025932 | Bacteria | 675 |
| 373 | Ga0207706_10015013 | 3300025933 | Bacteria | 7012 |
| 374 | Ga0207706_10033791 | 3300025933 | Bacteria | 4551 |
| 375 | Ga0207706_10040493 | 3300025933 | Bacteria | 4129 |
| 376 | Ga0207706_10104641 | 3300025933 | Bacteria | 2490 |
| 377 | Ga0207706_10156056 | 3300025933 | Bacteria | 2007 |
| 378 | Ga0207706_10189547 | 3300025933 | Bacteria | 1805 |
| 379 | Ga0207706_10338541 | 3300025933 | Bacteria | 1309 |
| 380 | Ga0207709_10015890 | 3300025935 | Bacteria | 4178 |
| 381 | Ga0207669_10053204 | 3300025937 | Bacteria | 2437 |
| 382 | Ga0207669_10135403 | 3300025937 | Bacteria | 1700 |
| 383 | Ga0207669_10649969 | 3300025937 | Bacteria | 862 |
| 384 | Ga0207669_10794792 | 3300025937 | Bacteria | 784 |
| 385 | Ga0207704_10797757 | 3300025938 | Bacteria | 788 |
| 386 | Ga0207691_10051024 | 3300025940 | Bacteria | 3784 |
| 387 | Ga0207691_10058524 | 3300025940 | Bacteria | 3505 |
| 388 | Ga0207691_10101086 | 3300025940 | Bacteria | 2573 |
| 389 | Ga0207691_10145070 | 3300025940 | Bacteria | 2090 |
| 390 | Ga0207691_10348873 | 3300025940 | Bacteria | 1266 |
| 391 | Ga0207691_10684465 | 3300025940 | Bacteria | 865 |
| 392 | Ga0207711_10009643 | 3300025941 | Bacteria | 8046 |
| 393 | Ga0207711_10196874 | 3300025941 | Bacteria | 1838 |
| 394 | Ga0207679_10006872 | 3300025945 | Bacteria | 7212 |
| 395 | Ga0207679_10064344 | 3300025945 | Bacteria | 2741 |
| 396 | Ga0207679_10140178 | 3300025945 | Bacteria | 1953 |
| 397 | Ga0207679_10140809 | 3300025945 | Bacteria | 1949 |
| 398 | Ga0207679_10742734 | 3300025945 | Bacteria | 892 |
| 399 | Ga0207667_10007343 | 3300025949 | Bacteria | 13266 |
| 400 | Ga0207667_10103026 | 3300025949 | Bacteria | 2944 |
| 401 | Ga0207667_10119887 | 3300025949 | Bacteria | 2711 |
| 402 | Ga0207667_10185042 | 3300025949 | Bacteria | 2139 |
| 403 | Ga0207667_10408880 | 3300025949 | Bacteria | 1381 |
| 404 | Ga0207667_10427562 | 3300025949 | Bacteria | 1347 |
| 405 | Ga0207667_10518908 | 3300025949 | Bacteria | 1207 |
| 406 | Ga0207651_10223256 | 3300025960 | Bacteria | 1524 |
| 407 | Ga0207651_10292313 | 3300025960 | Bacteria | 1351 |
| 408 | Ga0207651_10380190 | 3300025960 | Bacteria | 1196 |
| 409 | Ga0207712_10387379 | 3300025961 | Bacteria | 1171 |
| 410 | Ga0207668_10000012 | 3300025972 | Bacteria | 182541 |
| 411 | Ga0207668_10056154 | 3300025972 | Bacteria | 2741 |
| 412 | Ga0207668_10119773 | 3300025972 | Bacteria | 1991 |
| 413 | Ga0207668_10197567 | 3300025972 | Bacteria | 1599 |
| 414 | Ga0207668_10376308 | 3300025972 | Bacteria | 1194 |
| 415 | Ga0207668_11963297 | 3300025972 | Bacteria | 527 |
| 416 | Ga0207640_10001848 | 3300025981 | Bacteria | 11356 |
| 417 | Ga0207640_10017338 | 3300025981 | Bacteria | 4213 |
| 418 | Ga0207640_10111506 | 3300025981 | Bacteria | 1940 |
| 419 | Ga0207640_10127334 | 3300025981 | Bacteria | 1835 |
| 420 | Ga0207640_10191732 | 3300025981 | Bacteria | 1541 |
| 421 | Ga0207640_10528316 | 3300025981 | Bacteria | 987 |
| 422 | Ga0207658_10000011 | 3300025986 | Bacteria | 239620 |
| 423 | Ga0207658_10002199 | 3300025986 | Bacteria | 14477 |
| 424 | Ga0207658_10830996 | 3300025986 | Bacteria | 839 |
| 425 | Ga0207677_10673209 | 3300026023 | Bacteria | 915 |
| 426 | Ga0207703_10000474 | 3300026035 | Bacteria | 42009 |
| 427 | Ga0207703_10849837 | 3300026035 | Bacteria | 873 |
| 428 | Ga0207639_10125179 | 3300026041 | Bacteria | 2118 |
| 429 | Ga0207639_10166856 | 3300026041 | Bacteria | 1861 |
| 430 | Ga0207678_10000740 | 3300026067 | Bacteria | 29953 |
| 431 | Ga0207678_10020475 | 3300026067 | Bacteria | 5801 |
| 432 | Ga0207678_10091135 | 3300026067 | Bacteria | 2605 |
| 433 | Ga0207678_10137931 | 3300026067 | Bacteria | 2081 |
| 434 | Ga0207702_10014324 | 3300026078 | Bacteria | 6584 |
| 435 | Ga0207702_10265240 | 3300026078 | Bacteria | 1618 |
| 436 | Ga0207641_10000115 | 3300026088 | Bacteria | 118497 |
| 437 | Ga0207641_10056518 | 3300026088 | Bacteria | 3335 |
| 438 | Ga0207641_10157373 | 3300026088 | Bacteria | 2063 |
| 439 | Ga0207641_11011083 | 3300026088 | Bacteria | 828 |
| 440 | Ga0207641_11589248 | 3300026088 | Bacteria | 656 |
| 441 | Ga0207648_10090261 | 3300026089 | Bacteria | 2677 |
| 442 | Ga0207676_10034938 | 3300026095 | Bacteria | 3809 |
| 443 | Ga0207676_10076556 | 3300026095 | Bacteria | 2704 |
| 444 | Ga0207674_10018230 | 3300026116 | Bacteria | 7637 |
| 445 | Ga0207674_10088834 | 3300026116 | Bacteria | 3083 |
| 446 | Ga0207674_10180877 | 3300026116 | Bacteria | 2060 |
| 447 | Ga0207674_10320405 | 3300026116 | Bacteria | 1499 |
| 448 | Ga0207675_100019623 | 3300026118 | Bacteria | 6310 |
| 449 | Ga0207675_100033901 | 3300026118 | Bacteria | 4758 |
| 450 | Ga0207683_10202425 | 3300026121 | Bacteria | 1805 |
| 451 | Ga0207683_10544541 | 3300026121 | Bacteria | 1073 |
| 452 | Ga0207683_11179553 | 3300026121 | Bacteria | 710 |
| 453 | Ga0207698_10149250 | 3300026142 | Bacteria | 2026 |
| 454 | Ga0207698_10255992 | 3300026142 | Bacteria | 1605 |
| 455 | Ga0207698_10880600 | 3300026142 | Bacteria | 902 |
| 456 | Ga0209973_1067918 | 3300027252 | Bacteria | 555 |
| 457 | Ga0209982_1077435 | 3300027552 | Bacteria | 547 |
| 458 | Ga0209970_1028634 | 3300027614 | Bacteria | 962 |
| 459 | Ga0209983_1042697 | 3300027665 | Bacteria | 983 |
| 460 | Ga0209971_1050179 | 3300027682 | Bacteria | 1008 |
| 461 | Ga0209971_1081903 | 3300027682 | Bacteria | 786 |
| 462 | Ga0209974_10004110 | 3300027876 | Bacteria | 5201 |
| 463 | Ga0209974_10007757 | 3300027876 | Bacteria | 3690 |
| 464 | Ga0209974_10049059 | 3300027876 | Bacteria | 1416 |
| 465 | Ga0209974_10105958 | 3300027876 | Bacteria | 986 |
| 466 | Ga0209974_10157807 | 3300027876 | Bacteria | 822 |
| 467 | Ga0268266_10032486 | 3300028379 | Bacteria | 4434 |
| 468 | Ga0268265_10000442 | 3300028380 | Bacteria | 43732 |
| 469 | Ga0268265_10177402 | 3300028380 | Bacteria | 1827 |
| 470 | Ga0268264_10000089 | 3300028381 | Bacteria | 234760 |
| 471 | Ga0316177_1184625 | 3300030731 | Bacteria | 565 |
| 472 | Ga0316177_1200840 | 3300030731 | Bacteria | 1415 |
| 473 | Ga0316182_1365612 | 3300030745 | Bacteria | 1317 |
| 474 | Ga0316182_1391070 | 3300030745 | Bacteria | 1066 |
| 475 | Ga0307408_100007529 | 3300031548 | Bacteria | 7197 |
| 476 | Ga0307408_100049188 | 3300031548 | Bacteria | 3027 |
| 477 | Ga0307408_100063963 | 3300031548 | Bacteria | 2693 |
| 478 | Ga0307408_100104222 | 3300031548 | Bacteria | 2167 |
| 479 | Ga0307408_100135353 | 3300031548 | Bacteria | 1927 |
| 480 | Ga0307408_100198202 | 3300031548 | Bacteria | 1623 |
| 481 | Ga0307408_100440006 | 3300031548 | Bacteria | 1128 |
| 482 | Ga0307408_100702090 | 3300031548 | Bacteria | 909 |
| 483 | Ga0307408_100709040 | 3300031548 | Bacteria | 905 |
| 484 | Ga0307408_101130903 | 3300031548 | Bacteria | 728 |
| 485 | Ga0307405_10007002 | 3300031731 | Bacteria | 5602 |
| 486 | Ga0307405_10010274 | 3300031731 | Bacteria | 4839 |
| 487 | Ga0307405_10070544 | 3300031731 | Bacteria | 2245 |
| 488 | Ga0307405_10102744 | 3300031731 | Bacteria | 1920 |
| 489 | Ga0307405_10157583 | 3300031731 | Bacteria | 1604 |
| 490 | Ga0307405_10312412 | 3300031731 | Bacteria | 1197 |
| 491 | Ga0307405_10347084 | 3300031731 | Bacteria | 1143 |
| 492 | Ga0307405_10412948 | 3300031731 | Bacteria | 1060 |
| 493 | Ga0307405_10649176 | 3300031731 | Bacteria | 867 |
| 494 | Ga0307405_10833162 | 3300031731 | Bacteria | 775 |
| 495 | Ga0307405_11792826 | 3300031731 | Bacteria | 545 |
| 496 | Ga0307413_10005000 | 3300031824 | Bacteria | 5850 |
| 497 | Ga0307413_10009008 | 3300031824 | Bacteria | 4750 |
| 498 | Ga0307413_10016659 | 3300031824 | Bacteria | 3805 |
| 499 | Ga0307413_10016920 | 3300031824 | Bacteria | 3785 |
| 500 | Ga0307413_10070717 | 3300031824 | Bacteria | 2196 |
| 501 | Ga0307413_10111440 | 3300031824 | Bacteria | 1832 |
| 502 | Ga0307413_10141264 | 3300031824 | Bacteria | 1664 |
| 503 | Ga0307413_10159596 | 3300031824 | Bacteria | 1582 |
| 504 | Ga0307413_10211221 | 3300031824 | Bacteria | 1410 |
| 505 | Ga0307413_10252342 | 3300031824 | Bacteria | 1309 |
| 506 | Ga0307413_10353033 | 3300031824 | Bacteria | 1135 |
| 507 | Ga0307413_10410158 | 3300031824 | Bacteria | 1064 |
| 508 | Ga0307413_10803956 | 3300031824 | Bacteria | 790 |
| 509 | Ga0307413_11022410 | 3300031824 | Bacteria | 710 |
| 510 | Ga0307413_11713677 | 3300031824 | Bacteria | 561 |
| 511 | Ga0307413_11887974 | 3300031824 | Bacteria | 536 |
| 512 | Ga0307413_12183398 | 3300031824 | Bacteria | 502 |
| 513 | Ga0307410_10005310 | 3300031852 | Bacteria | 6801 |
| 514 | Ga0307410_10007253 | 3300031852 | Bacteria | 6055 |
| 515 | Ga0307410_10012139 | 3300031852 | Bacteria | 4964 |
| 516 | Ga0307410_10013692 | 3300031852 | Bacteria | 4743 |
| 517 | Ga0307410_10032983 | 3300031852 | Bacteria | 3339 |
| 518 | Ga0307410_10062654 | 3300031852 | Bacteria | 2549 |
| 519 | Ga0307410_10138879 | 3300031852 | Bacteria | 1795 |
| 520 | Ga0307410_10157463 | 3300031852 | Bacteria | 1698 |
| 521 | Ga0307410_10160659 | 3300031852 | Bacteria | 1683 |
| 522 | Ga0307410_10161892 | 3300031852 | Bacteria | 1678 |
| 523 | Ga0307410_10203006 | 3300031852 | Bacteria | 1514 |
| 524 | Ga0307410_10295103 | 3300031852 | Bacteria | 1277 |
| 525 | Ga0307410_10386639 | 3300031852 | Bacteria | 1127 |
| 526 | Ga0307410_10463528 | 3300031852 | Bacteria | 1036 |
| 527 | Ga0307410_10497042 | 3300031852 | Bacteria | 1003 |
| 528 | Ga0307410_10690560 | 3300031852 | Bacteria | 859 |
| 529 | Ga0307410_11041606 | 3300031852 | Bacteria | 707 |
| 530 | Ga0307406_10001811 | 3300031901 | Bacteria | 11673 |
| 531 | Ga0307406_10046094 | 3300031901 | Bacteria | 2741 |
| 532 | Ga0307406_10062115 | 3300031901 | Bacteria | 2415 |
| 533 | Ga0307406_10062434 | 3300031901 | Bacteria | 2410 |
| 534 | Ga0307406_10129411 | 3300031901 | Bacteria | 1769 |
| 535 | Ga0307406_10186116 | 3300031901 | Bacteria | 1516 |
| 536 | Ga0307406_10266902 | 3300031901 | Bacteria | 1298 |
| 537 | Ga0307406_10476926 | 3300031901 | Bacteria | 1006 |
| 538 | Ga0307407_10003820 | 3300031903 | Bacteria | 6272 |
| 539 | Ga0307407_10009943 | 3300031903 | Bacteria | 4457 |
| 540 | Ga0307407_10047675 | 3300031903 | Bacteria | 2433 |
| 541 | Ga0307407_10088091 | 3300031903 | Bacteria | 1896 |
| 542 | Ga0307407_10113279 | 3300031903 | Bacteria | 1706 |
| 543 | Ga0307407_10128551 | 3300031903 | Bacteria | 1617 |
| 544 | Ga0307407_10421815 | 3300031903 | Bacteria | 962 |
| 545 | Ga0307407_10444656 | 3300031903 | Bacteria | 939 |
| 546 | Ga0307407_10484726 | 3300031903 | Bacteria | 904 |
| 547 | Ga0307407_10506759 | 3300031903 | Bacteria | 885 |
| 548 | Ga0307407_10840137 | 3300031903 | Bacteria | 701 |
| 549 | Ga0307412_10012591 | 3300031911 | Bacteria | 4935 |
| 550 | Ga0307412_10032077 | 3300031911 | Bacteria | 3324 |
| 551 | Ga0307412_10049840 | 3300031911 | Bacteria | 2760 |
| 552 | Ga0307412_10050782 | 3300031911 | Bacteria | 2738 |
| 553 | Ga0307412_10439102 | 3300031911 | Bacteria | 1072 |
| 554 | Ga0307412_10958731 | 3300031911 | Bacteria | 753 |
| 555 | Ga0307409_100005057 | 3300031995 | Bacteria | 7516 |
| 556 | Ga0307409_100006744 | 3300031995 | Bacteria | 6791 |
| 557 | Ga0307409_100023772 | 3300031995 | Bacteria | 4256 |
| 558 | Ga0307409_100094437 | 3300031995 | Bacteria | 2461 |
| 559 | Ga0307409_100154511 | 3300031995 | Bacteria | 1997 |
| 560 | Ga0307409_100191240 | 3300031995 | Bacteria | 1822 |
| 561 | Ga0307409_100279010 | 3300031995 | Bacteria | 1543 |
| 562 | Ga0307409_100298139 | 3300031995 | Bacteria | 1498 |
| 563 | Ga0307409_100321871 | 3300031995 | Bacteria | 1447 |
| 564 | Ga0307409_100389879 | 3300031995 | Bacteria | 1327 |
| 565 | Ga0307409_100493290 | 3300031995 | Bacteria | 1191 |
| 566 | Ga0307409_100507196 | 3300031995 | Bacteria | 1176 |
| 567 | Ga0307409_100550341 | 3300031995 | Bacteria | 1133 |
| 568 | Ga0307409_100664535 | 3300031995 | Bacteria | 1037 |
| 569 | Ga0307409_100785741 | 3300031995 | Bacteria | 958 |
| 570 | Ga0307409_100807718 | 3300031995 | Bacteria | 946 |
| 571 | Ga0307409_101645627 | 3300031995 | Bacteria | 670 |
| 572 | Ga0307416_100005270 | 3300032002 | Bacteria | 7917 |
| 573 | Ga0307416_100013797 | 3300032002 | Bacteria | 5506 |
| 574 | Ga0307416_100028520 | 3300032002 | Bacteria | 4152 |
| 575 | Ga0307416_100079022 | 3300032002 | Bacteria | 2771 |
| 576 | Ga0307416_100155917 | 3300032002 | Bacteria | 2102 |
| 577 | Ga0307416_100196172 | 3300032002 | Bacteria | 1910 |
| 578 | Ga0307416_100247633 | 3300032002 | Bacteria | 1732 |
| 579 | Ga0307416_100258564 | 3300032002 | Bacteria | 1700 |
| 580 | Ga0307416_100337652 | 3300032002 | Bacteria | 1518 |
| 581 | Ga0307416_100443765 | 3300032002 | Bacteria | 1348 |
| 582 | Ga0307416_100610961 | 3300032002 | Bacteria | 1171 |
| 583 | Ga0307416_100784535 | 3300032002 | Bacteria | 1047 |
| 584 | Ga0307416_100943147 | 3300032002 | Bacteria | 964 |
| 585 | Ga0307416_101912445 | 3300032002 | Bacteria | 697 |
| 586 | Ga0307414_10013759 | 3300032004 | Bacteria | 4826 |
| 587 | Ga0307414_10020128 | 3300032004 | Bacteria | 4152 |
| 588 | Ga0307414_10023012 | 3300032004 | Bacteria | 3942 |
| 589 | Ga0307414_10026600 | 3300032004 | Bacteria | 3726 |
| 590 | Ga0307414_10091425 | 3300032004 | Bacteria | 2262 |
| 591 | Ga0307414_10093212 | 3300032004 | Bacteria | 2244 |
| 592 | Ga0307414_10110369 | 3300032004 | Bacteria | 2092 |
| 593 | Ga0307414_10194175 | 3300032004 | Bacteria | 1645 |
| 594 | Ga0307414_10197844 | 3300032004 | Bacteria | 1632 |
| 595 | Ga0307414_10276676 | 3300032004 | Bacteria | 1408 |
| 596 | Ga0307414_10486391 | 3300032004 | Bacteria | 1089 |
| 597 | Ga0307414_10628157 | 3300032004 | Bacteria | 966 |
| 598 | Ga0307414_10668114 | 3300032004 | Bacteria | 938 |
| 599 | Ga0307414_10697660 | 3300032004 | Bacteria | 919 |
| 600 | Ga0307414_10815686 | 3300032004 | Bacteria | 851 |
| 601 | Ga0307414_11277706 | 3300032004 | Bacteria | 681 |
| 602 | Ga0307414_11543583 | 3300032004 | Bacteria | 618 |
| 603 | Ga0307414_12006670 | 3300032004 | Bacteria | 540 |
| 604 | Ga0307411_10002032 | 3300032005 | Bacteria | 8676 |
| 605 | Ga0307411_10006937 | 3300032005 | Bacteria | 5714 |
| 606 | Ga0307411_10007469 | 3300032005 | Bacteria | 5572 |
| 607 | Ga0307411_10046726 | 3300032005 | Bacteria | 2793 |
| 608 | Ga0307411_10048566 | 3300032005 | Bacteria | 2751 |
| 609 | Ga0307411_10074659 | 3300032005 | Bacteria | 2311 |
| 610 | Ga0307411_10129911 | 3300032005 | Bacteria | 1839 |
| 611 | Ga0307411_10168858 | 3300032005 | Bacteria | 1647 |
| 612 | Ga0307411_10200966 | 3300032005 | Bacteria | 1530 |
| 613 | Ga0307411_10206657 | 3300032005 | Bacteria | 1512 |
| 614 | Ga0307411_10241681 | 3300032005 | Bacteria | 1414 |
| 615 | Ga0307411_10306715 | 3300032005 | Bacteria | 1276 |
| 616 | Ga0307411_10364325 | 3300032005 | Bacteria | 1183 |
| 617 | Ga0307411_10384293 | 3300032005 | Bacteria | 1156 |
| 618 | Ga0307411_10413587 | 3300032005 | Bacteria | 1118 |
| 619 | Ga0307411_10584973 | 3300032005 | Bacteria | 957 |
| 620 | Ga0307411_10712577 | 3300032005 | Bacteria | 875 |
| 621 | Ga0307411_10860677 | 3300032005 | Bacteria | 803 |
| 622 | Ga0307415_100009001 | 3300032126 | Bacteria | 5568 |
| 623 | Ga0307415_100013739 | 3300032126 | Bacteria | 4736 |
| 624 | Ga0307415_100013925 | 3300032126 | Bacteria | 4710 |
| 625 | Ga0307415_100065000 | 3300032126 | Bacteria | 2540 |
| 626 | Ga0307415_100101036 | 3300032126 | Bacteria | 2115 |
| 627 | Ga0307415_100153265 | 3300032126 | Bacteria | 1776 |
| 628 | Ga0307415_100209278 | 3300032126 | Bacteria | 1554 |
| 629 | Ga0307415_100300570 | 3300032126 | Bacteria | 1329 |
| 630 | Ga0307415_100686819 | 3300032126 | Bacteria | 922 |
| 631 | Ga0307415_100825192 | 3300032126 | Bacteria | 848 |
| 632 | Ga0307415_101163762 | 3300032126 | Bacteria | 725 |
| 633 | Ga0307415_101322525 | 3300032126 | Bacteria | 683 |
| 634 | Ga0307415_101351977 | 3300032126 | Bacteria | 676 |
| 635 | Ga0307415_101754814 | 3300032126 | Bacteria | 600 |
| 636 | Ga0307415_101946123 | 3300032126 | Bacteria | 571 |
| 637 | Ga0373931_0632614 | 3300035691 | Bacteria | 702 |
| 638 | Ga0316584_0098934 | 3300036712 | Bacteria | 2184 |
| 639 | Ga0395899_0001291 | 3300037312 | Bacteria | 21622 |
| 640 | Ga0395899_0006055 | 3300037312 | Bacteria | 9390 |
| 641 | Ga0395899_0008125 | 3300037312 | Bacteria | 8083 |
| 642 | Ga0395899_0009620 | 3300037312 | Bacteria | 7418 |
| 643 | Ga0395899_0051014 | 3300037312 | Bacteria | 3071 |
| 644 | Ga0395899_0478449 | 3300037312 | Bacteria | 811 |
| 645 | Ga0395900_0000447 | 3300037418 | Bacteria | 59069 |
| 646 | Ga0395900_0048606 | 3300037418 | Bacteria | 4369 |
| 647 | Ga0395900_0192214 | 3300037418 | Bacteria | 2069 |
| 648 | Ga0395900_0201328 | 3300037418 | Bacteria | 2014 |
| 649 | Ga0395900_0207807 | 3300037418 | Bacteria | 1978 |
| 650 | Ga0395900_0281463 | 3300037418 | Bacteria | 1655 |
| 651 | Ga0395900_0475149 | 3300037418 | Bacteria | 1203 |
| 652 | Ga0395900_0710973 | 3300037418 | Bacteria | 937 |
| 653 | Ga0395900_1111318 | 3300037418 | Bacteria | 707 |
| 654 | Ga0395898_0003866 | 3300037466 | Bacteria | 16551 |
| 655 | Ga0395898_0014584 | 3300037466 | Bacteria | 8069 |
| 656 | Ga0395898_0029335 | 3300037466 | Bacteria | 5512 |
| 657 | Ga0395898_0040457 | 3300037466 | Bacteria | 4609 |
| 658 | Ga0395898_0112915 | 3300037466 | Bacteria | 2604 |
| 659 | Ga0395898_0974013 | 3300037466 | Bacteria | 785 |
| 660 | Ga0395898_1745589 | 3300037466 | Bacteria | 544 |
| 661 | Ga0395905_0048408 | 3300037471 | Bacteria | 3984 |
| 662 | Ga0395905_0064672 | 3300037471 | Bacteria | 3423 |
| 663 | Ga0395905_0146194 | 3300037471 | Bacteria | 2224 |
| 664 | Ga0395905_0283835 | 3300037471 | Bacteria | 1542 |
| 665 | Ga0395905_0595391 | 3300037471 | Bacteria | 1007 |
| 666 | Ga0436364_1072241 | 3300037853 | Bacteria | 882 |
| 667 | Ga0395901_0000324 | 3300038443 | Bacteria | 59134 |
| 668 | Ga0395901_0082614 | 3300038443 | Bacteria | 3356 |
| 669 | Ga0395901_0095428 | 3300038443 | Bacteria | 3116 |
| 670 | Ga0395901_0117493 | 3300038443 | Bacteria | 2794 |
| 671 | Ga0395901_0173346 | 3300038443 | Bacteria | 2263 |
| 672 | Ga0395901_0207220 | 3300038443 | Bacteria | 2053 |
| 673 | Ga0395901_0314867 | 3300038443 | Bacteria | 1620 |
| 674 | Ga0395901_0728050 | 3300038443 | Bacteria | 987 |
| 675 | Ga0395901_0817684 | 3300038443 | Bacteria | 919 |
| 676 | Ga0395901_0911409 | 3300038443 | Bacteria | 860 |
| 677 | Ga0395901_1495104 | 3300038443 | Bacteria | 631 |
| 678 | Ga0395901_1724639 | 3300038443 | Bacteria | 577 |
| 679 | Ga0237819_01073 | 3300038705 | Bacteria | 8100 |
| 680 | Ga0237816_00317 | 3300039145 | Bacteria | 4136 |
| 681 | Ga0436365_0821190 | 3300039437 | Bacteria | 17086 |
| 682 | Ga0439436_0102831 | 3300041404 | Bacteria | 796 |
| 683 | Ga0439461_0132397 | 3300041410 | Bacteria | 631 |
| 684 | Ga0439465_0091417 | 3300041413 | Bacteria | 1041 |
| 685 | Ga0439465_0406122 | 3300041413 | Bacteria | 519 |
| 686 | Ga0451791_1297277 | 3300041451 | Bacteria | 811 |
| 687 | Ga0451807_0700907 | 3300041486 | Bacteria | 998 |
| 688 | Ga0451839_1017143 | 3300041496 | Bacteria | 568 |
| 689 | Ga0451853_3500119 | 3300041512 | Bacteria | 2003 |
| 690 | Ga0439431_0019707 | 3300041997 | Bacteria | 1605 |
| 691 | Ga0439437_003145 | 3300042000 | Bacteria | 1779 |
| 692 | Ga0439442_035210 | 3300042002 | Bacteria | 1047 |
| 693 | Ga0439442_052509 | 3300042002 | Bacteria | 861 |
| 694 | Ga0439443_006941 | 3300042003 | Bacteria | 1564 |
| 695 | Ga0439445_0053200 | 3300042004 | Bacteria | 1096 |
| 696 | Ga0439432_089397 | 3300042006 | Bacteria | 928 |
| 697 | Ga0439449_0027057 | 3300042007 | Bacteria | 2141 |
| 698 | Ga0439457_009705 | 3300042014 | Bacteria | 2234 |
| 699 | Ga0439462_0001208 | 3300042015 | Bacteria | 5648 |
| 700 | Ga0439462_0008646 | 3300042015 | Bacteria | 2571 |
| 701 | Ga0439462_0056879 | 3300042015 | Bacteria | 1056 |
| 702 | Ga0450912_001672 | 3300042116 | Bacteria | 1395 |
| 703 | Ga0450895_014404 | 3300042132 | Bacteria | 699 |
| 704 | Ga0450906_040534 | 3300042145 | Bacteria | 822 |
| 705 | Ga0450910_048457 | 3300042147 | Bacteria | 698 |
| 706 | Ga0439446_0107761 | 3300042156 | Bacteria | 886 |
| 707 | Ga0450918_067659 | 3300042531 | Bacteria | 667 |
| 708 | Ga0451577_0169758 | 3300042876 | Bacteria | 1966 |
| 709 | Ga0466969_0011722 | 3300044656 | Bacteria | 4637 |
| 710 | Ga0466966_0000077 | 3300044684 | Bacteria | 62463 |
| 711 | Ga0466966_0017763 | 3300044684 | Bacteria | 4696 |
| 712 | Ga0466961_0174410 | 3300044693 | Bacteria | 1336 |
| 713 | Ga0466963_0039815 | 3300044694 | Bacteria | 3079 |
| 714 | Ga0466963_0098772 | 3300044694 | Bacteria | 1996 |
| 715 | Ga0466963_0732976 | 3300044694 | Bacteria | 697 |
| 716 | Ga0466963_1203584 | 3300044694 | Bacteria | 532 |
| 717 | Ga0466971_0004154 | 3300044719 | Bacteria | 6244 |
| 718 | Ga0466970_0019762 | 3300044765 | Bacteria | 3495 |
| 719 | Ga0466957_0042009 | 3300044842 | Bacteria | 2765 |
| 720 | Ga0451576_2339543 | 3300045051 | Bacteria | 547 |
| 721 | Ga0466958_0186073 | 3300045836 | Bacteria | 1319 |
| 722 | Ga0466967_0092111 | 3300045976 | Bacteria | 2756 |
| 723 | Ga0495627_151198 | 3300046453 | Bacteria | 648 |
| 724 | Ga0495590_0093488 | 3300046457 | Bacteria | 1065 |
| 725 | Ga0495585_0143699 | 3300046492 | Bacteria | 1248 |
| 726 | Ga0495585_0220578 | 3300046492 | Bacteria | 957 |
| 727 | Ga0495620_0119038 | 3300046515 | Bacteria | 1042 |
| 728 | Ga0495663_0000982 | 3300046525 | Bacteria | 9423 |
| 729 | Ga0495642_0033149 | 3300046528 | Bacteria | 2076 |
| 730 | Ga0495598_0000608 | 3300046537 | Bacteria | 6771 |
| 731 | Ga0495598_0019081 | 3300046537 | Bacteria | 1792 |
| 732 | Ga0495598_0291928 | 3300046537 | Bacteria | 615 |
| 733 | Ga0495621_0001412 | 3300046539 | Bacteria | 6225 |
| 734 | Ga0495633_0004598 | 3300046558 | Bacteria | 8695 |
| 735 | Ga0495656_0069667 | 3300046615 | Bacteria | 1559 |
| 736 | Ga0495668_0036991 | 3300046616 | Bacteria | 2733 |
| 737 | Ga0495669_0000720 | 3300046684 | Bacteria | 14382 |
| 738 | Ga0495669_0025981 | 3300046684 | Bacteria | 2557 |
| 739 | Ga0495670_0004022 | 3300046691 | Bacteria | 7208 |
| 740 | Ga0495670_0148279 | 3300046691 | Bacteria | 1229 |
| 741 | Ga0495670_0165353 | 3300046691 | Bacteria | 1164 |
| 742 | Ga0495677_0002624 | 3300047445 | Bacteria | 7032 |
| 743 | Ga0495681_0173254 | 3300047470 | Bacteria | 891 |
| 744 | Ga0496101_0451971 | 3300048904 | Bacteria | 1014 |
| 745 | Ga0496101_1049936 | 3300048904 | Bacteria | 640 |
| 746 | Ga0496102_0548629 | 3300048905 | Bacteria | 1079 |
| 747 | Ga0496107_0091378 | 3300048910 | Bacteria | 2225 |
| 748 | Ga0496109_0029263 | 3300048912 | Bacteria | 4933 |
| 749 | Ga0496109_0327980 | 3300048912 | Bacteria | 1445 |
| 750 | Ga0496109_0431124 | 3300048912 | Bacteria | 1245 |
| 751 | Ga0496110_0020611 | 3300048913 | Bacteria | 5569 |
| 752 | Ga0496110_0385532 | 3300048913 | Bacteria | 1277 |
| 753 | Ga0496110_0496755 | 3300048913 | Bacteria | 1111 |
| 754 | Ga0496110_1386854 | 3300048913 | Bacteria | 612 |
| 755 | Ga0496111_0004026 | 3300048914 | Bacteria | 9225 |
| 756 | Ga0496111_0038086 | 3300048914 | Bacteria | 3444 |
| 757 | Ga0496111_0543425 | 3300048914 | Bacteria | 853 |
| 758 | Ga0496114_0007166 | 3300048917 | Bacteria | 8797 |
| 759 | Ga0496114_0026588 | 3300048917 | Bacteria | 4739 |
| 760 | Ga0496114_0051027 | 3300048917 | Bacteria | 3444 |
| 761 | Ga0496121_0000201 | 3300048924 | Bacteria | 131246 |
| 762 | Ga0495678_053954 | 3300049459 | Bacteria | 1541 |
| 763 | Ga0501034_0897926 | 3300049571 | Bacteria | 774 |
| 764 | Ga0501036_1392663 | 3300049572 | Bacteria | 569 |
| 765 | Ga0501039_0256191 | 3300049575 | Bacteria | 1376 |
| 766 | Ga0501046_0630292 | 3300049580 | Bacteria | 759 |
| 767 | Ga0501047_0324564 | 3300049581 | Bacteria | 1379 |
| 768 | Ga0501217_020403 | 3300049661 | Bacteria | 1556 |
| 769 | Ga0501223_064886 | 3300049663 | Bacteria | 716 |
| 770 | Ga0501227_124218 | 3300049665 | Bacteria | 699 |
| 771 | Ga0501233_105980 | 3300049668 | Bacteria | 748 |
| 772 | Ga0501242_075081 | 3300049674 | Bacteria | 535 |
| 773 | Ga0501250_029957 | 3300049680 | Bacteria | 751 |
| 774 | Ga0501225_0163585 | 3300049705 | Bacteria | 686 |
| 775 | Ga0501225_0178328 | 3300049705 | Bacteria | 663 |
| 776 | Ga0501268_058719 | 3300049765 | Bacteria | 758 |
| 777 | Ga0501270_014900 | 3300049767 | Bacteria | 1102 |
| 778 | Ga0501035_1088166 | 3300049822 | Bacteria | 625 |
| 779 | Ga0501035_1496565 | 3300049822 | Bacteria | 515 |
| 780 | Ga0501044_0398716 | 3300049823 | Bacteria | 1289 |
| 781 | Ga0500643_009425 | 3300053087 | Bacteria | 3734 |
| 782 | Ga0500566_0001993 | 3300053094 | Bacteria | 12051 |
| 783 | Ga0500555_059971 | 3300053103 | Bacteria | 1025 |
| 784 | Ga0500658_0085828 | 3300053134 | Bacteria | 1353 |
| 785 | Ga0500559_0134801 | 3300053136 | Bacteria | 1154 |
| 786 | Ga0500568_0382910 | 3300053139 | Bacteria | 509 |
| 787 | Ga0500577_0268216 | 3300053142 | Bacteria | 743 |
| 788 | Ga0500588_0020709 | 3300053146 | Bacteria | 1766 |
| 789 | Ga0500604_0222523 | 3300053151 | Bacteria | 651 |
| 790 | Ga0501084_1508003 | 3300054114 | Bacteria | 563 |
| 791 | Ga0590077_044978 | 3300059426 | Bacteria | 986 |
| 792 | Ga0466962_0002042 | 3300061719 | Bacteria | 9543 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037853 | Ga0436364_1072241 | Ga0436364_1072241_476_865 | 120 |
| 2 | iso_pu_bacteria | 2643221541 | 2643726963 | 121 |
| 3 | iso_pu_bacteria | 2643221606 | 2644045996 | 121 |
| 4 | iso_pu_bacteria | 2643221671 | 2644393193 | 121 |
| 5 | 2209111006 | 2214814960 | 2213849001 | 125 |
| 6 | 3300001904 | JGI24736J21556_1000939 | JGI24736J21556_10009394 | 125 |
| 7 | 3300001915 | JGI24741J21665_1019747 | JGI24741J21665_10197473 | 125 |
| 8 | 3300001979 | JGI24740J21852_10005216 | JGI24740J21852_100052164 | 125 |
| 9 | 3300001990 | JGI24737J22298_10055753 | JGI24737J22298_100557532 | 125 |
| 10 | 3300002239 | JGI24034J26672_10010588 | JGI24034J26672_100105882 | 125 |
| 11 | 3300002459 | JGI24751J29686_10011725 | JGI24751J29686_100117253 | 125 |
| 12 | 3300002774 | JGI25150J39212_1049317 | JGI25150J39212_10493171 | 125 |
| 13 | 3300002774 | JGI25150J39212_1052103 | JGI25150J39212_10521031 | 125 |
| 14 | 3300003215 | JGI25153J46596_10008965 | JGI25153J46596_100089655 | 125 |
| 15 | 3300003773 | Ga0055537_1000441 | Ga0055537_10004419 | 125 |
| 16 | 3300003773 | Ga0055537_1012581 | Ga0055537_10125813 | 125 |
| 17 | 3300003775 | Ga0055524_1000245 | Ga0055524_100024545 | 125 |
| 18 | 3300003791 | Ga0055530_10012116 | Ga0055530_100121166 | 125 |
| 19 | 3300003791 | Ga0055530_10075250 | Ga0055530_100752501 | 125 |
| 20 | 3300003794 | Ga0055531_10002452 | Ga0055531_1000245214 | 125 |
| 21 | 3300003911 | JGI25405J52794_10034577 | JGI25405J52794_100345772 | 125 |
| 22 | 3300004625 | Ga0055543_1011280 | Ga0055543_10112804 | 125 |
| 23 | 3300005262 | Ga0065165_1008746 | Ga0065165_10087464 | 125 |
| 24 | 3300005262 | Ga0065165_1032218 | Ga0065165_10322182 | 125 |
| 25 | 3300005290 | Ga0065712_10002451 | Ga0065712_100024514 | 125 |
| 26 | 3300005290 | Ga0065712_10100222 | Ga0065712_101002223 | 125 |
| 27 | 3300005293 | Ga0065715_10002752 | Ga0065715_100027524 | 125 |
| 28 | 3300005293 | Ga0065715_10028692 | Ga0065715_100286922 | 125 |
| 29 | 3300005293 | Ga0065715_10124416 | Ga0065715_101244162 | 125 |
| 30 | 3300005327 | Ga0070658_10002325 | Ga0070658_100023255 | 125 |
| 31 | 3300005327 | Ga0070658_10003674 | Ga0070658_1000367412 | 125 |
| 32 | 3300005327 | Ga0070658_10005871 | Ga0070658_100058712 | 125 |
| 33 | 3300005327 | Ga0070658_10080815 | Ga0070658_100808153 | 125 |
| 34 | 3300005327 | Ga0070658_10111656 | Ga0070658_101116561 | 125 |
| 35 | 3300005327 | Ga0070658_10147544 | Ga0070658_101475443 | 125 |
| 36 | 3300005327 | Ga0070658_10343096 | Ga0070658_103430961 | 125 |
| 37 | 3300005327 | Ga0070658_10510952 | Ga0070658_105109521 | 125 |
| 38 | 3300005327 | Ga0070658_11014154 | Ga0070658_110141542 | 125 |
| 39 | 3300005328 | Ga0070676_10005263 | Ga0070676_100052632 | 125 |
| 40 | 3300005329 | Ga0070683_100008142 | Ga0070683_1000081429 | 125 |
| 41 | 3300005331 | Ga0070670_100003053 | Ga0070670_10000305313 | 125 |
| 42 | 3300005331 | Ga0070670_100042043 | Ga0070670_1000420433 | 125 |
| 43 | 3300005331 | Ga0070670_100238668 | Ga0070670_1002386683 | 125 |
| 44 | 3300005331 | Ga0070670_100246219 | Ga0070670_1002462192 | 125 |
| 45 | 3300005331 | Ga0070670_101432371 | Ga0070670_1014323712 | 125 |
| 46 | 3300005333 | Ga0070677_10000456 | Ga0070677_1000045613 | 125 |
| 47 | 3300005333 | Ga0070677_10045304 | Ga0070677_100453042 | 125 |
| 48 | 3300005333 | Ga0070677_10307029 | Ga0070677_103070292 | 125 |
| 49 | 3300005333 | Ga0070677_10521474 | Ga0070677_105214741 | 125 |
| 50 | 3300005333 | Ga0070677_10622198 | Ga0070677_106221981 | 125 |
| 51 | 3300005335 | Ga0070666_10008323 | Ga0070666_100083235 | 125 |
| 52 | 3300005336 | Ga0070680_100026295 | Ga0070680_1000262953 | 125 |
| 53 | 3300005336 | Ga0070680_100338796 | Ga0070680_1003387962 | 125 |
| 54 | 3300005336 | Ga0070680_100360438 | Ga0070680_1003604382 | 125 |
| 55 | 3300005336 | Ga0070680_100382751 | Ga0070680_1003827511 | 125 |
| 56 | 3300005336 | Ga0070680_101082462 | Ga0070680_1010824622 | 125 |
| 57 | 3300005338 | Ga0068868_100738943 | Ga0068868_1007389432 | 125 |
| 58 | 3300005339 | Ga0070660_100001300 | Ga0070660_1000013006 | 125 |
| 59 | 3300005339 | Ga0070660_100003050 | Ga0070660_1000030502 | 125 |
| 60 | 3300005339 | Ga0070660_100003201 | Ga0070660_10000320113 | 125 |
| 61 | 3300005339 | Ga0070660_100014004 | Ga0070660_1000140049 | 125 |
| 62 | 3300005339 | Ga0070660_100017015 | Ga0070660_1000170152 | 125 |
| 63 | 3300005339 | Ga0070660_100031646 | Ga0070660_1000316462 | 125 |
| 64 | 3300005339 | Ga0070660_100052189 | Ga0070660_1000521892 | 125 |
| 65 | 3300005339 | Ga0070660_100086049 | Ga0070660_1000860492 | 125 |
| 66 | 3300005339 | Ga0070660_100145343 | Ga0070660_1001453432 | 125 |
| 67 | 3300005339 | Ga0070660_100173905 | Ga0070660_1001739052 | 125 |
| 68 | 3300005339 | Ga0070660_100283912 | Ga0070660_1002839121 | 125 |
| 69 | 3300005339 | Ga0070660_100515884 | Ga0070660_1005158842 | 125 |
| 70 | 3300005339 | Ga0070660_101235432 | Ga0070660_1012354322 | 125 |
| 71 | 3300005339 | Ga0070660_101580369 | Ga0070660_1015803691 | 125 |
| 72 | 3300005340 | Ga0070689_100604544 | Ga0070689_1006045442 | 125 |
| 73 | 3300005343 | Ga0070687_100226069 | Ga0070687_1002260692 | 125 |
| 74 | 3300005344 | Ga0070661_100000009 | Ga0070661_10000000966 | 125 |
| 75 | 3300005344 | Ga0070661_100005747 | Ga0070661_1000057478 | 125 |
| 76 | 3300005344 | Ga0070661_100128588 | Ga0070661_1001285883 | 125 |
| 77 | 3300005344 | Ga0070661_100511045 | Ga0070661_1005110452 | 125 |
| 78 | 3300005344 | Ga0070661_100784995 | Ga0070661_1007849951 | 125 |
| 79 | 3300005345 | Ga0070692_10007743 | Ga0070692_100077433 | 125 |
| 80 | 3300005345 | Ga0070692_10040842 | Ga0070692_100408423 | 125 |
| 81 | 3300005345 | Ga0070692_11182090 | Ga0070692_111820902 | 125 |
| 82 | 3300005347 | Ga0070668_100000015 | Ga0070668_10000001585 | 125 |
| 83 | 3300005347 | Ga0070668_100125549 | Ga0070668_1001255493 | 125 |
| 84 | 3300005347 | Ga0070668_100410534 | Ga0070668_1004105342 | 125 |
| 85 | 3300005347 | Ga0070668_100679438 | Ga0070668_1006794382 | 125 |
| 86 | 3300005353 | Ga0070669_100042765 | Ga0070669_1000427652 | 125 |
| 87 | 3300005353 | Ga0070669_100051030 | Ga0070669_1000510303 | 125 |
| 88 | 3300005353 | Ga0070669_100051768 | Ga0070669_1000517683 | 125 |
| 89 | 3300005353 | Ga0070669_100086459 | Ga0070669_1000864592 | 125 |
| 90 | 3300005353 | Ga0070669_100300753 | Ga0070669_1003007532 | 125 |
| 91 | 3300005353 | Ga0070669_100303537 | Ga0070669_1003035372 | 125 |
| 92 | 3300005353 | Ga0070669_100353272 | Ga0070669_1003532722 | 125 |
| 93 | 3300005353 | Ga0070669_100437455 | Ga0070669_1004374552 | 125 |
| 94 | 3300005353 | Ga0070669_101664383 | Ga0070669_1016643831 | 125 |
| 95 | 3300005354 | Ga0070675_100001728 | Ga0070675_1000017284 | 125 |
| 96 | 3300005354 | Ga0070675_100003423 | Ga0070675_1000034233 | 125 |
| 97 | 3300005354 | Ga0070675_100241199 | Ga0070675_1002411992 | 125 |
| 98 | 3300005354 | Ga0070675_100383728 | Ga0070675_1003837282 | 125 |
| 99 | 3300005355 | Ga0070671_100000322 | Ga0070671_10000032217 | 125 |
| 100 | 3300005355 | Ga0070671_100012423 | Ga0070671_1000124232 | 125 |
| 101 | 3300005355 | Ga0070671_100094864 | Ga0070671_1000948642 | 125 |
| 102 | 3300005355 | Ga0070671_100386599 | Ga0070671_1003865992 | 125 |
| 103 | 3300005355 | Ga0070671_100981292 | Ga0070671_1009812922 | 125 |
| 104 | 3300005356 | Ga0070674_100067301 | Ga0070674_1000673012 | 125 |
| 105 | 3300005356 | Ga0070674_100078186 | Ga0070674_1000781862 | 125 |
| 106 | 3300005356 | Ga0070674_100251530 | Ga0070674_1002515302 | 125 |
| 107 | 3300005356 | Ga0070674_100446229 | Ga0070674_1004462292 | 125 |
| 108 | 3300005356 | Ga0070674_100869687 | Ga0070674_1008696872 | 125 |
| 109 | 3300005364 | Ga0070673_100002044 | Ga0070673_10000204414 | 125 |
| 110 | 3300005364 | Ga0070673_100074161 | Ga0070673_1000741612 | 125 |
| 111 | 3300005364 | Ga0070673_100149011 | Ga0070673_1001490112 | 125 |
| 112 | 3300005364 | Ga0070673_100337495 | Ga0070673_1003374952 | 125 |
| 113 | 3300005364 | Ga0070673_100426871 | Ga0070673_1004268712 | 125 |
| 114 | 3300005366 | Ga0070659_100000979 | Ga0070659_10000097914 | 125 |
| 115 | 3300005366 | Ga0070659_100048521 | Ga0070659_1000485215 | 125 |
| 116 | 3300005366 | Ga0070659_100059123 | Ga0070659_1000591233 | 125 |
| 117 | 3300005366 | Ga0070659_100363038 | Ga0070659_1003630382 | 125 |
| 118 | 3300005366 | Ga0070659_100590201 | Ga0070659_1005902011 | 125 |
| 119 | 3300005366 | Ga0070659_100743754 | Ga0070659_1007437541 | 125 |
| 120 | 3300005366 | Ga0070659_101741934 | Ga0070659_1017419341 | 125 |
| 121 | 3300005367 | Ga0070667_100000017 | Ga0070667_100000017115 | 125 |
| 122 | 3300005367 | Ga0070667_100093954 | Ga0070667_1000939542 | 125 |
| 123 | 3300005367 | Ga0070667_100262476 | Ga0070667_1002624762 | 125 |
| 124 | 3300005455 | Ga0070663_100014045 | Ga0070663_1000140454 | 125 |
| 125 | 3300005455 | Ga0070663_100032493 | Ga0070663_1000324934 | 125 |
| 126 | 3300005455 | Ga0070663_100042039 | Ga0070663_1000420393 | 125 |
| 127 | 3300005455 | Ga0070663_100395515 | Ga0070663_1003955151 | 125 |
| 128 | 3300005455 | Ga0070663_101767648 | Ga0070663_1017676482 | 125 |
| 129 | 3300005456 | Ga0070678_100164276 | Ga0070678_1001642763 | 125 |
| 130 | 3300005456 | Ga0070678_100181774 | Ga0070678_1001817742 | 125 |
| 131 | 3300005456 | Ga0070678_100517362 | Ga0070678_1005173622 | 125 |
| 132 | 3300005457 | Ga0070662_100018695 | Ga0070662_1000186952 | 125 |
| 133 | 3300005457 | Ga0070662_100044388 | Ga0070662_1000443882 | 125 |
| 134 | 3300005457 | Ga0070662_100222171 | Ga0070662_1002221712 | 125 |
| 135 | 3300005457 | Ga0070662_100639341 | Ga0070662_1006393412 | 125 |
| 136 | 3300005457 | Ga0070662_100646677 | Ga0070662_1006466771 | 125 |
| 137 | 3300005458 | Ga0070681_10094424 | Ga0070681_100944243 | 125 |
| 138 | 3300005458 | Ga0070681_10748623 | Ga0070681_107486232 | 125 |
| 139 | 3300005458 | Ga0070681_11067016 | Ga0070681_110670162 | 125 |
| 140 | 3300005459 | Ga0068867_100177096 | Ga0068867_1001770962 | 125 |
| 141 | 3300005530 | Ga0070679_100000404 | Ga0070679_1000004048 | 125 |
| 142 | 3300005530 | Ga0070679_100054822 | Ga0070679_1000548223 | 125 |
| 143 | 3300005530 | Ga0070679_100100813 | Ga0070679_1001008134 | 125 |
| 144 | 3300005530 | Ga0070679_100111539 | Ga0070679_1001115393 | 125 |
| 145 | 3300005530 | Ga0070679_100203743 | Ga0070679_1002037433 | 125 |
| 146 | 3300005530 | Ga0070679_100503309 | Ga0070679_1005033092 | 125 |
| 147 | 3300005530 | Ga0070679_100642577 | Ga0070679_1006425771 | 125 |
| 148 | 3300005530 | Ga0070679_100974810 | Ga0070679_1009748102 | 125 |
| 149 | 3300005530 | Ga0070679_101814886 | Ga0070679_1018148861 | 125 |
| 150 | 3300005535 | Ga0070684_100338082 | Ga0070684_1003380822 | 125 |
| 151 | 3300005535 | Ga0070684_101674257 | Ga0070684_1016742571 | 125 |
| 152 | 3300005539 | Ga0068853_100131472 | Ga0068853_1001314722 | 125 |
| 153 | 3300005539 | Ga0068853_100242334 | Ga0068853_1002423342 | 125 |
| 154 | 3300005539 | Ga0068853_100249839 | Ga0068853_1002498392 | 125 |
| 155 | 3300005539 | Ga0068853_100946309 | Ga0068853_1009463092 | 125 |
| 156 | 3300005543 | Ga0070672_100019791 | Ga0070672_1000197916 | 125 |
| 157 | 3300005543 | Ga0070672_100089851 | Ga0070672_1000898513 | 125 |
| 158 | 3300005543 | Ga0070672_100639022 | Ga0070672_1006390222 | 125 |
| 159 | 3300005543 | Ga0070672_101207356 | Ga0070672_1012073562 | 125 |
| 160 | 3300005546 | Ga0070696_100918687 | Ga0070696_1009186872 | 125 |
| 161 | 3300005548 | Ga0070665_100060440 | Ga0070665_1000604404 | 125 |
| 162 | 3300005563 | Ga0068855_100026818 | Ga0068855_1000268188 | 125 |
| 163 | 3300005563 | Ga0068855_100039512 | Ga0068855_1000395124 | 125 |
| 164 | 3300005563 | Ga0068855_100130375 | Ga0068855_1001303754 | 125 |
| 165 | 3300005564 | Ga0070664_100014561 | Ga0070664_1000145614 | 125 |
| 166 | 3300005564 | Ga0070664_100085974 | Ga0070664_1000859742 | 125 |
| 167 | 3300005564 | Ga0070664_100128457 | Ga0070664_1001284573 | 125 |
| 168 | 3300005564 | Ga0070664_100151187 | Ga0070664_1001511872 | 125 |
| 169 | 3300005564 | Ga0070664_100835859 | Ga0070664_1008358591 | 125 |
| 170 | 3300005577 | Ga0068857_100081237 | Ga0068857_1000812373 | 125 |
| 171 | 3300005577 | Ga0068857_100238406 | Ga0068857_1002384062 | 125 |
| 172 | 3300005578 | Ga0068854_100003883 | Ga0068854_1000038839 | 125 |
| 173 | 3300005578 | Ga0068854_100138268 | Ga0068854_1001382683 | 125 |
| 174 | 3300005578 | Ga0068854_100321087 | Ga0068854_1003210872 | 125 |
| 175 | 3300005578 | Ga0068854_100827485 | Ga0068854_1008274852 | 125 |
| 176 | 3300005614 | Ga0068856_100009497 | Ga0068856_1000094979 | 125 |
| 177 | 3300005614 | Ga0068856_100399926 | Ga0068856_1003999262 | 125 |
| 178 | 3300005614 | Ga0068856_100455097 | Ga0068856_1004550973 | 125 |
| 179 | 3300005616 | Ga0068852_100008362 | Ga0068852_1000083623 | 125 |
| 180 | 3300005616 | Ga0068852_100294561 | Ga0068852_1002945612 | 125 |
| 181 | 3300005616 | Ga0068852_100425180 | Ga0068852_1004251801 | 125 |
| 182 | 3300005617 | Ga0068859_100253494 | Ga0068859_1002534943 | 125 |
| 183 | 3300005617 | Ga0068859_101603435 | Ga0068859_1016034352 | 125 |
| 184 | 3300005618 | Ga0068864_100006205 | Ga0068864_10000620511 | 125 |
| 185 | 3300005618 | Ga0068864_100588810 | Ga0068864_1005888102 | 125 |
| 186 | 3300005719 | Ga0068861_100043504 | Ga0068861_1000435045 | 125 |
| 187 | 3300005840 | Ga0068870_10227811 | Ga0068870_102278112 | 125 |
| 188 | 3300005840 | Ga0068870_10437691 | Ga0068870_104376911 | 125 |
| 189 | 3300005841 | Ga0068863_100016985 | Ga0068863_1000169852 | 125 |
| 190 | 3300005841 | Ga0068863_100595975 | Ga0068863_1005959752 | 125 |
| 191 | 3300005841 | Ga0068863_101340213 | Ga0068863_1013402132 | 125 |
| 192 | 3300005842 | Ga0068858_100001873 | Ga0068858_1000018737 | 125 |
| 193 | 3300005842 | Ga0068858_100702362 | Ga0068858_1007023622 | 125 |
| 194 | 3300005843 | Ga0068860_100000056 | Ga0068860_100000056129 | 125 |
| 195 | 3300005844 | Ga0068862_100000108 | Ga0068862_10000010837 | 125 |
| 196 | 3300005844 | Ga0068862_100419206 | Ga0068862_1004192062 | 125 |
| 197 | 3300005844 | Ga0068862_100814262 | Ga0068862_1008142621 | 125 |
| 198 | 3300005937 | Ga0081455_10000964 | Ga0081455_1000096419 | 125 |
| 199 | 3300006038 | Ga0075365_10051703 | Ga0075365_100517033 | 125 |
| 200 | 3300006051 | Ga0075364_10149240 | Ga0075364_101492403 | 125 |
| 201 | 3300006237 | Ga0097621_101135506 | Ga0097621_1011355062 | 125 |
| 202 | 3300006353 | Ga0075370_10197398 | Ga0075370_101973981 | 125 |
| 203 | 3300006353 | Ga0075370_10251505 | Ga0075370_102515052 | 125 |
| 204 | 3300006358 | Ga0068871_101268827 | Ga0068871_1012688272 | 125 |
| 205 | 3300006881 | Ga0068865_100621950 | Ga0068865_1006219502 | 125 |
| 206 | 3300006881 | Ga0068865_101169459 | Ga0068865_1011694591 | 125 |
| 207 | 3300006931 | Ga0097620_100253502 | Ga0097620_1002535023 | 125 |
| 208 | 3300006931 | Ga0097620_101603348 | Ga0097620_1016033482 | 125 |
| 209 | 3300009093 | Ga0105240_10073464 | Ga0105240_100734644 | 125 |
| 210 | 3300009093 | Ga0105240_10807730 | Ga0105240_108077301 | 125 |
| 211 | 3300009101 | Ga0105247_11104328 | Ga0105247_111043282 | 125 |
| 212 | 3300009148 | Ga0105243_10027845 | Ga0105243_100278454 | 125 |
| 213 | 3300009148 | Ga0105243_10549280 | Ga0105243_105492802 | 125 |
| 214 | 3300009148 | Ga0105243_10981002 | Ga0105243_109810022 | 125 |
| 215 | 3300009174 | Ga0105241_11216722 | Ga0105241_112167222 | 125 |
| 216 | 3300009177 | Ga0105248_10008010 | Ga0105248_100080104 | 125 |
| 217 | 3300009177 | Ga0105248_10317465 | Ga0105248_103174653 | 125 |
| 218 | 3300009177 | Ga0105248_11374633 | Ga0105248_113746331 | 125 |
| 219 | 3300009551 | Ga0105238_10221634 | Ga0105238_102216342 | 125 |
| 220 | 3300009551 | Ga0105238_10381912 | Ga0105238_103819122 | 125 |
| 221 | 3300009553 | Ga0105249_10609447 | Ga0105249_106094473 | 125 |
| 222 | 3300010375 | Ga0105239_10134418 | Ga0105239_101344183 | 125 |
| 223 | 3300012512 | Ga0157327_1020172 | Ga0157327_10201722 | 125 |
| 224 | 3300012513 | Ga0157326_1002409 | Ga0157326_10024092 | 125 |
| 225 | 3300013100 | Ga0157373_10002525 | Ga0157373_100025259 | 125 |
| 226 | 3300013100 | Ga0157373_10023486 | Ga0157373_100234864 | 125 |
| 227 | 3300013100 | Ga0157373_10160641 | Ga0157373_101606413 | 125 |
| 228 | 3300013100 | Ga0157373_10227975 | Ga0157373_102279753 | 125 |
| 229 | 3300013100 | Ga0157373_10235618 | Ga0157373_102356182 | 125 |
| 230 | 3300013100 | Ga0157373_10273000 | Ga0157373_102730002 | 125 |
| 231 | 3300013100 | Ga0157373_10487429 | Ga0157373_104874292 | 125 |
| 232 | 3300013100 | Ga0157373_10557542 | Ga0157373_105575422 | 125 |
| 233 | 3300013102 | Ga0157371_10002615 | Ga0157371_1000261512 | 125 |
| 234 | 3300013102 | Ga0157371_10008024 | Ga0157371_100080243 | 125 |
| 235 | 3300013102 | Ga0157371_10122835 | Ga0157371_101228352 | 125 |
| 236 | 3300013102 | Ga0157371_10272687 | Ga0157371_102726872 | 125 |
| 237 | 3300013102 | Ga0157371_10290586 | Ga0157371_102905861 | 125 |
| 238 | 3300013102 | Ga0157371_10299167 | Ga0157371_102991671 | 125 |
| 239 | 3300013102 | Ga0157371_11411167 | Ga0157371_114111671 | 125 |
| 240 | 3300013104 | Ga0157370_10017735 | Ga0157370_100177351 | 125 |
| 241 | 3300013104 | Ga0157370_10475894 | Ga0157370_104758942 | 125 |
| 242 | 3300013104 | Ga0157370_10748203 | Ga0157370_107482032 | 125 |
| 243 | 3300013105 | Ga0157369_10001135 | Ga0157369_100011354 | 125 |
| 244 | 3300013105 | Ga0157369_10003392 | Ga0157369_100033923 | 125 |
| 245 | 3300013105 | Ga0157369_10023242 | Ga0157369_100232424 | 125 |
| 246 | 3300013105 | Ga0157369_11164135 | Ga0157369_111641352 | 125 |
| 247 | 3300013296 | Ga0157374_10068169 | Ga0157374_100681692 | 125 |
| 248 | 3300013306 | Ga0163162_10391762 | Ga0163162_103917622 | 125 |
| 249 | 3300013307 | Ga0157372_10093611 | Ga0157372_100936114 | 125 |
| 250 | 3300013307 | Ga0157372_10158636 | Ga0157372_101586361 | 125 |
| 251 | 3300013307 | Ga0157372_10176026 | Ga0157372_101760262 | 125 |
| 252 | 3300013307 | Ga0157372_10511932 | Ga0157372_105119323 | 125 |
| 253 | 3300013307 | Ga0157372_10652951 | Ga0157372_106529511 | 125 |
| 254 | 3300013308 | Ga0157375_10004286 | Ga0157375_1000428611 | 125 |
| 255 | 3300013308 | Ga0157375_10450073 | Ga0157375_104500731 | 125 |
| 256 | 3300014325 | Ga0163163_10105952 | Ga0163163_101059522 | 125 |
| 257 | 3300014325 | Ga0163163_10197748 | Ga0163163_101977484 | 125 |
| 258 | 3300014325 | Ga0163163_10624305 | Ga0163163_106243052 | 125 |
| 259 | 3300014326 | Ga0157380_10008061 | Ga0157380_100080612 | 125 |
| 260 | 3300014326 | Ga0157380_10014874 | Ga0157380_100148742 | 125 |
| 261 | 3300014326 | Ga0157380_10052755 | Ga0157380_100527552 | 125 |
| 262 | 3300014326 | Ga0157380_10320287 | Ga0157380_103202874 | 125 |
| 263 | 3300014326 | Ga0157380_10499218 | Ga0157380_104992181 | 125 |
| 264 | 3300014326 | Ga0157380_11258657 | Ga0157380_112586572 | 125 |
| 265 | 3300014968 | Ga0157379_11517235 | Ga0157379_115172352 | 125 |
| 266 | 3300017792 | Ga0163161_10185712 | Ga0163161_101857122 | 125 |
| 267 | 3300017792 | Ga0163161_10663822 | Ga0163161_106638221 | 125 |
| 268 | 3300017792 | Ga0163161_10685195 | Ga0163161_106851952 | 125 |
| 269 | 3300020082 | Ga0206353_10796169 | Ga0206353_107961692 | 125 |
| 270 | 3300021384 | Ga0213876_10001167 | Ga0213876_100011672 | 125 |
| 271 | 3300025245 | Ga0207425_1007318 | Ga0207425_10073182 | 125 |
| 272 | 3300025263 | Ga0209565_1000007 | Ga0209565_1000007329 | 125 |
| 273 | 3300025263 | Ga0209565_1001004 | Ga0209565_100100420 | 125 |
| 274 | 3300025273 | Ga0209673_1001016 | Ga0209673_100101616 | 125 |
| 275 | 3300025273 | Ga0209673_1008645 | Ga0209673_10086453 | 125 |
| 276 | 3300025291 | Ga0209675_1013627 | Ga0209675_10136272 | 125 |
| 277 | 3300025295 | Ga0209564_1007139 | Ga0209564_10071393 | 125 |
| 278 | 3300025297 | Ga0209758_1007609 | Ga0209758_10076092 | 125 |
| 279 | 3300025297 | Ga0209758_1027150 | Ga0209758_10271503 | 125 |
| 280 | 3300025298 | Ga0209050_1014851 | Ga0209050_10148513 | 125 |
| 281 | 3300025298 | Ga0209050_1022518 | Ga0209050_10225182 | 125 |
| 282 | 3300025299 | Ga0209256_1000008 | Ga0209256_1000008171 | 125 |
| 283 | 3300025304 | Ga0209257_1004536 | Ga0209257_10045365 | 125 |
| 284 | 3300025315 | Ga0207697_10072169 | Ga0207697_100721691 | 125 |
| 285 | 3300025315 | Ga0207697_10081771 | Ga0207697_100817711 | 125 |
| 286 | 3300025893 | Ga0207682_10001287 | Ga0207682_100012879 | 125 |
| 287 | 3300025893 | Ga0207682_10084148 | Ga0207682_100841482 | 125 |
| 288 | 3300025893 | Ga0207682_10126320 | Ga0207682_101263202 | 125 |
| 289 | 3300025901 | Ga0207688_10025725 | Ga0207688_100257253 | 125 |
| 290 | 3300025901 | Ga0207688_10123898 | Ga0207688_101238981 | 125 |
| 291 | 3300025903 | Ga0207680_10035897 | Ga0207680_100358973 | 125 |
| 292 | 3300025903 | Ga0207680_10071279 | Ga0207680_100712793 | 125 |
| 293 | 3300025903 | Ga0207680_10230023 | Ga0207680_102300231 | 125 |
| 294 | 3300025904 | Ga0207647_10013638 | Ga0207647_100136383 | 125 |
| 295 | 3300025907 | Ga0207645_10009100 | Ga0207645_100091007 | 125 |
| 296 | 3300025907 | Ga0207645_10091369 | Ga0207645_100913693 | 125 |
| 297 | 3300025909 | Ga0207705_10000002 | Ga0207705_10000002427 | 125 |
| 298 | 3300025909 | Ga0207705_10000673 | Ga0207705_1000067326 | 125 |
| 299 | 3300025909 | Ga0207705_10001549 | Ga0207705_1000154915 | 125 |
| 300 | 3300025909 | Ga0207705_10003314 | Ga0207705_100033149 | 125 |
| 301 | 3300025909 | Ga0207705_10008205 | Ga0207705_100082059 | 125 |
| 302 | 3300025909 | Ga0207705_10011618 | Ga0207705_100116182 | 125 |
| 303 | 3300025909 | Ga0207705_10022590 | Ga0207705_100225903 | 125 |
| 304 | 3300025909 | Ga0207705_10093196 | Ga0207705_100931962 | 125 |
| 305 | 3300025909 | Ga0207705_10108458 | Ga0207705_101084583 | 125 |
| 306 | 3300025909 | Ga0207705_10192605 | Ga0207705_101926054 | 125 |
| 307 | 3300025909 | Ga0207705_10226447 | Ga0207705_102264474 | 125 |
| 308 | 3300025911 | Ga0207654_10479424 | Ga0207654_104794242 | 125 |
| 309 | 3300025912 | Ga0207707_10091266 | Ga0207707_100912663 | 125 |
| 310 | 3300025912 | Ga0207707_10113867 | Ga0207707_101138672 | 125 |
| 311 | 3300025912 | Ga0207707_10147539 | Ga0207707_101475392 | 125 |
| 312 | 3300025913 | Ga0207695_10033990 | Ga0207695_100339904 | 125 |
| 313 | 3300025913 | Ga0207695_10466074 | Ga0207695_104660742 | 125 |
| 314 | 3300025917 | Ga0207660_10347940 | Ga0207660_103479401 | 125 |
| 315 | 3300025917 | Ga0207660_10584302 | Ga0207660_105843022 | 125 |
| 316 | 3300025918 | Ga0207662_11099122 | Ga0207662_110991221 | 125 |
| 317 | 3300025919 | Ga0207657_10000267 | Ga0207657_1000026725 | 125 |
| 318 | 3300025919 | Ga0207657_10001047 | Ga0207657_1000104710 | 125 |
| 319 | 3300025919 | Ga0207657_10002051 | Ga0207657_1000205124 | 125 |
| 320 | 3300025919 | Ga0207657_10006696 | Ga0207657_1000669611 | 125 |
| 321 | 3300025919 | Ga0207657_10007422 | Ga0207657_1000742212 | 125 |
| 322 | 3300025919 | Ga0207657_10012828 | Ga0207657_100128283 | 125 |
| 323 | 3300025919 | Ga0207657_10014570 | Ga0207657_1001457010 | 125 |
| 324 | 3300025919 | Ga0207657_10176813 | Ga0207657_101768132 | 125 |
| 325 | 3300025919 | Ga0207657_10340107 | Ga0207657_103401072 | 125 |
| 326 | 3300025919 | Ga0207657_10641486 | Ga0207657_106414861 | 125 |
| 327 | 3300025919 | Ga0207657_11136547 | Ga0207657_111365472 | 125 |
| 328 | 3300025920 | Ga0207649_10000035 | Ga0207649_10000035107 | 125 |
| 329 | 3300025920 | Ga0207649_10000883 | Ga0207649_100008833 | 125 |
| 330 | 3300025920 | Ga0207649_10024663 | Ga0207649_100246633 | 125 |
| 331 | 3300025920 | Ga0207649_10175925 | Ga0207649_101759251 | 125 |
| 332 | 3300025920 | Ga0207649_10684199 | Ga0207649_106841992 | 125 |
| 333 | 3300025920 | Ga0207649_10984161 | Ga0207649_109841612 | 125 |
| 334 | 3300025921 | Ga0207652_10000003 | Ga0207652_10000003469 | 125 |
| 335 | 3300025921 | Ga0207652_10003472 | Ga0207652_1000347214 | 125 |
| 336 | 3300025921 | Ga0207652_10077886 | Ga0207652_100778864 | 125 |
| 337 | 3300025921 | Ga0207652_10167542 | Ga0207652_101675424 | 125 |
| 338 | 3300025921 | Ga0207652_10393293 | Ga0207652_103932932 | 125 |
| 339 | 3300025921 | Ga0207652_11360386 | Ga0207652_113603861 | 125 |
| 340 | 3300025921 | Ga0207652_11762310 | Ga0207652_117623101 | 125 |
| 341 | 3300025922 | Ga0207646_10253259 | Ga0207646_102532593 | 125 |
| 342 | 3300025923 | Ga0207681_10011678 | Ga0207681_100116782 | 125 |
| 343 | 3300025923 | Ga0207681_10021928 | Ga0207681_100219287 | 125 |
| 344 | 3300025923 | Ga0207681_10035788 | Ga0207681_100357882 | 125 |
| 345 | 3300025923 | Ga0207681_10101263 | Ga0207681_101012633 | 125 |
| 346 | 3300025923 | Ga0207681_10109454 | Ga0207681_101094543 | 125 |
| 347 | 3300025923 | Ga0207681_10120914 | Ga0207681_101209142 | 125 |
| 348 | 3300025923 | Ga0207681_10245148 | Ga0207681_102451483 | 125 |
| 349 | 3300025923 | Ga0207681_10283158 | Ga0207681_102831582 | 125 |
| 350 | 3300025923 | Ga0207681_10365153 | Ga0207681_103651532 | 125 |
| 351 | 3300025923 | Ga0207681_10700767 | Ga0207681_107007672 | 125 |
| 352 | 3300025923 | Ga0207681_11449649 | Ga0207681_114496491 | 125 |
| 353 | 3300025924 | Ga0207694_10312398 | Ga0207694_103123982 | 125 |
| 354 | 3300025925 | Ga0207650_10001934 | Ga0207650_100019344 | 125 |
| 355 | 3300025925 | Ga0207650_10043272 | Ga0207650_100432722 | 125 |
| 356 | 3300025925 | Ga0207650_10062254 | Ga0207650_100622544 | 125 |
| 357 | 3300025925 | Ga0207650_10108624 | Ga0207650_101086243 | 125 |
| 358 | 3300025925 | Ga0207650_10770381 | Ga0207650_107703812 | 125 |
| 359 | 3300025926 | Ga0207659_10005238 | Ga0207659_100052383 | 125 |
| 360 | 3300025926 | Ga0207659_10034621 | Ga0207659_100346212 | 125 |
| 361 | 3300025926 | Ga0207659_10097944 | Ga0207659_100979443 | 125 |
| 362 | 3300025926 | Ga0207659_10203911 | Ga0207659_102039113 | 125 |
| 363 | 3300025926 | Ga0207659_10317329 | Ga0207659_103173292 | 125 |
| 364 | 3300025929 | Ga0207664_10075480 | Ga0207664_100754803 | 125 |
| 365 | 3300025931 | Ga0207644_10000139 | Ga0207644_1000013959 | 125 |
| 366 | 3300025931 | Ga0207644_10000941 | Ga0207644_100009412 | 125 |
| 367 | 3300025931 | Ga0207644_10011535 | Ga0207644_100115356 | 125 |
| 368 | 3300025931 | Ga0207644_10072575 | Ga0207644_100725751 | 125 |
| 369 | 3300025931 | Ga0207644_10306923 | Ga0207644_103069231 | 125 |
| 370 | 3300025932 | Ga0207690_10005772 | Ga0207690_100057723 | 125 |
| 371 | 3300025932 | Ga0207690_10024895 | Ga0207690_100248952 | 125 |
| 372 | 3300025932 | Ga0207690_10071454 | Ga0207690_100714541 | 125 |
| 373 | 3300025932 | Ga0207690_10203577 | Ga0207690_102035773 | 125 |
| 374 | 3300025932 | Ga0207690_10276295 | Ga0207690_102762952 | 125 |
| 375 | 3300025932 | Ga0207690_10385336 | Ga0207690_103853362 | 125 |
| 376 | 3300025932 | Ga0207690_11061535 | Ga0207690_110615352 | 125 |
| 377 | 3300025933 | Ga0207706_10015013 | Ga0207706_100150138 | 125 |
| 378 | 3300025933 | Ga0207706_10033791 | Ga0207706_100337915 | 125 |
| 379 | 3300025933 | Ga0207706_10040493 | Ga0207706_100404934 | 125 |
| 380 | 3300025933 | Ga0207706_10104641 | Ga0207706_101046412 | 125 |
| 381 | 3300025933 | Ga0207706_10156056 | Ga0207706_101560563 | 125 |
| 382 | 3300025933 | Ga0207706_10189547 | Ga0207706_101895471 | 125 |
| 383 | 3300025933 | Ga0207706_10338541 | Ga0207706_103385412 | 125 |
| 384 | 3300025935 | Ga0207709_10015890 | Ga0207709_100158903 | 125 |
| 385 | 3300025937 | Ga0207669_10053204 | Ga0207669_100532042 | 125 |
| 386 | 3300025937 | Ga0207669_10135403 | Ga0207669_101354033 | 125 |
| 387 | 3300025937 | Ga0207669_10649969 | Ga0207669_106499692 | 125 |
| 388 | 3300025937 | Ga0207669_10794792 | Ga0207669_107947922 | 125 |
| 389 | 3300025938 | Ga0207704_10797757 | Ga0207704_107977572 | 125 |
| 390 | 3300025940 | Ga0207691_10051024 | Ga0207691_100510243 | 125 |
| 391 | 3300025940 | Ga0207691_10058524 | Ga0207691_100585242 | 125 |
| 392 | 3300025940 | Ga0207691_10101086 | Ga0207691_101010862 | 125 |
| 393 | 3300025940 | Ga0207691_10145070 | Ga0207691_101450703 | 125 |
| 394 | 3300025940 | Ga0207691_10348873 | Ga0207691_103488732 | 125 |
| 395 | 3300025940 | Ga0207691_10684465 | Ga0207691_106844652 | 125 |
| 396 | 3300025941 | Ga0207711_10009643 | Ga0207711_100096433 | 125 |
| 397 | 3300025941 | Ga0207711_10196874 | Ga0207711_101968742 | 125 |
| 398 | 3300025945 | Ga0207679_10006872 | Ga0207679_100068723 | 125 |
| 399 | 3300025945 | Ga0207679_10064344 | Ga0207679_100643442 | 125 |
| 400 | 3300025945 | Ga0207679_10140178 | Ga0207679_101401782 | 125 |
| 401 | 3300025945 | Ga0207679_10140809 | Ga0207679_101408093 | 125 |
| 402 | 3300025945 | Ga0207679_10742734 | Ga0207679_107427342 | 125 |
| 403 | 3300025949 | Ga0207667_10007343 | Ga0207667_100073434 | 125 |
| 404 | 3300025949 | Ga0207667_10103026 | Ga0207667_101030263 | 125 |
| 405 | 3300025949 | Ga0207667_10119887 | Ga0207667_101198874 | 125 |
| 406 | 3300025949 | Ga0207667_10185042 | Ga0207667_101850422 | 125 |
| 407 | 3300025949 | Ga0207667_10408880 | Ga0207667_104088803 | 125 |
| 408 | 3300025949 | Ga0207667_10427562 | Ga0207667_104275623 | 125 |
| 409 | 3300025949 | Ga0207667_10518908 | Ga0207667_105189081 | 125 |
| 410 | 3300025960 | Ga0207651_10223256 | Ga0207651_102232562 | 125 |
| 411 | 3300025960 | Ga0207651_10292313 | Ga0207651_102923132 | 125 |
| 412 | 3300025960 | Ga0207651_10380190 | Ga0207651_103801902 | 125 |
| 413 | 3300025961 | Ga0207712_10387379 | Ga0207712_103873791 | 125 |
| 414 | 3300025972 | Ga0207668_10000012 | Ga0207668_10000012127 | 125 |
| 415 | 3300025972 | Ga0207668_10056154 | Ga0207668_100561542 | 125 |
| 416 | 3300025972 | Ga0207668_10119773 | Ga0207668_101197732 | 125 |
| 417 | 3300025972 | Ga0207668_10197567 | Ga0207668_101975672 | 125 |
| 418 | 3300025972 | Ga0207668_10376308 | Ga0207668_103763081 | 125 |
| 419 | 3300025972 | Ga0207668_11963297 | Ga0207668_119632971 | 125 |
| 420 | 3300025981 | Ga0207640_10001848 | Ga0207640_1000184811 | 125 |
| 421 | 3300025981 | Ga0207640_10017338 | Ga0207640_100173383 | 125 |
| 422 | 3300025981 | Ga0207640_10111506 | Ga0207640_101115062 | 125 |
| 423 | 3300025981 | Ga0207640_10127334 | Ga0207640_101273342 | 125 |
| 424 | 3300025981 | Ga0207640_10191732 | Ga0207640_101917322 | 125 |
| 425 | 3300025981 | Ga0207640_10528316 | Ga0207640_105283162 | 125 |
| 426 | 3300025986 | Ga0207658_10000011 | Ga0207658_10000011128 | 125 |
| 427 | 3300025986 | Ga0207658_10002199 | Ga0207658_100021999 | 125 |
| 428 | 3300025986 | Ga0207658_10830996 | Ga0207658_108309962 | 125 |
| 429 | 3300026023 | Ga0207677_10673209 | Ga0207677_106732092 | 125 |
| 430 | 3300026035 | Ga0207703_10000474 | Ga0207703_100004746 | 125 |
| 431 | 3300026035 | Ga0207703_10849837 | Ga0207703_108498372 | 125 |
| 432 | 3300026041 | Ga0207639_10125179 | Ga0207639_101251792 | 125 |
| 433 | 3300026041 | Ga0207639_10166856 | Ga0207639_101668563 | 125 |
| 434 | 3300026067 | Ga0207678_10000740 | Ga0207678_100007404 | 125 |
| 435 | 3300026067 | Ga0207678_10020475 | Ga0207678_100204752 | 125 |
| 436 | 3300026067 | Ga0207678_10091135 | Ga0207678_100911352 | 125 |
| 437 | 3300026067 | Ga0207678_10137931 | Ga0207678_101379314 | 125 |
| 438 | 3300026078 | Ga0207702_10014324 | Ga0207702_100143244 | 125 |
| 439 | 3300026078 | Ga0207702_10265240 | Ga0207702_102652403 | 125 |
| 440 | 3300026088 | Ga0207641_10000115 | Ga0207641_100001155 | 125 |
| 441 | 3300026088 | Ga0207641_10056518 | Ga0207641_100565182 | 125 |
| 442 | 3300026088 | Ga0207641_10157373 | Ga0207641_101573733 | 125 |
| 443 | 3300026088 | Ga0207641_11011083 | Ga0207641_110110832 | 125 |
| 444 | 3300026088 | Ga0207641_11589248 | Ga0207641_115892482 | 125 |
| 445 | 3300026089 | Ga0207648_10090261 | Ga0207648_100902612 | 125 |
| 446 | 3300026095 | Ga0207676_10034938 | Ga0207676_100349385 | 125 |
| 447 | 3300026095 | Ga0207676_10076556 | Ga0207676_100765563 | 125 |
| 448 | 3300026116 | Ga0207674_10018230 | Ga0207674_100182309 | 125 |
| 449 | 3300026116 | Ga0207674_10088834 | Ga0207674_100888343 | 125 |
| 450 | 3300026116 | Ga0207674_10180877 | Ga0207674_101808774 | 125 |
| 451 | 3300026116 | Ga0207674_10320405 | Ga0207674_103204051 | 125 |
| 452 | 3300026118 | Ga0207675_100019623 | Ga0207675_1000196232 | 125 |
| 453 | 3300026118 | Ga0207675_100033901 | Ga0207675_1000339015 | 125 |
| 454 | 3300026121 | Ga0207683_10202425 | Ga0207683_102024251 | 125 |
| 455 | 3300026121 | Ga0207683_10544541 | Ga0207683_105445412 | 125 |
| 456 | 3300026121 | Ga0207683_11179553 | Ga0207683_111795531 | 125 |
| 457 | 3300026142 | Ga0207698_10149250 | Ga0207698_101492502 | 125 |
| 458 | 3300026142 | Ga0207698_10255992 | Ga0207698_102559922 | 125 |
| 459 | 3300026142 | Ga0207698_10880600 | Ga0207698_108806002 | 125 |
| 460 | 3300027252 | Ga0209973_1067918 | Ga0209973_10679182 | 125 |
| 461 | 3300027552 | Ga0209982_1077435 | Ga0209982_10774351 | 125 |
| 462 | 3300027614 | Ga0209970_1028634 | Ga0209970_10286342 | 125 |
| 463 | 3300027665 | Ga0209983_1042697 | Ga0209983_10426972 | 125 |
| 464 | 3300027682 | Ga0209971_1050179 | Ga0209971_10501792 | 125 |
| 465 | 3300027682 | Ga0209971_1081903 | Ga0209971_10819032 | 125 |
| 466 | 3300027876 | Ga0209974_10004110 | Ga0209974_100041105 | 125 |
| 467 | 3300027876 | Ga0209974_10007757 | Ga0209974_100077572 | 125 |
| 468 | 3300027876 | Ga0209974_10049059 | Ga0209974_100490593 | 125 |
| 469 | 3300027876 | Ga0209974_10105958 | Ga0209974_101059581 | 125 |
| 470 | 3300027876 | Ga0209974_10157807 | Ga0209974_101578072 | 125 |
| 471 | 3300028379 | Ga0268266_10032486 | Ga0268266_100324862 | 125 |
| 472 | 3300028380 | Ga0268265_10000442 | Ga0268265_1000044240 | 125 |
| 473 | 3300028380 | Ga0268265_10177402 | Ga0268265_101774022 | 125 |
| 474 | 3300028381 | Ga0268264_10000089 | Ga0268264_10000089122 | 125 |
| 475 | 3300030731 | Ga0316177_1184625 | Ga0316177_11846252 | 125 |
| 476 | 3300030731 | Ga0316177_1200840 | Ga0316177_12008402 | 125 |
| 477 | 3300030745 | Ga0316182_1365612 | Ga0316182_13656122 | 125 |
| 478 | 3300030745 | Ga0316182_1391070 | Ga0316182_13910702 | 125 |
| 479 | 3300031548 | Ga0307408_100007529 | Ga0307408_1000075293 | 125 |
| 480 | 3300031548 | Ga0307408_100049188 | Ga0307408_1000491882 | 125 |
| 481 | 3300031548 | Ga0307408_100063963 | Ga0307408_1000639632 | 125 |
| 482 | 3300031548 | Ga0307408_100104222 | Ga0307408_1001042222 | 125 |
| 483 | 3300031548 | Ga0307408_100135353 | Ga0307408_1001353532 | 125 |
| 484 | 3300031548 | Ga0307408_100198202 | Ga0307408_1001982022 | 125 |
| 485 | 3300031548 | Ga0307408_100440006 | Ga0307408_1004400062 | 125 |
| 486 | 3300031548 | Ga0307408_100702090 | Ga0307408_1007020902 | 125 |
| 487 | 3300031548 | Ga0307408_100709040 | Ga0307408_1007090402 | 125 |
| 488 | 3300031548 | Ga0307408_101130903 | Ga0307408_1011309032 | 125 |
| 489 | 3300031731 | Ga0307405_10007002 | Ga0307405_100070022 | 125 |
| 490 | 3300031731 | Ga0307405_10010274 | Ga0307405_100102742 | 125 |
| 491 | 3300031731 | Ga0307405_10070544 | Ga0307405_100705442 | 125 |
| 492 | 3300031731 | Ga0307405_10102744 | Ga0307405_101027443 | 125 |
| 493 | 3300031731 | Ga0307405_10157583 | Ga0307405_101575832 | 125 |
| 494 | 3300031731 | Ga0307405_10312412 | Ga0307405_103124122 | 125 |
| 495 | 3300031731 | Ga0307405_10347084 | Ga0307405_103470842 | 125 |
| 496 | 3300031731 | Ga0307405_10412948 | Ga0307405_104129481 | 125 |
| 497 | 3300031731 | Ga0307405_10649176 | Ga0307405_106491762 | 125 |
| 498 | 3300031731 | Ga0307405_10833162 | Ga0307405_108331621 | 125 |
| 499 | 3300031731 | Ga0307405_11792826 | Ga0307405_117928262 | 125 |
| 500 | 3300031824 | Ga0307413_10005000 | Ga0307413_100050002 | 125 |
| 501 | 3300031824 | Ga0307413_10009008 | Ga0307413_100090082 | 125 |
| 502 | 3300031824 | Ga0307413_10016659 | Ga0307413_100166592 | 125 |
| 503 | 3300031824 | Ga0307413_10016920 | Ga0307413_100169205 | 125 |
| 504 | 3300031824 | Ga0307413_10070717 | Ga0307413_100707172 | 125 |
| 505 | 3300031824 | Ga0307413_10111440 | Ga0307413_101114402 | 125 |
| 506 | 3300031824 | Ga0307413_10141264 | Ga0307413_101412642 | 125 |
| 507 | 3300031824 | Ga0307413_10159596 | Ga0307413_101595963 | 125 |
| 508 | 3300031824 | Ga0307413_10211221 | Ga0307413_102112211 | 125 |
| 509 | 3300031824 | Ga0307413_10252342 | Ga0307413_102523422 | 125 |
| 510 | 3300031824 | Ga0307413_10353033 | Ga0307413_103530332 | 125 |
| 511 | 3300031824 | Ga0307413_10410158 | Ga0307413_104101582 | 125 |
| 512 | 3300031824 | Ga0307413_10803956 | Ga0307413_108039562 | 125 |
| 513 | 3300031824 | Ga0307413_11022410 | Ga0307413_110224102 | 125 |
| 514 | 3300031824 | Ga0307413_11713677 | Ga0307413_117136771 | 125 |
| 515 | 3300031824 | Ga0307413_11887974 | Ga0307413_118879741 | 125 |
| 516 | 3300031824 | Ga0307413_12183398 | Ga0307413_121833981 | 125 |
| 517 | 3300031852 | Ga0307410_10005310 | Ga0307410_100053107 | 125 |
| 518 | 3300031852 | Ga0307410_10007253 | Ga0307410_100072537 | 125 |
| 519 | 3300031852 | Ga0307410_10012139 | Ga0307410_100121397 | 125 |
| 520 | 3300031852 | Ga0307410_10013692 | Ga0307410_100136921 | 125 |
| 521 | 3300031852 | Ga0307410_10032983 | Ga0307410_100329833 | 125 |
| 522 | 3300031852 | Ga0307410_10062654 | Ga0307410_100626542 | 125 |
| 523 | 3300031852 | Ga0307410_10138879 | Ga0307410_101388792 | 125 |
| 524 | 3300031852 | Ga0307410_10157463 | Ga0307410_101574632 | 125 |
| 525 | 3300031852 | Ga0307410_10160659 | Ga0307410_101606593 | 125 |
| 526 | 3300031852 | Ga0307410_10161892 | Ga0307410_101618922 | 125 |
| 527 | 3300031852 | Ga0307410_10203006 | Ga0307410_102030062 | 125 |
| 528 | 3300031852 | Ga0307410_10295103 | Ga0307410_102951032 | 125 |
| 529 | 3300031852 | Ga0307410_10386639 | Ga0307410_103866392 | 125 |
| 530 | 3300031852 | Ga0307410_10463528 | Ga0307410_104635282 | 125 |
| 531 | 3300031852 | Ga0307410_10497042 | Ga0307410_104970422 | 125 |
| 532 | 3300031852 | Ga0307410_10690560 | Ga0307410_106905602 | 125 |
| 533 | 3300031852 | Ga0307410_11041606 | Ga0307410_110416062 | 125 |
| 534 | 3300031901 | Ga0307406_10001811 | Ga0307406_100018112 | 125 |
| 535 | 3300031901 | Ga0307406_10046094 | Ga0307406_100460943 | 125 |
| 536 | 3300031901 | Ga0307406_10062115 | Ga0307406_100621152 | 125 |
| 537 | 3300031901 | Ga0307406_10062434 | Ga0307406_100624342 | 125 |
| 538 | 3300031901 | Ga0307406_10129411 | Ga0307406_101294113 | 125 |
| 539 | 3300031901 | Ga0307406_10186116 | Ga0307406_101861163 | 125 |
| 540 | 3300031901 | Ga0307406_10266902 | Ga0307406_102669022 | 125 |
| 541 | 3300031901 | Ga0307406_10476926 | Ga0307406_104769261 | 125 |
| 542 | 3300031903 | Ga0307407_10003820 | Ga0307407_100038207 | 125 |
| 543 | 3300031903 | Ga0307407_10009943 | Ga0307407_100099432 | 125 |
| 544 | 3300031903 | Ga0307407_10047675 | Ga0307407_100476752 | 125 |
| 545 | 3300031903 | Ga0307407_10088091 | Ga0307407_100880914 | 125 |
| 546 | 3300031903 | Ga0307407_10113279 | Ga0307407_101132792 | 125 |
| 547 | 3300031903 | Ga0307407_10128551 | Ga0307407_101285512 | 125 |
| 548 | 3300031903 | Ga0307407_10421815 | Ga0307407_104218152 | 125 |
| 549 | 3300031903 | Ga0307407_10444656 | Ga0307407_104446562 | 125 |
| 550 | 3300031903 | Ga0307407_10484726 | Ga0307407_104847261 | 125 |
| 551 | 3300031903 | Ga0307407_10506759 | Ga0307407_105067591 | 125 |
| 552 | 3300031903 | Ga0307407_10840137 | Ga0307407_108401372 | 125 |
| 553 | 3300031911 | Ga0307412_10012591 | Ga0307412_100125914 | 125 |
| 554 | 3300031911 | Ga0307412_10032077 | Ga0307412_100320772 | 125 |
| 555 | 3300031911 | Ga0307412_10049840 | Ga0307412_100498402 | 125 |
| 556 | 3300031911 | Ga0307412_10050782 | Ga0307412_100507822 | 125 |
| 557 | 3300031911 | Ga0307412_10439102 | Ga0307412_104391022 | 125 |
| 558 | 3300031911 | Ga0307412_10958731 | Ga0307412_109587312 | 125 |
| 559 | 3300031995 | Ga0307409_100005057 | Ga0307409_1000050574 | 125 |
| 560 | 3300031995 | Ga0307409_100006744 | Ga0307409_1000067442 | 125 |
| 561 | 3300031995 | Ga0307409_100023772 | Ga0307409_1000237722 | 125 |
| 562 | 3300031995 | Ga0307409_100094437 | Ga0307409_1000944373 | 125 |
| 563 | 3300031995 | Ga0307409_100154511 | Ga0307409_1001545112 | 125 |
| 564 | 3300031995 | Ga0307409_100191240 | Ga0307409_1001912403 | 125 |
| 565 | 3300031995 | Ga0307409_100279010 | Ga0307409_1002790102 | 125 |
| 566 | 3300031995 | Ga0307409_100298139 | Ga0307409_1002981392 | 125 |
| 567 | 3300031995 | Ga0307409_100321871 | Ga0307409_1003218712 | 125 |
| 568 | 3300031995 | Ga0307409_100389879 | Ga0307409_1003898792 | 125 |
| 569 | 3300031995 | Ga0307409_100493290 | Ga0307409_1004932903 | 125 |
| 570 | 3300031995 | Ga0307409_100507196 | Ga0307409_1005071963 | 125 |
| 571 | 3300031995 | Ga0307409_100550341 | Ga0307409_1005503412 | 125 |
| 572 | 3300031995 | Ga0307409_100664535 | Ga0307409_1006645352 | 125 |
| 573 | 3300031995 | Ga0307409_100785741 | Ga0307409_1007857412 | 125 |
| 574 | 3300031995 | Ga0307409_100807718 | Ga0307409_1008077181 | 125 |
| 575 | 3300031995 | Ga0307409_101645627 | Ga0307409_1016456272 | 125 |
| 576 | 3300032002 | Ga0307416_100005270 | Ga0307416_1000052702 | 125 |
| 577 | 3300032002 | Ga0307416_100013797 | Ga0307416_1000137972 | 125 |
| 578 | 3300032002 | Ga0307416_100028520 | Ga0307416_1000285202 | 125 |
| 579 | 3300032002 | Ga0307416_100079022 | Ga0307416_1000790223 | 125 |
| 580 | 3300032002 | Ga0307416_100155917 | Ga0307416_1001559173 | 125 |
| 581 | 3300032002 | Ga0307416_100196172 | Ga0307416_1001961722 | 125 |
| 582 | 3300032002 | Ga0307416_100247633 | Ga0307416_1002476332 | 125 |
| 583 | 3300032002 | Ga0307416_100258564 | Ga0307416_1002585642 | 125 |
| 584 | 3300032002 | Ga0307416_100337652 | Ga0307416_1003376522 | 125 |
| 585 | 3300032002 | Ga0307416_100443765 | Ga0307416_1004437651 | 125 |
| 586 | 3300032002 | Ga0307416_100610961 | Ga0307416_1006109612 | 125 |
| 587 | 3300032002 | Ga0307416_100784535 | Ga0307416_1007845352 | 125 |
| 588 | 3300032002 | Ga0307416_100943147 | Ga0307416_1009431471 | 125 |
| 589 | 3300032002 | Ga0307416_101912445 | Ga0307416_1019124451 | 125 |
| 590 | 3300032004 | Ga0307414_10013759 | Ga0307414_100137595 | 125 |
| 591 | 3300032004 | Ga0307414_10020128 | Ga0307414_100201284 | 125 |
| 592 | 3300032004 | Ga0307414_10023012 | Ga0307414_100230126 | 125 |
| 593 | 3300032004 | Ga0307414_10026600 | Ga0307414_100266003 | 125 |
| 594 | 3300032004 | Ga0307414_10091425 | Ga0307414_100914253 | 125 |
| 595 | 3300032004 | Ga0307414_10093212 | Ga0307414_100932123 | 125 |
| 596 | 3300032004 | Ga0307414_10110369 | Ga0307414_101103692 | 125 |
| 597 | 3300032004 | Ga0307414_10194175 | Ga0307414_101941752 | 125 |
| 598 | 3300032004 | Ga0307414_10197844 | Ga0307414_101978443 | 125 |
| 599 | 3300032004 | Ga0307414_10276676 | Ga0307414_102766763 | 125 |
| 600 | 3300032004 | Ga0307414_10486391 | Ga0307414_104863912 | 125 |
| 601 | 3300032004 | Ga0307414_10628157 | Ga0307414_106281572 | 125 |
| 602 | 3300032004 | Ga0307414_10668114 | Ga0307414_106681142 | 125 |
| 603 | 3300032004 | Ga0307414_10697660 | Ga0307414_106976602 | 125 |
| 604 | 3300032004 | Ga0307414_10815686 | Ga0307414_108156861 | 125 |
| 605 | 3300032004 | Ga0307414_11277706 | Ga0307414_112777062 | 125 |
| 606 | 3300032004 | Ga0307414_11543583 | Ga0307414_115435831 | 125 |
| 607 | 3300032004 | Ga0307414_12006670 | Ga0307414_120066701 | 125 |
| 608 | 3300032005 | Ga0307411_10002032 | Ga0307411_100020329 | 125 |
| 609 | 3300032005 | Ga0307411_10006937 | Ga0307411_100069372 | 125 |
| 610 | 3300032005 | Ga0307411_10007469 | Ga0307411_100074694 | 125 |
| 611 | 3300032005 | Ga0307411_10046726 | Ga0307411_100467262 | 125 |
| 612 | 3300032005 | Ga0307411_10048566 | Ga0307411_100485662 | 125 |
| 613 | 3300032005 | Ga0307411_10074659 | Ga0307411_100746593 | 125 |
| 614 | 3300032005 | Ga0307411_10129911 | Ga0307411_101299113 | 125 |
| 615 | 3300032005 | Ga0307411_10168858 | Ga0307411_101688583 | 125 |
| 616 | 3300032005 | Ga0307411_10200966 | Ga0307411_102009662 | 125 |
| 617 | 3300032005 | Ga0307411_10206657 | Ga0307411_102066572 | 125 |
| 618 | 3300032005 | Ga0307411_10241681 | Ga0307411_102416812 | 125 |
| 619 | 3300032005 | Ga0307411_10306715 | Ga0307411_103067152 | 125 |
| 620 | 3300032005 | Ga0307411_10364325 | Ga0307411_103643252 | 125 |
| 621 | 3300032005 | Ga0307411_10384293 | Ga0307411_103842932 | 125 |
| 622 | 3300032005 | Ga0307411_10413587 | Ga0307411_104135872 | 125 |
| 623 | 3300032005 | Ga0307411_10584973 | Ga0307411_105849732 | 125 |
| 624 | 3300032005 | Ga0307411_10712577 | Ga0307411_107125772 | 125 |
| 625 | 3300032005 | Ga0307411_10860677 | Ga0307411_108606771 | 125 |
| 626 | 3300032126 | Ga0307415_100009001 | Ga0307415_1000090012 | 125 |
| 627 | 3300032126 | Ga0307415_100013739 | Ga0307415_1000137393 | 125 |
| 628 | 3300032126 | Ga0307415_100013925 | Ga0307415_1000139252 | 125 |
| 629 | 3300032126 | Ga0307415_100065000 | Ga0307415_1000650003 | 125 |
| 630 | 3300032126 | Ga0307415_100101036 | Ga0307415_1001010363 | 125 |
| 631 | 3300032126 | Ga0307415_100153265 | Ga0307415_1001532652 | 125 |
| 632 | 3300032126 | Ga0307415_100209278 | Ga0307415_1002092781 | 125 |
| 633 | 3300032126 | Ga0307415_100300570 | Ga0307415_1003005702 | 125 |
| 634 | 3300032126 | Ga0307415_100686819 | Ga0307415_1006868191 | 125 |
| 635 | 3300032126 | Ga0307415_100825192 | Ga0307415_1008251921 | 125 |
| 636 | 3300032126 | Ga0307415_101163762 | Ga0307415_1011637622 | 125 |
| 637 | 3300032126 | Ga0307415_101322525 | Ga0307415_1013225252 | 125 |
| 638 | 3300032126 | Ga0307415_101351977 | Ga0307415_1013519771 | 125 |
| 639 | 3300032126 | Ga0307415_101754814 | Ga0307415_1017548141 | 125 |
| 640 | 3300032126 | Ga0307415_101946123 | Ga0307415_1019461231 | 125 |
| 641 | 3300035691 | Ga0373931_0632614 | Ga0373931_0632614_249_626 | 125 |
| 642 | 3300036712 | Ga0316584_0098934 | Ga0316584_0098934_1677_2054 | 125 |
| 643 | 3300037312 | Ga0395899_0001291 | Ga0395899_0001291_8591_8968 | 125 |
| 644 | 3300037312 | Ga0395899_0006055 | Ga0395899_0006055_2667_3044 | 125 |
| 645 | 3300037312 | Ga0395899_0008125 | Ga0395899_0008125_5301_5678 | 125 |
| 646 | 3300037312 | Ga0395899_0009620 | Ga0395899_0009620_57_434 | 125 |
| 647 | 3300037312 | Ga0395899_0051014 | Ga0395899_0051014_480_857 | 125 |
| 648 | 3300037312 | Ga0395899_0478449 | Ga0395899_0478449_255_632 | 125 |
| 649 | 3300037418 | Ga0395900_0000447 | Ga0395900_0000447_36863_37240 | 125 |
| 650 | 3300037418 | Ga0395900_0048606 | Ga0395900_0048606_2074_2451 | 125 |
| 651 | 3300037418 | Ga0395900_0192214 | Ga0395900_0192214_641_1018 | 125 |
| 652 | 3300037418 | Ga0395900_0201328 | Ga0395900_0201328_283_660 | 125 |
| 653 | 3300037418 | Ga0395900_0207807 | Ga0395900_0207807_732_1109 | 125 |
| 654 | 3300037418 | Ga0395900_0281463 | Ga0395900_0281463_147_530 | 125 |
| 655 | 3300037418 | Ga0395900_0475149 | Ga0395900_0475149_775_1152 | 125 |
| 656 | 3300037418 | Ga0395900_0710973 | Ga0395900_0710973_300_677 | 125 |
| 657 | 3300037418 | Ga0395900_1111318 | Ga0395900_1111318_36_413 | 125 |
| 658 | 3300037466 | Ga0395898_0003866 | Ga0395898_0003866_4572_4949 | 125 |
| 659 | 3300037466 | Ga0395898_0014584 | Ga0395898_0014584_6930_7307 | 125 |
| 660 | 3300037466 | Ga0395898_0029335 | Ga0395898_0029335_2617_2994 | 125 |
| 661 | 3300037466 | Ga0395898_0040457 | Ga0395898_0040457_1919_2296 | 125 |
| 662 | 3300037466 | Ga0395898_0112915 | Ga0395898_0112915_732_1109 | 125 |
| 663 | 3300037466 | Ga0395898_0974013 | Ga0395898_0974013_346_723 | 125 |
| 664 | 3300037466 | Ga0395898_1745589 | Ga0395898_1745589_97_474 | 125 |
| 665 | 3300037471 | Ga0395905_0048408 | Ga0395905_0048408_153_530 | 125 |
| 666 | 3300037471 | Ga0395905_0064672 | Ga0395905_0064672_2478_2855 | 125 |
| 667 | 3300037471 | Ga0395905_0146194 | Ga0395905_0146194_629_1006 | 125 |
| 668 | 3300037471 | Ga0395905_0283835 | Ga0395905_0283835_390_767 | 125 |
| 669 | 3300037471 | Ga0395905_0595391 | Ga0395905_0595391_336_713 | 125 |
| 670 | 3300038443 | Ga0395901_0000324 | Ga0395901_0000324_36895_37272 | 125 |
| 671 | 3300038443 | Ga0395901_0082614 | Ga0395901_0082614_2882_3259 | 125 |
| 672 | 3300038443 | Ga0395901_0095428 | Ga0395901_0095428_1759_2136 | 125 |
| 673 | 3300038443 | Ga0395901_0117493 | Ga0395901_0117493_2074_2451 | 125 |
| 674 | 3300038443 | Ga0395901_0173346 | Ga0395901_0173346_1377_1754 | 125 |
| 675 | 3300038443 | Ga0395901_0207220 | Ga0395901_0207220_563_940 | 125 |
| 676 | 3300038443 | Ga0395901_0314867 | Ga0395901_0314867_774_1157 | 125 |
| 677 | 3300038443 | Ga0395901_0728050 | Ga0395901_0728050_552_929 | 125 |
| 678 | 3300038443 | Ga0395901_0817684 | Ga0395901_0817684_148_525 | 125 |
| 679 | 3300038443 | Ga0395901_0911409 | Ga0395901_0911409_357_734 | 125 |
| 680 | 3300038443 | Ga0395901_1495104 | Ga0395901_1495104_145_522 | 125 |
| 681 | 3300038443 | Ga0395901_1724639 | Ga0395901_1724639_156_533 | 125 |
| 682 | 3300038705 | Ga0237819_01073 | Ga0237819_01073_3099_3476 | 125 |
| 683 | 3300039145 | Ga0237816_00317 | Ga0237816_00317_828_1205 | 125 |
| 684 | 3300039437 | Ga0436365_0821190 | Ga0436365_0821190_695_1072 | 125 |
| 685 | 3300041404 | Ga0439436_0102831 | Ga0439436_0102831_189_566 | 125 |
| 686 | 3300041410 | Ga0439461_0132397 | Ga0439461_0132397_85_462 | 125 |
| 687 | 3300041413 | Ga0439465_0091417 | Ga0439465_0091417_397_774 | 125 |
| 688 | 3300041413 | Ga0439465_0406122 | Ga0439465_0406122_115_492 | 125 |
| 689 | 3300041451 | Ga0451791_1297277 | Ga0451791_1297277_163_540 | 125 |
| 690 | 3300041486 | Ga0451807_0700907 | Ga0451807_0700907_412_789 | 125 |
| 691 | 3300041496 | Ga0451839_1017143 | Ga0451839_1017143_121_498 | 125 |
| 692 | 3300041512 | Ga0451853_3500119 | Ga0451853_3500119_1198_1575 | 125 |
| 693 | 3300041997 | Ga0439431_0019707 | Ga0439431_0019707_705_1082 | 125 |
| 694 | 3300042000 | Ga0439437_003145 | Ga0439437_003145_853_1230 | 125 |
| 695 | 3300042002 | Ga0439442_035210 | Ga0439442_035210_24_401 | 125 |
| 696 | 3300042002 | Ga0439442_052509 | Ga0439442_052509_123_500 | 125 |
| 697 | 3300042003 | Ga0439443_006941 | Ga0439443_006941_731_1108 | 125 |
| 698 | 3300042004 | Ga0439445_0053200 | Ga0439445_0053200_13_390 | 125 |
| 699 | 3300042006 | Ga0439432_089397 | Ga0439432_089397_533_910 | 125 |
| 700 | 3300042007 | Ga0439449_0027057 | Ga0439449_0027057_1717_2094 | 125 |
| 701 | 3300042014 | Ga0439457_009705 | Ga0439457_009705_232_627 | 125 |
| 702 | 3300042015 | Ga0439462_0001208 | Ga0439462_0001208_4596_4973 | 125 |
| 703 | 3300042015 | Ga0439462_0008646 | Ga0439462_0008646_2120_2497 | 125 |
| 704 | 3300042015 | Ga0439462_0056879 | Ga0439462_0056879_449_889 | 125 |
| 705 | 3300042116 | Ga0450912_001672 | Ga0450912_001672_833_1210 | 125 |
| 706 | 3300042132 | Ga0450895_014404 | Ga0450895_014404_223_600 | 125 |
| 707 | 3300042145 | Ga0450906_040534 | Ga0450906_040534_427_804 | 125 |
| 708 | 3300042147 | Ga0450910_048457 | Ga0450910_048457_147_524 | 125 |
| 709 | 3300042156 | Ga0439446_0107761 | Ga0439446_0107761_497_874 | 125 |
| 710 | 3300042531 | Ga0450918_067659 | Ga0450918_067659_175_552 | 125 |
| 711 | 3300042876 | Ga0451577_0169758 | Ga0451577_0169758_741_1118 | 125 |
| 712 | 3300044656 | Ga0466969_0011722 | Ga0466969_0011722_1323_1700 | 125 |
| 713 | 3300044684 | Ga0466966_0000077 | Ga0466966_0000077_2598_2975 | 125 |
| 714 | 3300044684 | Ga0466966_0017763 | Ga0466966_0017763_3872_4249 | 125 |
| 715 | 3300044693 | Ga0466961_0174410 | Ga0466961_0174410_298_675 | 125 |
| 716 | 3300044694 | Ga0466963_0039815 | Ga0466963_0039815_987_1364 | 125 |
| 717 | 3300044694 | Ga0466963_0098772 | Ga0466963_0098772_517_894 | 125 |
| 718 | 3300044694 | Ga0466963_0732976 | Ga0466963_0732976_215_592 | 125 |
| 719 | 3300044694 | Ga0466963_1203584 | Ga0466963_1203584_11_388 | 125 |
| 720 | 3300044719 | Ga0466971_0004154 | Ga0466971_0004154_2948_3325 | 125 |
| 721 | 3300044765 | Ga0466970_0019762 | Ga0466970_0019762_1547_1924 | 125 |
| 722 | 3300044842 | Ga0466957_0042009 | Ga0466957_0042009_720_1097 | 125 |
| 723 | 3300045051 | Ga0451576_2339543 | Ga0451576_2339543_120_497 | 125 |
| 724 | 3300045836 | Ga0466958_0186073 | Ga0466958_0186073_25_402 | 125 |
| 725 | 3300045976 | Ga0466967_0092111 | Ga0466967_0092111_981_1358 | 125 |
| 726 | 3300046453 | Ga0495627_151198 | Ga0495627_151198_20_397 | 125 |
| 727 | 3300046457 | Ga0495590_0093488 | Ga0495590_0093488_521_898 | 125 |
| 728 | 3300046492 | Ga0495585_0143699 | Ga0495585_0143699_527_904 | 125 |
| 729 | 3300046492 | Ga0495585_0220578 | Ga0495585_0220578_284_661 | 125 |
| 730 | 3300046515 | Ga0495620_0119038 | Ga0495620_0119038_262_639 | 125 |
| 731 | 3300046525 | Ga0495663_0000982 | Ga0495663_0000982_864_1241 | 125 |
| 732 | 3300046528 | Ga0495642_0033149 | Ga0495642_0033149_171_548 | 125 |
| 733 | 3300046537 | Ga0495598_0000608 | Ga0495598_0000608_4775_5152 | 125 |
| 734 | 3300046537 | Ga0495598_0019081 | Ga0495598_0019081_92_469 | 125 |
| 735 | 3300046537 | Ga0495598_0291928 | Ga0495598_0291928_57_434 | 125 |
| 736 | 3300046539 | Ga0495621_0001412 | Ga0495621_0001412_2889_3266 | 125 |
| 737 | 3300046558 | Ga0495633_0004598 | Ga0495633_0004598_5778_6155 | 125 |
| 738 | 3300046615 | Ga0495656_0069667 | Ga0495656_0069667_831_1208 | 125 |
| 739 | 3300046616 | Ga0495668_0036991 | Ga0495668_0036991_836_1213 | 125 |
| 740 | 3300046684 | Ga0495669_0000720 | Ga0495669_0000720_3751_4128 | 125 |
| 741 | 3300046684 | Ga0495669_0025981 | Ga0495669_0025981_1546_1923 | 125 |
| 742 | 3300046691 | Ga0495670_0004022 | Ga0495670_0004022_4051_4428 | 125 |
| 743 | 3300046691 | Ga0495670_0148279 | Ga0495670_0148279_255_632 | 125 |
| 744 | 3300046691 | Ga0495670_0165353 | Ga0495670_0165353_516_902 | 125 |
| 745 | 3300047445 | Ga0495677_0002624 | Ga0495677_0002624_189_566 | 125 |
| 746 | 3300047470 | Ga0495681_0173254 | Ga0495681_0173254_49_426 | 125 |
| 747 | 3300048904 | Ga0496101_0451971 | Ga0496101_0451971_194_571 | 125 |
| 748 | 3300048904 | Ga0496101_1049936 | Ga0496101_1049936_169_546 | 125 |
| 749 | 3300048905 | Ga0496102_0548629 | Ga0496102_0548629_476_853 | 125 |
| 750 | 3300048910 | Ga0496107_0091378 | Ga0496107_0091378_122_499 | 125 |
| 751 | 3300048912 | Ga0496109_0029263 | Ga0496109_0029263_901_1278 | 125 |
| 752 | 3300048912 | Ga0496109_0327980 | Ga0496109_0327980_312_689 | 125 |
| 753 | 3300048912 | Ga0496109_0431124 | Ga0496109_0431124_747_1124 | 125 |
| 754 | 3300048913 | Ga0496110_0020611 | Ga0496110_0020611_3359_3736 | 125 |
| 755 | 3300048913 | Ga0496110_0385532 | Ga0496110_0385532_303_680 | 125 |
| 756 | 3300048913 | Ga0496110_0496755 | Ga0496110_0496755_402_779 | 125 |
| 757 | 3300048913 | Ga0496110_1386854 | Ga0496110_1386854_70_447 | 125 |
| 758 | 3300048914 | Ga0496111_0004026 | Ga0496111_0004026_747_1124 | 125 |
| 759 | 3300048914 | Ga0496111_0038086 | Ga0496111_0038086_368_745 | 125 |
| 760 | 3300048914 | Ga0496111_0543425 | Ga0496111_0543425_293_670 | 125 |
| 761 | 3300048917 | Ga0496114_0007166 | Ga0496114_0007166_7789_8166 | 125 |
| 762 | 3300048917 | Ga0496114_0026588 | Ga0496114_0026588_1894_2271 | 125 |
| 763 | 3300048917 | Ga0496114_0051027 | Ga0496114_0051027_1089_1466 | 125 |
| 764 | 3300048924 | Ga0496121_0000201 | Ga0496121_0000201_124680_125057 | 125 |
| 765 | 3300049459 | Ga0495678_053954 | Ga0495678_053954_363_740 | 125 |
| 766 | 3300049571 | Ga0501034_0897926 | Ga0501034_0897926_315_692 | 125 |
| 767 | 3300049572 | Ga0501036_1392663 | Ga0501036_1392663_90_467 | 125 |
| 768 | 3300049575 | Ga0501039_0256191 | Ga0501039_0256191_217_594 | 125 |
| 769 | 3300049580 | Ga0501046_0630292 | Ga0501046_0630292_162_539 | 125 |
| 770 | 3300049581 | Ga0501047_0324564 | Ga0501047_0324564_675_1052 | 125 |
| 771 | 3300049661 | Ga0501217_020403 | Ga0501217_020403_86_463 | 125 |
| 772 | 3300049663 | Ga0501223_064886 | Ga0501223_064886_245_622 | 125 |
| 773 | 3300049665 | Ga0501227_124218 | Ga0501227_124218_182_559 | 125 |
| 774 | 3300049668 | Ga0501233_105980 | Ga0501233_105980_93_470 | 125 |
| 775 | 3300049674 | Ga0501242_075081 | Ga0501242_075081_61_438 | 125 |
| 776 | 3300049680 | Ga0501250_029957 | Ga0501250_029957_333_710 | 125 |
| 777 | 3300049705 | Ga0501225_0163585 | Ga0501225_0163585_261_638 | 125 |
| 778 | 3300049705 | Ga0501225_0178328 | Ga0501225_0178328_56_433 | 125 |
| 779 | 3300049765 | Ga0501268_058719 | Ga0501268_058719_84_461 | 125 |
| 780 | 3300049767 | Ga0501270_014900 | Ga0501270_014900_61_438 | 125 |
| 781 | 3300049822 | Ga0501035_1088166 | Ga0501035_1088166_120_497 | 125 |
| 782 | 3300049822 | Ga0501035_1496565 | Ga0501035_1496565_29_406 | 125 |
| 783 | 3300049823 | Ga0501044_0398716 | Ga0501044_0398716_834_1211 | 125 |
| 784 | 3300053087 | Ga0500643_009425 | Ga0500643_009425_2663_3040 | 125 |
| 785 | 3300053094 | Ga0500566_0001993 | Ga0500566_0001993_4610_4987 | 125 |
| 786 | 3300053103 | Ga0500555_059971 | Ga0500555_059971_256_633 | 125 |
| 787 | 3300053134 | Ga0500658_0085828 | Ga0500658_0085828_199_576 | 125 |
| 788 | 3300053136 | Ga0500559_0134801 | Ga0500559_0134801_383_760 | 125 |
| 789 | 3300053139 | Ga0500568_0382910 | Ga0500568_0382910_103_480 | 125 |
| 790 | 3300053142 | Ga0500577_0268216 | Ga0500577_0268216_170_547 | 125 |
| 791 | 3300053146 | Ga0500588_0020709 | Ga0500588_0020709_556_933 | 125 |
| 792 | 3300053151 | Ga0500604_0222523 | Ga0500604_0222523_132_509 | 125 |
| 793 | 3300054114 | Ga0501084_1508003 | Ga0501084_1508003_139_516 | 125 |
| 794 | 3300059426 | Ga0590077_044978 | Ga0590077_044978_583_960 | 125 |
| 795 | 3300061719 | Ga0466962_0002042 | Ga0466962_0002042_7987_8364 | 125 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3omf-assembly1.cif.gz_A | crystal structure of a histidine triad family protein from entamoeba histolytica, bound to amp | 0.9105 | 14 | 120 |
| 6ypx-assembly1.cif.gz_AAA | human histidine triad nucleotide-binding protein 2 (hhint2) refined to 2.11 a in c2221 space group | 0.9014 | 14 | 119 |
| 6yqd-assembly1.cif.gz_AAA | human histidine triad nucleotide-binding protein 2 (hhint2) refined to 1.41 a in p212121 space group | 0.8955 | 23 | 119 |
| 1y23-assembly3.cif.gz_E | crystal structure of a member of hit family of proteins from bacillus subtilis | 0.8922 | 12 | 115 |
| 4zgl-assembly2.cif.gz_D | hit like protein | 0.8902 | 12 | 117 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3oxkA00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9091 | 11 | 120 | 3.30.428.10 |
| 1y23A00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.8935 | 12 | 115 | 3.30.428.10 |
| 4q61B00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.8931 | 12 | 117 | 3.30.428.10 |
| 4njyA00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.8904 | 27 | 119 | 3.30.428.10 |
| 4q61B00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.8849 | 12 | 117 | 3.30.428.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A845SAR8-F1-model_v4 | HIT domain-containing protein | 1.003 | 9 | 82 |
GO:0003824
|
| AF-A0A3D3V702-F1-model_v4 | Histidine triad nucleotide-binding protein | 0.9956 | 7 | 92 |
GO:0003824
|
| AF-A0A3D3V702-F1-model_v4 | Histidine triad nucleotide-binding protein | 0.9842 | 7 | 92 |
GO:0003824
|
| AF-A0A7Y7CP82-F1-model_v4 | Histidine triad nucleotide-binding protein | 0.9839 | 7 | 110 |
GO:0003824
|
| AF-A0A845S519-F1-model_v4 | Histidine triad nucleotide-binding protein | 0.9831 | 9 | 112 |
GO:0003824
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar