F481206

General Info

Members Datasets Scaffolds Average Seq Length
796 242 786 85

Family's Representative Sequence

Representative Sequence 3300046528|Ga0495642_0000352|Ga0495642_0000352_18617_18898
Length 93
Sequence LRFYSTDFMKINLRFFASVREAVGTSNETVDLPEDVATVGAVRAFLIARGGAWAEALGQERALRMAFDHVMCAPETPVREGGEVAFFPPVTGG

Samples

Sample ID Description Type Environment
1 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
2 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
3 2643221638 Duganella sp. Root336D2 Isolate Unclassified
4 2643221664 Massilia sp. Root418 Isolate Unclassified
5 2738541280 Massilia sp. GV090 Isolate Unclassified
6 2738541300 Massilia sp. GV016 Isolate Unclassified
7 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
8 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
9 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
10 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
11 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
12 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
56 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
58 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
61 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
87 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
99 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
100 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
101 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
102 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
103 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
104 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
105 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
106 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
107 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
108 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
124 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
127 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
135 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
139 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
140 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
143 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
146 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
147 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
148 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
149 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
150 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
151 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
160 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
163 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
164 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
171 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
172 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
176 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
179 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
180 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
181 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
192 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
195 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
196 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
197 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
198 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
203 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
221 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
222 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
223 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
224 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
225 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
226 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
227 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
228 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
233 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
238 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
239 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
240 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 0.25
Isolates 1.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.18
Nodule 0.25
Rhizoplane 6.03
Rhizosphere 78.89
Stem 0
Stem Tuber 0
Unclassified 4.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000579 3300002739 Bacteria 7293
2 JGI25158J39367_1002308 3300002739 Bacteria 3136
3 JGI25152J39213_1000071 3300002773 Bacteria 66888
4 JGI25150J39212_1000674 3300002774 Bacteria 12515
5 JGI25150J39212_1002059 3300002774 Bacteria 5226
6 JGI25159J45721_1008136 3300002987 Bacteria 2914
7 JGI25159J45721_1012506 3300002987 Bacteria 2022
8 JGI25159J45721_1012543 3300002987 Bacteria 2016
9 rootL2_10126347 3300003322 Bacteria 2318
10 rootL2_10147025 3300003322 Bacteria 1224
11 JGI25160J50197_1020158 3300003354 Bacteria 2022
12 JGI25161J50226_1000444 3300003374 Bacteria 19387
13 JGI25161J50226_1001769 3300003374 Bacteria 6094
14 Ga0055525_1000008 3300003759 Bacteria 604287
15 Ga0055526_1001492 3300003771 Bacteria 16562
16 Ga0055526_1006009 3300003771 Bacteria 6737
17 Ga0055537_1001232 3300003773 Bacteria 10749
18 Ga0055537_1013963 3300003773 Bacteria 1480
19 Ga0055537_1044583 3300003773 Bacteria 522
20 Ga0055537_1046777 3300003773 Bacteria 504
21 Ga0055524_1000112 3300003775 Bacteria 95840
22 Ga0055524_1000241 3300003775 Bacteria 57262
23 Ga0055524_1000430 3300003775 Bacteria 35254
24 Ga0055524_1001460 3300003775 Bacteria 13512
25 Ga0055524_1003339 3300003775 Bacteria 7825
26 Ga0055524_1005319 3300003775 Bacteria 5777
27 Ga0055534_1002678 3300003784 Bacteria 6022
28 Ga0055534_1021893 3300003784 Bacteria 1064
29 Ga0055528_1042731 3300003790 Bacteria 995
30 Ga0055528_1077201 3300003790 Unclassified 591
31 Ga0055530_10000365 3300003791 Bacteria 41004
32 Ga0055530_10002070 3300003791 Bacteria 13466
33 Ga0055530_10005292 3300003791 Bacteria 6198
34 Ga0055531_10001721 3300003794 Bacteria 15676
35 Ga0055531_10063307 3300003794 Bacteria 890
36 Ga0055543_1000231 3300004625 Bacteria 44323
37 Ga0055543_1011867 3300004625 Bacteria 1768
38 Ga0055543_1028851 3300004625 Bacteria 975
39 Ga0065165_1000524 3300005262 Bacteria 58631
40 Ga0065165_1001165 3300005262 Bacteria 30569
41 Ga0065165_1002198 3300005262 Bacteria 17494
42 Ga0065165_1023081 3300005262 Bacteria 2117
43 Ga0065165_1128847 3300005262 Bacteria 607
44 Ga0065714_10389072 3300005288 Bacteria 600
45 Ga0070658_10133976 3300005327 Bacteria 2066
46 Ga0070658_10203631 3300005327 Bacteria 1670
47 Ga0070658_10216881 3300005327 Bacteria 1617
48 Ga0070658_10475721 3300005327 Bacteria 1078
49 Ga0070658_10603431 3300005327 Bacteria 951
50 Ga0070680_100165357 3300005336 Bacteria 1860
51 Ga0070660_100243467 3300005339 Bacteria 1465
52 Ga0070660_100583750 3300005339 Bacteria 934
53 Ga0070661_100097890 3300005344 Bacteria 2179
54 Ga0070675_101509366 3300005354 Bacteria 620
55 Ga0070659_100008805 3300005366 Bacteria 7393
56 Ga0070659_100215526 3300005366 Bacteria 1583
57 Ga0070659_100542820 3300005366 Bacteria 995
58 Ga0068867_101987076 3300005459 Bacteria 549
59 Ga0068855_100019577 3300005563 Bacteria 8129
60 Ga0070664_100109699 3300005564 Bacteria 2407
61 Ga0068856_100221826 3300005614 Bacteria 1906
62 Ga0068862_102600123 3300005844 Bacteria 518
63 Ga0099826_10000001 3300006948 Bacteria 1155201
64 Ga0105243_10288279 3300009148 Bacteria 1482
65 Ga0105241_10051139 3300009174 Bacteria 3150
66 Ga0105242_10320572 3300009176 Bacteria 1421
67 Ga0105242_11415208 3300009176 Bacteria 723
68 Ga0105238_10454555 3300009551 Bacteria 1278
69 Ga0105239_10303242 3300010375 Bacteria 1799
70 Ga0105239_11684646 3300010375 Bacteria 734
71 Ga0105246_10393759 3300011119 Bacteria 1148
72 Ga0157373_10425748 3300013100 Bacteria 953
73 Ga0157378_12658677 3300013297 Bacteria 553
74 Ga0157372_10924647 3300013307 Bacteria 1011
75 Ga0157372_11024632 3300013307 Bacteria 956
76 Ga0157372_11254955 3300013307 Bacteria 856
77 Ga0182008_10000928 3300014497 Bacteria 20408
78 Ga0182006_1000006 3300015261 Bacteria 555811
79 Ga0182007_10000013 3300015262 Bacteria 231000
80 Ga0182005_1000001 3300015265 Bacteria 1014869
81 Ga0163161_10071036 3300017792 Bacteria 2546
82 Ga0209436_100068 3300025208 Bacteria 53437
83 Ga0209436_108578 3300025208 Bacteria 2022
84 Ga0209436_112327 3300025208 Bacteria 1457
85 Ga0209563_100003 3300025230 Bacteria 1932942
86 Ga0207425_1000001 3300025245 Bacteria 2525432
87 Ga0207425_1000406 3300025245 Bacteria 29017
88 Ga0207425_1008655 3300025245 Bacteria 2586
89 Ga0209677_110147 3300025253 Bacteria 1600
90 Ga0209148_1001390 3300025254 Bacteria 12483
91 Ga0209129_1000003 3300025258 Bacteria 903689
92 Ga0209129_1000629 3300025258 Bacteria 23556
93 Ga0209129_1012331 3300025258 Bacteria 1968
94 Ga0209565_1001956 3300025263 Bacteria 8076
95 Ga0209565_1002640 3300025263 Bacteria 6309
96 Ga0209565_1004025 3300025263 Bacteria 4578
97 Ga0209565_1019464 3300025263 Bacteria 1450
98 Ga0209565_1037685 3300025263 Bacteria 914
99 Ga0209673_1054516 3300025273 Unclassified 1035
100 Ga0209130_1000046 3300025284 Bacteria 236658
101 Ga0209130_1000439 3300025284 Bacteria 44337
102 Ga0209130_1014076 3300025284 Bacteria 2022
103 Ga0209675_1003121 3300025291 Bacteria 8076
104 Ga0209675_1008638 3300025291 Bacteria 3709
105 Ga0209564_1000199 3300025295 Bacteria 138027
106 Ga0209564_1003392 3300025295 Bacteria 10971
107 Ga0209564_1012833 3300025295 Bacteria 3614
108 Ga0209758_1000098 3300025297 Bacteria 230499
109 Ga0209050_1000089 3300025298 Bacteria 256212
110 Ga0209050_1000293 3300025298 Bacteria 106097
111 Ga0209050_1002894 3300025298 Bacteria 13518
112 Ga0209050_1033313 3300025298 Bacteria 1564
113 Ga0209256_1000007 3300025299 Bacteria 1136599
114 Ga0209256_1000163 3300025299 Bacteria 136008
115 Ga0209256_1000334 3300025299 Bacteria 78875
116 Ga0209256_1003697 3300025299 Bacteria 10393
117 Ga0207426_1008182 3300025302 Bacteria 4258
118 Ga0207426_1029215 3300025302 Bacteria 1821
119 Ga0207426_1046051 3300025302 Bacteria 1323
120 Ga0209257_1000003 3300025304 Bacteria 1702593
121 Ga0209257_1002480 3300025304 Bacteria 18244
122 Ga0207705_10003593 3300025909 Bacteria 11816
123 Ga0207705_10254351 3300025909 Bacteria 1340
124 Ga0207705_10513200 3300025909 Bacteria 931
125 Ga0207705_10536186 3300025909 Bacteria 910
126 Ga0207654_10018085 3300025911 Bacteria 3695
127 Ga0207660_10289533 3300025917 Bacteria 1302
128 Ga0207657_10078851 3300025919 Bacteria 2772
129 Ga0207657_10079543 3300025919 Bacteria 2758
130 Ga0207657_10204679 3300025919 Bacteria 1586
131 Ga0207649_10548241 3300025920 Bacteria 884
132 Ga0207694_10418137 3300025924 Bacteria 1116
133 Ga0207659_11023002 3300025926 Bacteria 711
134 Ga0207690_10548683 3300025932 Bacteria 939
135 Ga0207690_10565467 3300025932 Bacteria 925
136 Ga0207686_10166257 3300025934 Bacteria 1551
137 Ga0207686_10592209 3300025934 Bacteria 872
138 Ga0207709_10072707 3300025935 Bacteria 2188
139 Ga0207679_10489915 3300025945 Bacteria 1096
140 Ga0207679_10703591 3300025945 Bacteria 917
141 Ga0207667_10079199 3300025949 Bacteria 3405
142 Ga0207667_10160470 3300025949 Bacteria 2313
143 Ga0207667_10749399 3300025949 Bacteria 976
144 Ga0207702_10417861 3300026078 Bacteria 1296
145 Ga0207648_11592376 3300026089 Bacteria 614
146 Ga0207674_10236175 3300026116 Bacteria 1776
147 Ga0209282_1000001 3300027666 Bacteria 2450367
148 Ga0316177_1132650 3300030731 Bacteria 531
149 Ga0307408_100000123 3300031548 Bacteria 85710
150 Ga0307408_100004417 3300031548 Bacteria 9546
151 Ga0307408_100029542 3300031548 Bacteria 3799
152 Ga0307408_100196188 3300031548 Bacteria 1630
153 Ga0307416_100315420 3300032002 Bacteria 1562
154 Ga0307414_10330545 3300032004 Bacteria 1301
155 Ga0307411_10660145 3300032005 Bacteria 906
156 Ga0373930_0143191 3300034816 Bacteria 595
157 Ga0395899_0009955 3300037312 Bacteria 7291
158 Ga0395899_0015351 3300037312 Bacteria 5837
159 Ga0395899_0105701 3300037312 Bacteria 2027
160 Ga0395899_0159133 3300037312 Bacteria 1597
161 Ga0395899_0211673 3300037312 Bacteria 1347
162 Ga0395899_0313513 3300037312 Bacteria 1058
163 Ga0395899_0343439 3300037312 Bacteria 1000
164 Ga0395899_0496487 3300037312 Bacteria 792
165 Ga0395900_0002250 3300037418 Bacteria 21465
166 Ga0395900_0015351 3300037418 Bacteria 7807
167 Ga0395900_0025781 3300037418 Bacteria 6017
168 Ga0395900_0105677 3300037418 Bacteria 2892
169 Ga0395900_0125215 3300037418 Bacteria 2635
170 Ga0395900_0320863 3300037418 Bacteria 1529
171 Ga0395900_0516832 3300037418 Bacteria 1142
172 Ga0395900_0571349 3300037418 Bacteria 1073
173 Ga0395900_0614249 3300037418 Bacteria 1026
174 Ga0395900_1108491 3300037418 Bacteria 709
175 Ga0395900_1678200 3300037418 Bacteria 546
176 Ga0395898_0012375 3300037466 Bacteria 8820
177 Ga0395898_0093030 3300037466 Bacteria 2898
178 Ga0395898_0295099 3300037466 Bacteria 1546
179 Ga0395898_1065840 3300037466 Bacteria 742
180 Ga0395898_1159007 3300037466 Bacteria 705
181 Ga0395905_0046228 3300037471 Bacteria 4082
182 Ga0395905_0064643 3300037471 Bacteria 3424
183 Ga0395905_0064975 3300037471 Bacteria 3415
184 Ga0395905_0069638 3300037471 Bacteria 3295
185 Ga0395905_0085384 3300037471 Bacteria 2958
186 Ga0395905_0234494 3300037471 Bacteria 1715
187 Ga0395905_0483815 3300037471 Bacteria 1137
188 Ga0395905_0614825 3300037471 Bacteria 988
189 Ga0395905_0622813 3300037471 Bacteria 981
190 Ga0395905_1226922 3300037471 Bacteria 653
191 Ga0395905_1256655 3300037471 Bacteria 644
192 Ga0395905_1506545 3300037471 Bacteria 577
193 Ga0395901_0067361 3300038443 Bacteria 3728
194 Ga0395901_0069009 3300038443 Bacteria 3681
195 Ga0395901_0369829 3300038443 Bacteria 1477
196 Ga0395901_0505784 3300038443 Bacteria 1229
197 Ga0395901_0596182 3300038443 Bacteria 1114
198 Ga0395901_0692724 3300038443 Bacteria 1017
199 Ga0395901_0715651 3300038443 Bacteria 997
200 Ga0395901_0751262 3300038443 Bacteria 968
201 Ga0395901_1094931 3300038443 Bacteria 767
202 Ga0395901_1355420 3300038443 Bacteria 671
203 Ga0395901_1503843 3300038443 Bacteria 629
204 Ga0439465_0013374 3300041413 Bacteria 2561
205 Ga0439448_0007022 3300042005 Bacteria 3251
206 Ga0439449_0020805 3300042007 Bacteria 2458
207 Ga0439450_008858 3300042008 Bacteria 1891
208 Ga0439450_059202 3300042008 Bacteria 923
209 Ga0439455_0008577 3300042012 Bacteria 2194
210 Ga0450904_002774 3300042139 Bacteria 2002
211 Ga0450906_080459 3300042145 Bacteria 588
212 Ga0439458_0011679 3300042157 Bacteria 1965
213 Ga0439458_0032427 3300042157 Bacteria 1249
214 Ga0439458_0078355 3300042157 Bacteria 841
215 Ga0439458_0103878 3300042157 Bacteria 739
216 Ga0450893_0096019 3300042532 Bacteria 600
217 Ga0466969_0319789 3300044656 Bacteria 702
218 Ga0466969_0549366 3300044656 Bacteria 528
219 Ga0466972_0000549 3300044658 Bacteria 18404
220 Ga0466972_0131866 3300044658 Bacteria 1177
221 Ga0453683_0073893 3300044673 Bacteria 2134
222 Ga0466965_0000621 3300044683 Bacteria 12951
223 Ga0466965_0075058 3300044683 Bacteria 1704
224 Ga0466965_0689312 3300044683 Bacteria 585
225 Ga0466966_0012545 3300044684 Bacteria 5613
226 Ga0466966_0034261 3300044684 Bacteria 3283
227 Ga0466966_0036911 3300044684 Bacteria 3153
228 Ga0466966_0067176 3300044684 Bacteria 2252
229 Ga0466966_0139170 3300044684 Bacteria 1484
230 Ga0466966_0171439 3300044684 Bacteria 1318
231 Ga0466966_0362998 3300044684 Bacteria 870
232 Ga0466966_0528990 3300044684 Bacteria 709
233 Ga0466961_0042988 3300044693 Bacteria 2895
234 Ga0466961_0329509 3300044693 Bacteria 930
235 Ga0466961_0379287 3300044693 Bacteria 859
236 Ga0466961_0401695 3300044693 Bacteria 832
237 Ga0466961_0875005 3300044693 Bacteria 535
238 Ga0466963_0081562 3300044694 Bacteria 2191
239 Ga0466964_0001638 3300044706 Bacteria 7729
240 Ga0466964_0270230 3300044706 Bacteria 846
241 Ga0466964_0367343 3300044706 Bacteria 743
242 Ga0466971_0458552 3300044719 Bacteria 626
243 Ga0466968_0010867 3300044735 Bacteria 3537
244 Ga0466968_0176250 3300044735 Bacteria 993
245 Ga0466970_0048267 3300044765 Bacteria 2270
246 Ga0466970_0152945 3300044765 Bacteria 1274
247 Ga0466970_0200617 3300044765 Bacteria 1110
248 Ga0466970_0635186 3300044765 Bacteria 621
249 Ga0466970_0728260 3300044765 Bacteria 579
250 Ga0466957_0000081 3300044842 Bacteria 38526
251 Ga0466957_0014682 3300044842 Bacteria 4563
252 Ga0466957_0155604 3300044842 Bacteria 1481
253 Ga0466957_0828195 3300044842 Bacteria 658
254 Ga0466960_0128844 3300044901 Bacteria 1333
255 Ga0466960_0598429 3300044901 Bacteria 654
256 Ga0466960_0678627 3300044901 Bacteria 617
257 Ga0466959_0029643 3300045049 Bacteria 4054
258 Ga0466959_0044919 3300045049 Bacteria 3254
259 Ga0466959_0179720 3300045049 Bacteria 1480
260 Ga0466959_0317495 3300045049 Bacteria 1065
261 Ga0466959_0344590 3300045049 Bacteria 1016
262 Ga0466959_0927794 3300045049 Bacteria 580
263 Ga0466958_0321197 3300045836 Bacteria 995
264 Ga0466958_0523941 3300045836 Bacteria 769
265 Ga0466967_0004448 3300045976 Bacteria 9455
266 Ga0466967_0124054 3300045976 Bacteria 2390
267 Ga0466967_1934530 3300045976 Bacteria 586
268 Ga0495617_000012 3300046452 Bacteria 295916
269 Ga0495617_016820 3300046452 Bacteria 2473
270 Ga0495617_021284 3300046452 Bacteria 2190
271 Ga0495617_034355 3300046452 Bacteria 1702
272 Ga0495627_000475 3300046453 Bacteria 33989
273 Ga0495627_003935 3300046453 Bacteria 6352
274 Ga0495627_062735 3300046453 Bacteria 1097
275 Ga0495603_0032245 3300046455 Bacteria 3153
276 Ga0495603_0178361 3300046455 Bacteria 1229
277 Ga0495590_0000498 3300046457 Bacteria 19291
278 Ga0495590_0001605 3300046457 Bacteria 9680
279 Ga0495590_0010457 3300046457 Bacteria 3488
280 Ga0495590_0069538 3300046457 Bacteria 1234
281 Ga0495590_0095945 3300046457 Bacteria 1051
282 Ga0495590_0368379 3300046457 Bacteria 548
283 Ga0495591_008285 3300046458 Bacteria 4279
284 Ga0495629_0004585 3300046459 Bacteria 10338
285 Ga0495629_0011922 3300046459 Bacteria 6304
286 Ga0495629_0724648 3300046459 Bacteria 659
287 Ga0495638_0002150 3300046460 Bacteria 16540
288 Ga0495638_0082402 3300046460 Bacteria 1951
289 Ga0495638_0112346 3300046460 Bacteria 1617
290 Ga0495638_0276680 3300046460 Bacteria 914
291 Ga0495653_0067100 3300046463 Bacteria 2695
292 Ga0495653_0109603 3300046463 Bacteria 1986
293 Ga0495653_0131685 3300046463 Bacteria 1769
294 Ga0495653_0155153 3300046463 Bacteria 1595
295 Ga0495650_0000001 3300046471 Bacteria 1085492
296 Ga0495650_0016048 3300046471 Bacteria 3813
297 Ga0495580_0054723 3300046472 Bacteria 2813
298 Ga0495582_0041498 3300046473 Bacteria 2535
299 Ga0495582_0073053 3300046473 Bacteria 1898
300 Ga0495605_0000138 3300046474 Bacteria 94241
301 Ga0495605_0000432 3300046474 Bacteria 37968
302 Ga0495605_0001199 3300046474 Bacteria 17258
303 Ga0495605_0012130 3300046474 Bacteria 4788
304 Ga0495605_0028552 3300046474 Bacteria 2878
305 Ga0495605_0395807 3300046474 Bacteria 575
306 Ga0495584_0001597 3300046491 Bacteria 13375
307 Ga0495584_0002301 3300046491 Bacteria 10898
308 Ga0495584_0006033 3300046491 Bacteria 6383
309 Ga0495584_0008438 3300046491 Bacteria 5338
310 Ga0495584_0036393 3300046491 Bacteria 2487
311 Ga0495584_0037484 3300046491 Bacteria 2450
312 Ga0495584_0043548 3300046491 Bacteria 2265
313 Ga0495584_0061006 3300046491 Bacteria 1895
314 Ga0495584_0068051 3300046491 Bacteria 1789
315 Ga0495585_0009363 3300046492 Bacteria 5877
316 Ga0495585_0021076 3300046492 Bacteria 3743
317 Ga0495585_0023784 3300046492 Bacteria 3515
318 Ga0495585_0041219 3300046492 Bacteria 2589
319 Ga0495585_0053894 3300046492 Bacteria 2225
320 Ga0495585_0072488 3300046492 Bacteria 1876
321 Ga0495585_0081578 3300046492 Bacteria 1752
322 Ga0495585_0324373 3300046492 Bacteria 752
323 Ga0495585_0410265 3300046492 Bacteria 651
324 Ga0495585_0410267 3300046492 Bacteria 651
325 Ga0495585_0526929 3300046492 Bacteria 559
326 Ga0495594_0067953 3300046499 Bacteria 1978
327 Ga0495594_0130298 3300046499 Bacteria 1424
328 Ga0495594_0306338 3300046499 Bacteria 905
329 Ga0495594_0482332 3300046499 Bacteria 704
330 Ga0495594_0559967 3300046499 Bacteria 648
331 Ga0495594_0572668 3300046499 Bacteria 640
332 Ga0495594_0587536 3300046499 Bacteria 631
333 Ga0495596_0005697 3300046500 Bacteria 5847
334 Ga0495596_0006440 3300046500 Bacteria 5402
335 Ga0495596_0015461 3300046500 Bacteria 3194
336 Ga0495596_0038264 3300046500 Bacteria 1896
337 Ga0495596_0044179 3300046500 Bacteria 1754
338 Ga0495596_0092449 3300046500 Bacteria 1174
339 Ga0495607_0002283 3300046501 Bacteria 15780
340 Ga0495607_0002389 3300046501 Bacteria 15303
341 Ga0495607_0004309 3300046501 Bacteria 10502
342 Ga0495607_0008277 3300046501 Bacteria 7115
343 Ga0495607_0008330 3300046501 Bacteria 7091
344 Ga0495607_0008584 3300046501 Bacteria 6976
345 Ga0495607_0032362 3300046501 Bacteria 3192
346 Ga0495607_0036971 3300046501 Bacteria 2936
347 Ga0495607_0057416 3300046501 Bacteria 2230
348 Ga0495607_0064713 3300046501 Bacteria 2064
349 Ga0495607_0070014 3300046501 Bacteria 1961
350 Ga0495607_0078079 3300046501 Bacteria 1827
351 Ga0495607_0080850 3300046501 Bacteria 1785
352 Ga0495607_0200618 3300046501 Bacteria 987
353 Ga0495607_0226698 3300046501 Bacteria 911
354 Ga0495583_0000026 3300046506 Bacteria 256777
355 Ga0495583_0000113 3300046506 Bacteria 136475
356 Ga0495583_0004818 3300046506 Bacteria 9457
357 Ga0495583_0008975 3300046506 Bacteria 6030
358 Ga0495583_0026429 3300046506 Bacteria 2878
359 Ga0495583_0143665 3300046506 Bacteria 992
360 Ga0495606_0002776 3300046507 Bacteria 19592
361 Ga0495606_0022152 3300046507 Bacteria 4638
362 Ga0495606_0166156 3300046507 Bacteria 1284
363 Ga0495606_0173188 3300046507 Bacteria 1250
364 Ga0495606_0240537 3300046507 Bacteria 1010
365 Ga0495606_0352223 3300046507 Bacteria 781
366 Ga0495606_0394492 3300046507 Bacteria 722
367 Ga0495606_0444586 3300046507 Bacteria 665
368 Ga0495606_0467192 3300046507 Bacteria 643
369 Ga0495606_0654141 3300046507 Bacteria 508
370 Ga0495610_0241736 3300046512 Bacteria 719
371 Ga0495616_0000037 3300046513 Bacteria 123624
372 Ga0495616_0002017 3300046513 Bacteria 13661
373 Ga0495616_0013490 3300046513 Bacteria 4608
374 Ga0495616_0015525 3300046513 Bacteria 4233
375 Ga0495616_0022187 3300046513 Bacteria 3429
376 Ga0495616_0033261 3300046513 Bacteria 2688
377 Ga0495616_0034392 3300046513 Bacteria 2632
378 Ga0495616_0074992 3300046513 Bacteria 1628
379 Ga0495616_0121975 3300046513 Bacteria 1202
380 Ga0495616_0152537 3300046513 Bacteria 1044
381 Ga0495630_0030210 3300046517 Bacteria 4030
382 Ga0495631_0000856 3300046518 Bacteria 19204
383 Ga0495631_0004211 3300046518 Bacteria 7693
384 Ga0495631_0024273 3300046518 Bacteria 2799
385 Ga0495631_0037819 3300046518 Bacteria 2148
386 Ga0495631_0041802 3300046518 Bacteria 2027
387 Ga0495631_0054934 3300046518 Bacteria 1735
388 Ga0495631_0073170 3300046518 Bacteria 1480
389 Ga0495631_0115868 3300046518 Bacteria 1152
390 Ga0495631_0148847 3300046518 Bacteria 1004
391 Ga0495631_0219104 3300046518 Bacteria 812
392 Ga0495631_0302447 3300046518 Bacteria 680
393 Ga0495631_0319674 3300046518 Bacteria 660
394 Ga0495631_0362976 3300046518 Bacteria 616
395 Ga0495632_0000018 3300046519 Bacteria 228282
396 Ga0495632_0000988 3300046519 Bacteria 24808
397 Ga0495632_0002964 3300046519 Bacteria 12438
398 Ga0495632_0040968 3300046519 Bacteria 2329
399 Ga0495632_0211667 3300046519 Bacteria 879
400 Ga0495637_0026325 3300046520 Bacteria 2612
401 Ga0495637_0229613 3300046520 Bacteria 673
402 Ga0495643_0004390 3300046522 Bacteria 9879
403 Ga0495643_0077916 3300046522 Bacteria 1731
404 Ga0495643_0101622 3300046522 Bacteria 1473
405 Ga0495643_0153784 3300046522 Bacteria 1137
406 Ga0495643_0253921 3300046522 Bacteria 819
407 Ga0495643_0285136 3300046522 Bacteria 758
408 Ga0495643_0288118 3300046522 Bacteria 753
409 Ga0495643_0430201 3300046522 Bacteria 577
410 Ga0495644_0000829 3300046523 Bacteria 12768
411 Ga0495644_0002102 3300046523 Bacteria 8009
412 Ga0495644_0004671 3300046523 Bacteria 5380
413 Ga0495644_0007037 3300046523 Bacteria 4352
414 Ga0495644_0020842 3300046523 Bacteria 2500
415 Ga0495644_0142204 3300046523 Bacteria 916
416 Ga0495648_0000607 3300046524 Bacteria 38333
417 Ga0495648_0002504 3300046524 Bacteria 16859
418 Ga0495648_0006132 3300046524 Bacteria 9854
419 Ga0495648_0006238 3300046524 Bacteria 9752
420 Ga0495648_0011054 3300046524 Bacteria 6838
421 Ga0495648_0017670 3300046524 Bacteria 5088
422 Ga0495648_0038433 3300046524 Bacteria 3060
423 Ga0495663_0002274 3300046525 Bacteria 5831
424 Ga0495663_0004275 3300046525 Bacteria 4025
425 Ga0495663_0050714 3300046525 Bacteria 1284
426 Ga0495666_0009518 3300046526 Bacteria 4854
427 Ga0495642_0000010 3300046528 Bacteria 136557
428 Ga0495642_0000352 3300046528 Bacteria 24904
429 Ga0495642_0000810 3300046528 Bacteria 15157
430 Ga0495642_0007615 3300046528 Bacteria 4150
431 Ga0495642_0008276 3300046528 Bacteria 3979
432 Ga0495642_0018015 3300046528 Bacteria 2762
433 Ga0495642_0045623 3300046528 Bacteria 1791
434 Ga0495642_0059301 3300046528 Bacteria 1586
435 Ga0495642_0078145 3300046528 Archaea 1391
436 Ga0495642_0103565 3300046528 Bacteria 1213
437 Ga0495642_0105842 3300046528 Bacteria 1200
438 Ga0495642_0122104 3300046528 Bacteria 1118
439 Ga0495642_0228107 3300046528 Bacteria 813
440 Ga0495642_0439893 3300046528 Bacteria 576
441 Ga0495652_0025910 3300046529 Bacteria 5181
442 Ga0495654_0004534 3300046530 Bacteria 8222
443 Ga0495654_0016780 3300046530 Bacteria 3860
444 Ga0495654_0019071 3300046530 Bacteria 3589
445 Ga0495654_0164804 3300046530 Bacteria 970
446 Ga0495654_0346460 3300046530 Bacteria 598
447 Ga0495654_0410524 3300046530 Bacteria 537
448 Ga0495665_0021110 3300046531 Bacteria 3498
449 Ga0495665_0190293 3300046531 Bacteria 1065
450 Ga0495586_0002254 3300046535 Bacteria 10496
451 Ga0495586_0102093 3300046535 Bacteria 1592
452 Ga0495587_0039023 3300046536 Bacteria 2845
453 Ga0495587_0048317 3300046536 Bacteria 2520
454 Ga0495609_0000001 3300046538 Bacteria 1060094
455 Ga0495609_0000142 3300046538 Bacteria 75002
456 Ga0495609_0001633 3300046538 Bacteria 14622
457 Ga0495609_0006249 3300046538 Bacteria 6113
458 Ga0495609_0008994 3300046538 Bacteria 4856
459 Ga0495609_0041688 3300046538 Bacteria 2062
460 Ga0495609_0110941 3300046538 Bacteria 1184
461 Ga0495609_0202904 3300046538 Bacteria 828
462 Ga0495609_0328276 3300046538 Bacteria 619
463 Ga0495609_0339717 3300046538 Bacteria 607
464 Ga0495597_0000967 3300046542 Bacteria 22208
465 Ga0495597_0001038 3300046542 Bacteria 21213
466 Ga0495597_0001317 3300046542 Bacteria 18177
467 Ga0495597_0002421 3300046542 Bacteria 11863
468 Ga0495597_0007941 3300046542 Bacteria 5345
469 Ga0495597_0009210 3300046542 Bacteria 4894
470 Ga0495597_0037773 3300046542 Bacteria 2167
471 Ga0495597_0084574 3300046542 Bacteria 1353
472 Ga0495597_0222786 3300046542 Bacteria 748
473 Ga0495645_0100590 3300046543 Bacteria 2056
474 Ga0495622_0001153 3300046557 Bacteria 13764
475 Ga0495622_0087447 3300046557 Bacteria 1433
476 Ga0495622_0148965 3300046557 Bacteria 1059
477 Ga0495622_0271177 3300046557 Bacteria 743
478 Ga0495622_0516203 3300046557 Bacteria 510
479 Ga0495633_0001497 3300046558 Bacteria 18105
480 Ga0495633_0004609 3300046558 Bacteria 8687
481 Ga0495633_0012049 3300046558 Bacteria 4618
482 Ga0495633_0076253 3300046558 Bacteria 1561
483 Ga0495633_0096639 3300046558 Bacteria 1372
484 Ga0495633_0413804 3300046558 Bacteria 609
485 Ga0495656_0003022 3300046615 Bacteria 5655
486 Ga0495656_0030945 3300046615 Bacteria 2167
487 Ga0495656_0031728 3300046615 Bacteria 2145
488 Ga0495656_0134824 3300046615 Bacteria 1178
489 Ga0495656_0371208 3300046615 Bacteria 744
490 Ga0495656_0548249 3300046615 Bacteria 616
491 Ga0495668_0000020 3300046616 Bacteria 411641
492 Ga0495668_0000448 3300046616 Bacteria 52646
493 Ga0495668_0001463 3300046616 Bacteria 22696
494 Ga0495668_0005020 3300046616 Bacteria 9131
495 Ga0495668_0005425 3300046616 Bacteria 8660
496 Ga0495668_0005806 3300046616 Bacteria 8250
497 Ga0495668_0006550 3300046616 Bacteria 7608
498 Ga0495668_0017187 3300046616 Bacteria 4200
499 Ga0495668_0074692 3300046616 Bacteria 1861
500 Ga0495668_0100758 3300046616 Bacteria 1580
501 Ga0495668_0374907 3300046616 Bacteria 781
502 Ga0495634_0022245 3300046642 Bacteria 4468
503 Ga0495611_0001473 3300046648 Bacteria 11705
504 Ga0495611_0001872 3300046648 Bacteria 10030
505 Ga0495611_0005286 3300046648 Bacteria 5531
506 Ga0495611_0006146 3300046648 Bacteria 5125
507 Ga0495611_0009096 3300046648 Bacteria 4199
508 Ga0495611_0029287 3300046648 Bacteria 2414
509 Ga0495611_0077310 3300046648 Bacteria 1526
510 Ga0495625_0011387 3300046660 Bacteria 7258
511 Ga0495625_0027230 3300046660 Bacteria 4307
512 Ga0495625_0038201 3300046660 Bacteria 3516
513 Ga0495625_0068427 3300046660 Bacteria 2496
514 Ga0495625_0093025 3300046660 Bacteria 2082
515 Ga0495625_0180046 3300046660 Bacteria 1406
516 Ga0495625_0204448 3300046660 Bacteria 1301
517 Ga0495625_0260969 3300046660 Bacteria 1121
518 Ga0495625_0571826 3300046660 Bacteria 682
519 Ga0495635_0002174 3300046663 Bacteria 13328
520 Ga0495635_0082269 3300046663 Bacteria 2203
521 Ga0495659_0000063 3300046664 Bacteria 47788
522 Ga0495659_0000393 3300046664 Bacteria 16723
523 Ga0495659_0001076 3300046664 Bacteria 9505
524 Ga0495659_0209956 3300046664 Bacteria 801
525 Ga0495661_0000082 3300046665 Bacteria 116600
526 Ga0495661_0001642 3300046665 Bacteria 18233
527 Ga0495661_0002755 3300046665 Bacteria 13352
528 Ga0495661_0003022 3300046665 Bacteria 12676
529 Ga0495661_0016241 3300046665 Bacteria 4941
530 Ga0495661_0025167 3300046665 Bacteria 3847
531 Ga0495661_0027959 3300046665 Bacteria 3617
532 Ga0495661_0057045 3300046665 Bacteria 2333
533 Ga0495661_0071242 3300046665 Bacteria 2031
534 Ga0495661_0076159 3300046665 Bacteria 1947
535 Ga0495661_0084795 3300046665 Bacteria 1817
536 Ga0495661_0156149 3300046665 Bacteria 1228
537 Ga0495661_0157339 3300046665 Bacteria 1222
538 Ga0495661_0229486 3300046665 Bacteria 958
539 Ga0495661_0264579 3300046665 Bacteria 872
540 Ga0495661_0328305 3300046665 Bacteria 758
541 Ga0495661_0340683 3300046665 Bacteria 740
542 Ga0495661_0411445 3300046665 Bacteria 656
543 Ga0495661_0461599 3300046665 Bacteria 610
544 Ga0495588_0000041 3300046674 Bacteria 377896
545 Ga0495588_0004219 3300046674 Bacteria 6335
546 Ga0495588_0028007 3300046674 Bacteria 2818
547 Ga0495588_0041796 3300046674 Bacteria 2342
548 Ga0495588_0076350 3300046674 Bacteria 1746
549 Ga0495588_0085442 3300046674 Bacteria 1649
550 Ga0495588_0106419 3300046674 Bacteria 1476
551 Ga0495588_0160522 3300046674 Bacteria 1189
552 Ga0495588_0241992 3300046674 Bacteria 952
553 Ga0495599_0664796 3300046678 Bacteria 603
554 Ga0495623_0011300 3300046679 Bacteria 5777
555 Ga0495623_0061097 3300046679 Bacteria 2363
556 Ga0495646_0665339 3300046680 Bacteria 525
557 Ga0495669_0000031 3300046684 Bacteria 101141
558 Ga0495669_0001229 3300046684 Bacteria 10642
559 Ga0495669_0006268 3300046684 Bacteria 4966
560 Ga0495669_0013036 3300046684 Bacteria 3542
561 Ga0495669_0045533 3300046684 Bacteria 1956
562 Ga0495669_0091264 3300046684 Bacteria 1406
563 Ga0495669_0281456 3300046684 Bacteria 800
564 Ga0495613_0132005 3300046689 Bacteria 1788
565 Ga0495670_0003564 3300046691 Bacteria 7648
566 Ga0495670_0003870 3300046691 Bacteria 7352
567 Ga0495670_0008414 3300046691 Bacteria 5072
568 Ga0495670_0026071 3300046691 Bacteria 2893
569 Ga0495670_0054327 3300046691 Bacteria 2006
570 Ga0495670_0424501 3300046691 Bacteria 719
571 Ga0495670_0626063 3300046691 Bacteria 586
572 Ga0495670_0659027 3300046691 Bacteria 570
573 Ga0495671_0000223 3300046692 Bacteria 49139
574 Ga0495671_0003296 3300046692 Bacteria 9987
575 Ga0495671_0010193 3300046692 Bacteria 5219
576 Ga0495671_0015755 3300046692 Bacteria 4044
577 Ga0495671_0472116 3300046692 Bacteria 599
578 Ga0495649_0060080 3300046694 Bacteria 2045
579 Ga0495649_0189040 3300046694 Bacteria 1072
580 Ga0495649_0326374 3300046694 Bacteria 778
581 Ga0495649_0437489 3300046694 Bacteria 654
582 Ga0495649_0603228 3300046694 Bacteria 541
583 Ga0495589_0000202 3300046794 Bacteria 51572
584 Ga0495589_0000512 3300046794 Bacteria 27325
585 Ga0495589_0000590 3300046794 Bacteria 24799
586 Ga0495589_0005802 3300046794 Bacteria 6510
587 Ga0495589_0010999 3300046794 Bacteria 4698
588 Ga0495589_0128372 3300046794 Bacteria 1218
589 Ga0495589_0202943 3300046794 Bacteria 935
590 Ga0495589_0213781 3300046794 Bacteria 907
591 Ga0495600_0109829 3300046809 Bacteria 1796
592 Ga0495600_0128180 3300046809 Bacteria 1650
593 Ga0495660_0000033 3300046810 Bacteria 212425
594 Ga0495660_0001217 3300046810 Bacteria 17977
595 Ga0495660_0009535 3300046810 Bacteria 5659
596 Ga0495660_0010304 3300046810 Bacteria 5434
597 Ga0495660_0020829 3300046810 Bacteria 3759
598 Ga0495660_0046568 3300046810 Bacteria 2378
599 Ga0495660_0057890 3300046810 Bacteria 2089
600 Ga0495660_0082669 3300046810 Bacteria 1681
601 Ga0495660_0158407 3300046810 Bacteria 1112
602 Ga0495660_0202860 3300046810 Bacteria 946
603 Ga0495581_0029044 3300047315 Bacteria 3206
604 Ga0495604_0010708 3300047317 Bacteria 7279
605 Ga0495604_0029427 3300047317 Bacteria 4369
606 Ga0495636_0027483 3300047318 Bacteria 2317
607 Ga0495636_0040418 3300047318 Bacteria 1933
608 Ga0495636_0047445 3300047318 Bacteria 1793
609 Ga0495636_0091011 3300047318 Bacteria 1324
610 Ga0495636_0179473 3300047318 Bacteria 960
611 Ga0495636_0190877 3300047318 Bacteria 932
612 Ga0495674_0027730 3300047319 Bacteria 5171
613 Ga0495672_0002906 3300047320 Bacteria 15161
614 Ga0495672_0006037 3300047320 Bacteria 9465
615 Ga0495672_0008060 3300047320 Bacteria 7833
616 Ga0495672_0018120 3300047320 Bacteria 4687
617 Ga0495672_0041145 3300047320 Bacteria 2797
618 Ga0495672_0251836 3300047320 Bacteria 857
619 Ga0495676_0000557 3300047321 Bacteria 30685
620 Ga0495676_0108630 3300047321 Bacteria 2040
621 Ga0495680_0002023 3300047322 Bacteria 21263
622 Ga0495683_0012165 3300047323 Bacteria 4522
623 Ga0495683_0015891 3300047323 Bacteria 3909
624 Ga0495683_0033055 3300047323 Bacteria 2634
625 Ga0495683_0055057 3300047323 Bacteria 1981
626 Ga0495683_0185289 3300047323 Bacteria 948
627 Ga0495683_0204142 3300047323 Bacteria 889
628 Ga0495683_0233045 3300047323 Bacteria 815
629 Ga0495687_000027 3300047443 Bacteria 299689
630 Ga0495687_000873 3300047443 Bacteria 31989
631 Ga0495687_001578 3300047443 Bacteria 20661
632 Ga0495687_001652 3300047443 Bacteria 20053
633 Ga0495687_125600 3300047443 Bacteria 918
634 Ga0495687_141437 3300047443 Bacteria 836
635 Ga0495687_210874 3300047443 Bacteria 608
636 Ga0495675_0025189 3300047444 Bacteria 3793
637 Ga0495675_0054323 3300047444 Bacteria 2542
638 Ga0495675_0075347 3300047444 Bacteria 2127
639 Ga0495677_0000001 3300047445 Bacteria 715000
640 Ga0495677_0001227 3300047445 Bacteria 10276
641 Ga0495677_0002166 3300047445 Bacteria 7775
642 Ga0495677_0002826 3300047445 Bacteria 6766
643 Ga0495677_0004714 3300047445 Bacteria 5199
644 Ga0495677_0008424 3300047445 Bacteria 3828
645 Ga0495677_0009451 3300047445 Bacteria 3601
646 Ga0495677_0027443 3300047445 Bacteria 2066
647 Ga0495677_0052856 3300047445 Bacteria 1497
648 Ga0495677_0133649 3300047445 Bacteria 950
649 Ga0495677_0302147 3300047445 Bacteria 629
650 Ga0495679_008820 3300047446 Bacteria 4071
651 Ga0495679_013635 3300047446 Bacteria 3040
652 Ga0495679_015106 3300047446 Bacteria 2834
653 Ga0495679_021968 3300047446 Bacteria 2192
654 Ga0495685_000064 3300047447 Bacteria 40085
655 Ga0495685_006568 3300047447 Bacteria 3815
656 Ga0495685_017181 3300047447 Bacteria 2476
657 Ga0495685_245879 3300047447 Bacteria 568
658 Ga0495673_0001902 3300047469 Bacteria 15634
659 Ga0495673_0268033 3300047469 Bacteria 619
660 Ga0495681_0001529 3300047470 Bacteria 17264
661 Ga0495681_0005675 3300047470 Bacteria 8310
662 Ga0495681_0021213 3300047470 Bacteria 3504
663 Ga0495681_0028278 3300047470 Bacteria 2887
664 Ga0495681_0085901 3300047470 Bacteria 1396
665 Ga0495681_0271662 3300047470 Bacteria 663
666 Ga0495686_0001196 3300047472 Bacteria 30003
667 Ga0495686_0028791 3300047472 Bacteria 3616
668 Ga0495686_0174505 3300047472 Bacteria 1249
669 Ga0495686_0196460 3300047472 Bacteria 1160
670 Ga0495686_0406145 3300047472 Bacteria 730
671 Ga0495593_0014985 3300047673 Bacteria 4401
672 Ga0495593_0048083 3300047673 Bacteria 2267
673 Ga0495602_0035851 3300048088 Bacteria 4622
674 Ga0495614_0000545 3300048089 Bacteria 15602
675 Ga0495614_0007999 3300048089 Bacteria 4699
676 Ga0495614_0277988 3300048089 Bacteria 770
677 Ga0495626_0000159 3300048091 Bacteria 83571
678 Ga0495626_0001535 3300048091 Bacteria 18118
679 Ga0495626_0010066 3300048091 Bacteria 5074
680 Ga0495626_0011759 3300048091 Bacteria 4615
681 Ga0495626_0033374 3300048091 Bacteria 2467
682 Ga0495626_0059779 3300048091 Bacteria 1738
683 Ga0495626_0115214 3300048091 Bacteria 1160
684 Ga0495626_0136195 3300048091 Bacteria 1044
685 Ga0495626_0251633 3300048091 Bacteria 708
686 Ga0496100_0429566 3300048903 Bacteria 1010
687 Ga0496100_0506678 3300048903 Bacteria 930
688 Ga0496100_0590989 3300048903 Bacteria 861
689 Ga0496101_0124556 3300048904 Bacteria 1952
690 Ga0496101_0167862 3300048904 Bacteria 1685
691 Ga0496101_0490652 3300048904 Bacteria 970
692 Ga0496102_0000150 3300048905 Bacteria 94718
693 Ga0496102_0000816 3300048905 Bacteria 30310
694 Ga0496102_0092747 3300048905 Bacteria 2797
695 Ga0496102_0165902 3300048905 Bacteria 2078
696 Ga0496102_0168007 3300048905 Bacteria 2065
697 Ga0496102_0754752 3300048905 Bacteria 896
698 Ga0496103_0029187 3300048906 Bacteria 3351
699 Ga0496103_0086436 3300048906 Bacteria 1976
700 Ga0496103_0380291 3300048906 Bacteria 907
701 Ga0496103_0469115 3300048906 Bacteria 807
702 Ga0496103_0720547 3300048906 Bacteria 632
703 Ga0496104_0299635 3300048907 Bacteria 1520
704 Ga0496104_0713267 3300048907 Bacteria 911
705 Ga0496105_0454230 3300048908 Bacteria 1011
706 Ga0496105_0558584 3300048908 Bacteria 893
707 Ga0496105_0849774 3300048908 Bacteria 691
708 Ga0496106_0017435 3300048909 Bacteria 5313
709 Ga0496107_0015847 3300048910 Bacteria 5288
710 Ga0496107_0329398 3300048910 Bacteria 1136
711 Ga0496107_0606913 3300048910 Bacteria 808
712 Ga0496107_0803235 3300048910 Bacteria 689
713 Ga0496107_1002236 3300048910 Bacteria 606
714 Ga0496108_0163188 3300048911 Bacteria 1926
715 Ga0496108_1680676 3300048911 Bacteria 523
716 Ga0496109_0908616 3300048912 Bacteria 818
717 Ga0496109_1610079 3300048912 Bacteria 584
718 Ga0496110_0000036 3300048913 Bacteria 64802
719 Ga0496110_0468673 3300048913 Bacteria 1148
720 Ga0496110_0625138 3300048913 Bacteria 976
721 Ga0496111_0049467 3300048914 Bacteria 3031
722 Ga0496111_0540277 3300048914 Bacteria 856
723 Ga0496111_0952526 3300048914 Bacteria 616
724 Ga0496111_0977582 3300048914 Bacteria 607
725 Ga0496112_0015901 3300048915 Bacteria 7033
726 Ga0496112_1231337 3300048915 Bacteria 665
727 Ga0496113_0009981 3300048916 Bacteria 6258
728 Ga0496113_0082996 3300048916 Bacteria 2458
729 Ga0496113_0958790 3300048916 Bacteria 675
730 Ga0496114_0074048 3300048917 Bacteria 2867
731 Ga0496115_0429508 3300048918 Bacteria 1069
732 Ga0496115_0471420 3300048918 Bacteria 1012
733 Ga0496116_0020670 3300048919 Bacteria 4992
734 Ga0496117_0000001 3300048920 Bacteria 2526244
735 Ga0496118_0000002 3300048921 Bacteria 1690764
736 Ga0496119_0442628 3300048922 Bacteria 613
737 Ga0496121_0000709 3300048924 Bacteria 61789
738 Ga0496121_0053734 3300048924 Bacteria 3372
739 Ga0496122_0000255 3300048925 Bacteria 120384
740 Ga0496122_0000660 3300048925 Bacteria 69382
741 Ga0496122_0006595 3300048925 Bacteria 13249
742 Ga0496122_0014117 3300048925 Bacteria 7747
743 Ga0496122_0278087 3300048925 Bacteria 917
744 Ga0496123_0000936 3300048926 Bacteria 45579
745 Ga0496123_0002832 3300048926 Bacteria 20510
746 Ga0496123_0007467 3300048926 Bacteria 10280
747 Ga0496123_0123759 3300048926 Bacteria 1448
748 Ga0496123_0252167 3300048926 Bacteria 870
749 Ga0496124_0013535 3300048927 Bacteria 7956
750 Ga0496124_0067859 3300048927 Bacteria 2966
751 Ga0496124_0100106 3300048927 Bacteria 2350
752 Ga0496124_0532066 3300048927 Bacteria 780
753 Ga0496124_0546748 3300048927 Bacteria 765
754 Ga0496124_0675300 3300048927 Bacteria 659
755 Ga0496125_0049086 3300048928 Bacteria 3511
756 Ga0496125_0119039 3300048928 Bacteria 1889
757 Ga0496125_0170718 3300048928 Bacteria 1462
758 Ga0496125_0401794 3300048928 Bacteria 800
759 Ga0496125_0433316 3300048928 Bacteria 758
760 Ga0496125_0457406 3300048928 Bacteria 729
761 Ga0496126_0870075 3300048929 Bacteria 686
762 Ga0501308_000396 3300049128 Bacteria 2777
763 Ga0501309_041317 3300049129 Bacteria 705
764 Ga0495678_000396 3300049459 Bacteria 43995
765 Ga0495678_000436 3300049459 Bacteria 41678
766 Ga0495678_018442 3300049459 Bacteria 3137
767 Ga0495678_032135 3300049459 Bacteria 2180
768 Ga0495678_128130 3300049459 Bacteria 844
769 Ga0495682_0000354 3300049460 Bacteria 33649
770 Ga0495682_0001087 3300049460 Bacteria 15940
771 Ga0495682_0006848 3300049460 Bacteria 4588
772 Ga0495682_0014657 3300049460 Bacteria 2971
773 Ga0495682_0155721 3300049460 Bacteria 814
774 Ga0501034_0747747 3300049571 Bacteria 873
775 Ga0501036_0845636 3300049572 Bacteria 752
776 Ga0501047_0225511 3300049581 Bacteria 1729
777 Ga0501227_010529 3300049665 Bacteria 2006
778 Ga0501235_176935 3300049669 Bacteria 567
779 Ga0501248_004688 3300049678 Bacteria 1045
780 Ga0501279_000371 3300049775 Bacteria 5993
781 Ga0501044_0514858 3300049823 Bacteria 1097
782 Ga0466962_0030852 3300061719 Bacteria 2566
783 Ga0466962_0166831 3300061719 Bacteria 1071
784 Ga0466962_0245428 3300061719 Bacteria 879
785 Ga0466962_0485485 3300061719 Bacteria 624
786 Ga0466962_0610881 3300061719 Bacteria 556

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046453 Ga0495627_062735 Ga0495627_062735_19_246 74
2 3300046513 Ga0495616_0033261 Ga0495616_0033261_2451_2678 74
3 iso_pu_bacteria 2600255292 2601668744 79
4 iso_pu_bacteria 2857547612 2857551441 79
5 iso_pu_bacteria 2932410948 2932414295 79
6 iso_pu_bacteria 2932416698 2932416904 79
7 iso_pu_bacteria 2643221554 2643791416 80
8 iso_pu_bacteria 2643221638 2644212775 80
9 iso_pu_bacteria 2643221664 2644354879 80
10 iso_pu_bacteria 2738541280 2738737977 80
11 iso_pu_bacteria 2738541300 2738842187 80
12 iso_pu_bacteria 2885080285 2885082732 80
13 3300005288 Ga0065714_10389072 Ga0065714_103890722 83
14 3300014497 Ga0182008_10000928 Ga0182008_100009285 83
15 3300015261 Ga0182006_1000006 Ga0182006_1000006125 83
16 3300015262 Ga0182007_10000013 Ga0182007_10000013104 83
17 3300015265 Ga0182005_1000001 Ga0182005_1000001370 83
18 3300017792 Ga0163161_10071036 Ga0163161_100710363 83
19 3300032004 Ga0307414_10330545 Ga0307414_103305453 83
20 3300032005 Ga0307411_10660145 Ga0307411_106601452 83
21 3300044673 Ga0453683_0073893 Ga0453683_0073893_1412_1666 83
22 3300048914 Ga0496111_0049467 Ga0496111_0049467_752_1006 83
23 3300048919 Ga0496116_0020670 Ga0496116_0020670_3734_3988 83
24 3300048920 Ga0496117_0000001 Ga0496117_0000001_248701_248955 83
25 3300048921 Ga0496118_0000002 Ga0496118_0000002_248701_248955 83
26 3300048922 Ga0496119_0442628 Ga0496119_0442628_138_392 83
27 3300048924 Ga0496121_0000709 Ga0496121_0000709_12208_12474 83
28 3300048924 Ga0496121_0053734 Ga0496121_0053734_1526_1780 83
29 3300048925 Ga0496122_0000660 Ga0496122_0000660_15104_15358 83
30 3300048926 Ga0496123_0002832 Ga0496123_0002832_18231_18485 83
31 3300048928 Ga0496125_0119039 Ga0496125_0119039_448_702 83
32 3300048928 Ga0496125_0170718 Ga0496125_0170718_1126_1380 83
33 3300002739 JGI25158J39367_1000579 JGI25158J39367_10005797 84
34 3300002739 JGI25158J39367_1002308 JGI25158J39367_10023082 84
35 3300002773 JGI25152J39213_1000071 JGI25152J39213_100007114 84
36 3300002774 JGI25150J39212_1000674 JGI25150J39212_10006745 84
37 3300002774 JGI25150J39212_1002059 JGI25150J39212_10020595 84
38 3300002987 JGI25159J45721_1008136 JGI25159J45721_10081362 84
39 3300002987 JGI25159J45721_1012506 JGI25159J45721_10125062 84
40 3300002987 JGI25159J45721_1012543 JGI25159J45721_10125433 84
41 3300003322 rootL2_10126347 rootL2_101263472 84
42 3300003322 rootL2_10147025 rootL2_101470252 84
43 3300003354 JGI25160J50197_1020158 JGI25160J50197_10201582 84
44 3300003374 JGI25161J50226_1000444 JGI25161J50226_100044411 84
45 3300003374 JGI25161J50226_1001769 JGI25161J50226_10017692 84
46 3300003759 Ga0055525_1000008 Ga0055525_1000008125 84
47 3300003771 Ga0055526_1001492 Ga0055526_10014923 84
48 3300003771 Ga0055526_1006009 Ga0055526_10060094 84
49 3300003773 Ga0055537_1001232 Ga0055537_10012327 84
50 3300003773 Ga0055537_1013963 Ga0055537_10139631 84
51 3300003773 Ga0055537_1044583 Ga0055537_10445832 84
52 3300003773 Ga0055537_1046777 Ga0055537_10467772 84
53 3300003775 Ga0055524_1000112 Ga0055524_100011229 84
54 3300003775 Ga0055524_1000241 Ga0055524_100024141 84
55 3300003775 Ga0055524_1000430 Ga0055524_100043011 84
56 3300003775 Ga0055524_1001460 Ga0055524_100146013 84
57 3300003775 Ga0055524_1003339 Ga0055524_10033392 84
58 3300003775 Ga0055524_1005319 Ga0055524_10053193 84
59 3300003784 Ga0055534_1002678 Ga0055534_10026783 84
60 3300003784 Ga0055534_1021893 Ga0055534_10218932 84
61 3300003790 Ga0055528_1042731 Ga0055528_10427312 84
62 3300003790 Ga0055528_1077201 Ga0055528_10772011 84
63 3300003791 Ga0055530_10000365 Ga0055530_1000036527 84
64 3300003791 Ga0055530_10002070 Ga0055530_100020704 84
65 3300003791 Ga0055530_10005292 Ga0055530_100052923 84
66 3300003794 Ga0055531_10001721 Ga0055531_100017219 84
67 3300003794 Ga0055531_10063307 Ga0055531_100633072 84
68 3300004625 Ga0055543_1000231 Ga0055543_100023112 84
69 3300004625 Ga0055543_1011867 Ga0055543_10118673 84
70 3300004625 Ga0055543_1028851 Ga0055543_10288511 84
71 3300005262 Ga0065165_1000524 Ga0065165_100052439 84
72 3300005262 Ga0065165_1001165 Ga0065165_100116516 84
73 3300005262 Ga0065165_1002198 Ga0065165_100219816 84
74 3300005262 Ga0065165_1023081 Ga0065165_10230812 84
75 3300005262 Ga0065165_1128847 Ga0065165_11288472 84
76 3300005327 Ga0070658_10133976 Ga0070658_101339762 84
77 3300005327 Ga0070658_10203631 Ga0070658_102036312 84
78 3300005327 Ga0070658_10216881 Ga0070658_102168811 84
79 3300005327 Ga0070658_10475721 Ga0070658_104757212 84
80 3300005327 Ga0070658_10603431 Ga0070658_106034311 84
81 3300005336 Ga0070680_100165357 Ga0070680_1001653572 84
82 3300005339 Ga0070660_100243467 Ga0070660_1002434672 84
83 3300005339 Ga0070660_100583750 Ga0070660_1005837502 84
84 3300005344 Ga0070661_100097890 Ga0070661_1000978902 84
85 3300005354 Ga0070675_101509366 Ga0070675_1015093662 84
86 3300005366 Ga0070659_100008805 Ga0070659_1000088056 84
87 3300005366 Ga0070659_100215526 Ga0070659_1002155262 84
88 3300005366 Ga0070659_100542820 Ga0070659_1005428201 84
89 3300005459 Ga0068867_101987076 Ga0068867_1019870762 84
90 3300005563 Ga0068855_100019577 Ga0068855_1000195772 84
91 3300005564 Ga0070664_100109699 Ga0070664_1001096993 84
92 3300005614 Ga0068856_100221826 Ga0068856_1002218262 84
93 3300005844 Ga0068862_102600123 Ga0068862_1026001232 84
94 3300006948 Ga0099826_10000001 Ga0099826_1000000127 84
95 3300009148 Ga0105243_10288279 Ga0105243_102882792 84
96 3300009174 Ga0105241_10051139 Ga0105241_100511393 84
97 3300009176 Ga0105242_10320572 Ga0105242_103205722 84
98 3300009176 Ga0105242_11415208 Ga0105242_114152081 84
99 3300009551 Ga0105238_10454555 Ga0105238_104545552 84
100 3300010375 Ga0105239_10303242 Ga0105239_103032422 84
101 3300010375 Ga0105239_11684646 Ga0105239_116846462 84
102 3300011119 Ga0105246_10393759 Ga0105246_103937592 84
103 3300013100 Ga0157373_10425748 Ga0157373_104257482 84
104 3300013297 Ga0157378_12658677 Ga0157378_126586771 84
105 3300013307 Ga0157372_10924647 Ga0157372_109246471 84
106 3300013307 Ga0157372_11024632 Ga0157372_110246322 84
107 3300013307 Ga0157372_11254955 Ga0157372_112549552 84
108 3300025208 Ga0209436_100068 Ga0209436_10006824 84
109 3300025208 Ga0209436_108578 Ga0209436_1085782 84
110 3300025208 Ga0209436_112327 Ga0209436_1123273 84
111 3300025230 Ga0209563_100003 Ga0209563_1000031209 84
112 3300025245 Ga0207425_1000001 Ga0207425_1000001456 84
113 3300025245 Ga0207425_1000406 Ga0207425_10004063 84
114 3300025245 Ga0207425_1008655 Ga0207425_10086553 84
115 3300025253 Ga0209677_110147 Ga0209677_1101472 84
116 3300025254 Ga0209148_1001390 Ga0209148_10013907 84
117 3300025258 Ga0209129_1000003 Ga0209129_1000003456 84
118 3300025258 Ga0209129_1000629 Ga0209129_10006291 84
119 3300025258 Ga0209129_1012331 Ga0209129_10123312 84
120 3300025263 Ga0209565_1001956 Ga0209565_10019562 84
121 3300025263 Ga0209565_1002640 Ga0209565_10026403 84
122 3300025263 Ga0209565_1004025 Ga0209565_10040253 84
123 3300025263 Ga0209565_1019464 Ga0209565_10194642 84
124 3300025263 Ga0209565_1037685 Ga0209565_10376852 84
125 3300025273 Ga0209673_1054516 Ga0209673_10545162 84
126 3300025284 Ga0209130_1000046 Ga0209130_1000046191 84
127 3300025284 Ga0209130_1000439 Ga0209130_100043912 84
128 3300025284 Ga0209130_1014076 Ga0209130_10140762 84
129 3300025291 Ga0209675_1003121 Ga0209675_10031212 84
130 3300025291 Ga0209675_1008638 Ga0209675_10086383 84
131 3300025295 Ga0209564_1000199 Ga0209564_1000199109 84
132 3300025295 Ga0209564_1003392 Ga0209564_100339211 84
133 3300025295 Ga0209564_1012833 Ga0209564_10128333 84
134 3300025297 Ga0209758_1000098 Ga0209758_1000098167 84
135 3300025298 Ga0209050_1000089 Ga0209050_100008912 84
136 3300025298 Ga0209050_1000293 Ga0209050_10002939 84
137 3300025298 Ga0209050_1002894 Ga0209050_10028944 84
138 3300025298 Ga0209050_1033313 Ga0209050_10333133 84
139 3300025299 Ga0209256_1000007 Ga0209256_1000007856 84
140 3300025299 Ga0209256_1000163 Ga0209256_100016311 84
141 3300025299 Ga0209256_1000334 Ga0209256_10003347 84
142 3300025299 Ga0209256_1003697 Ga0209256_10036972 84
143 3300025302 Ga0207426_1008182 Ga0207426_10081822 84
144 3300025302 Ga0207426_1029215 Ga0207426_10292153 84
145 3300025302 Ga0207426_1046051 Ga0207426_10460512 84
146 3300025304 Ga0209257_1000003 Ga0209257_1000003541 84
147 3300025304 Ga0209257_1002480 Ga0209257_10024804 84
148 3300025909 Ga0207705_10003593 Ga0207705_100035939 84
149 3300025909 Ga0207705_10254351 Ga0207705_102543512 84
150 3300025909 Ga0207705_10513200 Ga0207705_105132002 84
151 3300025909 Ga0207705_10536186 Ga0207705_105361861 84
152 3300025911 Ga0207654_10018085 Ga0207654_100180853 84
153 3300025917 Ga0207660_10289533 Ga0207660_102895332 84
154 3300025919 Ga0207657_10078851 Ga0207657_100788512 84
155 3300025919 Ga0207657_10079543 Ga0207657_100795433 84
156 3300025919 Ga0207657_10204679 Ga0207657_102046792 84
157 3300025920 Ga0207649_10548241 Ga0207649_105482412 84
158 3300025924 Ga0207694_10418137 Ga0207694_104181372 84
159 3300025926 Ga0207659_11023002 Ga0207659_110230022 84
160 3300025932 Ga0207690_10548683 Ga0207690_105486832 84
161 3300025932 Ga0207690_10565467 Ga0207690_105654672 84
162 3300025934 Ga0207686_10166257 Ga0207686_101662572 84
163 3300025934 Ga0207686_10592209 Ga0207686_105922092 84
164 3300025935 Ga0207709_10072707 Ga0207709_100727073 84
165 3300025945 Ga0207679_10489915 Ga0207679_104899151 84
166 3300025945 Ga0207679_10703591 Ga0207679_107035912 84
167 3300025949 Ga0207667_10079199 Ga0207667_100791993 84
168 3300025949 Ga0207667_10160470 Ga0207667_101604703 84
169 3300025949 Ga0207667_10749399 Ga0207667_107493992 84
170 3300026078 Ga0207702_10417861 Ga0207702_104178612 84
171 3300026089 Ga0207648_11592376 Ga0207648_115923762 84
172 3300026116 Ga0207674_10236175 Ga0207674_102361752 84
173 3300027666 Ga0209282_1000001 Ga0209282_10000011167 84
174 3300030731 Ga0316177_1132650 Ga0316177_11326502 84
175 3300031548 Ga0307408_100000123 Ga0307408_10000012365 84
176 3300031548 Ga0307408_100004417 Ga0307408_1000044177 84
177 3300031548 Ga0307408_100029542 Ga0307408_1000295423 84
178 3300031548 Ga0307408_100196188 Ga0307408_1001961882 84
179 3300032002 Ga0307416_100315420 Ga0307416_1003154202 84
180 3300034816 Ga0373930_0143191 Ga0373930_0143191_40_297 84
181 3300037312 Ga0395899_0009955 Ga0395899_0009955_5859_6116 84
182 3300037312 Ga0395899_0015351 Ga0395899_0015351_3134_3391 84
183 3300037312 Ga0395899_0105701 Ga0395899_0105701_459_716 84
184 3300037312 Ga0395899_0159133 Ga0395899_0159133_1155_1412 84
185 3300037312 Ga0395899_0211673 Ga0395899_0211673_703_960 84
186 3300037312 Ga0395899_0313513 Ga0395899_0313513_539_796 84
187 3300037312 Ga0395899_0343439 Ga0395899_0343439_65_322 84
188 3300037312 Ga0395899_0496487 Ga0395899_0496487_262_519 84
189 3300037418 Ga0395900_0002250 Ga0395900_0002250_14317_14574 84
190 3300037418 Ga0395900_0015351 Ga0395900_0015351_5470_5727 84
191 3300037418 Ga0395900_0025781 Ga0395900_0025781_1558_1815 84
192 3300037418 Ga0395900_0105677 Ga0395900_0105677_991_1248 84
193 3300037418 Ga0395900_0125215 Ga0395900_0125215_243_500 84
194 3300037418 Ga0395900_0320863 Ga0395900_0320863_1237_1494 84
195 3300037418 Ga0395900_0516832 Ga0395900_0516832_131_388 84
196 3300037418 Ga0395900_0571349 Ga0395900_0571349_380_637 84
197 3300037418 Ga0395900_0614249 Ga0395900_0614249_672_929 84
198 3300037418 Ga0395900_1108491 Ga0395900_1108491_262_519 84
199 3300037418 Ga0395900_1678200 Ga0395900_1678200_221_478 84
200 3300037466 Ga0395898_0012375 Ga0395898_0012375_6382_6639 84
201 3300037466 Ga0395898_0093030 Ga0395898_0093030_54_311 84
202 3300037466 Ga0395898_0295099 Ga0395898_0295099_168_425 84
203 3300037466 Ga0395898_1065840 Ga0395898_1065840_79_336 84
204 3300037466 Ga0395898_1159007 Ga0395898_1159007_138_395 84
205 3300037471 Ga0395905_0046228 Ga0395905_0046228_2877_3134 84
206 3300037471 Ga0395905_0064643 Ga0395905_0064643_1180_1437 84
207 3300037471 Ga0395905_0064975 Ga0395905_0064975_2910_3167 84
208 3300037471 Ga0395905_0069638 Ga0395905_0069638_1399_1656 84
209 3300037471 Ga0395905_0085384 Ga0395905_0085384_743_1000 84
210 3300037471 Ga0395905_0234494 Ga0395905_0234494_78_335 84
211 3300037471 Ga0395905_0483815 Ga0395905_0483815_615_872 84
212 3300037471 Ga0395905_0614825 Ga0395905_0614825_481_738 84
213 3300037471 Ga0395905_0622813 Ga0395905_0622813_129_386 84
214 3300037471 Ga0395905_1226922 Ga0395905_1226922_386_643 84
215 3300037471 Ga0395905_1256655 Ga0395905_1256655_332_589 84
216 3300037471 Ga0395905_1506545 Ga0395905_1506545_149_406 84
217 3300038443 Ga0395901_0067361 Ga0395901_0067361_1356_1613 84
218 3300038443 Ga0395901_0069009 Ga0395901_0069009_598_855 84
219 3300038443 Ga0395901_0369829 Ga0395901_0369829_363_620 84
220 3300038443 Ga0395901_0505784 Ga0395901_0505784_466_723 84
221 3300038443 Ga0395901_0596182 Ga0395901_0596182_186_443 84
222 3300038443 Ga0395901_0692724 Ga0395901_0692724_387_644 84
223 3300038443 Ga0395901_0715651 Ga0395901_0715651_474_731 84
224 3300038443 Ga0395901_0751262 Ga0395901_0751262_559_816 84
225 3300038443 Ga0395901_1094931 Ga0395901_1094931_43_300 84
226 3300038443 Ga0395901_1355420 Ga0395901_1355420_112_369 84
227 3300038443 Ga0395901_1503843 Ga0395901_1503843_213_470 84
228 3300041413 Ga0439465_0013374 Ga0439465_0013374_1100_1357 84
229 3300042005 Ga0439448_0007022 Ga0439448_0007022_2108_2365 84
230 3300042007 Ga0439449_0020805 Ga0439449_0020805_527_784 84
231 3300042008 Ga0439450_008858 Ga0439450_008858_707_964 84
232 3300042008 Ga0439450_059202 Ga0439450_059202_528_785 84
233 3300042012 Ga0439455_0008577 Ga0439455_0008577_1285_1542 84
234 3300042139 Ga0450904_002774 Ga0450904_002774_1209_1466 84
235 3300042145 Ga0450906_080459 Ga0450906_080459_178_435 84
236 3300042157 Ga0439458_0011679 Ga0439458_0011679_260_517 84
237 3300042157 Ga0439458_0032427 Ga0439458_0032427_643_900 84
238 3300042157 Ga0439458_0078355 Ga0439458_0078355_175_432 84
239 3300042157 Ga0439458_0103878 Ga0439458_0103878_323_580 84
240 3300042532 Ga0450893_0096019 Ga0450893_0096019_146_403 84
241 3300044656 Ga0466969_0319789 Ga0466969_0319789_431_688 84
242 3300044656 Ga0466969_0549366 Ga0466969_0549366_140_397 84
243 3300044658 Ga0466972_0000549 Ga0466972_0000549_5651_5908 84
244 3300044658 Ga0466972_0131866 Ga0466972_0131866_219_476 84
245 3300044683 Ga0466965_0000621 Ga0466965_0000621_8321_8578 84
246 3300044683 Ga0466965_0075058 Ga0466965_0075058_153_410 84
247 3300044683 Ga0466965_0689312 Ga0466965_0689312_257_514 84
248 3300044684 Ga0466966_0012545 Ga0466966_0012545_2749_3006 84
249 3300044684 Ga0466966_0034261 Ga0466966_0034261_95_352 84
250 3300044684 Ga0466966_0036911 Ga0466966_0036911_987_1244 84
251 3300044684 Ga0466966_0067176 Ga0466966_0067176_1602_1859 84
252 3300044684 Ga0466966_0139170 Ga0466966_0139170_981_1238 84
253 3300044684 Ga0466966_0171439 Ga0466966_0171439_589_846 84
254 3300044684 Ga0466966_0362998 Ga0466966_0362998_530_787 84
255 3300044684 Ga0466966_0528990 Ga0466966_0528990_225_482 84
256 3300044693 Ga0466961_0042988 Ga0466961_0042988_2238_2498 84
257 3300044693 Ga0466961_0329509 Ga0466961_0329509_422_679 84
258 3300044693 Ga0466961_0379287 Ga0466961_0379287_114_371 84
259 3300044693 Ga0466961_0401695 Ga0466961_0401695_128_385 84
260 3300044693 Ga0466961_0875005 Ga0466961_0875005_172_429 84
261 3300044694 Ga0466963_0081562 Ga0466963_0081562_193_450 84
262 3300044706 Ga0466964_0001638 Ga0466964_0001638_7049_7306 84
263 3300044706 Ga0466964_0270230 Ga0466964_0270230_102_359 84
264 3300044706 Ga0466964_0367343 Ga0466964_0367343_459_716 84
265 3300044719 Ga0466971_0458552 Ga0466971_0458552_130_387 84
266 3300044735 Ga0466968_0010867 Ga0466968_0010867_693_950 84
267 3300044735 Ga0466968_0176250 Ga0466968_0176250_652_909 84
268 3300044765 Ga0466970_0048267 Ga0466970_0048267_1479_1736 84
269 3300044765 Ga0466970_0152945 Ga0466970_0152945_57_314 84
270 3300044765 Ga0466970_0200617 Ga0466970_0200617_515_772 84
271 3300044765 Ga0466970_0635186 Ga0466970_0635186_174_431 84
272 3300044765 Ga0466970_0728260 Ga0466970_0728260_249_506 84
273 3300044842 Ga0466957_0000081 Ga0466957_0000081_30878_31135 84
274 3300044842 Ga0466957_0014682 Ga0466957_0014682_1835_2092 84
275 3300044842 Ga0466957_0155604 Ga0466957_0155604_507_764 84
276 3300044842 Ga0466957_0828195 Ga0466957_0828195_336_593 84
277 3300044901 Ga0466960_0128844 Ga0466960_0128844_488_745 84
278 3300044901 Ga0466960_0598429 Ga0466960_0598429_225_482 84
279 3300044901 Ga0466960_0678627 Ga0466960_0678627_265_522 84
280 3300045049 Ga0466959_0029643 Ga0466959_0029643_1049_1306 84
281 3300045049 Ga0466959_0044919 Ga0466959_0044919_1523_1780 84
282 3300045049 Ga0466959_0179720 Ga0466959_0179720_702_959 84
283 3300045049 Ga0466959_0317495 Ga0466959_0317495_485_742 84
284 3300045049 Ga0466959_0344590 Ga0466959_0344590_281_538 84
285 3300045049 Ga0466959_0927794 Ga0466959_0927794_62_319 84
286 3300045836 Ga0466958_0321197 Ga0466958_0321197_162_419 84
287 3300045836 Ga0466958_0523941 Ga0466958_0523941_19_276 84
288 3300045976 Ga0466967_0004448 Ga0466967_0004448_7760_8017 84
289 3300045976 Ga0466967_0124054 Ga0466967_0124054_504_761 84
290 3300045976 Ga0466967_1934530 Ga0466967_1934530_124_381 84
291 3300046452 Ga0495617_000012 Ga0495617_000012_274691_274948 84
292 3300046452 Ga0495617_016820 Ga0495617_016820_80_337 84
293 3300046452 Ga0495617_021284 Ga0495617_021284_1693_1950 84
294 3300046452 Ga0495617_034355 Ga0495617_034355_135_392 84
295 3300046453 Ga0495627_000475 Ga0495627_000475_15876_16133 84
296 3300046453 Ga0495627_003935 Ga0495627_003935_1999_2256 84
297 3300046455 Ga0495603_0032245 Ga0495603_0032245_1564_1821 84
298 3300046455 Ga0495603_0178361 Ga0495603_0178361_714_971 84
299 3300046457 Ga0495590_0000498 Ga0495590_0000498_7031_7288 84
300 3300046457 Ga0495590_0001605 Ga0495590_0001605_6655_6912 84
301 3300046457 Ga0495590_0010457 Ga0495590_0010457_1063_1320 84
302 3300046457 Ga0495590_0069538 Ga0495590_0069538_575_832 84
303 3300046457 Ga0495590_0095945 Ga0495590_0095945_404_661 84
304 3300046457 Ga0495590_0368379 Ga0495590_0368379_182_439 84
305 3300046458 Ga0495591_008285 Ga0495591_008285_2815_3072 84
306 3300046459 Ga0495629_0004585 Ga0495629_0004585_4040_4297 84
307 3300046459 Ga0495629_0011922 Ga0495629_0011922_1436_1693 84
308 3300046459 Ga0495629_0724648 Ga0495629_0724648_156_413 84
309 3300046460 Ga0495638_0002150 Ga0495638_0002150_14293_14550 84
310 3300046460 Ga0495638_0082402 Ga0495638_0082402_1513_1770 84
311 3300046460 Ga0495638_0112346 Ga0495638_0112346_721_978 84
312 3300046460 Ga0495638_0276680 Ga0495638_0276680_384_641 84
313 3300046463 Ga0495653_0067100 Ga0495653_0067100_1676_1933 84
314 3300046463 Ga0495653_0109603 Ga0495653_0109603_1165_1422 84
315 3300046463 Ga0495653_0131685 Ga0495653_0131685_477_734 84
316 3300046463 Ga0495653_0155153 Ga0495653_0155153_444_701 84
317 3300046471 Ga0495650_0000001 Ga0495650_0000001_833377_833634 84
318 3300046471 Ga0495650_0016048 Ga0495650_0016048_1965_2222 84
319 3300046472 Ga0495580_0054723 Ga0495580_0054723_742_999 84
320 3300046473 Ga0495582_0041498 Ga0495582_0041498_184_441 84
321 3300046473 Ga0495582_0073053 Ga0495582_0073053_277_534 84
322 3300046474 Ga0495605_0000138 Ga0495605_0000138_88140_88397 84
323 3300046474 Ga0495605_0000432 Ga0495605_0000432_20513_20770 84
324 3300046474 Ga0495605_0001199 Ga0495605_0001199_12275_12532 84
325 3300046474 Ga0495605_0012130 Ga0495605_0012130_1800_2057 84
326 3300046474 Ga0495605_0028552 Ga0495605_0028552_954_1211 84
327 3300046474 Ga0495605_0395807 Ga0495605_0395807_279_536 84
328 3300046491 Ga0495584_0001597 Ga0495584_0001597_1869_2126 84
329 3300046491 Ga0495584_0002301 Ga0495584_0002301_2293_2550 84
330 3300046491 Ga0495584_0006033 Ga0495584_0006033_5458_5715 84
331 3300046491 Ga0495584_0008438 Ga0495584_0008438_2832_3089 84
332 3300046491 Ga0495584_0036393 Ga0495584_0036393_66_323 84
333 3300046491 Ga0495584_0037484 Ga0495584_0037484_529_786 84
334 3300046491 Ga0495584_0043548 Ga0495584_0043548_1401_1658 84
335 3300046491 Ga0495584_0061006 Ga0495584_0061006_900_1157 84
336 3300046491 Ga0495584_0068051 Ga0495584_0068051_1066_1335 84
337 3300046492 Ga0495585_0009363 Ga0495585_0009363_3476_3733 84
338 3300046492 Ga0495585_0021076 Ga0495585_0021076_1284_1541 84
339 3300046492 Ga0495585_0023784 Ga0495585_0023784_2536_2793 84
340 3300046492 Ga0495585_0041219 Ga0495585_0041219_516_773 84
341 3300046492 Ga0495585_0053894 Ga0495585_0053894_770_1027 84
342 3300046492 Ga0495585_0072488 Ga0495585_0072488_531_788 84
343 3300046492 Ga0495585_0081578 Ga0495585_0081578_211_468 84
344 3300046492 Ga0495585_0324373 Ga0495585_0324373_378_635 84
345 3300046492 Ga0495585_0410265 Ga0495585_0410265_305_562 84
346 3300046492 Ga0495585_0410267 Ga0495585_0410267_90_347 84
347 3300046492 Ga0495585_0526929 Ga0495585_0526929_269_526 84
348 3300046499 Ga0495594_0067953 Ga0495594_0067953_816_1073 84
349 3300046499 Ga0495594_0130298 Ga0495594_0130298_13_270 84
350 3300046499 Ga0495594_0306338 Ga0495594_0306338_357_614 84
351 3300046499 Ga0495594_0482332 Ga0495594_0482332_256_513 84
352 3300046499 Ga0495594_0559967 Ga0495594_0559967_146_403 84
353 3300046499 Ga0495594_0572668 Ga0495594_0572668_199_456 84
354 3300046499 Ga0495594_0587536 Ga0495594_0587536_44_301 84
355 3300046500 Ga0495596_0005697 Ga0495596_0005697_4946_5203 84
356 3300046500 Ga0495596_0006440 Ga0495596_0006440_3012_3269 84
357 3300046500 Ga0495596_0015461 Ga0495596_0015461_2248_2505 84
358 3300046500 Ga0495596_0038264 Ga0495596_0038264_1313_1570 84
359 3300046500 Ga0495596_0044179 Ga0495596_0044179_571_828 84
360 3300046500 Ga0495596_0092449 Ga0495596_0092449_871_1128 84
361 3300046501 Ga0495607_0002283 Ga0495607_0002283_15282_15539 84
362 3300046501 Ga0495607_0002389 Ga0495607_0002389_1520_1777 84
363 3300046501 Ga0495607_0004309 Ga0495607_0004309_8628_8885 84
364 3300046501 Ga0495607_0008277 Ga0495607_0008277_1335_1592 84
365 3300046501 Ga0495607_0008330 Ga0495607_0008330_5101_5358 84
366 3300046501 Ga0495607_0008584 Ga0495607_0008584_5141_5398 84
367 3300046501 Ga0495607_0032362 Ga0495607_0032362_295_552 84
368 3300046501 Ga0495607_0036971 Ga0495607_0036971_908_1165 84
369 3300046501 Ga0495607_0057416 Ga0495607_0057416_439_696 84
370 3300046501 Ga0495607_0064713 Ga0495607_0064713_1136_1393 84
371 3300046501 Ga0495607_0070014 Ga0495607_0070014_72_329 84
372 3300046501 Ga0495607_0078079 Ga0495607_0078079_32_289 84
373 3300046501 Ga0495607_0080850 Ga0495607_0080850_932_1189 84
374 3300046501 Ga0495607_0200618 Ga0495607_0200618_96_353 84
375 3300046501 Ga0495607_0226698 Ga0495607_0226698_344_601 84
376 3300046506 Ga0495583_0000026 Ga0495583_0000026_199760_200017 84
377 3300046506 Ga0495583_0000113 Ga0495583_0000113_44346_44603 84
378 3300046506 Ga0495583_0004818 Ga0495583_0004818_1454_1711 84
379 3300046506 Ga0495583_0008975 Ga0495583_0008975_1758_2015 84
380 3300046506 Ga0495583_0026429 Ga0495583_0026429_1093_1350 84
381 3300046506 Ga0495583_0143665 Ga0495583_0143665_660_917 84
382 3300046507 Ga0495606_0002776 Ga0495606_0002776_7743_8000 84
383 3300046507 Ga0495606_0022152 Ga0495606_0022152_970_1227 84
384 3300046507 Ga0495606_0166156 Ga0495606_0166156_551_808 84
385 3300046507 Ga0495606_0173188 Ga0495606_0173188_211_468 84
386 3300046507 Ga0495606_0240537 Ga0495606_0240537_13_270 84
387 3300046507 Ga0495606_0352223 Ga0495606_0352223_418_675 84
388 3300046507 Ga0495606_0394492 Ga0495606_0394492_449_706 84
389 3300046507 Ga0495606_0444586 Ga0495606_0444586_244_507 84
390 3300046507 Ga0495606_0467192 Ga0495606_0467192_136_393 84
391 3300046507 Ga0495606_0654141 Ga0495606_0654141_235_492 84
392 3300046512 Ga0495610_0241736 Ga0495610_0241736_310_567 84
393 3300046513 Ga0495616_0000037 Ga0495616_0000037_117296_117553 84
394 3300046513 Ga0495616_0002017 Ga0495616_0002017_7184_7441 84
395 3300046513 Ga0495616_0013490 Ga0495616_0013490_2047_2304 84
396 3300046513 Ga0495616_0015525 Ga0495616_0015525_3447_3704 84
397 3300046513 Ga0495616_0022187 Ga0495616_0022187_1037_1294 84
398 3300046513 Ga0495616_0034392 Ga0495616_0034392_1009_1266 84
399 3300046513 Ga0495616_0074992 Ga0495616_0074992_507_764 84
400 3300046513 Ga0495616_0121975 Ga0495616_0121975_34_291 84
401 3300046513 Ga0495616_0152537 Ga0495616_0152537_718_975 84
402 3300046517 Ga0495630_0030210 Ga0495630_0030210_803_1060 84
403 3300046518 Ga0495631_0000856 Ga0495631_0000856_3400_3657 84
404 3300046518 Ga0495631_0004211 Ga0495631_0004211_411_668 84
405 3300046518 Ga0495631_0024273 Ga0495631_0024273_2149_2406 84
406 3300046518 Ga0495631_0037819 Ga0495631_0037819_1158_1415 84
407 3300046518 Ga0495631_0041802 Ga0495631_0041802_230_487 84
408 3300046518 Ga0495631_0054934 Ga0495631_0054934_1398_1655 84
409 3300046518 Ga0495631_0073170 Ga0495631_0073170_468_737 84
410 3300046518 Ga0495631_0115868 Ga0495631_0115868_249_506 84
411 3300046518 Ga0495631_0148847 Ga0495631_0148847_155_412 84
412 3300046518 Ga0495631_0219104 Ga0495631_0219104_179_436 84
413 3300046518 Ga0495631_0302447 Ga0495631_0302447_106_363 84
414 3300046518 Ga0495631_0319674 Ga0495631_0319674_383_640 84
415 3300046518 Ga0495631_0362976 Ga0495631_0362976_237_494 84
416 3300046519 Ga0495632_0000018 Ga0495632_0000018_204833_205096 84
417 3300046519 Ga0495632_0000988 Ga0495632_0000988_5818_6075 84
418 3300046519 Ga0495632_0002964 Ga0495632_0002964_2055_2312 84
419 3300046519 Ga0495632_0040968 Ga0495632_0040968_1167_1424 84
420 3300046519 Ga0495632_0211667 Ga0495632_0211667_545_802 84
421 3300046520 Ga0495637_0026325 Ga0495637_0026325_165_422 84
422 3300046520 Ga0495637_0229613 Ga0495637_0229613_92_349 84
423 3300046522 Ga0495643_0004390 Ga0495643_0004390_7278_7535 84
424 3300046522 Ga0495643_0077916 Ga0495643_0077916_1008_1265 84
425 3300046522 Ga0495643_0101622 Ga0495643_0101622_1063_1320 84
426 3300046522 Ga0495643_0153784 Ga0495643_0153784_534_791 84
427 3300046522 Ga0495643_0253921 Ga0495643_0253921_427_684 84
428 3300046522 Ga0495643_0285136 Ga0495643_0285136_224_490 84
429 3300046522 Ga0495643_0288118 Ga0495643_0288118_481_738 84
430 3300046522 Ga0495643_0430201 Ga0495643_0430201_115_372 84
431 3300046523 Ga0495644_0000829 Ga0495644_0000829_12166_12423 84
432 3300046523 Ga0495644_0002102 Ga0495644_0002102_3389_3646 84
433 3300046523 Ga0495644_0004671 Ga0495644_0004671_2177_2434 84
434 3300046523 Ga0495644_0007037 Ga0495644_0007037_3034_3291 84
435 3300046523 Ga0495644_0020842 Ga0495644_0020842_601_858 84
436 3300046523 Ga0495644_0142204 Ga0495644_0142204_384_641 84
437 3300046524 Ga0495648_0000607 Ga0495648_0000607_15818_16075 84
438 3300046524 Ga0495648_0002504 Ga0495648_0002504_14135_14392 84
439 3300046524 Ga0495648_0006132 Ga0495648_0006132_8481_8738 84
440 3300046524 Ga0495648_0006238 Ga0495648_0006238_6701_6958 84
441 3300046524 Ga0495648_0011054 Ga0495648_0011054_693_950 84
442 3300046524 Ga0495648_0017670 Ga0495648_0017670_1384_1641 84
443 3300046524 Ga0495648_0038433 Ga0495648_0038433_1965_2222 84
444 3300046525 Ga0495663_0002274 Ga0495663_0002274_3945_4202 84
445 3300046525 Ga0495663_0004275 Ga0495663_0004275_3197_3454 84
446 3300046525 Ga0495663_0050714 Ga0495663_0050714_79_336 84
447 3300046526 Ga0495666_0009518 Ga0495666_0009518_2662_2919 84
448 3300046528 Ga0495642_0000010 Ga0495642_0000010_119324_119581 84
449 3300046528 Ga0495642_0000352 Ga0495642_0000352_18617_18898 84
450 3300046528 Ga0495642_0000810 Ga0495642_0000810_2169_2426 84
451 3300046528 Ga0495642_0007615 Ga0495642_0007615_1545_1802 84
452 3300046528 Ga0495642_0008276 Ga0495642_0008276_3549_3806 84
453 3300046528 Ga0495642_0018015 Ga0495642_0018015_1081_1338 84
454 3300046528 Ga0495642_0045623 Ga0495642_0045623_871_1128 84
455 3300046528 Ga0495642_0059301 Ga0495642_0059301_1125_1382 84
456 3300046528 Ga0495642_0078145 Ga0495642_0078145_1119_1376 84
457 3300046528 Ga0495642_0103565 Ga0495642_0103565_638_895 84
458 3300046528 Ga0495642_0105842 Ga0495642_0105842_188_445 84
459 3300046528 Ga0495642_0122104 Ga0495642_0122104_582_839 84
460 3300046528 Ga0495642_0228107 Ga0495642_0228107_469_726 84
461 3300046528 Ga0495642_0439893 Ga0495642_0439893_13_270 84
462 3300046529 Ga0495652_0025910 Ga0495652_0025910_1986_2243 84
463 3300046530 Ga0495654_0004534 Ga0495654_0004534_5825_6082 84
464 3300046530 Ga0495654_0016780 Ga0495654_0016780_574_831 84
465 3300046530 Ga0495654_0019071 Ga0495654_0019071_2181_2438 84
466 3300046530 Ga0495654_0164804 Ga0495654_0164804_653_910 84
467 3300046530 Ga0495654_0346460 Ga0495654_0346460_105_362 84
468 3300046530 Ga0495654_0410524 Ga0495654_0410524_256_513 84
469 3300046531 Ga0495665_0021110 Ga0495665_0021110_2971_3228 84
470 3300046531 Ga0495665_0190293 Ga0495665_0190293_218_475 84
471 3300046535 Ga0495586_0002254 Ga0495586_0002254_7141_7398 84
472 3300046535 Ga0495586_0102093 Ga0495586_0102093_1233_1490 84
473 3300046536 Ga0495587_0039023 Ga0495587_0039023_1694_1951 84
474 3300046536 Ga0495587_0048317 Ga0495587_0048317_1943_2200 84
475 3300046538 Ga0495609_0000001 Ga0495609_0000001_622541_622798 84
476 3300046538 Ga0495609_0000142 Ga0495609_0000142_7511_7768 84
477 3300046538 Ga0495609_0001633 Ga0495609_0001633_1376_1633 84
478 3300046538 Ga0495609_0006249 Ga0495609_0006249_403_660 84
479 3300046538 Ga0495609_0008994 Ga0495609_0008994_1569_1826 84
480 3300046538 Ga0495609_0041688 Ga0495609_0041688_1694_1951 84
481 3300046538 Ga0495609_0110941 Ga0495609_0110941_197_454 84
482 3300046538 Ga0495609_0202904 Ga0495609_0202904_363_620 84
483 3300046538 Ga0495609_0328276 Ga0495609_0328276_112_369 84
484 3300046538 Ga0495609_0339717 Ga0495609_0339717_308_565 84
485 3300046542 Ga0495597_0000967 Ga0495597_0000967_18881_19138 84
486 3300046542 Ga0495597_0001038 Ga0495597_0001038_19019_19276 84
487 3300046542 Ga0495597_0001317 Ga0495597_0001317_8414_8671 84
488 3300046542 Ga0495597_0002421 Ga0495597_0002421_9425_9682 84
489 3300046542 Ga0495597_0007941 Ga0495597_0007941_4890_5147 84
490 3300046542 Ga0495597_0009210 Ga0495597_0009210_1252_1509 84
491 3300046542 Ga0495597_0037773 Ga0495597_0037773_1751_2008 84
492 3300046542 Ga0495597_0084574 Ga0495597_0084574_448_705 84
493 3300046542 Ga0495597_0222786 Ga0495597_0222786_296_553 84
494 3300046543 Ga0495645_0100590 Ga0495645_0100590_286_543 84
495 3300046557 Ga0495622_0001153 Ga0495622_0001153_11593_11856 84
496 3300046557 Ga0495622_0087447 Ga0495622_0087447_1080_1337 84
497 3300046557 Ga0495622_0148965 Ga0495622_0148965_723_980 84
498 3300046557 Ga0495622_0271177 Ga0495622_0271177_246_503 84
499 3300046557 Ga0495622_0516203 Ga0495622_0516203_201_458 84
500 3300046558 Ga0495633_0001497 Ga0495633_0001497_5488_5745 84
501 3300046558 Ga0495633_0004609 Ga0495633_0004609_2105_2362 84
502 3300046558 Ga0495633_0012049 Ga0495633_0012049_3648_3905 84
503 3300046558 Ga0495633_0076253 Ga0495633_0076253_591_848 84
504 3300046558 Ga0495633_0096639 Ga0495633_0096639_835_1092 84
505 3300046558 Ga0495633_0413804 Ga0495633_0413804_98_355 84
506 3300046615 Ga0495656_0003022 Ga0495656_0003022_1791_2048 84
507 3300046615 Ga0495656_0030945 Ga0495656_0030945_510_767 84
508 3300046615 Ga0495656_0031728 Ga0495656_0031728_84_341 84
509 3300046615 Ga0495656_0134824 Ga0495656_0134824_466_723 84
510 3300046615 Ga0495656_0371208 Ga0495656_0371208_302_559 84
511 3300046615 Ga0495656_0548249 Ga0495656_0548249_229_486 84
512 3300046616 Ga0495668_0000020 Ga0495668_0000020_283763_284020 84
513 3300046616 Ga0495668_0000448 Ga0495668_0000448_31346_31603 84
514 3300046616 Ga0495668_0001463 Ga0495668_0001463_16197_16454 84
515 3300046616 Ga0495668_0005020 Ga0495668_0005020_5166_5423 84
516 3300046616 Ga0495668_0005425 Ga0495668_0005425_1313_1570 84
517 3300046616 Ga0495668_0005806 Ga0495668_0005806_1902_2159 84
518 3300046616 Ga0495668_0006550 Ga0495668_0006550_861_1118 84
519 3300046616 Ga0495668_0017187 Ga0495668_0017187_2086_2343 84
520 3300046616 Ga0495668_0074692 Ga0495668_0074692_71_328 84
521 3300046616 Ga0495668_0100758 Ga0495668_0100758_829_1086 84
522 3300046616 Ga0495668_0374907 Ga0495668_0374907_192_449 84
523 3300046642 Ga0495634_0022245 Ga0495634_0022245_1843_2100 84
524 3300046648 Ga0495611_0001473 Ga0495611_0001473_6077_6334 84
525 3300046648 Ga0495611_0001872 Ga0495611_0001872_7041_7298 84
526 3300046648 Ga0495611_0005286 Ga0495611_0005286_2970_3227 84
527 3300046648 Ga0495611_0006146 Ga0495611_0006146_186_443 84
528 3300046648 Ga0495611_0009096 Ga0495611_0009096_3293_3550 84
529 3300046648 Ga0495611_0029287 Ga0495611_0029287_1912_2169 84
530 3300046648 Ga0495611_0077310 Ga0495611_0077310_26_283 84
531 3300046660 Ga0495625_0011387 Ga0495625_0011387_1982_2239 84
532 3300046660 Ga0495625_0027230 Ga0495625_0027230_382_639 84
533 3300046660 Ga0495625_0038201 Ga0495625_0038201_1615_1872 84
534 3300046660 Ga0495625_0068427 Ga0495625_0068427_2149_2406 84
535 3300046660 Ga0495625_0093025 Ga0495625_0093025_405_662 84
536 3300046660 Ga0495625_0180046 Ga0495625_0180046_288_545 84
537 3300046660 Ga0495625_0204448 Ga0495625_0204448_510_767 84
538 3300046660 Ga0495625_0260969 Ga0495625_0260969_262_519 84
539 3300046660 Ga0495625_0571826 Ga0495625_0571826_78_335 84
540 3300046663 Ga0495635_0002174 Ga0495635_0002174_8287_8544 84
541 3300046663 Ga0495635_0082269 Ga0495635_0082269_60_317 84
542 3300046664 Ga0495659_0000063 Ga0495659_0000063_35785_36042 84
543 3300046664 Ga0495659_0000393 Ga0495659_0000393_4604_4861 84
544 3300046664 Ga0495659_0001076 Ga0495659_0001076_941_1198 84
545 3300046664 Ga0495659_0209956 Ga0495659_0209956_517_774 84
546 3300046665 Ga0495661_0000082 Ga0495661_0000082_15355_15612 84
547 3300046665 Ga0495661_0001642 Ga0495661_0001642_2140_2397 84
548 3300046665 Ga0495661_0002755 Ga0495661_0002755_10434_10691 84
549 3300046665 Ga0495661_0003022 Ga0495661_0003022_4524_4781 84
550 3300046665 Ga0495661_0016241 Ga0495661_0016241_383_640 84
551 3300046665 Ga0495661_0025167 Ga0495661_0025167_1223_1480 84
552 3300046665 Ga0495661_0027959 Ga0495661_0027959_586_849 84
553 3300046665 Ga0495661_0057045 Ga0495661_0057045_628_885 84
554 3300046665 Ga0495661_0071242 Ga0495661_0071242_628_885 84
555 3300046665 Ga0495661_0076159 Ga0495661_0076159_210_467 84
556 3300046665 Ga0495661_0084795 Ga0495661_0084795_1154_1411 84
557 3300046665 Ga0495661_0156149 Ga0495661_0156149_622_879 84
558 3300046665 Ga0495661_0157339 Ga0495661_0157339_178_435 84
559 3300046665 Ga0495661_0229486 Ga0495661_0229486_226_483 84
560 3300046665 Ga0495661_0264579 Ga0495661_0264579_352_609 84
561 3300046665 Ga0495661_0328305 Ga0495661_0328305_246_503 84
562 3300046665 Ga0495661_0340683 Ga0495661_0340683_72_329 84
563 3300046665 Ga0495661_0411445 Ga0495661_0411445_279_536 84
564 3300046665 Ga0495661_0461599 Ga0495661_0461599_75_332 84
565 3300046674 Ga0495588_0000041 Ga0495588_0000041_18618_18875 84
566 3300046674 Ga0495588_0004219 Ga0495588_0004219_103_360 84
567 3300046674 Ga0495588_0028007 Ga0495588_0028007_2271_2528 84
568 3300046674 Ga0495588_0041796 Ga0495588_0041796_75_332 84
569 3300046674 Ga0495588_0076350 Ga0495588_0076350_384_641 84
570 3300046674 Ga0495588_0085442 Ga0495588_0085442_912_1169 84
571 3300046674 Ga0495588_0106419 Ga0495588_0106419_646_903 84
572 3300046674 Ga0495588_0160522 Ga0495588_0160522_160_417 84
573 3300046674 Ga0495588_0241992 Ga0495588_0241992_423_680 84
574 3300046678 Ga0495599_0664796 Ga0495599_0664796_142_399 84
575 3300046679 Ga0495623_0011300 Ga0495623_0011300_1766_2023 84
576 3300046679 Ga0495623_0061097 Ga0495623_0061097_2096_2353 84
577 3300046680 Ga0495646_0665339 Ga0495646_0665339_67_324 84
578 3300046684 Ga0495669_0000031 Ga0495669_0000031_81508_81765 84
579 3300046684 Ga0495669_0001229 Ga0495669_0001229_9260_9541 84
580 3300046684 Ga0495669_0006268 Ga0495669_0006268_2505_2762 84
581 3300046684 Ga0495669_0013036 Ga0495669_0013036_1941_2198 84
582 3300046684 Ga0495669_0045533 Ga0495669_0045533_43_300 84
583 3300046684 Ga0495669_0091264 Ga0495669_0091264_893_1150 84
584 3300046684 Ga0495669_0281456 Ga0495669_0281456_512_769 84
585 3300046689 Ga0495613_0132005 Ga0495613_0132005_896_1153 84
586 3300046691 Ga0495670_0003564 Ga0495670_0003564_5601_5858 84
587 3300046691 Ga0495670_0003870 Ga0495670_0003870_4404_4661 84
588 3300046691 Ga0495670_0008414 Ga0495670_0008414_3594_3851 84
589 3300046691 Ga0495670_0026071 Ga0495670_0026071_2391_2648 84
590 3300046691 Ga0495670_0054327 Ga0495670_0054327_118_375 84
591 3300046691 Ga0495670_0424501 Ga0495670_0424501_125_382 84
592 3300046691 Ga0495670_0626063 Ga0495670_0626063_178_435 84
593 3300046691 Ga0495670_0659027 Ga0495670_0659027_246_503 84
594 3300046692 Ga0495671_0000223 Ga0495671_0000223_31514_31771 84
595 3300046692 Ga0495671_0003296 Ga0495671_0003296_8696_8953 84
596 3300046692 Ga0495671_0010193 Ga0495671_0010193_2931_3188 84
597 3300046692 Ga0495671_0015755 Ga0495671_0015755_1109_1366 84
598 3300046692 Ga0495671_0472116 Ga0495671_0472116_143_400 84
599 3300046694 Ga0495649_0060080 Ga0495649_0060080_204_467 84
600 3300046694 Ga0495649_0189040 Ga0495649_0189040_207_473 84
601 3300046694 Ga0495649_0326374 Ga0495649_0326374_381_638 84
602 3300046694 Ga0495649_0437489 Ga0495649_0437489_122_379 84
603 3300046694 Ga0495649_0603228 Ga0495649_0603228_112_369 84
604 3300046794 Ga0495589_0000202 Ga0495589_0000202_34006_34263 84
605 3300046794 Ga0495589_0000512 Ga0495589_0000512_21166_21423 84
606 3300046794 Ga0495589_0000590 Ga0495589_0000590_22645_22902 84
607 3300046794 Ga0495589_0005802 Ga0495589_0005802_3752_4009 84
608 3300046794 Ga0495589_0010999 Ga0495589_0010999_3451_3708 84
609 3300046794 Ga0495589_0128372 Ga0495589_0128372_450_707 84
610 3300046794 Ga0495589_0202943 Ga0495589_0202943_620_877 84
611 3300046794 Ga0495589_0213781 Ga0495589_0213781_18_275 84
612 3300046809 Ga0495600_0109829 Ga0495600_0109829_1075_1332 84
613 3300046809 Ga0495600_0128180 Ga0495600_0128180_724_981 84
614 3300046810 Ga0495660_0000033 Ga0495660_0000033_17209_17466 84
615 3300046810 Ga0495660_0001217 Ga0495660_0001217_15697_15954 84
616 3300046810 Ga0495660_0009535 Ga0495660_0009535_3761_4018 84
617 3300046810 Ga0495660_0010304 Ga0495660_0010304_861_1118 84
618 3300046810 Ga0495660_0020829 Ga0495660_0020829_2372_2629 84
619 3300046810 Ga0495660_0046568 Ga0495660_0046568_1067_1324 84
620 3300046810 Ga0495660_0057890 Ga0495660_0057890_901_1158 84
621 3300046810 Ga0495660_0082669 Ga0495660_0082669_549_806 84
622 3300046810 Ga0495660_0158407 Ga0495660_0158407_343_600 84
623 3300046810 Ga0495660_0202860 Ga0495660_0202860_114_371 84
624 3300047315 Ga0495581_0029044 Ga0495581_0029044_2802_3059 84
625 3300047317 Ga0495604_0010708 Ga0495604_0010708_6937_7194 84
626 3300047317 Ga0495604_0029427 Ga0495604_0029427_275_532 84
627 3300047318 Ga0495636_0027483 Ga0495636_0027483_132_389 84
628 3300047318 Ga0495636_0040418 Ga0495636_0040418_942_1199 84
629 3300047318 Ga0495636_0047445 Ga0495636_0047445_944_1201 84
630 3300047318 Ga0495636_0091011 Ga0495636_0091011_307_564 84
631 3300047318 Ga0495636_0179473 Ga0495636_0179473_663_920 84
632 3300047318 Ga0495636_0190877 Ga0495636_0190877_438_695 84
633 3300047319 Ga0495674_0027730 Ga0495674_0027730_3760_4017 84
634 3300047320 Ga0495672_0002906 Ga0495672_0002906_10725_10982 84
635 3300047320 Ga0495672_0006037 Ga0495672_0006037_2068_2325 84
636 3300047320 Ga0495672_0008060 Ga0495672_0008060_1409_1666 84
637 3300047320 Ga0495672_0018120 Ga0495672_0018120_1698_1955 84
638 3300047320 Ga0495672_0041145 Ga0495672_0041145_1082_1339 84
639 3300047320 Ga0495672_0251836 Ga0495672_0251836_139_396 84
640 3300047321 Ga0495676_0000557 Ga0495676_0000557_13407_13664 84
641 3300047321 Ga0495676_0108630 Ga0495676_0108630_1581_1838 84
642 3300047322 Ga0495680_0002023 Ga0495680_0002023_12383_12640 84
643 3300047323 Ga0495683_0012165 Ga0495683_0012165_2081_2338 84
644 3300047323 Ga0495683_0015891 Ga0495683_0015891_3237_3494 84
645 3300047323 Ga0495683_0033055 Ga0495683_0033055_535_792 84
646 3300047323 Ga0495683_0055057 Ga0495683_0055057_1202_1459 84
647 3300047323 Ga0495683_0185289 Ga0495683_0185289_491_748 84
648 3300047323 Ga0495683_0204142 Ga0495683_0204142_611_868 84
649 3300047323 Ga0495683_0233045 Ga0495683_0233045_512_769 84
650 3300047443 Ga0495687_000027 Ga0495687_000027_280813_281070 84
651 3300047443 Ga0495687_000873 Ga0495687_000873_15052_15309 84
652 3300047443 Ga0495687_001578 Ga0495687_001578_18863_19120 84
653 3300047443 Ga0495687_001652 Ga0495687_001652_17567_17824 84
654 3300047443 Ga0495687_125600 Ga0495687_125600_545_802 84
655 3300047443 Ga0495687_141437 Ga0495687_141437_413_670 84
656 3300047443 Ga0495687_210874 Ga0495687_210874_72_329 84
657 3300047444 Ga0495675_0025189 Ga0495675_0025189_738_995 84
658 3300047444 Ga0495675_0054323 Ga0495675_0054323_562_819 84
659 3300047444 Ga0495675_0075347 Ga0495675_0075347_1356_1613 84
660 3300047445 Ga0495677_0000001 Ga0495677_0000001_280894_281151 84
661 3300047445 Ga0495677_0001227 Ga0495677_0001227_5884_6141 84
662 3300047445 Ga0495677_0002166 Ga0495677_0002166_134_391 84
663 3300047445 Ga0495677_0002826 Ga0495677_0002826_908_1165 84
664 3300047445 Ga0495677_0004714 Ga0495677_0004714_2843_3100 84
665 3300047445 Ga0495677_0008424 Ga0495677_0008424_3548_3805 84
666 3300047445 Ga0495677_0009451 Ga0495677_0009451_484_741 84
667 3300047445 Ga0495677_0027443 Ga0495677_0027443_290_547 84
668 3300047445 Ga0495677_0052856 Ga0495677_0052856_281_538 84
669 3300047445 Ga0495677_0133649 Ga0495677_0133649_43_300 84
670 3300047445 Ga0495677_0302147 Ga0495677_0302147_229_486 84
671 3300047446 Ga0495679_008820 Ga0495679_008820_2302_2559 84
672 3300047446 Ga0495679_013635 Ga0495679_013635_1720_1977 84
673 3300047446 Ga0495679_015106 Ga0495679_015106_1495_1752 84
674 3300047446 Ga0495679_021968 Ga0495679_021968_1920_2177 84
675 3300047447 Ga0495685_000064 Ga0495685_000064_3137_3394 84
676 3300047447 Ga0495685_006568 Ga0495685_006568_707_964 84
677 3300047447 Ga0495685_017181 Ga0495685_017181_1061_1318 84
678 3300047447 Ga0495685_245879 Ga0495685_245879_62_319 84
679 3300047469 Ga0495673_0001902 Ga0495673_0001902_5310_5567 84
680 3300047469 Ga0495673_0268033 Ga0495673_0268033_243_500 84
681 3300047470 Ga0495681_0001529 Ga0495681_0001529_11160_11417 84
682 3300047470 Ga0495681_0005675 Ga0495681_0005675_1493_1750 84
683 3300047470 Ga0495681_0021213 Ga0495681_0021213_1737_1994 84
684 3300047470 Ga0495681_0028278 Ga0495681_0028278_1081_1338 84
685 3300047470 Ga0495681_0085901 Ga0495681_0085901_988_1245 84
686 3300047470 Ga0495681_0271662 Ga0495681_0271662_14_271 84
687 3300047472 Ga0495686_0001196 Ga0495686_0001196_15374_15631 84
688 3300047472 Ga0495686_0028791 Ga0495686_0028791_1175_1432 84
689 3300047472 Ga0495686_0174505 Ga0495686_0174505_190_447 84
690 3300047472 Ga0495686_0196460 Ga0495686_0196460_161_418 84
691 3300047472 Ga0495686_0406145 Ga0495686_0406145_144_401 84
692 3300047673 Ga0495593_0014985 Ga0495593_0014985_1983_2240 84
693 3300047673 Ga0495593_0048083 Ga0495593_0048083_200_457 84
694 3300048088 Ga0495602_0035851 Ga0495602_0035851_51_308 84
695 3300048089 Ga0495614_0000545 Ga0495614_0000545_3241_3498 84
696 3300048089 Ga0495614_0007999 Ga0495614_0007999_1343_1600 84
697 3300048089 Ga0495614_0277988 Ga0495614_0277988_164_421 84
698 3300048091 Ga0495626_0000159 Ga0495626_0000159_66106_66363 84
699 3300048091 Ga0495626_0001535 Ga0495626_0001535_15705_15962 84
700 3300048091 Ga0495626_0010066 Ga0495626_0010066_2689_2946 84
701 3300048091 Ga0495626_0011759 Ga0495626_0011759_3834_4091 84
702 3300048091 Ga0495626_0033374 Ga0495626_0033374_1877_2134 84
703 3300048091 Ga0495626_0059779 Ga0495626_0059779_846_1103 84
704 3300048091 Ga0495626_0115214 Ga0495626_0115214_653_910 84
705 3300048091 Ga0495626_0136195 Ga0495626_0136195_166_423 84
706 3300048091 Ga0495626_0251633 Ga0495626_0251633_58_315 84
707 3300048903 Ga0496100_0429566 Ga0496100_0429566_728_985 84
708 3300048903 Ga0496100_0506678 Ga0496100_0506678_330_587 84
709 3300048903 Ga0496100_0590989 Ga0496100_0590989_137_394 84
710 3300048904 Ga0496101_0124556 Ga0496101_0124556_1367_1624 84
711 3300048904 Ga0496101_0167862 Ga0496101_0167862_1372_1629 84
712 3300048904 Ga0496101_0490652 Ga0496101_0490652_476_733 84
713 3300048905 Ga0496102_0000150 Ga0496102_0000150_87180_87437 84
714 3300048905 Ga0496102_0000816 Ga0496102_0000816_5485_5742 84
715 3300048905 Ga0496102_0092747 Ga0496102_0092747_902_1159 84
716 3300048905 Ga0496102_0165902 Ga0496102_0165902_1217_1474 84
717 3300048905 Ga0496102_0168007 Ga0496102_0168007_1794_2051 84
718 3300048905 Ga0496102_0754752 Ga0496102_0754752_312_569 84
719 3300048906 Ga0496103_0029187 Ga0496103_0029187_2018_2275 84
720 3300048906 Ga0496103_0086436 Ga0496103_0086436_764_1021 84
721 3300048906 Ga0496103_0380291 Ga0496103_0380291_166_423 84
722 3300048906 Ga0496103_0469115 Ga0496103_0469115_324_581 84
723 3300048906 Ga0496103_0720547 Ga0496103_0720547_218_475 84
724 3300048907 Ga0496104_0299635 Ga0496104_0299635_1097_1354 84
725 3300048907 Ga0496104_0713267 Ga0496104_0713267_489_746 84
726 3300048908 Ga0496105_0454230 Ga0496105_0454230_101_358 84
727 3300048908 Ga0496105_0558584 Ga0496105_0558584_546_803 84
728 3300048908 Ga0496105_0849774 Ga0496105_0849774_289_546 84
729 3300048909 Ga0496106_0017435 Ga0496106_0017435_1875_2132 84
730 3300048910 Ga0496107_0015847 Ga0496107_0015847_2963_3220 84
731 3300048910 Ga0496107_0329398 Ga0496107_0329398_132_389 84
732 3300048910 Ga0496107_0606913 Ga0496107_0606913_509_766 84
733 3300048910 Ga0496107_0803235 Ga0496107_0803235_328_585 84
734 3300048910 Ga0496107_1002236 Ga0496107_1002236_198_455 84
735 3300048911 Ga0496108_0163188 Ga0496108_0163188_1656_1913 84
736 3300048911 Ga0496108_1680676 Ga0496108_1680676_202_459 84
737 3300048912 Ga0496109_0908616 Ga0496109_0908616_250_507 84
738 3300048912 Ga0496109_1610079 Ga0496109_1610079_156_413 84
739 3300048913 Ga0496110_0000036 Ga0496110_0000036_17885_18142 84
740 3300048913 Ga0496110_0468673 Ga0496110_0468673_713_970 84
741 3300048913 Ga0496110_0625138 Ga0496110_0625138_558_815 84
742 3300048914 Ga0496111_0540277 Ga0496111_0540277_482_739 84
743 3300048914 Ga0496111_0952526 Ga0496111_0952526_343_600 84
744 3300048914 Ga0496111_0977582 Ga0496111_0977582_300_557 84
745 3300048915 Ga0496112_0015901 Ga0496112_0015901_663_920 84
746 3300048915 Ga0496112_1231337 Ga0496112_1231337_192_449 84
747 3300048916 Ga0496113_0009981 Ga0496113_0009981_5152_5409 84
748 3300048916 Ga0496113_0082996 Ga0496113_0082996_2063_2320 84
749 3300048916 Ga0496113_0958790 Ga0496113_0958790_186_449 84
750 3300048917 Ga0496114_0074048 Ga0496114_0074048_2020_2277 84
751 3300048918 Ga0496115_0429508 Ga0496115_0429508_324_581 84
752 3300048918 Ga0496115_0471420 Ga0496115_0471420_133_390 84
753 3300048925 Ga0496122_0000255 Ga0496122_0000255_18331_18588 84
754 3300048925 Ga0496122_0006595 Ga0496122_0006595_10860_11117 84
755 3300048925 Ga0496122_0014117 Ga0496122_0014117_2191_2448 84
756 3300048925 Ga0496122_0278087 Ga0496122_0278087_583_840 84
757 3300048926 Ga0496123_0000936 Ga0496123_0000936_29825_30082 84
758 3300048926 Ga0496123_0007467 Ga0496123_0007467_1466_1723 84
759 3300048926 Ga0496123_0123759 Ga0496123_0123759_846_1103 84
760 3300048926 Ga0496123_0252167 Ga0496123_0252167_424_681 84
761 3300048927 Ga0496124_0013535 Ga0496124_0013535_1700_1957 84
762 3300048927 Ga0496124_0067859 Ga0496124_0067859_2211_2468 84
763 3300048927 Ga0496124_0100106 Ga0496124_0100106_1669_1926 84
764 3300048927 Ga0496124_0532066 Ga0496124_0532066_436_693 84
765 3300048927 Ga0496124_0546748 Ga0496124_0546748_262_519 84
766 3300048927 Ga0496124_0675300 Ga0496124_0675300_162_419 84
767 3300048928 Ga0496125_0049086 Ga0496125_0049086_1127_1384 84
768 3300048928 Ga0496125_0401794 Ga0496125_0401794_312_569 84
769 3300048928 Ga0496125_0433316 Ga0496125_0433316_313_570 84
770 3300048928 Ga0496125_0457406 Ga0496125_0457406_120_377 84
771 3300048929 Ga0496126_0870075 Ga0496126_0870075_123_380 84
772 3300049128 Ga0501308_000396 Ga0501308_000396_1230_1487 84
773 3300049129 Ga0501309_041317 Ga0501309_041317_121_375 84
774 3300049459 Ga0495678_000396 Ga0495678_000396_19279_19536 84
775 3300049459 Ga0495678_000436 Ga0495678_000436_14307_14564 84
776 3300049459 Ga0495678_018442 Ga0495678_018442_1884_2141 84
777 3300049459 Ga0495678_032135 Ga0495678_032135_26_283 84
778 3300049459 Ga0495678_128130 Ga0495678_128130_273_530 84
779 3300049460 Ga0495682_0000354 Ga0495682_0000354_12349_12606 84
780 3300049460 Ga0495682_0001087 Ga0495682_0001087_11304_11561 84
781 3300049460 Ga0495682_0006848 Ga0495682_0006848_1659_1940 84
782 3300049460 Ga0495682_0014657 Ga0495682_0014657_2226_2483 84
783 3300049460 Ga0495682_0155721 Ga0495682_0155721_519_776 84
784 3300049571 Ga0501034_0747747 Ga0501034_0747747_188_445 84
785 3300049572 Ga0501036_0845636 Ga0501036_0845636_408_665 84
786 3300049581 Ga0501047_0225511 Ga0501047_0225511_1122_1379 84
787 3300049665 Ga0501227_010529 Ga0501227_010529_147_401 84
788 3300049669 Ga0501235_176935 Ga0501235_176935_211_468 84
789 3300049678 Ga0501248_004688 Ga0501248_004688_225_479 84
790 3300049775 Ga0501279_000371 Ga0501279_000371_5226_5480 84
791 3300049823 Ga0501044_0514858 Ga0501044_0514858_634_891 84
792 3300061719 Ga0466962_0030852 Ga0466962_0030852_777_1034 84
793 3300061719 Ga0466962_0166831 Ga0466962_0166831_85_342 84
794 3300061719 Ga0466962_0245428 Ga0466962_0245428_467_724 84
795 3300061719 Ga0466962_0485485 Ga0466962_0485485_105_362 84
796 3300061719 Ga0466962_0610881 Ga0466962_0610881_159_416 84

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

13

93

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mdb-assembly2.cif.gz_B crystal structure of the ternary complex of full length centaurin alpha-1, kif13b fha domain, and ip4 0.8414 55 78
1jwb-assembly1.cif.gz_D-2 structure of the covalent acyl-adenylate form of the moeb-moad protein complex 0.8365 4 84
5djo-assembly1.cif.gz_A crystal structure of the cc1-fha tandem of kinesin-3 kif13a 0.8346 54 77
6jbz-assembly1.cif.gz_D structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8202 1 84
1jwb-assembly1.cif.gz_D-2 structure of the covalent acyl-adenylate form of the moeb-moad protein complex 0.8179 4 84
ID Description Score Start End Superfamily
af_P30748_1_81_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8798 3 84 3.10.20.30
af_P30748_1_81_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8599 3 84 3.10.20.30
af_D3ZM20_384_492_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8563 54 78 2.60.200.20
af_Q9VN82_366_475_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8523 56 77 2.60.200.20
af_F1RCT7_451_562_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8461 54 78 2.60.200.20
ID Description Score Start End GO Terms
AF-A0A7C4U1E9-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.988 1 84 GO:0000166
GO:0006777
GO:1990133
AF-A0A4R5W6M9-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9877 1 84 GO:0000166
GO:0006777
GO:1990133
AF-A0A840RNX6-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9866 1 84
AF-A0A839VF36-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9843 1 84
AF-A0A658R4Q9-F1-model_v4 Molybdopterin converting factor subunit 1 0.9828 1 84

Feature Viewer

pLDDT pTM Quality
94.51 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map