F481237

General Info

Members Datasets Scaffolds Average Seq Length
797 336 1595 393

Family's Representative Sequence

Representative Sequence 3300005544|Ga0070686_100102581|Ga0070686_1001025812
Length 429
Sequence MFLFRKWHEEEQGTTSRAQGTSNQKTKQKTINMKRIAMLGSGFIGRFYADSLQGNRSQDKIVSIYSRREESAKKFAQDYNVSHWTIDMEECITNPDADVVCIALPNNLHEPAVMLCCKHKKAVIITKPLGRNGEEAKRMLEAVEKAGIFNGYLEDLVYTPKFLKALETVKNGALGRILWAKSRETHPGPHSDWFWNLEQAGGGCILDLGCHCVEITRSYIGKDIKPVEVMCWADTQVKPIDAEDHAIALIKYENGSIAQFEVSWTFRGGLDLRDEVMGTEGTIWINSFLRTGFEMFTTGKAANYVAEKAESNSGWLFPIGDELNELGYNHMFMDMFKAMEQKREPKENFYDGYIVNCILDAAYRSAKTKQWEPVKLDIWRGRTGVTKDSHLTEYDKDNYLVKEEVTHYGARKVILKNKHTNKIIEKVLE

Samples

Sample ID Description Type Environment
1 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
117 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
119 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
121 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
122 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
124 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
183 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
184 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
185 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
186 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
187 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
188 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
191 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
192 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
202 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
209 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
210 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
211 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
212 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
213 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
214 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
215 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
216 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
217 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
220 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
221 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
222 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
223 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
224 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
225 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
226 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
227 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
230 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
231 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
232 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
233 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
234 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
235 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
236 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
237 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
238 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
239 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
243 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
244 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
245 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
246 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
247 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
248 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
249 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
250 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
251 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
252 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
258 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
259 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
271 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
272 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
273 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
274 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
275 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
276 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
277 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
278 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
279 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
280 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
281 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
282 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
283 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
284 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
285 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
286 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
287 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
288 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
289 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
290 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
291 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
292 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
293 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
294 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
295 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
296 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
297 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
298 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
299 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
300 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
301 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
302 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
303 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
304 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
305 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
306 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
307 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
308 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
309 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
310 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
311 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
312 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
313 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
314 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
315 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
316 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
317 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
318 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
319 2738541278 Niastella sp. CF465 Isolate Unclassified
320 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
321 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
322 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
323 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
324 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
325 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
326 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
327 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
328 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
329 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
330 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
331 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
332 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
333 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
334 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
335 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
336 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.62
Metatranscriptomes 0
Isolates 2.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.53
Nodule 0
Rhizoplane 0.63
Rhizosphere 84.07
Stem 0
Stem Tuber 0
Unclassified 0.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070686_100102581 3300005544 Bacteria 1935
2 SwRhRL2b_contig_3365545 2162886007 Bacteria 2495
3 JGI24739J22299_10001725 3300001989 Bacteria 8308
4 JGI25162J39368_1002488 3300002737 Bacteria 7085
5 JGI25154J39366_1000120 3300002738 Bacteria 63261
6 JGI25157J39369_1003864 3300002741 Bacteria 2910
7 JGI25164J39214_1000976 3300002772 Bacteria 9102
8 JGI25406J46586_10000481 3300003203 Bacteria 18605
9 JGI25165J46597_1000426 3300003214 Bacteria 43457
10 JGI25153J46596_10015134 3300003215 Bacteria 3162
11 JGI25153J46596_10026466 3300003215 Bacteria 2051
12 rootH1_10000642 3300003316 Bacteria 33948
13 rootH1_10063898 3300003316 Bacteria 1932
14 rootH1_10063898 3300003323 Bacteria 5530
15 rootH2_10001529 3300003320 Bacteria 89054
16 rootH2_10004243 3300003320 Bacteria 29145
17 rootH2_10016199 3300003320 Bacteria 99895
18 rootH2_10021351 3300003320 Bacteria 2703
19 rootH2_10037508 3300003320 Bacteria 4267
20 rootH2_10067178 3300003320 Bacteria 6630
21 rootL2_10004081 3300003322 Bacteria 9778
22 rootL2_10010050 3300003322 Bacteria 5737
23 rootL2_10025221 3300003322 Bacteria 4323
24 rootL2_10078697 3300003322 Bacteria 7050
25 rootL2_10086654 3300003322 Bacteria 4355
26 rootH1_10003667 3300003323 Bacteria 128566
27 rootH1_10007212 3300003323 Bacteria 22648
28 rootH1_10033931 3300003323 Bacteria 2530
29 rootH1_10044901 3300003323 Bacteria 12138
30 rootH1_10057868 3300003323 Bacteria 6127
31 rootH1_10090043 3300003323 Bacteria 8677
32 JGI25160J50197_1001317 3300003354 Bacteria 12537
33 Ga0055542_1007334 3300003762 Bacteria 2249
34 Ga0055526_1009734 3300003771 Bacteria 4578
35 Ga0055528_1000265 3300003790 Bacteria 44369
36 Ga0055530_10003316 3300003791 Bacteria 9300
37 Ga0055530_10021000 3300003791 Bacteria 1935
38 Ga0055531_10000115 3300003794 Bacteria 88381
39 Ga0055531_10000169 3300003794 Bacteria 73302
40 Ga0055543_1009073 3300004625 Bacteria 2163
41 Ga0065165_1000358 3300005262 Bacteria 75013
42 Ga0065165_1000519 3300005262 Bacteria 58989
43 Ga0065165_1010940 3300005262 Bacteria 3853
44 Ga0065704_10071683 3300005289 Bacteria 10277
45 Ga0065712_10013012 3300005290 Bacteria 1860
46 Ga0065712_10071842 3300005290 Bacteria 5033
47 Ga0065712_10076510 3300005290 Bacteria 3631
48 Ga0065712_10086019 3300005290 Bacteria 2661
49 Ga0070658_10072092 3300005327 Bacteria 2830
50 Ga0070676_10000081 3300005328 Bacteria 32936
51 Ga0070676_10000086 3300005328 Bacteria 32492
52 Ga0070676_10036264 3300005328 Bacteria 2840
53 Ga0070683_100000508 3300005329 Bacteria 27277
54 Ga0070683_100009114 3300005329 Bacteria 8471
55 Ga0070683_100013382 3300005329 Bacteria 7154
56 Ga0070690_100071707 3300005330 Bacteria 2251
57 Ga0070670_100035386 3300005331 Bacteria 4299
58 Ga0070670_100037929 3300005331 Bacteria 4144
59 Ga0070670_100038397 3300005331 Bacteria 4118
60 Ga0070670_100062492 3300005331 Bacteria 3197
61 Ga0070670_100162207 3300005331 Bacteria 1937
62 Ga0070677_10053632 3300005333 Bacteria 1640
63 Ga0068869_100010484 3300005334 Bacteria 6046
64 Ga0068869_100025094 3300005334 Bacteria 4136
65 Ga0068869_100048224 3300005334 Bacteria 3079
66 Ga0068869_100098615 3300005334 Bacteria 2207
67 Ga0068869_100131300 3300005334 Bacteria 1926
68 Ga0068869_100182409 3300005334 Bacteria 1646
69 Ga0070666_10000110 3300005335 Bacteria 56184
70 Ga0070666_10010336 3300005335 Bacteria 5836
71 Ga0070666_10014633 3300005335 Bacteria 4996
72 Ga0070666_10032865 3300005335 Bacteria 3429
73 Ga0070680_100002529 3300005336 Bacteria 13548
74 Ga0070682_100007037 3300005337 Bacteria 6329
75 Ga0068868_100000420 3300005338 Bacteria 28736
76 Ga0068868_100010515 3300005338 Bacteria 6706
77 Ga0068868_100026384 3300005338 Bacteria 4427
78 Ga0068868_100041064 3300005338 Bacteria 3603
79 Ga0068868_100041472 3300005338 Bacteria 3586
80 Ga0068868_100136484 3300005338 Bacteria 2011
81 Ga0070660_100007231 3300005339 Bacteria 7726
82 Ga0070689_100009325 3300005340 Bacteria 6957
83 Ga0070689_100019305 3300005340 Bacteria 5039
84 Ga0070689_100115162 3300005340 Bacteria 2142
85 Ga0070691_10007389 3300005341 Eukaryota 5031
86 Ga0070691_10013358 3300005341 Bacteria 3761
87 Ga0070661_100000111 3300005344 Bacteria 68066
88 Ga0070661_100061446 3300005344 Bacteria 2757
89 Ga0070668_100000077 3300005347 Bacteria 60697
90 Ga0070668_100024712 3300005347 Bacteria 4553
91 Ga0070668_100046103 3300005347 Bacteria 3346
92 Ga0070668_100192490 3300005347 Bacteria 1671
93 Ga0070669_100001696 3300005353 Bacteria 15945
94 Ga0070669_100021159 3300005353 Bacteria 4648
95 Ga0070669_100038636 3300005353 Bacteria 3466
96 Ga0070669_100116157 3300005353 Bacteria 2036
97 Ga0070675_100020849 3300005354 Bacteria 5231
98 Ga0070675_100020879 3300005354 Bacteria 5228
99 Ga0070675_100037185 3300005354 Bacteria 3964
100 Ga0070671_100003332 3300005355 Bacteria 12534
101 Ga0070671_100010273 3300005355 Bacteria 7513
102 Ga0070671_100103567 3300005355 Bacteria 2388
103 Ga0070671_100104571 3300005355 Bacteria 2376
104 Ga0070674_100072723 3300005356 Bacteria 2436
105 Ga0070674_100087818 3300005356 Bacteria 2236
106 Ga0070673_100000072 3300005364 Bacteria 43011
107 Ga0070673_100001289 3300005364 Bacteria 14599
108 Ga0070673_100014416 3300005364 Bacteria 5505
109 Ga0070673_100083080 3300005364 Bacteria 2601
110 Ga0070688_100056018 3300005365 Bacteria 2475
111 Ga0070659_100004012 3300005366 Bacteria 10477
112 Ga0070667_100000382 3300005367 Bacteria 48246
113 Ga0070667_100005185 3300005367 Bacteria 10890
114 Ga0070667_100016325 3300005367 Bacteria 6142
115 Ga0070667_100033408 3300005367 Bacteria 4299
116 Ga0070711_100042892 3300005439 Bacteria 3061
117 Ga0070678_100294242 3300005456 Bacteria 1377
118 Ga0070662_100000011 3300005457 Bacteria 133652
119 Ga0070662_100016867 3300005457 Bacteria 4909
120 Ga0070662_100151587 3300005457 Bacteria 1805
121 Ga0070681_10020519 3300005458 Bacteria 6623
122 Ga0070681_10052850 3300005458 Bacteria 4051
123 Ga0070681_10058761 3300005458 Bacteria 3825
124 Ga0070681_10098827 3300005458 Bacteria 2865
125 Ga0068867_100000558 3300005459 Bacteria 24610
126 Ga0068867_100002567 3300005459 Bacteria 12804
127 Ga0068867_100013547 3300005459 Bacteria 5774
128 Ga0068867_100022499 3300005459 Bacteria 4508
129 Ga0068867_100047386 3300005459 Bacteria 3159
130 Ga0068867_100119985 3300005459 Bacteria 2031
131 Ga0070685_10003168 3300005466 Bacteria 8368
132 Ga0070685_10039777 3300005466 Bacteria 2673
133 Ga0070685_10075053 3300005466 Bacteria 2013
134 Ga0070698_100009065 3300005471 Bacteria 10695
135 Ga0070698_100021251 3300005471 Bacteria 6800
136 Ga0070698_100023339 3300005471 Bacteria 6467
137 Ga0070698_100354040 3300005471 Bacteria 1400
138 Ga0070679_100017217 3300005530 Bacteria 6990
139 Ga0070679_100050288 3300005530 Bacteria 4152
140 Ga0070679_100051240 3300005530 Bacteria 4111
141 Ga0070684_100006108 3300005535 Bacteria 9281
142 Ga0070684_100060256 3300005535 Bacteria 3319
143 Ga0070684_100064156 3300005535 Bacteria 3221
144 Ga0070684_100077523 3300005535 Bacteria 2935
145 Ga0068853_100013016 3300005539 Bacteria 6785
146 Ga0068853_100038517 3300005539 Bacteria 4073
147 Ga0068853_100072769 3300005539 Bacteria 2996
148 Ga0068853_100087345 3300005539 Bacteria 2736
149 Ga0068853_100167475 3300005539 Bacteria 1986
150 Ga0070672_100000240 3300005543 Bacteria 30633
151 Ga0070672_100028861 3300005543 Bacteria 4155
152 Ga0070672_100054203 3300005543 Bacteria 3138
153 Ga0070672_100093627 3300005543 Bacteria 2428
154 Ga0070665_100000003 3300005548 Bacteria 811857
155 Ga0070665_100001677 3300005548 Bacteria 25513
156 Ga0070665_100032445 3300005548 Bacteria 5256
157 Ga0070665_100267228 3300005548 Bacteria 1712
158 Ga0068855_100000108 3300005563 Bacteria 103059
159 Ga0068855_100000260 3300005563 Bacteria 65935
160 Ga0068855_100003173 3300005563 Bacteria 20124
161 Ga0068855_100024009 3300005563 Bacteria 7300
162 Ga0068855_100068897 3300005563 Bacteria 4118
163 Ga0068855_100075471 3300005563 Bacteria 3915
164 Ga0068855_100099737 3300005563 Bacteria 3344
165 Ga0070664_100004434 3300005564 Bacteria 11274
166 Ga0070664_100005019 3300005564 Bacteria 10604
167 Ga0070664_100011721 3300005564 Bacteria 7116
168 Ga0070664_100025199 3300005564 Bacteria 4927
169 Ga0070664_100178036 3300005564 Unclassified 1889
170 Ga0068857_100001839 3300005577 Bacteria 17074
171 Ga0068857_100003159 3300005577 Bacteria 13659
172 Ga0068857_100022840 3300005577 Bacteria 5503
173 Ga0068857_100050419 3300005577 Bacteria 3693
174 Ga0068854_100012236 3300005578 Bacteria 5616
175 Ga0068854_100057107 3300005578 Bacteria 2815
176 Ga0068854_100061107 3300005578 Bacteria 2728
177 Ga0068854_100192405 3300005578 Bacteria 1599
178 Ga0068856_100001596 3300005614 Bacteria 23687
179 Ga0068856_100014292 3300005614 Bacteria 7678
180 Ga0068856_100045665 3300005614 Bacteria 4314
181 Ga0068856_100160281 3300005614 Bacteria 2260
182 Ga0068856_100242780 3300005614 Bacteria 1816
183 Ga0070702_100024277 3300005615 Bacteria 3233
184 Ga0068852_100000527 3300005616 Bacteria 25187
185 Ga0068852_100004482 3300005616 Bacteria 9869
186 Ga0068852_100039418 3300005616 Bacteria 3977
187 Ga0068852_100196765 3300005616 Bacteria 1905
188 Ga0068852_100395286 3300005616 Bacteria 1359
189 Ga0068859_100000026 3300005617 Bacteria 188742
190 Ga0068859_100046521 3300005617 Bacteria 4357
191 Ga0068859_100082711 3300005617 Bacteria 3253
192 Ga0068859_100119174 3300005617 Bacteria 2705
193 Ga0068859_100180784 3300005617 Bacteria 2192
194 Ga0068864_100000389 3300005618 Bacteria 38410
195 Ga0068864_100016837 3300005618 Bacteria 6092
196 Ga0068864_100019322 3300005618 Bacteria 5696
197 Ga0068864_100136905 3300005618 Bacteria 2206
198 Ga0068864_100231797 3300005618 Bacteria 1708
199 Ga0068866_10027931 3300005718 Bacteria 2684
200 Ga0068861_100010696 3300005719 Bacteria 6375
201 Ga0068861_100015199 3300005719 Bacteria 5418
202 Ga0068861_100057001 3300005719 Bacteria 2984
203 Ga0068861_100103204 3300005719 Bacteria 2272
204 Ga0068851_10000082 3300005834 Bacteria 52889
205 Ga0068870_10009545 3300005840 Bacteria 4420
206 Ga0068870_10010874 3300005840 Bacteria 4199
207 Ga0068863_100023529 3300005841 Bacteria 5880
208 Ga0068863_100027750 3300005841 Bacteria 5403
209 Ga0068863_100118890 3300005841 Bacteria 2519
210 Ga0068858_100000634 3300005842 Bacteria 36584
211 Ga0068858_100028849 3300005842 Bacteria 5153
212 Ga0068858_100391730 3300005842 Bacteria 1334
213 Ga0068860_100000072 3300005843 Bacteria 174997
214 Ga0068860_100001760 3300005843 Bacteria 23110
215 Ga0068860_100009606 3300005843 Bacteria 9612
216 Ga0068860_100032131 3300005843 Bacteria 5046
217 Ga0068860_100042201 3300005843 Bacteria 4358
218 Ga0068860_100389434 3300005843 Bacteria 1377
219 Ga0068862_100005406 3300005844 Bacteria 10672
220 Ga0081540_1014647 3300005983 Bacteria 5011
221 Ga0081539_10000714 3300005985 Bacteria 66625
222 Ga0081539_10008308 3300005985 Bacteria 9084
223 Ga0097621_100000150 3300006237 Bacteria 42846
224 Ga0097621_100002418 3300006237 Bacteria 12783
225 Ga0097621_100002717 3300006237 Bacteria 12108
226 Ga0097621_100003513 3300006237 Bacteria 10823
227 Ga0097621_100006095 3300006237 Bacteria 8536
228 Ga0097621_100036902 3300006237 Bacteria 3912
229 Ga0097621_100043480 3300006237 Bacteria 3621
230 Ga0097621_100088848 3300006237 Bacteria 2583
231 Ga0097621_100169635 3300006237 Bacteria 1880
232 Ga0068871_100000045 3300006358 Bacteria 67014
233 Ga0068871_100001431 3300006358 Bacteria 15983
234 Ga0068871_100026597 3300006358 Bacteria 4517
235 Ga0068871_100062262 3300006358 Bacteria 3048
236 Ga0068871_100089138 3300006358 Bacteria 2567
237 Ga0068871_100216659 3300006358 Bacteria 1657
238 Ga0068871_100288272 3300006358 Bacteria 1438
239 Ga0075428_100015432 3300006844 Bacteria 8467
240 Ga0075428_100066893 3300006844 Bacteria 3934
241 Ga0075428_100423186 3300006844 Bacteria 1427
242 Ga0075431_100017550 3300006847 Bacteria 7275
243 Ga0075434_100170664 3300006871 Bacteria 2195
244 Ga0075429_100019702 3300006880 Bacteria 5849
245 Ga0068865_100000170 3300006881 Bacteria 36005
246 Ga0068865_100096638 3300006881 Bacteria 2154
247 Ga0097620_100000026 3300006931 Bacteria 188742
248 Ga0097620_100046525 3300006931 Bacteria 4357
249 Ga0097620_100082713 3300006931 Bacteria 3253
250 Ga0097620_100119178 3300006931 Bacteria 2705
251 Ga0097620_100180782 3300006931 Bacteria 2192
252 Ga0105240_10000991 3300009093 Bacteria 50697
253 Ga0105240_10001109 3300009093 Bacteria 47404
254 Ga0105240_10002195 3300009093 Bacteria 31863
255 Ga0105240_10002244 3300009093 Bacteria 31388
256 Ga0105240_10012757 3300009093 Bacteria 11583
257 Ga0105240_10019308 3300009093 Bacteria 9109
258 Ga0105240_10023818 3300009093 Bacteria 8086
259 Ga0105240_10028757 3300009093 Bacteria 7251
260 Ga0105240_10033251 3300009093 Bacteria 6666
261 Ga0105240_10039959 3300009093 Bacteria 6005
262 Ga0105240_10102003 3300009093 Bacteria 3488
263 Ga0105240_10169871 3300009093 Bacteria 2584
264 Ga0111539_10003835 3300009094 Bacteria 19797
265 Ga0111539_10043774 3300009094 Bacteria 5367
266 Ga0111539_10484782 3300009094 Bacteria 1440
267 Ga0105245_10017518 3300009098 Bacteria 6251
268 Ga0105245_10107271 3300009098 Bacteria 2593
269 Ga0105247_10026765 3300009101 Bacteria 3485
270 Ga0105247_10179656 3300009101 Bacteria 1412
271 Ga0114129_10007891 3300009147 Bacteria 15148
272 Ga0114129_10041640 3300009147 Bacteria 6470
273 Ga0105241_10000268 3300009174 Bacteria 38825
274 Ga0105241_10000739 3300009174 Bacteria 24827
275 Ga0105241_10001510 3300009174 Bacteria 17817
276 Ga0105241_10003366 3300009174 Bacteria 11908
277 Ga0105241_10003966 3300009174 Bacteria 10941
278 Ga0105241_10050791 3300009174 Bacteria 3161
279 Ga0105242_10007643 3300009176 Bacteria 8319
280 Ga0105242_10008158 3300009176 Bacteria 8054
281 Ga0105242_10014438 3300009176 Bacteria 6120
282 Ga0105242_10181963 3300009176 Bacteria 1855
283 Ga0105237_10000943 3300009545 Bacteria 39090
284 Ga0105237_10005407 3300009545 Bacteria 14427
285 Ga0105237_10005933 3300009545 Bacteria 13698
286 Ga0105237_10012129 3300009545 Bacteria 9092
287 Ga0105237_10012937 3300009545 Bacteria 8765
288 Ga0105237_10017853 3300009545 Bacteria 7354
289 Ga0105237_10049862 3300009545 Unclassified 4207
290 Ga0105237_10062812 3300009545 Bacteria 3713
291 Ga0105237_10272468 3300009545 Bacteria 1695
292 Ga0105238_10002471 3300009551 Bacteria 18498
293 Ga0105238_10016058 3300009551 Bacteria 7574
294 Ga0105249_10002519 3300009553 Bacteria 15852
295 Ga0105249_10020489 3300009553 Bacteria 5911
296 Ga0105249_10072733 3300009553 Bacteria 3179
297 Ga0105249_10210145 3300009553 Bacteria 1909
298 Ga0105249_10275950 3300009553 Bacteria 1677
299 Ga0105239_10000017 3300010375 Bacteria 290760
300 Ga0105239_10000168 3300010375 Bacteria 94279
301 Ga0105239_10001486 3300010375 Bacteria 31166
302 Ga0105239_10007223 3300010375 Bacteria 12760
303 Ga0105239_10010270 3300010375 Bacteria 10487
304 Ga0105239_10019423 3300010375 Bacteria 7502
305 Ga0105239_10038201 3300010375 Bacteria 5261
306 Ga0105239_10053100 3300010375 Bacteria 4446
307 Ga0105239_10124266 3300010375 Bacteria 2867
308 Ga0105239_10271724 3300010375 Bacteria 1907
309 Ga0105239_10400754 3300010375 Bacteria 1553
310 Ga0105246_10054960 3300011119 Bacteria 2746
311 Ga0105246_10075863 3300011119 Bacteria 2381
312 Ga0105246_10077166 3300011119 Bacteria 2363
313 Ga0105246_10107179 3300011119 Bacteria 2046
314 Ga0157373_10014240 3300013100 Bacteria 5834
315 Ga0157373_10087532 3300013100 Bacteria 2195
316 Ga0157370_10001221 3300013104 Bacteria 32173
317 Ga0157370_10002685 3300013104 Bacteria 21321
318 Ga0157370_10025719 3300013104 Bacteria 5824
319 Ga0157370_10081361 3300013104 Bacteria 3047
320 Ga0157370_10154587 3300013104 Bacteria 2134
321 Ga0157369_10008855 3300013105 Bacteria 11526
322 Ga0157369_10109533 3300013105 Bacteria 2936
323 Ga0157374_10000002 3300013296 Bacteria 1054226
324 Ga0157374_10000277 3300013296 Bacteria 47639
325 Ga0157374_10001261 3300013296 Bacteria 21620
326 Ga0157374_10002879 3300013296 Bacteria 14436
327 Ga0157374_10009549 3300013296 Bacteria 8332
328 Ga0157374_10132030 3300013296 Bacteria 2417
329 Ga0157374_10164274 3300013296 Bacteria 2163
330 Ga0157378_10004161 3300013297 Bacteria 12775
331 Ga0157378_10008593 3300013297 Bacteria 8886
332 Ga0157378_10027445 3300013297 Bacteria 5025
333 Ga0157378_10027708 3300013297 Bacteria 4997
334 Ga0157378_10062779 3300013297 Bacteria 3318
335 Ga0157378_10075808 3300013297 Bacteria 3029
336 Ga0157378_10187623 3300013297 Bacteria 1948
337 Ga0163162_10000024 3300013306 Bacteria 188515
338 Ga0163162_10000084 3300013306 Bacteria 86252
339 Ga0163162_10000510 3300013306 Bacteria 36016
340 Ga0163162_10003635 3300013306 Bacteria 14780
341 Ga0163162_10010342 3300013306 Bacteria 9069
342 Ga0163162_10220561 3300013306 Bacteria 2026
343 Ga0157372_10005788 3300013307 Bacteria 13169
344 Ga0157372_10007445 3300013307 Bacteria 11643
345 Ga0157372_10111568 3300013307 Bacteria 3133
346 Ga0157372_10119055 3300013307 Bacteria 3031
347 Ga0157372_10157079 3300013307 Bacteria 2627
348 Ga0157372_10185253 3300013307 Bacteria 2411
349 Ga0157372_10214327 3300013307 Bacteria 2231
350 Ga0157375_10000219 3300013308 Bacteria 53586
351 Ga0157375_10000616 3300013308 Bacteria 31588
352 Ga0157375_10013462 3300013308 Bacteria 7281
353 Ga0157375_10030799 3300013308 Bacteria 5064
354 Ga0157375_10055189 3300013308 Bacteria 3916
355 Ga0163163_10000388 3300014325 Bacteria 41885
356 Ga0163163_10022878 3300014325 Bacteria 5924
357 Ga0157380_10043637 3300014326 Bacteria 3511
358 Ga0157380_10049095 3300014326 Bacteria 3327
359 Ga0157380_10242238 3300014326 Bacteria 1627
360 Ga0157377_10002248 3300014745 Bacteria 8487
361 Ga0157377_10004867 3300014745 Bacteria 6244
362 Ga0157377_10005236 3300014745 Bacteria 6073
363 Ga0157379_10000078 3300014968 Bacteria 63565
364 Ga0157379_10039395 3300014968 Bacteria 4216
365 Ga0157379_10090138 3300014968 Bacteria 2751
366 Ga0157379_10098487 3300014968 Bacteria 2625
367 Ga0157379_10290973 3300014968 Bacteria 1487
368 Ga0157376_10000219 3300014969 Bacteria 39583
369 Ga0157376_10024890 3300014969 Bacteria 4708
370 Ga0157376_10037733 3300014969 Bacteria 3926
371 Ga0157376_10041030 3300014969 Bacteria 3786
372 Ga0157376_10082798 3300014969 Bacteria 2759
373 Ga0157376_10179620 3300014969 Bacteria 1933
374 Ga0182005_1000294 3300015265 Bacteria 31099
375 Ga0163161_10015478 3300017792 Bacteria 5318
376 Ga0163161_10019244 3300017792 Bacteria 4787
377 Ga0163161_10062866 3300017792 Bacteria 2705
378 Ga0213876_10010259 3300021384 Bacteria 5030
379 Ga0213876_10044704 3300021384 Bacteria 2341
380 Ga0209436_101389 3300025208 Bacteria 8545
381 Ga0207427_100204 3300025231 Bacteria 54529
382 Ga0209437_100048 3300025233 Bacteria 405107
383 Ga0209258_100032 3300025242 Bacteria 452764
384 Ga0209646_1000050 3300025246 Bacteria 296599
385 Ga0209646_1003487 3300025246 Bacteria 3101
386 Ga0209026_1000637 3300025250 Bacteria 21809
387 Ga0209148_1000223 3300025254 Bacteria 93490
388 Ga0209233_1000029 3300025261 Bacteria 641642
389 Ga0209455_1005960 3300025272 Bacteria 3671
390 Ga0209673_1000042 3300025273 Bacteria 300704
391 Ga0209564_1004940 3300025295 Bacteria 7880
392 Ga0209758_1003391 3300025297 Bacteria 14567
393 Ga0209758_1005114 3300025297 Bacteria 10377
394 Ga0209758_1010376 3300025297 Bacteria 5586
395 Ga0209050_1000295 3300025298 Bacteria 104889
396 Ga0209050_1001207 3300025298 Bacteria 30299
397 Ga0209050_1025068 3300025298 Bacteria 2040
398 Ga0207426_1000105 3300025302 Bacteria 247269
399 Ga0207426_1000711 3300025302 Bacteria 38972
400 Ga0207426_1001775 3300025302 Bacteria 16222
401 Ga0207426_1010051 3300025302 Bacteria 3700
402 Ga0209257_1000007 3300025304 Bacteria 1564415
403 Ga0209257_1000128 3300025304 Bacteria 214268
404 Ga0209257_1001716 3300025304 Bacteria 24510
405 Ga0207656_10001244 3300025321 Bacteria 8399
406 Ga0207656_10045430 3300025321 Bacteria 1880
407 Ga0207688_10018799 3300025901 Bacteria 3759
408 Ga0207680_10000369 3300025903 Bacteria 21664
409 Ga0207680_10013164 3300025903 Bacteria 4240
410 Ga0207680_10023789 3300025903 Bacteria 3351
411 Ga0207680_10125019 3300025903 Bacteria 1687
412 Ga0207647_10000051 3300025904 Bacteria 87826
413 Ga0207647_10022032 3300025904 Bacteria 4239
414 Ga0207647_10085907 3300025904 Bacteria 1881
415 Ga0207645_10000156 3300025907 Bacteria 53492
416 Ga0207645_10003882 3300025907 Bacteria 11175
417 Ga0207645_10013421 3300025907 Bacteria 5521
418 Ga0207645_10096578 3300025907 Bacteria 1904
419 Ga0207643_10006662 3300025908 Bacteria 6193
420 Ga0207643_10011676 3300025908 Bacteria 4743
421 Ga0207643_10044052 3300025908 Bacteria 2519
422 Ga0207643_10077774 3300025908 Bacteria 1918
423 Ga0207705_10007511 3300025909 Bacteria 8009
424 Ga0207705_10049268 3300025909 Bacteria 3032
425 Ga0207705_10143653 3300025909 Bacteria 1784
426 Ga0207654_10000828 3300025911 Bacteria 17043
427 Ga0207654_10002743 3300025911 Bacteria 8936
428 Ga0207654_10004390 3300025911 Bacteria 7108
429 Ga0207654_10006614 3300025911 Bacteria 5830
430 Ga0207654_10007708 3300025911 Bacteria 5432
431 Ga0207707_10052527 3300025912 Bacteria 3548
432 Ga0207695_10000060 3300025913 Bacteria 360217
433 Ga0207695_10000185 3300025913 Bacteria 180225
434 Ga0207695_10000666 3300025913 Bacteria 67698
435 Ga0207695_10005639 3300025913 Bacteria 16519
436 Ga0207695_10019309 3300025913 Bacteria 7849
437 Ga0207695_10019941 3300025913 Bacteria 7700
438 Ga0207695_10021827 3300025913 Bacteria 7291
439 Ga0207695_10058175 3300025913 Bacteria 4013
440 Ga0207695_10124895 3300025913 Bacteria 2537
441 Ga0207695_10268643 3300025913 Bacteria 1601
442 Ga0207671_10002465 3300025914 Bacteria 19764
443 Ga0207671_10005680 3300025914 Bacteria 11404
444 Ga0207671_10009372 3300025914 Bacteria 8186
445 Ga0207671_10011264 3300025914 Bacteria 7296
446 Ga0207671_10011822 3300025914 Bacteria 7065
447 Ga0207671_10015343 3300025914 Bacteria 6002
448 Ga0207671_10023857 3300025914 Bacteria 4608
449 Ga0207671_10026174 3300025914 Bacteria 4374
450 Ga0207671_10035973 3300025914 Bacteria 3672
451 Ga0207660_10004270 3300025917 Bacteria 9313
452 Ga0207660_10009343 3300025917 Bacteria 6346
453 Ga0207657_10077204 3300025919 Bacteria 2808
454 Ga0207649_10001181 3300025920 Bacteria 15722
455 Ga0207652_10014701 3300025921 Bacteria 6344
456 Ga0207681_10079562 3300025923 Bacteria 2310
457 Ga0207681_10186620 3300025923 Bacteria 1583
458 Ga0207694_10011559 3300025924 Bacteria 6660
459 Ga0207694_10028134 3300025924 Bacteria 4285
460 Ga0207694_10059933 3300025924 Bacteria 2961
461 Ga0207650_10077799 3300025925 Bacteria 2508
462 Ga0207659_10032676 3300025926 Bacteria 3574
463 Ga0207659_10067892 3300025926 Bacteria 2592
464 Ga0207659_10069974 3300025926 Bacteria 2558
465 Ga0207644_10035849 3300025931 Bacteria 3479
466 Ga0207644_10083177 3300025931 Bacteria 2370
467 Ga0207706_10000122 3300025933 Bacteria 83838
468 Ga0207706_10004505 3300025933 Bacteria 13082
469 Ga0207706_10014606 3300025933 Bacteria 7111
470 Ga0207706_10022199 3300025933 Bacteria 5696
471 Ga0207706_10053352 3300025933 Bacteria 3569
472 Ga0207686_10001038 3300025934 Bacteria 16431
473 Ga0207709_10271318 3300025935 Bacteria 1249
474 Ga0207670_10026350 3300025936 Bacteria 3662
475 Ga0207670_10043575 3300025936 Bacteria 2965
476 Ga0207669_10043887 3300025937 Bacteria 2622
477 Ga0207704_10000041 3300025938 Bacteria 89976
478 Ga0207704_10200942 3300025938 Bacteria 1459
479 Ga0207691_10000014 3300025940 Bacteria 142542
480 Ga0207691_10001372 3300025940 Bacteria 24295
481 Ga0207691_10006843 3300025940 Bacteria 11002
482 Ga0207691_10052525 3300025940 Bacteria 3722
483 Ga0207691_10152025 3300025940 Bacteria 2034
484 Ga0207691_10186318 3300025940 Unclassified 1812
485 Ga0207689_10014672 3300025942 Bacteria 6653
486 Ga0207689_10016596 3300025942 Bacteria 6231
487 Ga0207689_10041962 3300025942 Bacteria 3786
488 Ga0207689_10075180 3300025942 Bacteria 2777
489 Ga0207661_10018492 3300025944 Bacteria 5177
490 Ga0207679_10000909 3300025945 Bacteria 18903
491 Ga0207679_10118647 3300025945 Bacteria 2102
492 Ga0207667_10000039 3300025949 Bacteria 278843
493 Ga0207667_10000084 3300025949 Bacteria 152086
494 Ga0207667_10001931 3300025949 Bacteria 25993
495 Ga0207667_10004246 3300025949 Bacteria 17581
496 Ga0207667_10017761 3300025949 Bacteria 8001
497 Ga0207667_10022635 3300025949 Bacteria 6934
498 Ga0207667_10203855 3300025949 Bacteria 2029
499 Ga0207651_10024826 3300025960 Bacteria 3715
500 Ga0207651_10026783 3300025960 Bacteria 3609
501 Ga0207651_10175114 3300025960 Bacteria 1696
502 Ga0207712_10047014 3300025961 Bacteria 2994
503 Ga0207712_10062662 3300025961 Bacteria 2644
504 Ga0207668_10000286 3300025972 Bacteria 33154
505 Ga0207668_10248282 3300025972 Bacteria 1444
506 Ga0207640_10157196 3300025981 Unclassified 1677
507 Ga0207658_10003829 3300025986 Bacteria 10597
508 Ga0207658_10008758 3300025986 Bacteria 6871
509 Ga0207658_10077582 3300025986 Bacteria 2535
510 Ga0207658_10096011 3300025986 Bacteria 2311
511 Ga0207677_10000815 3300026023 Bacteria 17837
512 Ga0207677_10031546 3300026023 Bacteria 3395
513 Ga0207677_10039672 3300026023 Bacteria 3098
514 Ga0207677_10053571 3300026023 Bacteria 2747
515 Ga0207677_10057635 3300026023 Bacteria 2669
516 Ga0207677_10114535 3300026023 Bacteria 2015
517 Ga0207677_10130379 3300026023 Bacteria 1908
518 Ga0207703_10001163 3300026035 Bacteria 24833
519 Ga0207703_10118699 3300026035 Bacteria 2268
520 Ga0207703_10360813 3300026035 Bacteria 1340
521 Ga0207639_10010664 3300026041 Bacteria 6364
522 Ga0207639_10022234 3300026041 Bacteria 4565
523 Ga0207639_10024756 3300026041 Bacteria 4349
524 Ga0207639_10027714 3300026041 Bacteria 4130
525 Ga0207678_10191739 3300026067 Bacteria 1747
526 Ga0207702_10000861 3300026078 Bacteria 31674
527 Ga0207702_10080774 3300026078 Bacteria 2822
528 Ga0207641_10000155 3300026088 Bacteria 97385
529 Ga0207641_10001712 3300026088 Bacteria 21281
530 Ga0207641_10036756 3300026088 Bacteria 4088
531 Ga0207641_10045902 3300026088 Bacteria 3681
532 Ga0207641_10070207 3300026088 Bacteria 3010
533 Ga0207641_10075528 3300026088 Unclassified 2910
534 Ga0207648_10000645 3300026089 Bacteria 39153
535 Ga0207648_10003712 3300026089 Bacteria 15982
536 Ga0207648_10004371 3300026089 Bacteria 14530
537 Ga0207648_10034959 3300026089 Bacteria 4430
538 Ga0207648_10054258 3300026089 Bacteria 3501
539 Ga0207676_10011233 3300026095 Bacteria 6397
540 Ga0207676_10031919 3300026095 Bacteria 3964
541 Ga0207676_10032674 3300026095 Bacteria 3924
542 Ga0207676_10252616 3300026095 Bacteria 1588
543 Ga0207676_10277714 3300026095 Bacteria 1520
544 Ga0207674_10001267 3300026116 Bacteria 33015
545 Ga0207674_10001616 3300026116 Bacteria 28994
546 Ga0207674_10003427 3300026116 Bacteria 19412
547 Ga0207674_10020871 3300026116 Bacteria 7068
548 Ga0207674_10199902 3300026116 Bacteria 1948
549 Ga0207675_100001183 3300026118 Bacteria 25978
550 Ga0207675_100019898 3300026118 Bacteria 6265
551 Ga0207675_100021831 3300026118 Bacteria 5960
552 Ga0207675_100056540 3300026118 Bacteria 3660
553 Ga0207675_100087317 3300026118 Bacteria 2929
554 Ga0207675_100118162 3300026118 Bacteria 2507
555 Ga0207683_10001922 3300026121 Bacteria 18390
556 Ga0207683_10023174 3300026121 Bacteria 5336
557 Ga0207698_10004138 3300026142 Bacteria 8814
558 Ga0207698_10004684 3300026142 Bacteria 8363
559 Ga0207698_10026987 3300026142 Bacteria 4071
560 Ga0207698_10102040 3300026142 Bacteria 2380
561 Ga0207698_10155181 3300026142 Bacteria 1993
562 Ga0207428_10011109 3300027907 Bacteria 7998
563 Ga0268266_10000088 3300028379 Bacteria 199029
564 Ga0268266_10000137 3300028379 Bacteria 140685
565 Ga0268266_10002464 3300028379 Bacteria 19788
566 Ga0268264_10000484 3300028381 Bacteria 52947
567 Ga0268264_10003582 3300028381 Bacteria 13377
568 Ga0268264_10004151 3300028381 Bacteria 12386
569 Ga0268264_10005674 3300028381 Bacteria 10584
570 Ga0307517_10000959 3300028786 Bacteria 48920
571 Ga0307517_10010052 3300028786 Bacteria 13301
572 Ga0307515_10000012 3300028794 Bacteria 582232
573 Ga0307515_10000363 3300028794 Bacteria 111302
574 Ga0265338_10031831 3300028800 Bacteria 5162
575 Ga0307511_10001671 3300030521 Bacteria 23361
576 Ga0265327_10000152 3300031251 Bacteria 149065
577 Ga0265327_10018278 3300031251 Bacteria 4355
578 Ga0307513_10053489 3300031456 Bacteria 4339
579 Ga0307513_10064861 3300031456 Bacteria 3845
580 Ga0307509_10006387 3300031507 Bacteria 15889
581 Ga0307509_10009690 3300031507 Bacteria 11968
582 Ga0307408_100003690 3300031548 Bacteria 10432
583 Ga0307408_100017838 3300031548 Bacteria 4756
584 Ga0307508_10001601 3300031616 Bacteria 25237
585 Ga0307516_10002853 3300031730 Bacteria 22760
586 Ga0307516_10112980 3300031730 Bacteria 2515
587 Ga0316577_10022831 3300031733 Bacteria 3475
588 Ga0307412_10078911 3300031911 Bacteria 2269
589 Ga0307416_100043251 3300032002 Bacteria 3525
590 Ga0307416_100284081 3300032002 Bacteria 1634
591 Ga0307414_10017794 3300032004 Bacteria 4357
592 Ga0307414_10083957 3300032004 Bacteria 2341
593 Ga0307411_10179015 3300032005 Bacteria 1607
594 Ga0307510_10000074 3300033180 Bacteria 75194
595 Ga0307510_10021413 3300033180 Bacteria 7532
596 Ga0373955_0160915 3300035172 Bacteria 1325
597 Ga0373927_0020017 3300035695 Bacteria 4389
598 Ga0373937_0030534 3300036401 Bacteria 4880
599 Ga0316584_0151445 3300036712 Bacteria 1726
600 Ga0395899_0004641 3300037312 Bacteria 10713
601 Ga0395900_0000014 3300037418 Bacteria 386513
602 Ga0395900_0000357 3300037418 Bacteria 66369
603 Ga0395898_0005171 3300037466 Bacteria 14117
604 Ga0395905_0000241 3300037471 Bacteria 82847
605 Ga0395905_0001914 3300037471 Bacteria 23897
606 Ga0395901_0002234 3300038443 Bacteria 19753
607 Ga0395901_0006039 3300038443 Bacteria 12274
608 Ga0436365_1727150 3300039437 Bacteria 7083
609 Ga0439436_0010284 3300041404 Bacteria 2857
610 Ga0439436_0013224 3300041404 Bacteria 2499
611 Ga0439439_0006910 3300041406 Bacteria 2635
612 Ga0439431_0001817 3300041997 Bacteria 4722
613 Ga0439431_0010470 3300041997 Bacteria 2105
614 Ga0439442_006236 3300042002 Bacteria 2392
615 Ga0439445_0005470 3300042004 Bacteria 2896
616 Ga0439449_0000332 3300042007 Bacteria 17103
617 Ga0439449_0031633 3300042007 Bacteria 1973
618 Ga0439457_002437 3300042014 Bacteria 5319
619 Ga0439462_0037047 3300042015 Bacteria 1299
620 Ga0450897_000991 3300042128 Bacteria 1800
621 Ga0439434_0007514 3300042435 Bacteria 3194
622 Ga0451577_0002166 3300042876 Bacteria 24011
623 Ga0451577_0002748 3300042876 Bacteria 20396
624 Ga0451577_0006701 3300042876 Bacteria 11431
625 Ga0451577_0035910 3300042876 Bacteria 4464
626 Ga0451577_0143130 3300042876 Bacteria 2149
627 Ga0451577_0195132 3300042876 Bacteria 1827
628 Ga0466969_0000940 3300044656 Bacteria 15720
629 Ga0466972_0000022 3300044658 Bacteria 193802
630 Ga0466972_0000108 3300044658 Bacteria 71610
631 Ga0466982_0064539 3300044672 Bacteria 2256
632 Ga0466965_0043861 3300044683 Bacteria 2209
633 Ga0466966_0025199 3300044684 Bacteria 3886
634 Ga0453684_0000771 3300044712 Bacteria 110664
635 Ga0453684_0001035 3300044712 Bacteria 88955
636 Ga0453684_0002604 3300044712 Bacteria 43124
637 Ga0453684_0004538 3300044712 Bacteria 29114
638 Ga0453684_0023677 3300044712 Bacteria 9024
639 Ga0453684_0029659 3300044712 Bacteria 7757
640 Ga0453684_0078113 3300044712 Bacteria 4144
641 Ga0453684_0113443 3300044712 Bacteria 3287
642 Ga0453684_0168128 3300044712 Bacteria 2587
643 Ga0466971_0015381 3300044719 Bacteria 3367
644 Ga0466968_0081558 3300044735 Bacteria 1422
645 Ga0466970_0000367 3300044765 Bacteria 21910
646 Ga0466957_0008234 3300044842 Bacteria 5923
647 Ga0466957_0027951 3300044842 Bacteria 3355
648 Ga0466957_0077549 3300044842 Bacteria 2065
649 Ga0466960_0063354 3300044901 Bacteria 1820
650 Ga0466959_0000025 3300045049 Bacteria 120128
651 Ga0466959_0023180 3300045049 Bacteria 4593
652 Ga0451576_0004004 3300045051 Bacteria 19605
653 Ga0451576_0015745 3300045051 Bacteria 8371
654 Ga0451576_0357748 3300045051 Bacteria 1529
655 Ga0495627_004527 3300046453 Bacteria 5797
656 Ga0495592_0031736 3300046454 Bacteria 3991
657 Ga0495592_0175138 3300046454 Bacteria 1466
658 Ga0495638_0000004 3300046460 Bacteria 700795
659 Ga0495638_0071686 3300046460 Bacteria 2119
660 Ga0495638_0148164 3300046460 Bacteria 1363
661 Ga0495606_0010248 3300046507 Bacteria 7809
662 Ga0495606_0064889 3300046507 Bacteria 2322
663 Ga0495608_0035559 3300046511 Bacteria 3359
664 Ga0495628_0017999 3300046516 Bacteria 5862
665 Ga0495644_0002493 3300046523 Bacteria 7343
666 Ga0495648_0000294 3300046524 Bacteria 55789
667 Ga0495652_0202937 3300046529 Bacteria 1503
668 Ga0495645_0194287 3300046543 Bacteria 1381
669 Ga0495633_0001374 3300046558 Bacteria 19009
670 Ga0495668_0001899 3300046616 Bacteria 18698
671 Ga0495668_0103065 3300046616 Bacteria 1561
672 Ga0495611_0000274 3300046648 Bacteria 35206
673 Ga0495611_0074110 3300046648 Bacteria 1559
674 Ga0495635_0105204 3300046663 Bacteria 1928
675 Ga0495661_0078724 3300046665 Bacteria 1906
676 Ga0495649_0031063 3300046694 Bacteria 2947
677 Ga0495649_0101118 3300046694 Bacteria 1532
678 Ga0495672_0057673 3300047320 Bacteria 2254
679 Ga0495687_000010 3300047443 Bacteria 413735
680 Ga0495675_0056842 3300047444 Bacteria 2481
681 Ga0495677_0035719 3300047445 Bacteria 1814
682 Ga0495686_0000102 3300047472 Bacteria 177525
683 Ga0495686_0057563 3300047472 Bacteria 2426
684 Ga0496102_0254332 3300048905 Bacteria 1656
685 Ga0496110_0437307 3300048913 Bacteria 1192
686 Ga0496111_0089179 3300048914 Bacteria 2259
687 Ga0496111_0166126 3300048914 Bacteria 1639
688 Ga0496112_0025653 3300048915 Bacteria 5661
689 Ga0496121_0000051 3300048924 Bacteria 315378
690 Ga0501298_003020 3300049521 Bacteria 2591
691 Ga0501300_002090 3300049523 Bacteria 2981
692 Ga0501031_0069882 3300049568 Bacteria 2287
693 Ga0501031_0090747 3300049568 Bacteria 1993
694 Ga0501034_0024528 3300049571 Bacteria 6135
695 Ga0501034_0086214 3300049571 Bacteria 3141
696 Ga0501034_0280666 3300049571 Bacteria 1605
697 Ga0501036_0009447 3300049572 Bacteria 8021
698 Ga0501037_0138367 3300049573 Bacteria 1743
699 Ga0501038_0013907 3300049574 Bacteria 7335
700 Ga0501038_0088589 3300049574 Bacteria 2598
701 Ga0501039_0162152 3300049575 Bacteria 1757
702 Ga0501040_0016966 3300049576 Bacteria 4828
703 Ga0501043_0154819 3300049579 Bacteria 1793
704 Ga0501047_0006633 3300049581 Bacteria 10886
705 Ga0501047_0031077 3300049581 Bacteria 5150
706 Ga0501047_0197182 3300049581 Bacteria 1875
707 Ga0501047_0229782 3300049581 Bacteria 1709
708 Ga0501047_0258629 3300049581 Bacteria 1589
709 Ga0501048_0199071 3300049582 Bacteria 1420
710 Ga0501072_0048071 3300049588 Bacteria 3360
711 Ga0501073_0021932 3300049589 Bacteria 4601
712 Ga0501076_0021489 3300049592 Bacteria 4952
713 Ga0501201_000025 3300049651 Bacteria 9478
714 Ga0501202_002827 3300049652 Bacteria 2940
715 Ga0501222_000486 3300049662 Bacteria 5894
716 Ga0501222_001469 3300049662 Bacteria 3306
717 Ga0501223_000781 3300049663 Bacteria 7534
718 Ga0501224_000108 3300049664 Bacteria 8879
719 Ga0501235_000528 3300049669 Bacteria 7639
720 Ga0501243_000071 3300049675 Bacteria 10207
721 Ga0501247_000431 3300049677 Bacteria 3267
722 Ga0501252_000336 3300049682 Bacteria 3375
723 Ga0501253_004592 3300049683 Bacteria 1755
724 Ga0501257_001403 3300049686 Bacteria 4970
725 Ga0501257_005312 3300049686 Bacteria 2833
726 Ga0501259_000621 3300049688 Bacteria 5699
727 Ga0501219_000215 3300049703 Bacteria 10886
728 Ga0501221_000830 3300049704 Bacteria 5023
729 Ga0501234_001058 3300049707 Bacteria 4347
730 Ga0501245_000770 3300049708 Bacteria 3999
731 Ga0501079_0025221 3300049741 Bacteria 4561
732 Ga0501081_0193466 3300049743 Bacteria 1473
733 Ga0501083_0018107 3300049744 Bacteria 4910
734 Ga0501241_000299 3300049758 Bacteria 10918
735 Ga0501264_000114 3300049761 Bacteria 12301
736 Ga0501044_0005828 3300049823 Bacteria 13646
737 Ga0501044_0085615 3300049823 Bacteria 3185
738 Ga0501044_0132553 3300049823 Bacteria 2485
739 Ga0501044_0256109 3300049823 Bacteria 1689
740 Ga0501284_00096 3300050005 Bacteria 19148
741 nmdc:mga05p37_18061_c1 3300050507 Bacteria 8519
742 nmdc:mga05p37_18797_c1 3300050507 Bacteria 8352
743 nmdc:mga05p37_201220_c1 3300050507 Bacteria 2412
744 nmdc:mga05p37_485917_c1 3300050507 Bacteria 1421
745 nmdc:mga09592_25098_c1 3300050508 Bacteria 4932
746 nmdc:mga06r32_11835_c1 3300050510 Bacteria 7856
747 nmdc:mga08y16_1505_c1 3300050511 Bacteria 23452
748 nmdc:mga08y16_192153_c1 3300050511 Bacteria 2117
749 nmdc:mga08y16_21207_c1 3300050511 Bacteria 6861
750 Ga0500635_0006413 3300053080 Bacteria 3141
751 Ga0500578_0000315 3300053086 Bacteria 59398
752 Ga0500644_0000032 3300053088 Bacteria 85851
753 Ga0500644_0005850 3300053088 Bacteria 3122
754 Ga0500646_0002064 3300053090 Bacteria 5240
755 Ga0500583_0000017 3300053092 Bacteria 141647
756 Ga0500583_0010310 3300053092 Bacteria 3461
757 Ga0500583_0024518 3300053092 Bacteria 2560
758 Ga0500562_013842 3300053108 Bacteria 2063
759 Ga0500569_000043 3300053109 Bacteria 23160
760 Ga0500607_043850 3300053121 Bacteria 2408
761 Ga0500642_0017763 3300053130 Bacteria 2735
762 Ga0500568_0013027 3300053139 Bacteria 3805
763 Ga0500568_0013112 3300053139 Bacteria 3788
764 Ga0500588_0041403 3300053146 Bacteria 1390
765 Ga0500590_008016 3300053148 Bacteria 5257
766 Ga0500604_0015350 3300053151 Bacteria 2097
767 Ga0500616_0000015 3300053153 Bacteria 633259
768 Ga0500616_0006711 3300053153 Bacteria 7471
769 Ga0500616_0030085 3300053153 Bacteria 2984
770 Ga0500622_0000075 3300053156 Bacteria 109513
771 Ga0500622_0000086 3300053156 Bacteria 99366
772 Ga0500622_0000093 3300053156 Bacteria 92537
773 Ga0500622_0002243 3300053156 Bacteria 14211
774 Ga0500622_0004441 3300053156 Bacteria 8812
775 Ga0500622_0085730 3300053156 Bacteria 1570
776 Ga0500633_0009997 3300053160 Bacteria 2519
777 Ga0500636_0032724 3300053177 Bacteria 3078
778 Ga0500636_0073176 3300053177 Bacteria 1985
779 Ga0501082_0022571 3300060353 Bacteria 5420
780 2522549510 2522125168 Bacteria 7376607
781 2738730309 2738541278 Bacteria 9755573
782 2819577321 2818991442 Bacteria 8318214
783 2821140624 2821136567 Bacteria 8080116
784 2840678308 2840677318 Bacteria 2664183
785 2852627179 2852623160 Bacteria 4376875
786 2883071236 2883068021 Bacteria 6192739
787 2884791832 2884791551 Bacteria 8511252
788 2884935884 2884933994 Bacteria 4535041
789 2896086125 2896085136 Bacteria 6129793
790 2896115300 2896109856 Bacteria 7140722
791 2904473043 2904467357 Bacteria 8057758
792 2910250785 2910245624 Bacteria 6935613
793 2929178187 2929177148 Bacteria 7883697
794 2929240488 2929239360 Bacteria 7745570
795 2929922331 2929921140 Bacteria 8649150
796 2945980549 2945977869 Bacteria 7777518
797 2946013588 2946013367 Bacteria 7766675
798 8003156680 8003151029 Bacteria 8187759
799 Ga0070686_100102581
800 SwRhRL2b_contig_3365545
801 JGI24739J22299_10001725
802 JGI25162J39368_1002488
803 JGI25154J39366_1000120
804 JGI25157J39369_1003864
805 JGI25164J39214_1000976
806 JGI25406J46586_10000481
807 JGI25165J46597_1000426
808 JGI25153J46596_10015134
809 JGI25153J46596_10026466
810 rootH1_10000642
811 rootH1_10063898
812 rootH2_10001529
813 rootH2_10004243
814 rootH2_10016199
815 rootH2_10021351
816 rootH2_10037508
817 rootH2_10067178
818 rootL2_10004081
819 rootL2_10010050
820 rootL2_10025221
821 rootL2_10078697
822 rootL2_10086654
823 rootH1_10003667
824 rootH1_10007212
825 rootH1_10033931
826 rootH1_10044901
827 rootH1_10057868
828 rootH1_10090043
829 JGI25160J50197_1001317
830 Ga0055542_1007334
831 Ga0055526_1009734
832 Ga0055528_1000265
833 Ga0055530_10003316
834 Ga0055530_10021000
835 Ga0055531_10000115
836 Ga0055531_10000169
837 Ga0055543_1009073
838 Ga0065165_1000358
839 Ga0065165_1000519
840 Ga0065165_1010940
841 Ga0065704_10071683
842 Ga0065712_10013012
843 Ga0065712_10071842
844 Ga0065712_10076510
845 Ga0065712_10086019
846 Ga0070658_10072092
847 Ga0070676_10000081
848 Ga0070676_10000086
849 Ga0070676_10036264
850 Ga0070683_100000508
851 Ga0070683_100009114
852 Ga0070683_100013382
853 Ga0070690_100071707
854 Ga0070670_100035386
855 Ga0070670_100037929
856 Ga0070670_100038397
857 Ga0070670_100062492
858 Ga0070670_100162207
859 Ga0070677_10053632
860 Ga0068869_100010484
861 Ga0068869_100025094
862 Ga0068869_100048224
863 Ga0068869_100098615
864 Ga0068869_100131300
865 Ga0068869_100182409
866 Ga0070666_10000110
867 Ga0070666_10010336
868 Ga0070666_10014633
869 Ga0070666_10032865
870 Ga0070680_100002529
871 Ga0070682_100007037
872 Ga0068868_100000420
873 Ga0068868_100010515
874 Ga0068868_100026384
875 Ga0068868_100041064
876 Ga0068868_100041472
877 Ga0068868_100136484
878 Ga0070660_100007231
879 Ga0070689_100009325
880 Ga0070689_100019305
881 Ga0070689_100115162
882 Ga0070691_10007389
883 Ga0070691_10013358
884 Ga0070661_100000111
885 Ga0070661_100061446
886 Ga0070668_100000077
887 Ga0070668_100024712
888 Ga0070668_100046103
889 Ga0070668_100192490
890 Ga0070669_100001696
891 Ga0070669_100021159
892 Ga0070669_100038636
893 Ga0070669_100116157
894 Ga0070675_100020849
895 Ga0070675_100020879
896 Ga0070675_100037185
897 Ga0070671_100003332
898 Ga0070671_100010273
899 Ga0070671_100103567
900 Ga0070671_100104571
901 Ga0070674_100072723
902 Ga0070674_100087818
903 Ga0070673_100000072
904 Ga0070673_100001289
905 Ga0070673_100014416
906 Ga0070673_100083080
907 Ga0070688_100056018
908 Ga0070659_100004012
909 Ga0070667_100000382
910 Ga0070667_100005185
911 Ga0070667_100016325
912 Ga0070667_100033408
913 Ga0070711_100042892
914 Ga0070678_100294242
915 Ga0070662_100000011
916 Ga0070662_100016867
917 Ga0070662_100151587
918 Ga0070681_10020519
919 Ga0070681_10052850
920 Ga0070681_10058761
921 Ga0070681_10098827
922 Ga0068867_100000558
923 Ga0068867_100002567
924 Ga0068867_100013547
925 Ga0068867_100022499
926 Ga0068867_100047386
927 Ga0068867_100119985
928 Ga0070685_10003168
929 Ga0070685_10039777
930 Ga0070685_10075053
931 Ga0070698_100009065
932 Ga0070698_100021251
933 Ga0070698_100023339
934 Ga0070698_100354040
935 Ga0070679_100017217
936 Ga0070679_100050288
937 Ga0070679_100051240
938 Ga0070684_100006108
939 Ga0070684_100060256
940 Ga0070684_100064156
941 Ga0070684_100077523
942 Ga0068853_100013016
943 Ga0068853_100038517
944 Ga0068853_100072769
945 Ga0068853_100087345
946 Ga0068853_100167475
947 Ga0070672_100000240
948 Ga0070672_100028861
949 Ga0070672_100054203
950 Ga0070672_100093627
951 Ga0070665_100000003
952 Ga0070665_100001677
953 Ga0070665_100032445
954 Ga0070665_100267228
955 Ga0068855_100000108
956 Ga0068855_100000260
957 Ga0068855_100003173
958 Ga0068855_100024009
959 Ga0068855_100068897
960 Ga0068855_100075471
961 Ga0068855_100099737
962 Ga0070664_100004434
963 Ga0070664_100005019
964 Ga0070664_100011721
965 Ga0070664_100025199
966 Ga0070664_100178036
967 Ga0068857_100001839
968 Ga0068857_100003159
969 Ga0068857_100022840
970 Ga0068857_100050419
971 Ga0068854_100012236
972 Ga0068854_100057107
973 Ga0068854_100061107
974 Ga0068854_100192405
975 Ga0068856_100001596
976 Ga0068856_100014292
977 Ga0068856_100045665
978 Ga0068856_100160281
979 Ga0068856_100242780
980 Ga0070702_100024277
981 Ga0068852_100000527
982 Ga0068852_100004482
983 Ga0068852_100039418
984 Ga0068852_100196765
985 Ga0068852_100395286
986 Ga0068859_100000026
987 Ga0068859_100046521
988 Ga0068859_100082711
989 Ga0068859_100119174
990 Ga0068859_100180784
991 Ga0068864_100000389
992 Ga0068864_100016837
993 Ga0068864_100019322
994 Ga0068864_100136905
995 Ga0068864_100231797
996 Ga0068866_10027931
997 Ga0068861_100010696
998 Ga0068861_100015199
999 Ga0068861_100057001
1000 Ga0068861_100103204
1001 Ga0068851_10000082
1002 Ga0068870_10009545
1003 Ga0068870_10010874
1004 Ga0068863_100023529
1005 Ga0068863_100027750
1006 Ga0068863_100118890
1007 Ga0068858_100000634
1008 Ga0068858_100028849
1009 Ga0068858_100391730
1010 Ga0068860_100000072
1011 Ga0068860_100001760
1012 Ga0068860_100009606
1013 Ga0068860_100032131
1014 Ga0068860_100042201
1015 Ga0068860_100389434
1016 Ga0068862_100005406
1017 Ga0081540_1014647
1018 Ga0081539_10000714
1019 Ga0081539_10008308
1020 Ga0097621_100000150
1021 Ga0097621_100002418
1022 Ga0097621_100002717
1023 Ga0097621_100003513
1024 Ga0097621_100006095
1025 Ga0097621_100036902
1026 Ga0097621_100043480
1027 Ga0097621_100088848
1028 Ga0097621_100169635
1029 Ga0068871_100000045
1030 Ga0068871_100001431
1031 Ga0068871_100026597
1032 Ga0068871_100062262
1033 Ga0068871_100089138
1034 Ga0068871_100216659
1035 Ga0068871_100288272
1036 Ga0075428_100015432
1037 Ga0075428_100066893
1038 Ga0075428_100423186
1039 Ga0075431_100017550
1040 Ga0075434_100170664
1041 Ga0075429_100019702
1042 Ga0068865_100000170
1043 Ga0068865_100096638
1044 Ga0097620_100000026
1045 Ga0097620_100046525
1046 Ga0097620_100082713
1047 Ga0097620_100119178
1048 Ga0097620_100180782
1049 Ga0105240_10000991
1050 Ga0105240_10001109
1051 Ga0105240_10002195
1052 Ga0105240_10002244
1053 Ga0105240_10012757
1054 Ga0105240_10019308
1055 Ga0105240_10023818
1056 Ga0105240_10028757
1057 Ga0105240_10033251
1058 Ga0105240_10039959
1059 Ga0105240_10102003
1060 Ga0105240_10169871
1061 Ga0111539_10003835
1062 Ga0111539_10043774
1063 Ga0111539_10484782
1064 Ga0105245_10017518
1065 Ga0105245_10107271
1066 Ga0105247_10026765
1067 Ga0105247_10179656
1068 Ga0114129_10007891
1069 Ga0114129_10041640
1070 Ga0105241_10000268
1071 Ga0105241_10000739
1072 Ga0105241_10001510
1073 Ga0105241_10003366
1074 Ga0105241_10003966
1075 Ga0105241_10050791
1076 Ga0105242_10007643
1077 Ga0105242_10008158
1078 Ga0105242_10014438
1079 Ga0105242_10181963
1080 Ga0105237_10000943
1081 Ga0105237_10005407
1082 Ga0105237_10005933
1083 Ga0105237_10012129
1084 Ga0105237_10012937
1085 Ga0105237_10017853
1086 Ga0105237_10049862
1087 Ga0105237_10062812
1088 Ga0105237_10272468
1089 Ga0105238_10002471
1090 Ga0105238_10016058
1091 Ga0105249_10002519
1092 Ga0105249_10020489
1093 Ga0105249_10072733
1094 Ga0105249_10210145
1095 Ga0105249_10275950
1096 Ga0105239_10000017
1097 Ga0105239_10000168
1098 Ga0105239_10001486
1099 Ga0105239_10007223
1100 Ga0105239_10010270
1101 Ga0105239_10019423
1102 Ga0105239_10038201
1103 Ga0105239_10053100
1104 Ga0105239_10124266
1105 Ga0105239_10271724
1106 Ga0105239_10400754
1107 Ga0105246_10054960
1108 Ga0105246_10075863
1109 Ga0105246_10077166
1110 Ga0105246_10107179
1111 Ga0157373_10014240
1112 Ga0157373_10087532
1113 Ga0157370_10001221
1114 Ga0157370_10002685
1115 Ga0157370_10025719
1116 Ga0157370_10081361
1117 Ga0157370_10154587
1118 Ga0157369_10008855
1119 Ga0157369_10109533
1120 Ga0157374_10000002
1121 Ga0157374_10000277
1122 Ga0157374_10001261
1123 Ga0157374_10002879
1124 Ga0157374_10009549
1125 Ga0157374_10132030
1126 Ga0157374_10164274
1127 Ga0157378_10004161
1128 Ga0157378_10008593
1129 Ga0157378_10027445
1130 Ga0157378_10027708
1131 Ga0157378_10062779
1132 Ga0157378_10075808
1133 Ga0157378_10187623
1134 Ga0163162_10000024
1135 Ga0163162_10000084
1136 Ga0163162_10000510
1137 Ga0163162_10003635
1138 Ga0163162_10010342
1139 Ga0163162_10220561
1140 Ga0157372_10005788
1141 Ga0157372_10007445
1142 Ga0157372_10111568
1143 Ga0157372_10119055
1144 Ga0157372_10157079
1145 Ga0157372_10185253
1146 Ga0157372_10214327
1147 Ga0157375_10000219
1148 Ga0157375_10000616
1149 Ga0157375_10013462
1150 Ga0157375_10030799
1151 Ga0157375_10055189
1152 Ga0163163_10000388
1153 Ga0163163_10022878
1154 Ga0157380_10043637
1155 Ga0157380_10049095
1156 Ga0157380_10242238
1157 Ga0157377_10002248
1158 Ga0157377_10004867
1159 Ga0157377_10005236
1160 Ga0157379_10000078
1161 Ga0157379_10039395
1162 Ga0157379_10090138
1163 Ga0157379_10098487
1164 Ga0157379_10290973
1165 Ga0157376_10000219
1166 Ga0157376_10024890
1167 Ga0157376_10037733
1168 Ga0157376_10041030
1169 Ga0157376_10082798
1170 Ga0157376_10179620
1171 Ga0182005_1000294
1172 Ga0163161_10015478
1173 Ga0163161_10019244
1174 Ga0163161_10062866
1175 Ga0213876_10010259
1176 Ga0213876_10044704
1177 Ga0209436_101389
1178 Ga0207427_100204
1179 Ga0209437_100048
1180 Ga0209258_100032
1181 Ga0209646_1000050
1182 Ga0209646_1003487
1183 Ga0209026_1000637
1184 Ga0209148_1000223
1185 Ga0209233_1000029
1186 Ga0209455_1005960
1187 Ga0209673_1000042
1188 Ga0209564_1004940
1189 Ga0209758_1003391
1190 Ga0209758_1005114
1191 Ga0209758_1010376
1192 Ga0209050_1000295
1193 Ga0209050_1001207
1194 Ga0209050_1025068
1195 Ga0207426_1000105
1196 Ga0207426_1000711
1197 Ga0207426_1001775
1198 Ga0207426_1010051
1199 Ga0209257_1000007
1200 Ga0209257_1000128
1201 Ga0209257_1001716
1202 Ga0207656_10001244
1203 Ga0207656_10045430
1204 Ga0207688_10018799
1205 Ga0207680_10000369
1206 Ga0207680_10013164
1207 Ga0207680_10023789
1208 Ga0207680_10125019
1209 Ga0207647_10000051
1210 Ga0207647_10022032
1211 Ga0207647_10085907
1212 Ga0207645_10000156
1213 Ga0207645_10003882
1214 Ga0207645_10013421
1215 Ga0207645_10096578
1216 Ga0207643_10006662
1217 Ga0207643_10011676
1218 Ga0207643_10044052
1219 Ga0207643_10077774
1220 Ga0207705_10007511
1221 Ga0207705_10049268
1222 Ga0207705_10143653
1223 Ga0207654_10000828
1224 Ga0207654_10002743
1225 Ga0207654_10004390
1226 Ga0207654_10006614
1227 Ga0207654_10007708
1228 Ga0207707_10052527
1229 Ga0207695_10000060
1230 Ga0207695_10000185
1231 Ga0207695_10000666
1232 Ga0207695_10005639
1233 Ga0207695_10019309
1234 Ga0207695_10019941
1235 Ga0207695_10021827
1236 Ga0207695_10058175
1237 Ga0207695_10124895
1238 Ga0207695_10268643
1239 Ga0207671_10002465
1240 Ga0207671_10005680
1241 Ga0207671_10009372
1242 Ga0207671_10011264
1243 Ga0207671_10011822
1244 Ga0207671_10015343
1245 Ga0207671_10023857
1246 Ga0207671_10026174
1247 Ga0207671_10035973
1248 Ga0207660_10004270
1249 Ga0207660_10009343
1250 Ga0207657_10077204
1251 Ga0207649_10001181
1252 Ga0207652_10014701
1253 Ga0207681_10079562
1254 Ga0207681_10186620
1255 Ga0207694_10011559
1256 Ga0207694_10028134
1257 Ga0207694_10059933
1258 Ga0207650_10077799
1259 Ga0207659_10032676
1260 Ga0207659_10067892
1261 Ga0207659_10069974
1262 Ga0207644_10035849
1263 Ga0207644_10083177
1264 Ga0207706_10000122
1265 Ga0207706_10004505
1266 Ga0207706_10014606
1267 Ga0207706_10022199
1268 Ga0207706_10053352
1269 Ga0207686_10001038
1270 Ga0207709_10271318
1271 Ga0207670_10026350
1272 Ga0207670_10043575
1273 Ga0207669_10043887
1274 Ga0207704_10000041
1275 Ga0207704_10200942
1276 Ga0207691_10000014
1277 Ga0207691_10001372
1278 Ga0207691_10006843
1279 Ga0207691_10052525
1280 Ga0207691_10152025
1281 Ga0207691_10186318
1282 Ga0207689_10014672
1283 Ga0207689_10016596
1284 Ga0207689_10041962
1285 Ga0207689_10075180
1286 Ga0207661_10018492
1287 Ga0207679_10000909
1288 Ga0207679_10118647
1289 Ga0207667_10000039
1290 Ga0207667_10000084
1291 Ga0207667_10001931
1292 Ga0207667_10004246
1293 Ga0207667_10017761
1294 Ga0207667_10022635
1295 Ga0207667_10203855
1296 Ga0207651_10024826
1297 Ga0207651_10026783
1298 Ga0207651_10175114
1299 Ga0207712_10047014
1300 Ga0207712_10062662
1301 Ga0207668_10000286
1302 Ga0207668_10248282
1303 Ga0207640_10157196
1304 Ga0207658_10003829
1305 Ga0207658_10008758
1306 Ga0207658_10077582
1307 Ga0207658_10096011
1308 Ga0207677_10000815
1309 Ga0207677_10031546
1310 Ga0207677_10039672
1311 Ga0207677_10053571
1312 Ga0207677_10057635
1313 Ga0207677_10114535
1314 Ga0207677_10130379
1315 Ga0207703_10001163
1316 Ga0207703_10118699
1317 Ga0207703_10360813
1318 Ga0207639_10010664
1319 Ga0207639_10022234
1320 Ga0207639_10024756
1321 Ga0207639_10027714
1322 Ga0207678_10191739
1323 Ga0207702_10000861
1324 Ga0207702_10080774
1325 Ga0207641_10000155
1326 Ga0207641_10001712
1327 Ga0207641_10036756
1328 Ga0207641_10045902
1329 Ga0207641_10070207
1330 Ga0207641_10075528
1331 Ga0207648_10000645
1332 Ga0207648_10003712
1333 Ga0207648_10004371
1334 Ga0207648_10034959
1335 Ga0207648_10054258
1336 Ga0207676_10011233
1337 Ga0207676_10031919
1338 Ga0207676_10032674
1339 Ga0207676_10252616
1340 Ga0207676_10277714
1341 Ga0207674_10001267
1342 Ga0207674_10001616
1343 Ga0207674_10003427
1344 Ga0207674_10020871
1345 Ga0207674_10199902
1346 Ga0207675_100001183
1347 Ga0207675_100019898
1348 Ga0207675_100021831
1349 Ga0207675_100056540
1350 Ga0207675_100087317
1351 Ga0207675_100118162
1352 Ga0207683_10001922
1353 Ga0207683_10023174
1354 Ga0207698_10004138
1355 Ga0207698_10004684
1356 Ga0207698_10026987
1357 Ga0207698_10102040
1358 Ga0207698_10155181
1359 Ga0207428_10011109
1360 Ga0268266_10000088
1361 Ga0268266_10000137
1362 Ga0268266_10002464
1363 Ga0268264_10000484
1364 Ga0268264_10003582
1365 Ga0268264_10004151
1366 Ga0268264_10005674
1367 Ga0307517_10000959
1368 Ga0307517_10010052
1369 Ga0307515_10000012
1370 Ga0307515_10000363
1371 Ga0265338_10031831
1372 Ga0307511_10001671
1373 Ga0265327_10000152
1374 Ga0265327_10018278
1375 Ga0307513_10053489
1376 Ga0307513_10064861
1377 Ga0307509_10006387
1378 Ga0307509_10009690
1379 Ga0307408_100003690
1380 Ga0307408_100017838
1381 Ga0307508_10001601
1382 Ga0307516_10002853
1383 Ga0307516_10112980
1384 Ga0316577_10022831
1385 Ga0307412_10078911
1386 Ga0307416_100043251
1387 Ga0307416_100284081
1388 Ga0307414_10017794
1389 Ga0307414_10083957
1390 Ga0307411_10179015
1391 Ga0307510_10000074
1392 Ga0307510_10021413
1393 Ga0373955_0160915
1394 Ga0373927_0020017
1395 Ga0373937_0030534
1396 Ga0316584_0151445
1397 Ga0395899_0004641
1398 Ga0395900_0000014
1399 Ga0395900_0000357
1400 Ga0395898_0005171
1401 Ga0395905_0000241
1402 Ga0395905_0001914
1403 Ga0395901_0002234
1404 Ga0395901_0006039
1405 Ga0436365_1727150
1406 Ga0439436_0010284
1407 Ga0439436_0013224
1408 Ga0439439_0006910
1409 Ga0439431_0001817
1410 Ga0439431_0010470
1411 Ga0439442_006236
1412 Ga0439445_0005470
1413 Ga0439449_0000332
1414 Ga0439449_0031633
1415 Ga0439457_002437
1416 Ga0439462_0037047
1417 Ga0450897_000991
1418 Ga0439434_0007514
1419 Ga0451577_0002166
1420 Ga0451577_0002748
1421 Ga0451577_0006701
1422 Ga0451577_0035910
1423 Ga0451577_0143130
1424 Ga0451577_0195132
1425 Ga0466969_0000940
1426 Ga0466972_0000022
1427 Ga0466972_0000108
1428 Ga0466982_0064539
1429 Ga0466965_0043861
1430 Ga0466966_0025199
1431 Ga0453684_0000771
1432 Ga0453684_0001035
1433 Ga0453684_0002604
1434 Ga0453684_0004538
1435 Ga0453684_0023677
1436 Ga0453684_0029659
1437 Ga0453684_0078113
1438 Ga0453684_0113443
1439 Ga0453684_0168128
1440 Ga0466971_0015381
1441 Ga0466968_0081558
1442 Ga0466970_0000367
1443 Ga0466957_0008234
1444 Ga0466957_0027951
1445 Ga0466957_0077549
1446 Ga0466960_0063354
1447 Ga0466959_0000025
1448 Ga0466959_0023180
1449 Ga0451576_0004004
1450 Ga0451576_0015745
1451 Ga0451576_0357748
1452 Ga0495627_004527
1453 Ga0495592_0031736
1454 Ga0495592_0175138
1455 Ga0495638_0000004
1456 Ga0495638_0071686
1457 Ga0495638_0148164
1458 Ga0495606_0010248
1459 Ga0495606_0064889
1460 Ga0495608_0035559
1461 Ga0495628_0017999
1462 Ga0495644_0002493
1463 Ga0495648_0000294
1464 Ga0495652_0202937
1465 Ga0495645_0194287
1466 Ga0495633_0001374
1467 Ga0495668_0001899
1468 Ga0495668_0103065
1469 Ga0495611_0000274
1470 Ga0495611_0074110
1471 Ga0495635_0105204
1472 Ga0495661_0078724
1473 Ga0495649_0031063
1474 Ga0495649_0101118
1475 Ga0495672_0057673
1476 Ga0495687_000010
1477 Ga0495675_0056842
1478 Ga0495677_0035719
1479 Ga0495686_0000102
1480 Ga0495686_0057563
1481 Ga0496102_0254332
1482 Ga0496110_0437307
1483 Ga0496111_0089179
1484 Ga0496111_0166126
1485 Ga0496112_0025653
1486 Ga0496121_0000051
1487 Ga0501298_003020
1488 Ga0501300_002090
1489 Ga0501031_0069882
1490 Ga0501031_0090747
1491 Ga0501034_0024528
1492 Ga0501034_0086214
1493 Ga0501034_0280666
1494 Ga0501036_0009447
1495 Ga0501037_0138367
1496 Ga0501038_0013907
1497 Ga0501038_0088589
1498 Ga0501039_0162152
1499 Ga0501040_0016966
1500 Ga0501043_0154819
1501 Ga0501047_0006633
1502 Ga0501047_0031077
1503 Ga0501047_0197182
1504 Ga0501047_0229782
1505 Ga0501047_0258629
1506 Ga0501048_0199071
1507 Ga0501072_0048071
1508 Ga0501073_0021932
1509 Ga0501076_0021489
1510 Ga0501201_000025
1511 Ga0501202_002827
1512 Ga0501222_000486
1513 Ga0501222_001469
1514 Ga0501223_000781
1515 Ga0501224_000108
1516 Ga0501235_000528
1517 Ga0501243_000071
1518 Ga0501247_000431
1519 Ga0501252_000336
1520 Ga0501253_004592
1521 Ga0501257_001403
1522 Ga0501257_005312
1523 Ga0501259_000621
1524 Ga0501219_000215
1525 Ga0501221_000830
1526 Ga0501234_001058
1527 Ga0501245_000770
1528 Ga0501079_0025221
1529 Ga0501081_0193466
1530 Ga0501083_0018107
1531 Ga0501241_000299
1532 Ga0501264_000114
1533 Ga0501044_0005828
1534 Ga0501044_0085615
1535 Ga0501044_0132553
1536 Ga0501044_0256109
1537 Ga0501284_00096
1538 nmdc:mga05p37_18061_c1
1539 nmdc:mga05p37_18797_c1
1540 nmdc:mga05p37_201220_c1
1541 nmdc:mga05p37_485917_c1
1542 nmdc:mga09592_25098_c1
1543 nmdc:mga06r32_11835_c1
1544 nmdc:mga08y16_1505_c1
1545 nmdc:mga08y16_192153_c1
1546 nmdc:mga08y16_21207_c1
1547 Ga0500635_0006413
1548 Ga0500578_0000315
1549 Ga0500644_0000032
1550 Ga0500644_0005850
1551 Ga0500646_0002064
1552 Ga0500583_0000017
1553 Ga0500583_0010310
1554 Ga0500583_0024518
1555 Ga0500562_013842
1556 Ga0500569_000043
1557 Ga0500607_043850
1558 Ga0500642_0017763
1559 Ga0500568_0013027
1560 Ga0500568_0013112
1561 Ga0500588_0041403
1562 Ga0500590_008016
1563 Ga0500604_0015350
1564 Ga0500616_0000015
1565 Ga0500616_0006711
1566 Ga0500616_0030085
1567 Ga0500622_0000075
1568 Ga0500622_0000086
1569 Ga0500622_0000093
1570 Ga0500622_0002243
1571 Ga0500622_0004441
1572 Ga0500622_0085730
1573 Ga0500633_0009997
1574 Ga0500636_0032724
1575 Ga0500636_0073176
1576 Ga0501082_0022571
1577 2522549510
1578 2738730309
1579 2819577321
1580 2821140624
1581 2840678308
1582 2852627179
1583 2883071236
1584 2884791832
1585 2884935884
1586 2896086125
1587 2896115300
1588 2904473043
1589 2910250785
1590 2929178187
1591 2929240488
1592 2929922331
1593 2945980549
1594 2946013588
1595 8003156680

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

34

151

0.97

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

162

284

0.95

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

35

127

0.87

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

166

376

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ryt-assembly1.cif.gz_A engineered beta-lactoglobulin: variant m107l 0.9337 366 395
7z9z-assembly1.cif.gz_AAA-2 mutant l39y of recombinant bovine beta-lactoglobulin in complex with pramocaine 0.9312 366 395
7bvj-assembly4.cif.gz_D udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.9009 2 336
6nor-assembly1.cif.gz_A crystal structure of gend2 from gentamicin a biosynthesis in complex with nad 0.8994 2 344
6a3j-assembly1.cif.gz_D levoglucosan dehydrogenase, complex with nadh and l-sorbose 0.8908 2 343
ID Description Score Start End Superfamily
3ezyC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9557 3 116 3.40.50.720
af_Q54H02_2_246_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9528 366 395 3.50.50.60
af_Q04869_4_115_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9481 3 109 3.40.50.720
3q2kH01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9442 3 123 3.40.50.720
af_B1WBV3_5_113_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9354 3 113 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7X3RDH1-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9551 1 143 GO:0000166
AF-A0A536UNG7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9498 2 116 GO:0000166
AF-A0A836SQT7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9451 3 146 GO:0000166
AF-A0A535DBZ8-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9434 1 146 GO:0000166
GO:0003824
AF-A0A351MHT5-F1-model_v4 Dehydrogenase 0.9433 2 128 GO:0000166
GO:0016491

Map