F481237
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 797 | 336 | 1595 | 393 |
Family's Representative Sequence
| Representative Sequence | 3300005544|Ga0070686_100102581|Ga0070686_1001025812 |
| Length | 429 |
| Sequence | MFLFRKWHEEEQGTTSRAQGTSNQKTKQKTINMKRIAMLGSGFIGRFYADSLQGNRSQDKIVSIYSRREESAKKFAQDYNVSHWTIDMEECITNPDADVVCIALPNNLHEPAVMLCCKHKKAVIITKPLGRNGEEAKRMLEAVEKAGIFNGYLEDLVYTPKFLKALETVKNGALGRILWAKSRETHPGPHSDWFWNLEQAGGGCILDLGCHCVEITRSYIGKDIKPVEVMCWADTQVKPIDAEDHAIALIKYENGSIAQFEVSWTFRGGLDLRDEVMGTEGTIWINSFLRTGFEMFTTGKAANYVAEKAESNSGWLFPIGDELNELGYNHMFMDMFKAMEQKREPKENFYDGYIVNCILDAAYRSAKTKQWEPVKLDIWRGRTGVTKDSHLTEYDKDNYLVKEEVTHYGARKVILKNKHTNKIIEKVLE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 121 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 183 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 184 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 186 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 187 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 188 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 191 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 192 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 196 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 197 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 198 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 200 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 202 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 203 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 204 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 205 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 206 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 207 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 208 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 209 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 210 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 211 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 212 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 213 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 214 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 215 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 216 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 217 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 218 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 219 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 220 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 221 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 222 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 223 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 224 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 225 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 226 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 227 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 228 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 229 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 230 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 231 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 232 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 254 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 255 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 256 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 257 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 258 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 259 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 260 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 274 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 275 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 276 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 277 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 278 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 279 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 280 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 281 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 282 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 283 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 284 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 285 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 286 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 287 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 288 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 289 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 293 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 294 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 296 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 301 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 302 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 303 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 304 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 305 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 306 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 307 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 308 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 309 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 310 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 311 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 312 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 313 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 314 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 315 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 316 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 317 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 319 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 320 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 321 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 322 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 323 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 324 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 325 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 326 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 327 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 328 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 329 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 330 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 331 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 332 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 333 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 334 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 335 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 336 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.62 |
| Metatranscriptomes | 0 |
| Isolates | 2.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.53 |
| Nodule | 0 |
| Rhizoplane | 0.63 |
| Rhizosphere | 84.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070686_100102581 | 3300005544 | Bacteria | 1935 |
| 2 | SwRhRL2b_contig_3365545 | 2162886007 | Bacteria | 2495 |
| 3 | JGI24739J22299_10001725 | 3300001989 | Bacteria | 8308 |
| 4 | JGI25162J39368_1002488 | 3300002737 | Bacteria | 7085 |
| 5 | JGI25154J39366_1000120 | 3300002738 | Bacteria | 63261 |
| 6 | JGI25157J39369_1003864 | 3300002741 | Bacteria | 2910 |
| 7 | JGI25164J39214_1000976 | 3300002772 | Bacteria | 9102 |
| 8 | JGI25406J46586_10000481 | 3300003203 | Bacteria | 18605 |
| 9 | JGI25165J46597_1000426 | 3300003214 | Bacteria | 43457 |
| 10 | JGI25153J46596_10015134 | 3300003215 | Bacteria | 3162 |
| 11 | JGI25153J46596_10026466 | 3300003215 | Bacteria | 2051 |
| 12 | rootH1_10000642 | 3300003316 | Bacteria | 33948 |
| 13 | rootH1_10063898 | 3300003316 | Bacteria | 1932 |
| 14 | rootH1_10063898 | 3300003323 | Bacteria | 5530 |
| 15 | rootH2_10001529 | 3300003320 | Bacteria | 89054 |
| 16 | rootH2_10004243 | 3300003320 | Bacteria | 29145 |
| 17 | rootH2_10016199 | 3300003320 | Bacteria | 99895 |
| 18 | rootH2_10021351 | 3300003320 | Bacteria | 2703 |
| 19 | rootH2_10037508 | 3300003320 | Bacteria | 4267 |
| 20 | rootH2_10067178 | 3300003320 | Bacteria | 6630 |
| 21 | rootL2_10004081 | 3300003322 | Bacteria | 9778 |
| 22 | rootL2_10010050 | 3300003322 | Bacteria | 5737 |
| 23 | rootL2_10025221 | 3300003322 | Bacteria | 4323 |
| 24 | rootL2_10078697 | 3300003322 | Bacteria | 7050 |
| 25 | rootL2_10086654 | 3300003322 | Bacteria | 4355 |
| 26 | rootH1_10003667 | 3300003323 | Bacteria | 128566 |
| 27 | rootH1_10007212 | 3300003323 | Bacteria | 22648 |
| 28 | rootH1_10033931 | 3300003323 | Bacteria | 2530 |
| 29 | rootH1_10044901 | 3300003323 | Bacteria | 12138 |
| 30 | rootH1_10057868 | 3300003323 | Bacteria | 6127 |
| 31 | rootH1_10090043 | 3300003323 | Bacteria | 8677 |
| 32 | JGI25160J50197_1001317 | 3300003354 | Bacteria | 12537 |
| 33 | Ga0055542_1007334 | 3300003762 | Bacteria | 2249 |
| 34 | Ga0055526_1009734 | 3300003771 | Bacteria | 4578 |
| 35 | Ga0055528_1000265 | 3300003790 | Bacteria | 44369 |
| 36 | Ga0055530_10003316 | 3300003791 | Bacteria | 9300 |
| 37 | Ga0055530_10021000 | 3300003791 | Bacteria | 1935 |
| 38 | Ga0055531_10000115 | 3300003794 | Bacteria | 88381 |
| 39 | Ga0055531_10000169 | 3300003794 | Bacteria | 73302 |
| 40 | Ga0055543_1009073 | 3300004625 | Bacteria | 2163 |
| 41 | Ga0065165_1000358 | 3300005262 | Bacteria | 75013 |
| 42 | Ga0065165_1000519 | 3300005262 | Bacteria | 58989 |
| 43 | Ga0065165_1010940 | 3300005262 | Bacteria | 3853 |
| 44 | Ga0065704_10071683 | 3300005289 | Bacteria | 10277 |
| 45 | Ga0065712_10013012 | 3300005290 | Bacteria | 1860 |
| 46 | Ga0065712_10071842 | 3300005290 | Bacteria | 5033 |
| 47 | Ga0065712_10076510 | 3300005290 | Bacteria | 3631 |
| 48 | Ga0065712_10086019 | 3300005290 | Bacteria | 2661 |
| 49 | Ga0070658_10072092 | 3300005327 | Bacteria | 2830 |
| 50 | Ga0070676_10000081 | 3300005328 | Bacteria | 32936 |
| 51 | Ga0070676_10000086 | 3300005328 | Bacteria | 32492 |
| 52 | Ga0070676_10036264 | 3300005328 | Bacteria | 2840 |
| 53 | Ga0070683_100000508 | 3300005329 | Bacteria | 27277 |
| 54 | Ga0070683_100009114 | 3300005329 | Bacteria | 8471 |
| 55 | Ga0070683_100013382 | 3300005329 | Bacteria | 7154 |
| 56 | Ga0070690_100071707 | 3300005330 | Bacteria | 2251 |
| 57 | Ga0070670_100035386 | 3300005331 | Bacteria | 4299 |
| 58 | Ga0070670_100037929 | 3300005331 | Bacteria | 4144 |
| 59 | Ga0070670_100038397 | 3300005331 | Bacteria | 4118 |
| 60 | Ga0070670_100062492 | 3300005331 | Bacteria | 3197 |
| 61 | Ga0070670_100162207 | 3300005331 | Bacteria | 1937 |
| 62 | Ga0070677_10053632 | 3300005333 | Bacteria | 1640 |
| 63 | Ga0068869_100010484 | 3300005334 | Bacteria | 6046 |
| 64 | Ga0068869_100025094 | 3300005334 | Bacteria | 4136 |
| 65 | Ga0068869_100048224 | 3300005334 | Bacteria | 3079 |
| 66 | Ga0068869_100098615 | 3300005334 | Bacteria | 2207 |
| 67 | Ga0068869_100131300 | 3300005334 | Bacteria | 1926 |
| 68 | Ga0068869_100182409 | 3300005334 | Bacteria | 1646 |
| 69 | Ga0070666_10000110 | 3300005335 | Bacteria | 56184 |
| 70 | Ga0070666_10010336 | 3300005335 | Bacteria | 5836 |
| 71 | Ga0070666_10014633 | 3300005335 | Bacteria | 4996 |
| 72 | Ga0070666_10032865 | 3300005335 | Bacteria | 3429 |
| 73 | Ga0070680_100002529 | 3300005336 | Bacteria | 13548 |
| 74 | Ga0070682_100007037 | 3300005337 | Bacteria | 6329 |
| 75 | Ga0068868_100000420 | 3300005338 | Bacteria | 28736 |
| 76 | Ga0068868_100010515 | 3300005338 | Bacteria | 6706 |
| 77 | Ga0068868_100026384 | 3300005338 | Bacteria | 4427 |
| 78 | Ga0068868_100041064 | 3300005338 | Bacteria | 3603 |
| 79 | Ga0068868_100041472 | 3300005338 | Bacteria | 3586 |
| 80 | Ga0068868_100136484 | 3300005338 | Bacteria | 2011 |
| 81 | Ga0070660_100007231 | 3300005339 | Bacteria | 7726 |
| 82 | Ga0070689_100009325 | 3300005340 | Bacteria | 6957 |
| 83 | Ga0070689_100019305 | 3300005340 | Bacteria | 5039 |
| 84 | Ga0070689_100115162 | 3300005340 | Bacteria | 2142 |
| 85 | Ga0070691_10007389 | 3300005341 | Eukaryota | 5031 |
| 86 | Ga0070691_10013358 | 3300005341 | Bacteria | 3761 |
| 87 | Ga0070661_100000111 | 3300005344 | Bacteria | 68066 |
| 88 | Ga0070661_100061446 | 3300005344 | Bacteria | 2757 |
| 89 | Ga0070668_100000077 | 3300005347 | Bacteria | 60697 |
| 90 | Ga0070668_100024712 | 3300005347 | Bacteria | 4553 |
| 91 | Ga0070668_100046103 | 3300005347 | Bacteria | 3346 |
| 92 | Ga0070668_100192490 | 3300005347 | Bacteria | 1671 |
| 93 | Ga0070669_100001696 | 3300005353 | Bacteria | 15945 |
| 94 | Ga0070669_100021159 | 3300005353 | Bacteria | 4648 |
| 95 | Ga0070669_100038636 | 3300005353 | Bacteria | 3466 |
| 96 | Ga0070669_100116157 | 3300005353 | Bacteria | 2036 |
| 97 | Ga0070675_100020849 | 3300005354 | Bacteria | 5231 |
| 98 | Ga0070675_100020879 | 3300005354 | Bacteria | 5228 |
| 99 | Ga0070675_100037185 | 3300005354 | Bacteria | 3964 |
| 100 | Ga0070671_100003332 | 3300005355 | Bacteria | 12534 |
| 101 | Ga0070671_100010273 | 3300005355 | Bacteria | 7513 |
| 102 | Ga0070671_100103567 | 3300005355 | Bacteria | 2388 |
| 103 | Ga0070671_100104571 | 3300005355 | Bacteria | 2376 |
| 104 | Ga0070674_100072723 | 3300005356 | Bacteria | 2436 |
| 105 | Ga0070674_100087818 | 3300005356 | Bacteria | 2236 |
| 106 | Ga0070673_100000072 | 3300005364 | Bacteria | 43011 |
| 107 | Ga0070673_100001289 | 3300005364 | Bacteria | 14599 |
| 108 | Ga0070673_100014416 | 3300005364 | Bacteria | 5505 |
| 109 | Ga0070673_100083080 | 3300005364 | Bacteria | 2601 |
| 110 | Ga0070688_100056018 | 3300005365 | Bacteria | 2475 |
| 111 | Ga0070659_100004012 | 3300005366 | Bacteria | 10477 |
| 112 | Ga0070667_100000382 | 3300005367 | Bacteria | 48246 |
| 113 | Ga0070667_100005185 | 3300005367 | Bacteria | 10890 |
| 114 | Ga0070667_100016325 | 3300005367 | Bacteria | 6142 |
| 115 | Ga0070667_100033408 | 3300005367 | Bacteria | 4299 |
| 116 | Ga0070711_100042892 | 3300005439 | Bacteria | 3061 |
| 117 | Ga0070678_100294242 | 3300005456 | Bacteria | 1377 |
| 118 | Ga0070662_100000011 | 3300005457 | Bacteria | 133652 |
| 119 | Ga0070662_100016867 | 3300005457 | Bacteria | 4909 |
| 120 | Ga0070662_100151587 | 3300005457 | Bacteria | 1805 |
| 121 | Ga0070681_10020519 | 3300005458 | Bacteria | 6623 |
| 122 | Ga0070681_10052850 | 3300005458 | Bacteria | 4051 |
| 123 | Ga0070681_10058761 | 3300005458 | Bacteria | 3825 |
| 124 | Ga0070681_10098827 | 3300005458 | Bacteria | 2865 |
| 125 | Ga0068867_100000558 | 3300005459 | Bacteria | 24610 |
| 126 | Ga0068867_100002567 | 3300005459 | Bacteria | 12804 |
| 127 | Ga0068867_100013547 | 3300005459 | Bacteria | 5774 |
| 128 | Ga0068867_100022499 | 3300005459 | Bacteria | 4508 |
| 129 | Ga0068867_100047386 | 3300005459 | Bacteria | 3159 |
| 130 | Ga0068867_100119985 | 3300005459 | Bacteria | 2031 |
| 131 | Ga0070685_10003168 | 3300005466 | Bacteria | 8368 |
| 132 | Ga0070685_10039777 | 3300005466 | Bacteria | 2673 |
| 133 | Ga0070685_10075053 | 3300005466 | Bacteria | 2013 |
| 134 | Ga0070698_100009065 | 3300005471 | Bacteria | 10695 |
| 135 | Ga0070698_100021251 | 3300005471 | Bacteria | 6800 |
| 136 | Ga0070698_100023339 | 3300005471 | Bacteria | 6467 |
| 137 | Ga0070698_100354040 | 3300005471 | Bacteria | 1400 |
| 138 | Ga0070679_100017217 | 3300005530 | Bacteria | 6990 |
| 139 | Ga0070679_100050288 | 3300005530 | Bacteria | 4152 |
| 140 | Ga0070679_100051240 | 3300005530 | Bacteria | 4111 |
| 141 | Ga0070684_100006108 | 3300005535 | Bacteria | 9281 |
| 142 | Ga0070684_100060256 | 3300005535 | Bacteria | 3319 |
| 143 | Ga0070684_100064156 | 3300005535 | Bacteria | 3221 |
| 144 | Ga0070684_100077523 | 3300005535 | Bacteria | 2935 |
| 145 | Ga0068853_100013016 | 3300005539 | Bacteria | 6785 |
| 146 | Ga0068853_100038517 | 3300005539 | Bacteria | 4073 |
| 147 | Ga0068853_100072769 | 3300005539 | Bacteria | 2996 |
| 148 | Ga0068853_100087345 | 3300005539 | Bacteria | 2736 |
| 149 | Ga0068853_100167475 | 3300005539 | Bacteria | 1986 |
| 150 | Ga0070672_100000240 | 3300005543 | Bacteria | 30633 |
| 151 | Ga0070672_100028861 | 3300005543 | Bacteria | 4155 |
| 152 | Ga0070672_100054203 | 3300005543 | Bacteria | 3138 |
| 153 | Ga0070672_100093627 | 3300005543 | Bacteria | 2428 |
| 154 | Ga0070665_100000003 | 3300005548 | Bacteria | 811857 |
| 155 | Ga0070665_100001677 | 3300005548 | Bacteria | 25513 |
| 156 | Ga0070665_100032445 | 3300005548 | Bacteria | 5256 |
| 157 | Ga0070665_100267228 | 3300005548 | Bacteria | 1712 |
| 158 | Ga0068855_100000108 | 3300005563 | Bacteria | 103059 |
| 159 | Ga0068855_100000260 | 3300005563 | Bacteria | 65935 |
| 160 | Ga0068855_100003173 | 3300005563 | Bacteria | 20124 |
| 161 | Ga0068855_100024009 | 3300005563 | Bacteria | 7300 |
| 162 | Ga0068855_100068897 | 3300005563 | Bacteria | 4118 |
| 163 | Ga0068855_100075471 | 3300005563 | Bacteria | 3915 |
| 164 | Ga0068855_100099737 | 3300005563 | Bacteria | 3344 |
| 165 | Ga0070664_100004434 | 3300005564 | Bacteria | 11274 |
| 166 | Ga0070664_100005019 | 3300005564 | Bacteria | 10604 |
| 167 | Ga0070664_100011721 | 3300005564 | Bacteria | 7116 |
| 168 | Ga0070664_100025199 | 3300005564 | Bacteria | 4927 |
| 169 | Ga0070664_100178036 | 3300005564 | Unclassified | 1889 |
| 170 | Ga0068857_100001839 | 3300005577 | Bacteria | 17074 |
| 171 | Ga0068857_100003159 | 3300005577 | Bacteria | 13659 |
| 172 | Ga0068857_100022840 | 3300005577 | Bacteria | 5503 |
| 173 | Ga0068857_100050419 | 3300005577 | Bacteria | 3693 |
| 174 | Ga0068854_100012236 | 3300005578 | Bacteria | 5616 |
| 175 | Ga0068854_100057107 | 3300005578 | Bacteria | 2815 |
| 176 | Ga0068854_100061107 | 3300005578 | Bacteria | 2728 |
| 177 | Ga0068854_100192405 | 3300005578 | Bacteria | 1599 |
| 178 | Ga0068856_100001596 | 3300005614 | Bacteria | 23687 |
| 179 | Ga0068856_100014292 | 3300005614 | Bacteria | 7678 |
| 180 | Ga0068856_100045665 | 3300005614 | Bacteria | 4314 |
| 181 | Ga0068856_100160281 | 3300005614 | Bacteria | 2260 |
| 182 | Ga0068856_100242780 | 3300005614 | Bacteria | 1816 |
| 183 | Ga0070702_100024277 | 3300005615 | Bacteria | 3233 |
| 184 | Ga0068852_100000527 | 3300005616 | Bacteria | 25187 |
| 185 | Ga0068852_100004482 | 3300005616 | Bacteria | 9869 |
| 186 | Ga0068852_100039418 | 3300005616 | Bacteria | 3977 |
| 187 | Ga0068852_100196765 | 3300005616 | Bacteria | 1905 |
| 188 | Ga0068852_100395286 | 3300005616 | Bacteria | 1359 |
| 189 | Ga0068859_100000026 | 3300005617 | Bacteria | 188742 |
| 190 | Ga0068859_100046521 | 3300005617 | Bacteria | 4357 |
| 191 | Ga0068859_100082711 | 3300005617 | Bacteria | 3253 |
| 192 | Ga0068859_100119174 | 3300005617 | Bacteria | 2705 |
| 193 | Ga0068859_100180784 | 3300005617 | Bacteria | 2192 |
| 194 | Ga0068864_100000389 | 3300005618 | Bacteria | 38410 |
| 195 | Ga0068864_100016837 | 3300005618 | Bacteria | 6092 |
| 196 | Ga0068864_100019322 | 3300005618 | Bacteria | 5696 |
| 197 | Ga0068864_100136905 | 3300005618 | Bacteria | 2206 |
| 198 | Ga0068864_100231797 | 3300005618 | Bacteria | 1708 |
| 199 | Ga0068866_10027931 | 3300005718 | Bacteria | 2684 |
| 200 | Ga0068861_100010696 | 3300005719 | Bacteria | 6375 |
| 201 | Ga0068861_100015199 | 3300005719 | Bacteria | 5418 |
| 202 | Ga0068861_100057001 | 3300005719 | Bacteria | 2984 |
| 203 | Ga0068861_100103204 | 3300005719 | Bacteria | 2272 |
| 204 | Ga0068851_10000082 | 3300005834 | Bacteria | 52889 |
| 205 | Ga0068870_10009545 | 3300005840 | Bacteria | 4420 |
| 206 | Ga0068870_10010874 | 3300005840 | Bacteria | 4199 |
| 207 | Ga0068863_100023529 | 3300005841 | Bacteria | 5880 |
| 208 | Ga0068863_100027750 | 3300005841 | Bacteria | 5403 |
| 209 | Ga0068863_100118890 | 3300005841 | Bacteria | 2519 |
| 210 | Ga0068858_100000634 | 3300005842 | Bacteria | 36584 |
| 211 | Ga0068858_100028849 | 3300005842 | Bacteria | 5153 |
| 212 | Ga0068858_100391730 | 3300005842 | Bacteria | 1334 |
| 213 | Ga0068860_100000072 | 3300005843 | Bacteria | 174997 |
| 214 | Ga0068860_100001760 | 3300005843 | Bacteria | 23110 |
| 215 | Ga0068860_100009606 | 3300005843 | Bacteria | 9612 |
| 216 | Ga0068860_100032131 | 3300005843 | Bacteria | 5046 |
| 217 | Ga0068860_100042201 | 3300005843 | Bacteria | 4358 |
| 218 | Ga0068860_100389434 | 3300005843 | Bacteria | 1377 |
| 219 | Ga0068862_100005406 | 3300005844 | Bacteria | 10672 |
| 220 | Ga0081540_1014647 | 3300005983 | Bacteria | 5011 |
| 221 | Ga0081539_10000714 | 3300005985 | Bacteria | 66625 |
| 222 | Ga0081539_10008308 | 3300005985 | Bacteria | 9084 |
| 223 | Ga0097621_100000150 | 3300006237 | Bacteria | 42846 |
| 224 | Ga0097621_100002418 | 3300006237 | Bacteria | 12783 |
| 225 | Ga0097621_100002717 | 3300006237 | Bacteria | 12108 |
| 226 | Ga0097621_100003513 | 3300006237 | Bacteria | 10823 |
| 227 | Ga0097621_100006095 | 3300006237 | Bacteria | 8536 |
| 228 | Ga0097621_100036902 | 3300006237 | Bacteria | 3912 |
| 229 | Ga0097621_100043480 | 3300006237 | Bacteria | 3621 |
| 230 | Ga0097621_100088848 | 3300006237 | Bacteria | 2583 |
| 231 | Ga0097621_100169635 | 3300006237 | Bacteria | 1880 |
| 232 | Ga0068871_100000045 | 3300006358 | Bacteria | 67014 |
| 233 | Ga0068871_100001431 | 3300006358 | Bacteria | 15983 |
| 234 | Ga0068871_100026597 | 3300006358 | Bacteria | 4517 |
| 235 | Ga0068871_100062262 | 3300006358 | Bacteria | 3048 |
| 236 | Ga0068871_100089138 | 3300006358 | Bacteria | 2567 |
| 237 | Ga0068871_100216659 | 3300006358 | Bacteria | 1657 |
| 238 | Ga0068871_100288272 | 3300006358 | Bacteria | 1438 |
| 239 | Ga0075428_100015432 | 3300006844 | Bacteria | 8467 |
| 240 | Ga0075428_100066893 | 3300006844 | Bacteria | 3934 |
| 241 | Ga0075428_100423186 | 3300006844 | Bacteria | 1427 |
| 242 | Ga0075431_100017550 | 3300006847 | Bacteria | 7275 |
| 243 | Ga0075434_100170664 | 3300006871 | Bacteria | 2195 |
| 244 | Ga0075429_100019702 | 3300006880 | Bacteria | 5849 |
| 245 | Ga0068865_100000170 | 3300006881 | Bacteria | 36005 |
| 246 | Ga0068865_100096638 | 3300006881 | Bacteria | 2154 |
| 247 | Ga0097620_100000026 | 3300006931 | Bacteria | 188742 |
| 248 | Ga0097620_100046525 | 3300006931 | Bacteria | 4357 |
| 249 | Ga0097620_100082713 | 3300006931 | Bacteria | 3253 |
| 250 | Ga0097620_100119178 | 3300006931 | Bacteria | 2705 |
| 251 | Ga0097620_100180782 | 3300006931 | Bacteria | 2192 |
| 252 | Ga0105240_10000991 | 3300009093 | Bacteria | 50697 |
| 253 | Ga0105240_10001109 | 3300009093 | Bacteria | 47404 |
| 254 | Ga0105240_10002195 | 3300009093 | Bacteria | 31863 |
| 255 | Ga0105240_10002244 | 3300009093 | Bacteria | 31388 |
| 256 | Ga0105240_10012757 | 3300009093 | Bacteria | 11583 |
| 257 | Ga0105240_10019308 | 3300009093 | Bacteria | 9109 |
| 258 | Ga0105240_10023818 | 3300009093 | Bacteria | 8086 |
| 259 | Ga0105240_10028757 | 3300009093 | Bacteria | 7251 |
| 260 | Ga0105240_10033251 | 3300009093 | Bacteria | 6666 |
| 261 | Ga0105240_10039959 | 3300009093 | Bacteria | 6005 |
| 262 | Ga0105240_10102003 | 3300009093 | Bacteria | 3488 |
| 263 | Ga0105240_10169871 | 3300009093 | Bacteria | 2584 |
| 264 | Ga0111539_10003835 | 3300009094 | Bacteria | 19797 |
| 265 | Ga0111539_10043774 | 3300009094 | Bacteria | 5367 |
| 266 | Ga0111539_10484782 | 3300009094 | Bacteria | 1440 |
| 267 | Ga0105245_10017518 | 3300009098 | Bacteria | 6251 |
| 268 | Ga0105245_10107271 | 3300009098 | Bacteria | 2593 |
| 269 | Ga0105247_10026765 | 3300009101 | Bacteria | 3485 |
| 270 | Ga0105247_10179656 | 3300009101 | Bacteria | 1412 |
| 271 | Ga0114129_10007891 | 3300009147 | Bacteria | 15148 |
| 272 | Ga0114129_10041640 | 3300009147 | Bacteria | 6470 |
| 273 | Ga0105241_10000268 | 3300009174 | Bacteria | 38825 |
| 274 | Ga0105241_10000739 | 3300009174 | Bacteria | 24827 |
| 275 | Ga0105241_10001510 | 3300009174 | Bacteria | 17817 |
| 276 | Ga0105241_10003366 | 3300009174 | Bacteria | 11908 |
| 277 | Ga0105241_10003966 | 3300009174 | Bacteria | 10941 |
| 278 | Ga0105241_10050791 | 3300009174 | Bacteria | 3161 |
| 279 | Ga0105242_10007643 | 3300009176 | Bacteria | 8319 |
| 280 | Ga0105242_10008158 | 3300009176 | Bacteria | 8054 |
| 281 | Ga0105242_10014438 | 3300009176 | Bacteria | 6120 |
| 282 | Ga0105242_10181963 | 3300009176 | Bacteria | 1855 |
| 283 | Ga0105237_10000943 | 3300009545 | Bacteria | 39090 |
| 284 | Ga0105237_10005407 | 3300009545 | Bacteria | 14427 |
| 285 | Ga0105237_10005933 | 3300009545 | Bacteria | 13698 |
| 286 | Ga0105237_10012129 | 3300009545 | Bacteria | 9092 |
| 287 | Ga0105237_10012937 | 3300009545 | Bacteria | 8765 |
| 288 | Ga0105237_10017853 | 3300009545 | Bacteria | 7354 |
| 289 | Ga0105237_10049862 | 3300009545 | Unclassified | 4207 |
| 290 | Ga0105237_10062812 | 3300009545 | Bacteria | 3713 |
| 291 | Ga0105237_10272468 | 3300009545 | Bacteria | 1695 |
| 292 | Ga0105238_10002471 | 3300009551 | Bacteria | 18498 |
| 293 | Ga0105238_10016058 | 3300009551 | Bacteria | 7574 |
| 294 | Ga0105249_10002519 | 3300009553 | Bacteria | 15852 |
| 295 | Ga0105249_10020489 | 3300009553 | Bacteria | 5911 |
| 296 | Ga0105249_10072733 | 3300009553 | Bacteria | 3179 |
| 297 | Ga0105249_10210145 | 3300009553 | Bacteria | 1909 |
| 298 | Ga0105249_10275950 | 3300009553 | Bacteria | 1677 |
| 299 | Ga0105239_10000017 | 3300010375 | Bacteria | 290760 |
| 300 | Ga0105239_10000168 | 3300010375 | Bacteria | 94279 |
| 301 | Ga0105239_10001486 | 3300010375 | Bacteria | 31166 |
| 302 | Ga0105239_10007223 | 3300010375 | Bacteria | 12760 |
| 303 | Ga0105239_10010270 | 3300010375 | Bacteria | 10487 |
| 304 | Ga0105239_10019423 | 3300010375 | Bacteria | 7502 |
| 305 | Ga0105239_10038201 | 3300010375 | Bacteria | 5261 |
| 306 | Ga0105239_10053100 | 3300010375 | Bacteria | 4446 |
| 307 | Ga0105239_10124266 | 3300010375 | Bacteria | 2867 |
| 308 | Ga0105239_10271724 | 3300010375 | Bacteria | 1907 |
| 309 | Ga0105239_10400754 | 3300010375 | Bacteria | 1553 |
| 310 | Ga0105246_10054960 | 3300011119 | Bacteria | 2746 |
| 311 | Ga0105246_10075863 | 3300011119 | Bacteria | 2381 |
| 312 | Ga0105246_10077166 | 3300011119 | Bacteria | 2363 |
| 313 | Ga0105246_10107179 | 3300011119 | Bacteria | 2046 |
| 314 | Ga0157373_10014240 | 3300013100 | Bacteria | 5834 |
| 315 | Ga0157373_10087532 | 3300013100 | Bacteria | 2195 |
| 316 | Ga0157370_10001221 | 3300013104 | Bacteria | 32173 |
| 317 | Ga0157370_10002685 | 3300013104 | Bacteria | 21321 |
| 318 | Ga0157370_10025719 | 3300013104 | Bacteria | 5824 |
| 319 | Ga0157370_10081361 | 3300013104 | Bacteria | 3047 |
| 320 | Ga0157370_10154587 | 3300013104 | Bacteria | 2134 |
| 321 | Ga0157369_10008855 | 3300013105 | Bacteria | 11526 |
| 322 | Ga0157369_10109533 | 3300013105 | Bacteria | 2936 |
| 323 | Ga0157374_10000002 | 3300013296 | Bacteria | 1054226 |
| 324 | Ga0157374_10000277 | 3300013296 | Bacteria | 47639 |
| 325 | Ga0157374_10001261 | 3300013296 | Bacteria | 21620 |
| 326 | Ga0157374_10002879 | 3300013296 | Bacteria | 14436 |
| 327 | Ga0157374_10009549 | 3300013296 | Bacteria | 8332 |
| 328 | Ga0157374_10132030 | 3300013296 | Bacteria | 2417 |
| 329 | Ga0157374_10164274 | 3300013296 | Bacteria | 2163 |
| 330 | Ga0157378_10004161 | 3300013297 | Bacteria | 12775 |
| 331 | Ga0157378_10008593 | 3300013297 | Bacteria | 8886 |
| 332 | Ga0157378_10027445 | 3300013297 | Bacteria | 5025 |
| 333 | Ga0157378_10027708 | 3300013297 | Bacteria | 4997 |
| 334 | Ga0157378_10062779 | 3300013297 | Bacteria | 3318 |
| 335 | Ga0157378_10075808 | 3300013297 | Bacteria | 3029 |
| 336 | Ga0157378_10187623 | 3300013297 | Bacteria | 1948 |
| 337 | Ga0163162_10000024 | 3300013306 | Bacteria | 188515 |
| 338 | Ga0163162_10000084 | 3300013306 | Bacteria | 86252 |
| 339 | Ga0163162_10000510 | 3300013306 | Bacteria | 36016 |
| 340 | Ga0163162_10003635 | 3300013306 | Bacteria | 14780 |
| 341 | Ga0163162_10010342 | 3300013306 | Bacteria | 9069 |
| 342 | Ga0163162_10220561 | 3300013306 | Bacteria | 2026 |
| 343 | Ga0157372_10005788 | 3300013307 | Bacteria | 13169 |
| 344 | Ga0157372_10007445 | 3300013307 | Bacteria | 11643 |
| 345 | Ga0157372_10111568 | 3300013307 | Bacteria | 3133 |
| 346 | Ga0157372_10119055 | 3300013307 | Bacteria | 3031 |
| 347 | Ga0157372_10157079 | 3300013307 | Bacteria | 2627 |
| 348 | Ga0157372_10185253 | 3300013307 | Bacteria | 2411 |
| 349 | Ga0157372_10214327 | 3300013307 | Bacteria | 2231 |
| 350 | Ga0157375_10000219 | 3300013308 | Bacteria | 53586 |
| 351 | Ga0157375_10000616 | 3300013308 | Bacteria | 31588 |
| 352 | Ga0157375_10013462 | 3300013308 | Bacteria | 7281 |
| 353 | Ga0157375_10030799 | 3300013308 | Bacteria | 5064 |
| 354 | Ga0157375_10055189 | 3300013308 | Bacteria | 3916 |
| 355 | Ga0163163_10000388 | 3300014325 | Bacteria | 41885 |
| 356 | Ga0163163_10022878 | 3300014325 | Bacteria | 5924 |
| 357 | Ga0157380_10043637 | 3300014326 | Bacteria | 3511 |
| 358 | Ga0157380_10049095 | 3300014326 | Bacteria | 3327 |
| 359 | Ga0157380_10242238 | 3300014326 | Bacteria | 1627 |
| 360 | Ga0157377_10002248 | 3300014745 | Bacteria | 8487 |
| 361 | Ga0157377_10004867 | 3300014745 | Bacteria | 6244 |
| 362 | Ga0157377_10005236 | 3300014745 | Bacteria | 6073 |
| 363 | Ga0157379_10000078 | 3300014968 | Bacteria | 63565 |
| 364 | Ga0157379_10039395 | 3300014968 | Bacteria | 4216 |
| 365 | Ga0157379_10090138 | 3300014968 | Bacteria | 2751 |
| 366 | Ga0157379_10098487 | 3300014968 | Bacteria | 2625 |
| 367 | Ga0157379_10290973 | 3300014968 | Bacteria | 1487 |
| 368 | Ga0157376_10000219 | 3300014969 | Bacteria | 39583 |
| 369 | Ga0157376_10024890 | 3300014969 | Bacteria | 4708 |
| 370 | Ga0157376_10037733 | 3300014969 | Bacteria | 3926 |
| 371 | Ga0157376_10041030 | 3300014969 | Bacteria | 3786 |
| 372 | Ga0157376_10082798 | 3300014969 | Bacteria | 2759 |
| 373 | Ga0157376_10179620 | 3300014969 | Bacteria | 1933 |
| 374 | Ga0182005_1000294 | 3300015265 | Bacteria | 31099 |
| 375 | Ga0163161_10015478 | 3300017792 | Bacteria | 5318 |
| 376 | Ga0163161_10019244 | 3300017792 | Bacteria | 4787 |
| 377 | Ga0163161_10062866 | 3300017792 | Bacteria | 2705 |
| 378 | Ga0213876_10010259 | 3300021384 | Bacteria | 5030 |
| 379 | Ga0213876_10044704 | 3300021384 | Bacteria | 2341 |
| 380 | Ga0209436_101389 | 3300025208 | Bacteria | 8545 |
| 381 | Ga0207427_100204 | 3300025231 | Bacteria | 54529 |
| 382 | Ga0209437_100048 | 3300025233 | Bacteria | 405107 |
| 383 | Ga0209258_100032 | 3300025242 | Bacteria | 452764 |
| 384 | Ga0209646_1000050 | 3300025246 | Bacteria | 296599 |
| 385 | Ga0209646_1003487 | 3300025246 | Bacteria | 3101 |
| 386 | Ga0209026_1000637 | 3300025250 | Bacteria | 21809 |
| 387 | Ga0209148_1000223 | 3300025254 | Bacteria | 93490 |
| 388 | Ga0209233_1000029 | 3300025261 | Bacteria | 641642 |
| 389 | Ga0209455_1005960 | 3300025272 | Bacteria | 3671 |
| 390 | Ga0209673_1000042 | 3300025273 | Bacteria | 300704 |
| 391 | Ga0209564_1004940 | 3300025295 | Bacteria | 7880 |
| 392 | Ga0209758_1003391 | 3300025297 | Bacteria | 14567 |
| 393 | Ga0209758_1005114 | 3300025297 | Bacteria | 10377 |
| 394 | Ga0209758_1010376 | 3300025297 | Bacteria | 5586 |
| 395 | Ga0209050_1000295 | 3300025298 | Bacteria | 104889 |
| 396 | Ga0209050_1001207 | 3300025298 | Bacteria | 30299 |
| 397 | Ga0209050_1025068 | 3300025298 | Bacteria | 2040 |
| 398 | Ga0207426_1000105 | 3300025302 | Bacteria | 247269 |
| 399 | Ga0207426_1000711 | 3300025302 | Bacteria | 38972 |
| 400 | Ga0207426_1001775 | 3300025302 | Bacteria | 16222 |
| 401 | Ga0207426_1010051 | 3300025302 | Bacteria | 3700 |
| 402 | Ga0209257_1000007 | 3300025304 | Bacteria | 1564415 |
| 403 | Ga0209257_1000128 | 3300025304 | Bacteria | 214268 |
| 404 | Ga0209257_1001716 | 3300025304 | Bacteria | 24510 |
| 405 | Ga0207656_10001244 | 3300025321 | Bacteria | 8399 |
| 406 | Ga0207656_10045430 | 3300025321 | Bacteria | 1880 |
| 407 | Ga0207688_10018799 | 3300025901 | Bacteria | 3759 |
| 408 | Ga0207680_10000369 | 3300025903 | Bacteria | 21664 |
| 409 | Ga0207680_10013164 | 3300025903 | Bacteria | 4240 |
| 410 | Ga0207680_10023789 | 3300025903 | Bacteria | 3351 |
| 411 | Ga0207680_10125019 | 3300025903 | Bacteria | 1687 |
| 412 | Ga0207647_10000051 | 3300025904 | Bacteria | 87826 |
| 413 | Ga0207647_10022032 | 3300025904 | Bacteria | 4239 |
| 414 | Ga0207647_10085907 | 3300025904 | Bacteria | 1881 |
| 415 | Ga0207645_10000156 | 3300025907 | Bacteria | 53492 |
| 416 | Ga0207645_10003882 | 3300025907 | Bacteria | 11175 |
| 417 | Ga0207645_10013421 | 3300025907 | Bacteria | 5521 |
| 418 | Ga0207645_10096578 | 3300025907 | Bacteria | 1904 |
| 419 | Ga0207643_10006662 | 3300025908 | Bacteria | 6193 |
| 420 | Ga0207643_10011676 | 3300025908 | Bacteria | 4743 |
| 421 | Ga0207643_10044052 | 3300025908 | Bacteria | 2519 |
| 422 | Ga0207643_10077774 | 3300025908 | Bacteria | 1918 |
| 423 | Ga0207705_10007511 | 3300025909 | Bacteria | 8009 |
| 424 | Ga0207705_10049268 | 3300025909 | Bacteria | 3032 |
| 425 | Ga0207705_10143653 | 3300025909 | Bacteria | 1784 |
| 426 | Ga0207654_10000828 | 3300025911 | Bacteria | 17043 |
| 427 | Ga0207654_10002743 | 3300025911 | Bacteria | 8936 |
| 428 | Ga0207654_10004390 | 3300025911 | Bacteria | 7108 |
| 429 | Ga0207654_10006614 | 3300025911 | Bacteria | 5830 |
| 430 | Ga0207654_10007708 | 3300025911 | Bacteria | 5432 |
| 431 | Ga0207707_10052527 | 3300025912 | Bacteria | 3548 |
| 432 | Ga0207695_10000060 | 3300025913 | Bacteria | 360217 |
| 433 | Ga0207695_10000185 | 3300025913 | Bacteria | 180225 |
| 434 | Ga0207695_10000666 | 3300025913 | Bacteria | 67698 |
| 435 | Ga0207695_10005639 | 3300025913 | Bacteria | 16519 |
| 436 | Ga0207695_10019309 | 3300025913 | Bacteria | 7849 |
| 437 | Ga0207695_10019941 | 3300025913 | Bacteria | 7700 |
| 438 | Ga0207695_10021827 | 3300025913 | Bacteria | 7291 |
| 439 | Ga0207695_10058175 | 3300025913 | Bacteria | 4013 |
| 440 | Ga0207695_10124895 | 3300025913 | Bacteria | 2537 |
| 441 | Ga0207695_10268643 | 3300025913 | Bacteria | 1601 |
| 442 | Ga0207671_10002465 | 3300025914 | Bacteria | 19764 |
| 443 | Ga0207671_10005680 | 3300025914 | Bacteria | 11404 |
| 444 | Ga0207671_10009372 | 3300025914 | Bacteria | 8186 |
| 445 | Ga0207671_10011264 | 3300025914 | Bacteria | 7296 |
| 446 | Ga0207671_10011822 | 3300025914 | Bacteria | 7065 |
| 447 | Ga0207671_10015343 | 3300025914 | Bacteria | 6002 |
| 448 | Ga0207671_10023857 | 3300025914 | Bacteria | 4608 |
| 449 | Ga0207671_10026174 | 3300025914 | Bacteria | 4374 |
| 450 | Ga0207671_10035973 | 3300025914 | Bacteria | 3672 |
| 451 | Ga0207660_10004270 | 3300025917 | Bacteria | 9313 |
| 452 | Ga0207660_10009343 | 3300025917 | Bacteria | 6346 |
| 453 | Ga0207657_10077204 | 3300025919 | Bacteria | 2808 |
| 454 | Ga0207649_10001181 | 3300025920 | Bacteria | 15722 |
| 455 | Ga0207652_10014701 | 3300025921 | Bacteria | 6344 |
| 456 | Ga0207681_10079562 | 3300025923 | Bacteria | 2310 |
| 457 | Ga0207681_10186620 | 3300025923 | Bacteria | 1583 |
| 458 | Ga0207694_10011559 | 3300025924 | Bacteria | 6660 |
| 459 | Ga0207694_10028134 | 3300025924 | Bacteria | 4285 |
| 460 | Ga0207694_10059933 | 3300025924 | Bacteria | 2961 |
| 461 | Ga0207650_10077799 | 3300025925 | Bacteria | 2508 |
| 462 | Ga0207659_10032676 | 3300025926 | Bacteria | 3574 |
| 463 | Ga0207659_10067892 | 3300025926 | Bacteria | 2592 |
| 464 | Ga0207659_10069974 | 3300025926 | Bacteria | 2558 |
| 465 | Ga0207644_10035849 | 3300025931 | Bacteria | 3479 |
| 466 | Ga0207644_10083177 | 3300025931 | Bacteria | 2370 |
| 467 | Ga0207706_10000122 | 3300025933 | Bacteria | 83838 |
| 468 | Ga0207706_10004505 | 3300025933 | Bacteria | 13082 |
| 469 | Ga0207706_10014606 | 3300025933 | Bacteria | 7111 |
| 470 | Ga0207706_10022199 | 3300025933 | Bacteria | 5696 |
| 471 | Ga0207706_10053352 | 3300025933 | Bacteria | 3569 |
| 472 | Ga0207686_10001038 | 3300025934 | Bacteria | 16431 |
| 473 | Ga0207709_10271318 | 3300025935 | Bacteria | 1249 |
| 474 | Ga0207670_10026350 | 3300025936 | Bacteria | 3662 |
| 475 | Ga0207670_10043575 | 3300025936 | Bacteria | 2965 |
| 476 | Ga0207669_10043887 | 3300025937 | Bacteria | 2622 |
| 477 | Ga0207704_10000041 | 3300025938 | Bacteria | 89976 |
| 478 | Ga0207704_10200942 | 3300025938 | Bacteria | 1459 |
| 479 | Ga0207691_10000014 | 3300025940 | Bacteria | 142542 |
| 480 | Ga0207691_10001372 | 3300025940 | Bacteria | 24295 |
| 481 | Ga0207691_10006843 | 3300025940 | Bacteria | 11002 |
| 482 | Ga0207691_10052525 | 3300025940 | Bacteria | 3722 |
| 483 | Ga0207691_10152025 | 3300025940 | Bacteria | 2034 |
| 484 | Ga0207691_10186318 | 3300025940 | Unclassified | 1812 |
| 485 | Ga0207689_10014672 | 3300025942 | Bacteria | 6653 |
| 486 | Ga0207689_10016596 | 3300025942 | Bacteria | 6231 |
| 487 | Ga0207689_10041962 | 3300025942 | Bacteria | 3786 |
| 488 | Ga0207689_10075180 | 3300025942 | Bacteria | 2777 |
| 489 | Ga0207661_10018492 | 3300025944 | Bacteria | 5177 |
| 490 | Ga0207679_10000909 | 3300025945 | Bacteria | 18903 |
| 491 | Ga0207679_10118647 | 3300025945 | Bacteria | 2102 |
| 492 | Ga0207667_10000039 | 3300025949 | Bacteria | 278843 |
| 493 | Ga0207667_10000084 | 3300025949 | Bacteria | 152086 |
| 494 | Ga0207667_10001931 | 3300025949 | Bacteria | 25993 |
| 495 | Ga0207667_10004246 | 3300025949 | Bacteria | 17581 |
| 496 | Ga0207667_10017761 | 3300025949 | Bacteria | 8001 |
| 497 | Ga0207667_10022635 | 3300025949 | Bacteria | 6934 |
| 498 | Ga0207667_10203855 | 3300025949 | Bacteria | 2029 |
| 499 | Ga0207651_10024826 | 3300025960 | Bacteria | 3715 |
| 500 | Ga0207651_10026783 | 3300025960 | Bacteria | 3609 |
| 501 | Ga0207651_10175114 | 3300025960 | Bacteria | 1696 |
| 502 | Ga0207712_10047014 | 3300025961 | Bacteria | 2994 |
| 503 | Ga0207712_10062662 | 3300025961 | Bacteria | 2644 |
| 504 | Ga0207668_10000286 | 3300025972 | Bacteria | 33154 |
| 505 | Ga0207668_10248282 | 3300025972 | Bacteria | 1444 |
| 506 | Ga0207640_10157196 | 3300025981 | Unclassified | 1677 |
| 507 | Ga0207658_10003829 | 3300025986 | Bacteria | 10597 |
| 508 | Ga0207658_10008758 | 3300025986 | Bacteria | 6871 |
| 509 | Ga0207658_10077582 | 3300025986 | Bacteria | 2535 |
| 510 | Ga0207658_10096011 | 3300025986 | Bacteria | 2311 |
| 511 | Ga0207677_10000815 | 3300026023 | Bacteria | 17837 |
| 512 | Ga0207677_10031546 | 3300026023 | Bacteria | 3395 |
| 513 | Ga0207677_10039672 | 3300026023 | Bacteria | 3098 |
| 514 | Ga0207677_10053571 | 3300026023 | Bacteria | 2747 |
| 515 | Ga0207677_10057635 | 3300026023 | Bacteria | 2669 |
| 516 | Ga0207677_10114535 | 3300026023 | Bacteria | 2015 |
| 517 | Ga0207677_10130379 | 3300026023 | Bacteria | 1908 |
| 518 | Ga0207703_10001163 | 3300026035 | Bacteria | 24833 |
| 519 | Ga0207703_10118699 | 3300026035 | Bacteria | 2268 |
| 520 | Ga0207703_10360813 | 3300026035 | Bacteria | 1340 |
| 521 | Ga0207639_10010664 | 3300026041 | Bacteria | 6364 |
| 522 | Ga0207639_10022234 | 3300026041 | Bacteria | 4565 |
| 523 | Ga0207639_10024756 | 3300026041 | Bacteria | 4349 |
| 524 | Ga0207639_10027714 | 3300026041 | Bacteria | 4130 |
| 525 | Ga0207678_10191739 | 3300026067 | Bacteria | 1747 |
| 526 | Ga0207702_10000861 | 3300026078 | Bacteria | 31674 |
| 527 | Ga0207702_10080774 | 3300026078 | Bacteria | 2822 |
| 528 | Ga0207641_10000155 | 3300026088 | Bacteria | 97385 |
| 529 | Ga0207641_10001712 | 3300026088 | Bacteria | 21281 |
| 530 | Ga0207641_10036756 | 3300026088 | Bacteria | 4088 |
| 531 | Ga0207641_10045902 | 3300026088 | Bacteria | 3681 |
| 532 | Ga0207641_10070207 | 3300026088 | Bacteria | 3010 |
| 533 | Ga0207641_10075528 | 3300026088 | Unclassified | 2910 |
| 534 | Ga0207648_10000645 | 3300026089 | Bacteria | 39153 |
| 535 | Ga0207648_10003712 | 3300026089 | Bacteria | 15982 |
| 536 | Ga0207648_10004371 | 3300026089 | Bacteria | 14530 |
| 537 | Ga0207648_10034959 | 3300026089 | Bacteria | 4430 |
| 538 | Ga0207648_10054258 | 3300026089 | Bacteria | 3501 |
| 539 | Ga0207676_10011233 | 3300026095 | Bacteria | 6397 |
| 540 | Ga0207676_10031919 | 3300026095 | Bacteria | 3964 |
| 541 | Ga0207676_10032674 | 3300026095 | Bacteria | 3924 |
| 542 | Ga0207676_10252616 | 3300026095 | Bacteria | 1588 |
| 543 | Ga0207676_10277714 | 3300026095 | Bacteria | 1520 |
| 544 | Ga0207674_10001267 | 3300026116 | Bacteria | 33015 |
| 545 | Ga0207674_10001616 | 3300026116 | Bacteria | 28994 |
| 546 | Ga0207674_10003427 | 3300026116 | Bacteria | 19412 |
| 547 | Ga0207674_10020871 | 3300026116 | Bacteria | 7068 |
| 548 | Ga0207674_10199902 | 3300026116 | Bacteria | 1948 |
| 549 | Ga0207675_100001183 | 3300026118 | Bacteria | 25978 |
| 550 | Ga0207675_100019898 | 3300026118 | Bacteria | 6265 |
| 551 | Ga0207675_100021831 | 3300026118 | Bacteria | 5960 |
| 552 | Ga0207675_100056540 | 3300026118 | Bacteria | 3660 |
| 553 | Ga0207675_100087317 | 3300026118 | Bacteria | 2929 |
| 554 | Ga0207675_100118162 | 3300026118 | Bacteria | 2507 |
| 555 | Ga0207683_10001922 | 3300026121 | Bacteria | 18390 |
| 556 | Ga0207683_10023174 | 3300026121 | Bacteria | 5336 |
| 557 | Ga0207698_10004138 | 3300026142 | Bacteria | 8814 |
| 558 | Ga0207698_10004684 | 3300026142 | Bacteria | 8363 |
| 559 | Ga0207698_10026987 | 3300026142 | Bacteria | 4071 |
| 560 | Ga0207698_10102040 | 3300026142 | Bacteria | 2380 |
| 561 | Ga0207698_10155181 | 3300026142 | Bacteria | 1993 |
| 562 | Ga0207428_10011109 | 3300027907 | Bacteria | 7998 |
| 563 | Ga0268266_10000088 | 3300028379 | Bacteria | 199029 |
| 564 | Ga0268266_10000137 | 3300028379 | Bacteria | 140685 |
| 565 | Ga0268266_10002464 | 3300028379 | Bacteria | 19788 |
| 566 | Ga0268264_10000484 | 3300028381 | Bacteria | 52947 |
| 567 | Ga0268264_10003582 | 3300028381 | Bacteria | 13377 |
| 568 | Ga0268264_10004151 | 3300028381 | Bacteria | 12386 |
| 569 | Ga0268264_10005674 | 3300028381 | Bacteria | 10584 |
| 570 | Ga0307517_10000959 | 3300028786 | Bacteria | 48920 |
| 571 | Ga0307517_10010052 | 3300028786 | Bacteria | 13301 |
| 572 | Ga0307515_10000012 | 3300028794 | Bacteria | 582232 |
| 573 | Ga0307515_10000363 | 3300028794 | Bacteria | 111302 |
| 574 | Ga0265338_10031831 | 3300028800 | Bacteria | 5162 |
| 575 | Ga0307511_10001671 | 3300030521 | Bacteria | 23361 |
| 576 | Ga0265327_10000152 | 3300031251 | Bacteria | 149065 |
| 577 | Ga0265327_10018278 | 3300031251 | Bacteria | 4355 |
| 578 | Ga0307513_10053489 | 3300031456 | Bacteria | 4339 |
| 579 | Ga0307513_10064861 | 3300031456 | Bacteria | 3845 |
| 580 | Ga0307509_10006387 | 3300031507 | Bacteria | 15889 |
| 581 | Ga0307509_10009690 | 3300031507 | Bacteria | 11968 |
| 582 | Ga0307408_100003690 | 3300031548 | Bacteria | 10432 |
| 583 | Ga0307408_100017838 | 3300031548 | Bacteria | 4756 |
| 584 | Ga0307508_10001601 | 3300031616 | Bacteria | 25237 |
| 585 | Ga0307516_10002853 | 3300031730 | Bacteria | 22760 |
| 586 | Ga0307516_10112980 | 3300031730 | Bacteria | 2515 |
| 587 | Ga0316577_10022831 | 3300031733 | Bacteria | 3475 |
| 588 | Ga0307412_10078911 | 3300031911 | Bacteria | 2269 |
| 589 | Ga0307416_100043251 | 3300032002 | Bacteria | 3525 |
| 590 | Ga0307416_100284081 | 3300032002 | Bacteria | 1634 |
| 591 | Ga0307414_10017794 | 3300032004 | Bacteria | 4357 |
| 592 | Ga0307414_10083957 | 3300032004 | Bacteria | 2341 |
| 593 | Ga0307411_10179015 | 3300032005 | Bacteria | 1607 |
| 594 | Ga0307510_10000074 | 3300033180 | Bacteria | 75194 |
| 595 | Ga0307510_10021413 | 3300033180 | Bacteria | 7532 |
| 596 | Ga0373955_0160915 | 3300035172 | Bacteria | 1325 |
| 597 | Ga0373927_0020017 | 3300035695 | Bacteria | 4389 |
| 598 | Ga0373937_0030534 | 3300036401 | Bacteria | 4880 |
| 599 | Ga0316584_0151445 | 3300036712 | Bacteria | 1726 |
| 600 | Ga0395899_0004641 | 3300037312 | Bacteria | 10713 |
| 601 | Ga0395900_0000014 | 3300037418 | Bacteria | 386513 |
| 602 | Ga0395900_0000357 | 3300037418 | Bacteria | 66369 |
| 603 | Ga0395898_0005171 | 3300037466 | Bacteria | 14117 |
| 604 | Ga0395905_0000241 | 3300037471 | Bacteria | 82847 |
| 605 | Ga0395905_0001914 | 3300037471 | Bacteria | 23897 |
| 606 | Ga0395901_0002234 | 3300038443 | Bacteria | 19753 |
| 607 | Ga0395901_0006039 | 3300038443 | Bacteria | 12274 |
| 608 | Ga0436365_1727150 | 3300039437 | Bacteria | 7083 |
| 609 | Ga0439436_0010284 | 3300041404 | Bacteria | 2857 |
| 610 | Ga0439436_0013224 | 3300041404 | Bacteria | 2499 |
| 611 | Ga0439439_0006910 | 3300041406 | Bacteria | 2635 |
| 612 | Ga0439431_0001817 | 3300041997 | Bacteria | 4722 |
| 613 | Ga0439431_0010470 | 3300041997 | Bacteria | 2105 |
| 614 | Ga0439442_006236 | 3300042002 | Bacteria | 2392 |
| 615 | Ga0439445_0005470 | 3300042004 | Bacteria | 2896 |
| 616 | Ga0439449_0000332 | 3300042007 | Bacteria | 17103 |
| 617 | Ga0439449_0031633 | 3300042007 | Bacteria | 1973 |
| 618 | Ga0439457_002437 | 3300042014 | Bacteria | 5319 |
| 619 | Ga0439462_0037047 | 3300042015 | Bacteria | 1299 |
| 620 | Ga0450897_000991 | 3300042128 | Bacteria | 1800 |
| 621 | Ga0439434_0007514 | 3300042435 | Bacteria | 3194 |
| 622 | Ga0451577_0002166 | 3300042876 | Bacteria | 24011 |
| 623 | Ga0451577_0002748 | 3300042876 | Bacteria | 20396 |
| 624 | Ga0451577_0006701 | 3300042876 | Bacteria | 11431 |
| 625 | Ga0451577_0035910 | 3300042876 | Bacteria | 4464 |
| 626 | Ga0451577_0143130 | 3300042876 | Bacteria | 2149 |
| 627 | Ga0451577_0195132 | 3300042876 | Bacteria | 1827 |
| 628 | Ga0466969_0000940 | 3300044656 | Bacteria | 15720 |
| 629 | Ga0466972_0000022 | 3300044658 | Bacteria | 193802 |
| 630 | Ga0466972_0000108 | 3300044658 | Bacteria | 71610 |
| 631 | Ga0466982_0064539 | 3300044672 | Bacteria | 2256 |
| 632 | Ga0466965_0043861 | 3300044683 | Bacteria | 2209 |
| 633 | Ga0466966_0025199 | 3300044684 | Bacteria | 3886 |
| 634 | Ga0453684_0000771 | 3300044712 | Bacteria | 110664 |
| 635 | Ga0453684_0001035 | 3300044712 | Bacteria | 88955 |
| 636 | Ga0453684_0002604 | 3300044712 | Bacteria | 43124 |
| 637 | Ga0453684_0004538 | 3300044712 | Bacteria | 29114 |
| 638 | Ga0453684_0023677 | 3300044712 | Bacteria | 9024 |
| 639 | Ga0453684_0029659 | 3300044712 | Bacteria | 7757 |
| 640 | Ga0453684_0078113 | 3300044712 | Bacteria | 4144 |
| 641 | Ga0453684_0113443 | 3300044712 | Bacteria | 3287 |
| 642 | Ga0453684_0168128 | 3300044712 | Bacteria | 2587 |
| 643 | Ga0466971_0015381 | 3300044719 | Bacteria | 3367 |
| 644 | Ga0466968_0081558 | 3300044735 | Bacteria | 1422 |
| 645 | Ga0466970_0000367 | 3300044765 | Bacteria | 21910 |
| 646 | Ga0466957_0008234 | 3300044842 | Bacteria | 5923 |
| 647 | Ga0466957_0027951 | 3300044842 | Bacteria | 3355 |
| 648 | Ga0466957_0077549 | 3300044842 | Bacteria | 2065 |
| 649 | Ga0466960_0063354 | 3300044901 | Bacteria | 1820 |
| 650 | Ga0466959_0000025 | 3300045049 | Bacteria | 120128 |
| 651 | Ga0466959_0023180 | 3300045049 | Bacteria | 4593 |
| 652 | Ga0451576_0004004 | 3300045051 | Bacteria | 19605 |
| 653 | Ga0451576_0015745 | 3300045051 | Bacteria | 8371 |
| 654 | Ga0451576_0357748 | 3300045051 | Bacteria | 1529 |
| 655 | Ga0495627_004527 | 3300046453 | Bacteria | 5797 |
| 656 | Ga0495592_0031736 | 3300046454 | Bacteria | 3991 |
| 657 | Ga0495592_0175138 | 3300046454 | Bacteria | 1466 |
| 658 | Ga0495638_0000004 | 3300046460 | Bacteria | 700795 |
| 659 | Ga0495638_0071686 | 3300046460 | Bacteria | 2119 |
| 660 | Ga0495638_0148164 | 3300046460 | Bacteria | 1363 |
| 661 | Ga0495606_0010248 | 3300046507 | Bacteria | 7809 |
| 662 | Ga0495606_0064889 | 3300046507 | Bacteria | 2322 |
| 663 | Ga0495608_0035559 | 3300046511 | Bacteria | 3359 |
| 664 | Ga0495628_0017999 | 3300046516 | Bacteria | 5862 |
| 665 | Ga0495644_0002493 | 3300046523 | Bacteria | 7343 |
| 666 | Ga0495648_0000294 | 3300046524 | Bacteria | 55789 |
| 667 | Ga0495652_0202937 | 3300046529 | Bacteria | 1503 |
| 668 | Ga0495645_0194287 | 3300046543 | Bacteria | 1381 |
| 669 | Ga0495633_0001374 | 3300046558 | Bacteria | 19009 |
| 670 | Ga0495668_0001899 | 3300046616 | Bacteria | 18698 |
| 671 | Ga0495668_0103065 | 3300046616 | Bacteria | 1561 |
| 672 | Ga0495611_0000274 | 3300046648 | Bacteria | 35206 |
| 673 | Ga0495611_0074110 | 3300046648 | Bacteria | 1559 |
| 674 | Ga0495635_0105204 | 3300046663 | Bacteria | 1928 |
| 675 | Ga0495661_0078724 | 3300046665 | Bacteria | 1906 |
| 676 | Ga0495649_0031063 | 3300046694 | Bacteria | 2947 |
| 677 | Ga0495649_0101118 | 3300046694 | Bacteria | 1532 |
| 678 | Ga0495672_0057673 | 3300047320 | Bacteria | 2254 |
| 679 | Ga0495687_000010 | 3300047443 | Bacteria | 413735 |
| 680 | Ga0495675_0056842 | 3300047444 | Bacteria | 2481 |
| 681 | Ga0495677_0035719 | 3300047445 | Bacteria | 1814 |
| 682 | Ga0495686_0000102 | 3300047472 | Bacteria | 177525 |
| 683 | Ga0495686_0057563 | 3300047472 | Bacteria | 2426 |
| 684 | Ga0496102_0254332 | 3300048905 | Bacteria | 1656 |
| 685 | Ga0496110_0437307 | 3300048913 | Bacteria | 1192 |
| 686 | Ga0496111_0089179 | 3300048914 | Bacteria | 2259 |
| 687 | Ga0496111_0166126 | 3300048914 | Bacteria | 1639 |
| 688 | Ga0496112_0025653 | 3300048915 | Bacteria | 5661 |
| 689 | Ga0496121_0000051 | 3300048924 | Bacteria | 315378 |
| 690 | Ga0501298_003020 | 3300049521 | Bacteria | 2591 |
| 691 | Ga0501300_002090 | 3300049523 | Bacteria | 2981 |
| 692 | Ga0501031_0069882 | 3300049568 | Bacteria | 2287 |
| 693 | Ga0501031_0090747 | 3300049568 | Bacteria | 1993 |
| 694 | Ga0501034_0024528 | 3300049571 | Bacteria | 6135 |
| 695 | Ga0501034_0086214 | 3300049571 | Bacteria | 3141 |
| 696 | Ga0501034_0280666 | 3300049571 | Bacteria | 1605 |
| 697 | Ga0501036_0009447 | 3300049572 | Bacteria | 8021 |
| 698 | Ga0501037_0138367 | 3300049573 | Bacteria | 1743 |
| 699 | Ga0501038_0013907 | 3300049574 | Bacteria | 7335 |
| 700 | Ga0501038_0088589 | 3300049574 | Bacteria | 2598 |
| 701 | Ga0501039_0162152 | 3300049575 | Bacteria | 1757 |
| 702 | Ga0501040_0016966 | 3300049576 | Bacteria | 4828 |
| 703 | Ga0501043_0154819 | 3300049579 | Bacteria | 1793 |
| 704 | Ga0501047_0006633 | 3300049581 | Bacteria | 10886 |
| 705 | Ga0501047_0031077 | 3300049581 | Bacteria | 5150 |
| 706 | Ga0501047_0197182 | 3300049581 | Bacteria | 1875 |
| 707 | Ga0501047_0229782 | 3300049581 | Bacteria | 1709 |
| 708 | Ga0501047_0258629 | 3300049581 | Bacteria | 1589 |
| 709 | Ga0501048_0199071 | 3300049582 | Bacteria | 1420 |
| 710 | Ga0501072_0048071 | 3300049588 | Bacteria | 3360 |
| 711 | Ga0501073_0021932 | 3300049589 | Bacteria | 4601 |
| 712 | Ga0501076_0021489 | 3300049592 | Bacteria | 4952 |
| 713 | Ga0501201_000025 | 3300049651 | Bacteria | 9478 |
| 714 | Ga0501202_002827 | 3300049652 | Bacteria | 2940 |
| 715 | Ga0501222_000486 | 3300049662 | Bacteria | 5894 |
| 716 | Ga0501222_001469 | 3300049662 | Bacteria | 3306 |
| 717 | Ga0501223_000781 | 3300049663 | Bacteria | 7534 |
| 718 | Ga0501224_000108 | 3300049664 | Bacteria | 8879 |
| 719 | Ga0501235_000528 | 3300049669 | Bacteria | 7639 |
| 720 | Ga0501243_000071 | 3300049675 | Bacteria | 10207 |
| 721 | Ga0501247_000431 | 3300049677 | Bacteria | 3267 |
| 722 | Ga0501252_000336 | 3300049682 | Bacteria | 3375 |
| 723 | Ga0501253_004592 | 3300049683 | Bacteria | 1755 |
| 724 | Ga0501257_001403 | 3300049686 | Bacteria | 4970 |
| 725 | Ga0501257_005312 | 3300049686 | Bacteria | 2833 |
| 726 | Ga0501259_000621 | 3300049688 | Bacteria | 5699 |
| 727 | Ga0501219_000215 | 3300049703 | Bacteria | 10886 |
| 728 | Ga0501221_000830 | 3300049704 | Bacteria | 5023 |
| 729 | Ga0501234_001058 | 3300049707 | Bacteria | 4347 |
| 730 | Ga0501245_000770 | 3300049708 | Bacteria | 3999 |
| 731 | Ga0501079_0025221 | 3300049741 | Bacteria | 4561 |
| 732 | Ga0501081_0193466 | 3300049743 | Bacteria | 1473 |
| 733 | Ga0501083_0018107 | 3300049744 | Bacteria | 4910 |
| 734 | Ga0501241_000299 | 3300049758 | Bacteria | 10918 |
| 735 | Ga0501264_000114 | 3300049761 | Bacteria | 12301 |
| 736 | Ga0501044_0005828 | 3300049823 | Bacteria | 13646 |
| 737 | Ga0501044_0085615 | 3300049823 | Bacteria | 3185 |
| 738 | Ga0501044_0132553 | 3300049823 | Bacteria | 2485 |
| 739 | Ga0501044_0256109 | 3300049823 | Bacteria | 1689 |
| 740 | Ga0501284_00096 | 3300050005 | Bacteria | 19148 |
| 741 | nmdc:mga05p37_18061_c1 | 3300050507 | Bacteria | 8519 |
| 742 | nmdc:mga05p37_18797_c1 | 3300050507 | Bacteria | 8352 |
| 743 | nmdc:mga05p37_201220_c1 | 3300050507 | Bacteria | 2412 |
| 744 | nmdc:mga05p37_485917_c1 | 3300050507 | Bacteria | 1421 |
| 745 | nmdc:mga09592_25098_c1 | 3300050508 | Bacteria | 4932 |
| 746 | nmdc:mga06r32_11835_c1 | 3300050510 | Bacteria | 7856 |
| 747 | nmdc:mga08y16_1505_c1 | 3300050511 | Bacteria | 23452 |
| 748 | nmdc:mga08y16_192153_c1 | 3300050511 | Bacteria | 2117 |
| 749 | nmdc:mga08y16_21207_c1 | 3300050511 | Bacteria | 6861 |
| 750 | Ga0500635_0006413 | 3300053080 | Bacteria | 3141 |
| 751 | Ga0500578_0000315 | 3300053086 | Bacteria | 59398 |
| 752 | Ga0500644_0000032 | 3300053088 | Bacteria | 85851 |
| 753 | Ga0500644_0005850 | 3300053088 | Bacteria | 3122 |
| 754 | Ga0500646_0002064 | 3300053090 | Bacteria | 5240 |
| 755 | Ga0500583_0000017 | 3300053092 | Bacteria | 141647 |
| 756 | Ga0500583_0010310 | 3300053092 | Bacteria | 3461 |
| 757 | Ga0500583_0024518 | 3300053092 | Bacteria | 2560 |
| 758 | Ga0500562_013842 | 3300053108 | Bacteria | 2063 |
| 759 | Ga0500569_000043 | 3300053109 | Bacteria | 23160 |
| 760 | Ga0500607_043850 | 3300053121 | Bacteria | 2408 |
| 761 | Ga0500642_0017763 | 3300053130 | Bacteria | 2735 |
| 762 | Ga0500568_0013027 | 3300053139 | Bacteria | 3805 |
| 763 | Ga0500568_0013112 | 3300053139 | Bacteria | 3788 |
| 764 | Ga0500588_0041403 | 3300053146 | Bacteria | 1390 |
| 765 | Ga0500590_008016 | 3300053148 | Bacteria | 5257 |
| 766 | Ga0500604_0015350 | 3300053151 | Bacteria | 2097 |
| 767 | Ga0500616_0000015 | 3300053153 | Bacteria | 633259 |
| 768 | Ga0500616_0006711 | 3300053153 | Bacteria | 7471 |
| 769 | Ga0500616_0030085 | 3300053153 | Bacteria | 2984 |
| 770 | Ga0500622_0000075 | 3300053156 | Bacteria | 109513 |
| 771 | Ga0500622_0000086 | 3300053156 | Bacteria | 99366 |
| 772 | Ga0500622_0000093 | 3300053156 | Bacteria | 92537 |
| 773 | Ga0500622_0002243 | 3300053156 | Bacteria | 14211 |
| 774 | Ga0500622_0004441 | 3300053156 | Bacteria | 8812 |
| 775 | Ga0500622_0085730 | 3300053156 | Bacteria | 1570 |
| 776 | Ga0500633_0009997 | 3300053160 | Bacteria | 2519 |
| 777 | Ga0500636_0032724 | 3300053177 | Bacteria | 3078 |
| 778 | Ga0500636_0073176 | 3300053177 | Bacteria | 1985 |
| 779 | Ga0501082_0022571 | 3300060353 | Bacteria | 5420 |
| 780 | 2522549510 | 2522125168 | Bacteria | 7376607 |
| 781 | 2738730309 | 2738541278 | Bacteria | 9755573 |
| 782 | 2819577321 | 2818991442 | Bacteria | 8318214 |
| 783 | 2821140624 | 2821136567 | Bacteria | 8080116 |
| 784 | 2840678308 | 2840677318 | Bacteria | 2664183 |
| 785 | 2852627179 | 2852623160 | Bacteria | 4376875 |
| 786 | 2883071236 | 2883068021 | Bacteria | 6192739 |
| 787 | 2884791832 | 2884791551 | Bacteria | 8511252 |
| 788 | 2884935884 | 2884933994 | Bacteria | 4535041 |
| 789 | 2896086125 | 2896085136 | Bacteria | 6129793 |
| 790 | 2896115300 | 2896109856 | Bacteria | 7140722 |
| 791 | 2904473043 | 2904467357 | Bacteria | 8057758 |
| 792 | 2910250785 | 2910245624 | Bacteria | 6935613 |
| 793 | 2929178187 | 2929177148 | Bacteria | 7883697 |
| 794 | 2929240488 | 2929239360 | Bacteria | 7745570 |
| 795 | 2929922331 | 2929921140 | Bacteria | 8649150 |
| 796 | 2945980549 | 2945977869 | Bacteria | 7777518 |
| 797 | 2946013588 | 2946013367 | Bacteria | 7766675 |
| 798 | 8003156680 | 8003151029 | Bacteria | 8187759 |
| 799 | Ga0070686_100102581 | |||
| 800 | SwRhRL2b_contig_3365545 | |||
| 801 | JGI24739J22299_10001725 | |||
| 802 | JGI25162J39368_1002488 | |||
| 803 | JGI25154J39366_1000120 | |||
| 804 | JGI25157J39369_1003864 | |||
| 805 | JGI25164J39214_1000976 | |||
| 806 | JGI25406J46586_10000481 | |||
| 807 | JGI25165J46597_1000426 | |||
| 808 | JGI25153J46596_10015134 | |||
| 809 | JGI25153J46596_10026466 | |||
| 810 | rootH1_10000642 | |||
| 811 | rootH1_10063898 | |||
| 812 | rootH2_10001529 | |||
| 813 | rootH2_10004243 | |||
| 814 | rootH2_10016199 | |||
| 815 | rootH2_10021351 | |||
| 816 | rootH2_10037508 | |||
| 817 | rootH2_10067178 | |||
| 818 | rootL2_10004081 | |||
| 819 | rootL2_10010050 | |||
| 820 | rootL2_10025221 | |||
| 821 | rootL2_10078697 | |||
| 822 | rootL2_10086654 | |||
| 823 | rootH1_10003667 | |||
| 824 | rootH1_10007212 | |||
| 825 | rootH1_10033931 | |||
| 826 | rootH1_10044901 | |||
| 827 | rootH1_10057868 | |||
| 828 | rootH1_10090043 | |||
| 829 | JGI25160J50197_1001317 | |||
| 830 | Ga0055542_1007334 | |||
| 831 | Ga0055526_1009734 | |||
| 832 | Ga0055528_1000265 | |||
| 833 | Ga0055530_10003316 | |||
| 834 | Ga0055530_10021000 | |||
| 835 | Ga0055531_10000115 | |||
| 836 | Ga0055531_10000169 | |||
| 837 | Ga0055543_1009073 | |||
| 838 | Ga0065165_1000358 | |||
| 839 | Ga0065165_1000519 | |||
| 840 | Ga0065165_1010940 | |||
| 841 | Ga0065704_10071683 | |||
| 842 | Ga0065712_10013012 | |||
| 843 | Ga0065712_10071842 | |||
| 844 | Ga0065712_10076510 | |||
| 845 | Ga0065712_10086019 | |||
| 846 | Ga0070658_10072092 | |||
| 847 | Ga0070676_10000081 | |||
| 848 | Ga0070676_10000086 | |||
| 849 | Ga0070676_10036264 | |||
| 850 | Ga0070683_100000508 | |||
| 851 | Ga0070683_100009114 | |||
| 852 | Ga0070683_100013382 | |||
| 853 | Ga0070690_100071707 | |||
| 854 | Ga0070670_100035386 | |||
| 855 | Ga0070670_100037929 | |||
| 856 | Ga0070670_100038397 | |||
| 857 | Ga0070670_100062492 | |||
| 858 | Ga0070670_100162207 | |||
| 859 | Ga0070677_10053632 | |||
| 860 | Ga0068869_100010484 | |||
| 861 | Ga0068869_100025094 | |||
| 862 | Ga0068869_100048224 | |||
| 863 | Ga0068869_100098615 | |||
| 864 | Ga0068869_100131300 | |||
| 865 | Ga0068869_100182409 | |||
| 866 | Ga0070666_10000110 | |||
| 867 | Ga0070666_10010336 | |||
| 868 | Ga0070666_10014633 | |||
| 869 | Ga0070666_10032865 | |||
| 870 | Ga0070680_100002529 | |||
| 871 | Ga0070682_100007037 | |||
| 872 | Ga0068868_100000420 | |||
| 873 | Ga0068868_100010515 | |||
| 874 | Ga0068868_100026384 | |||
| 875 | Ga0068868_100041064 | |||
| 876 | Ga0068868_100041472 | |||
| 877 | Ga0068868_100136484 | |||
| 878 | Ga0070660_100007231 | |||
| 879 | Ga0070689_100009325 | |||
| 880 | Ga0070689_100019305 | |||
| 881 | Ga0070689_100115162 | |||
| 882 | Ga0070691_10007389 | |||
| 883 | Ga0070691_10013358 | |||
| 884 | Ga0070661_100000111 | |||
| 885 | Ga0070661_100061446 | |||
| 886 | Ga0070668_100000077 | |||
| 887 | Ga0070668_100024712 | |||
| 888 | Ga0070668_100046103 | |||
| 889 | Ga0070668_100192490 | |||
| 890 | Ga0070669_100001696 | |||
| 891 | Ga0070669_100021159 | |||
| 892 | Ga0070669_100038636 | |||
| 893 | Ga0070669_100116157 | |||
| 894 | Ga0070675_100020849 | |||
| 895 | Ga0070675_100020879 | |||
| 896 | Ga0070675_100037185 | |||
| 897 | Ga0070671_100003332 | |||
| 898 | Ga0070671_100010273 | |||
| 899 | Ga0070671_100103567 | |||
| 900 | Ga0070671_100104571 | |||
| 901 | Ga0070674_100072723 | |||
| 902 | Ga0070674_100087818 | |||
| 903 | Ga0070673_100000072 | |||
| 904 | Ga0070673_100001289 | |||
| 905 | Ga0070673_100014416 | |||
| 906 | Ga0070673_100083080 | |||
| 907 | Ga0070688_100056018 | |||
| 908 | Ga0070659_100004012 | |||
| 909 | Ga0070667_100000382 | |||
| 910 | Ga0070667_100005185 | |||
| 911 | Ga0070667_100016325 | |||
| 912 | Ga0070667_100033408 | |||
| 913 | Ga0070711_100042892 | |||
| 914 | Ga0070678_100294242 | |||
| 915 | Ga0070662_100000011 | |||
| 916 | Ga0070662_100016867 | |||
| 917 | Ga0070662_100151587 | |||
| 918 | Ga0070681_10020519 | |||
| 919 | Ga0070681_10052850 | |||
| 920 | Ga0070681_10058761 | |||
| 921 | Ga0070681_10098827 | |||
| 922 | Ga0068867_100000558 | |||
| 923 | Ga0068867_100002567 | |||
| 924 | Ga0068867_100013547 | |||
| 925 | Ga0068867_100022499 | |||
| 926 | Ga0068867_100047386 | |||
| 927 | Ga0068867_100119985 | |||
| 928 | Ga0070685_10003168 | |||
| 929 | Ga0070685_10039777 | |||
| 930 | Ga0070685_10075053 | |||
| 931 | Ga0070698_100009065 | |||
| 932 | Ga0070698_100021251 | |||
| 933 | Ga0070698_100023339 | |||
| 934 | Ga0070698_100354040 | |||
| 935 | Ga0070679_100017217 | |||
| 936 | Ga0070679_100050288 | |||
| 937 | Ga0070679_100051240 | |||
| 938 | Ga0070684_100006108 | |||
| 939 | Ga0070684_100060256 | |||
| 940 | Ga0070684_100064156 | |||
| 941 | Ga0070684_100077523 | |||
| 942 | Ga0068853_100013016 | |||
| 943 | Ga0068853_100038517 | |||
| 944 | Ga0068853_100072769 | |||
| 945 | Ga0068853_100087345 | |||
| 946 | Ga0068853_100167475 | |||
| 947 | Ga0070672_100000240 | |||
| 948 | Ga0070672_100028861 | |||
| 949 | Ga0070672_100054203 | |||
| 950 | Ga0070672_100093627 | |||
| 951 | Ga0070665_100000003 | |||
| 952 | Ga0070665_100001677 | |||
| 953 | Ga0070665_100032445 | |||
| 954 | Ga0070665_100267228 | |||
| 955 | Ga0068855_100000108 | |||
| 956 | Ga0068855_100000260 | |||
| 957 | Ga0068855_100003173 | |||
| 958 | Ga0068855_100024009 | |||
| 959 | Ga0068855_100068897 | |||
| 960 | Ga0068855_100075471 | |||
| 961 | Ga0068855_100099737 | |||
| 962 | Ga0070664_100004434 | |||
| 963 | Ga0070664_100005019 | |||
| 964 | Ga0070664_100011721 | |||
| 965 | Ga0070664_100025199 | |||
| 966 | Ga0070664_100178036 | |||
| 967 | Ga0068857_100001839 | |||
| 968 | Ga0068857_100003159 | |||
| 969 | Ga0068857_100022840 | |||
| 970 | Ga0068857_100050419 | |||
| 971 | Ga0068854_100012236 | |||
| 972 | Ga0068854_100057107 | |||
| 973 | Ga0068854_100061107 | |||
| 974 | Ga0068854_100192405 | |||
| 975 | Ga0068856_100001596 | |||
| 976 | Ga0068856_100014292 | |||
| 977 | Ga0068856_100045665 | |||
| 978 | Ga0068856_100160281 | |||
| 979 | Ga0068856_100242780 | |||
| 980 | Ga0070702_100024277 | |||
| 981 | Ga0068852_100000527 | |||
| 982 | Ga0068852_100004482 | |||
| 983 | Ga0068852_100039418 | |||
| 984 | Ga0068852_100196765 | |||
| 985 | Ga0068852_100395286 | |||
| 986 | Ga0068859_100000026 | |||
| 987 | Ga0068859_100046521 | |||
| 988 | Ga0068859_100082711 | |||
| 989 | Ga0068859_100119174 | |||
| 990 | Ga0068859_100180784 | |||
| 991 | Ga0068864_100000389 | |||
| 992 | Ga0068864_100016837 | |||
| 993 | Ga0068864_100019322 | |||
| 994 | Ga0068864_100136905 | |||
| 995 | Ga0068864_100231797 | |||
| 996 | Ga0068866_10027931 | |||
| 997 | Ga0068861_100010696 | |||
| 998 | Ga0068861_100015199 | |||
| 999 | Ga0068861_100057001 | |||
| 1000 | Ga0068861_100103204 | |||
| 1001 | Ga0068851_10000082 | |||
| 1002 | Ga0068870_10009545 | |||
| 1003 | Ga0068870_10010874 | |||
| 1004 | Ga0068863_100023529 | |||
| 1005 | Ga0068863_100027750 | |||
| 1006 | Ga0068863_100118890 | |||
| 1007 | Ga0068858_100000634 | |||
| 1008 | Ga0068858_100028849 | |||
| 1009 | Ga0068858_100391730 | |||
| 1010 | Ga0068860_100000072 | |||
| 1011 | Ga0068860_100001760 | |||
| 1012 | Ga0068860_100009606 | |||
| 1013 | Ga0068860_100032131 | |||
| 1014 | Ga0068860_100042201 | |||
| 1015 | Ga0068860_100389434 | |||
| 1016 | Ga0068862_100005406 | |||
| 1017 | Ga0081540_1014647 | |||
| 1018 | Ga0081539_10000714 | |||
| 1019 | Ga0081539_10008308 | |||
| 1020 | Ga0097621_100000150 | |||
| 1021 | Ga0097621_100002418 | |||
| 1022 | Ga0097621_100002717 | |||
| 1023 | Ga0097621_100003513 | |||
| 1024 | Ga0097621_100006095 | |||
| 1025 | Ga0097621_100036902 | |||
| 1026 | Ga0097621_100043480 | |||
| 1027 | Ga0097621_100088848 | |||
| 1028 | Ga0097621_100169635 | |||
| 1029 | Ga0068871_100000045 | |||
| 1030 | Ga0068871_100001431 | |||
| 1031 | Ga0068871_100026597 | |||
| 1032 | Ga0068871_100062262 | |||
| 1033 | Ga0068871_100089138 | |||
| 1034 | Ga0068871_100216659 | |||
| 1035 | Ga0068871_100288272 | |||
| 1036 | Ga0075428_100015432 | |||
| 1037 | Ga0075428_100066893 | |||
| 1038 | Ga0075428_100423186 | |||
| 1039 | Ga0075431_100017550 | |||
| 1040 | Ga0075434_100170664 | |||
| 1041 | Ga0075429_100019702 | |||
| 1042 | Ga0068865_100000170 | |||
| 1043 | Ga0068865_100096638 | |||
| 1044 | Ga0097620_100000026 | |||
| 1045 | Ga0097620_100046525 | |||
| 1046 | Ga0097620_100082713 | |||
| 1047 | Ga0097620_100119178 | |||
| 1048 | Ga0097620_100180782 | |||
| 1049 | Ga0105240_10000991 | |||
| 1050 | Ga0105240_10001109 | |||
| 1051 | Ga0105240_10002195 | |||
| 1052 | Ga0105240_10002244 | |||
| 1053 | Ga0105240_10012757 | |||
| 1054 | Ga0105240_10019308 | |||
| 1055 | Ga0105240_10023818 | |||
| 1056 | Ga0105240_10028757 | |||
| 1057 | Ga0105240_10033251 | |||
| 1058 | Ga0105240_10039959 | |||
| 1059 | Ga0105240_10102003 | |||
| 1060 | Ga0105240_10169871 | |||
| 1061 | Ga0111539_10003835 | |||
| 1062 | Ga0111539_10043774 | |||
| 1063 | Ga0111539_10484782 | |||
| 1064 | Ga0105245_10017518 | |||
| 1065 | Ga0105245_10107271 | |||
| 1066 | Ga0105247_10026765 | |||
| 1067 | Ga0105247_10179656 | |||
| 1068 | Ga0114129_10007891 | |||
| 1069 | Ga0114129_10041640 | |||
| 1070 | Ga0105241_10000268 | |||
| 1071 | Ga0105241_10000739 | |||
| 1072 | Ga0105241_10001510 | |||
| 1073 | Ga0105241_10003366 | |||
| 1074 | Ga0105241_10003966 | |||
| 1075 | Ga0105241_10050791 | |||
| 1076 | Ga0105242_10007643 | |||
| 1077 | Ga0105242_10008158 | |||
| 1078 | Ga0105242_10014438 | |||
| 1079 | Ga0105242_10181963 | |||
| 1080 | Ga0105237_10000943 | |||
| 1081 | Ga0105237_10005407 | |||
| 1082 | Ga0105237_10005933 | |||
| 1083 | Ga0105237_10012129 | |||
| 1084 | Ga0105237_10012937 | |||
| 1085 | Ga0105237_10017853 | |||
| 1086 | Ga0105237_10049862 | |||
| 1087 | Ga0105237_10062812 | |||
| 1088 | Ga0105237_10272468 | |||
| 1089 | Ga0105238_10002471 | |||
| 1090 | Ga0105238_10016058 | |||
| 1091 | Ga0105249_10002519 | |||
| 1092 | Ga0105249_10020489 | |||
| 1093 | Ga0105249_10072733 | |||
| 1094 | Ga0105249_10210145 | |||
| 1095 | Ga0105249_10275950 | |||
| 1096 | Ga0105239_10000017 | |||
| 1097 | Ga0105239_10000168 | |||
| 1098 | Ga0105239_10001486 | |||
| 1099 | Ga0105239_10007223 | |||
| 1100 | Ga0105239_10010270 | |||
| 1101 | Ga0105239_10019423 | |||
| 1102 | Ga0105239_10038201 | |||
| 1103 | Ga0105239_10053100 | |||
| 1104 | Ga0105239_10124266 | |||
| 1105 | Ga0105239_10271724 | |||
| 1106 | Ga0105239_10400754 | |||
| 1107 | Ga0105246_10054960 | |||
| 1108 | Ga0105246_10075863 | |||
| 1109 | Ga0105246_10077166 | |||
| 1110 | Ga0105246_10107179 | |||
| 1111 | Ga0157373_10014240 | |||
| 1112 | Ga0157373_10087532 | |||
| 1113 | Ga0157370_10001221 | |||
| 1114 | Ga0157370_10002685 | |||
| 1115 | Ga0157370_10025719 | |||
| 1116 | Ga0157370_10081361 | |||
| 1117 | Ga0157370_10154587 | |||
| 1118 | Ga0157369_10008855 | |||
| 1119 | Ga0157369_10109533 | |||
| 1120 | Ga0157374_10000002 | |||
| 1121 | Ga0157374_10000277 | |||
| 1122 | Ga0157374_10001261 | |||
| 1123 | Ga0157374_10002879 | |||
| 1124 | Ga0157374_10009549 | |||
| 1125 | Ga0157374_10132030 | |||
| 1126 | Ga0157374_10164274 | |||
| 1127 | Ga0157378_10004161 | |||
| 1128 | Ga0157378_10008593 | |||
| 1129 | Ga0157378_10027445 | |||
| 1130 | Ga0157378_10027708 | |||
| 1131 | Ga0157378_10062779 | |||
| 1132 | Ga0157378_10075808 | |||
| 1133 | Ga0157378_10187623 | |||
| 1134 | Ga0163162_10000024 | |||
| 1135 | Ga0163162_10000084 | |||
| 1136 | Ga0163162_10000510 | |||
| 1137 | Ga0163162_10003635 | |||
| 1138 | Ga0163162_10010342 | |||
| 1139 | Ga0163162_10220561 | |||
| 1140 | Ga0157372_10005788 | |||
| 1141 | Ga0157372_10007445 | |||
| 1142 | Ga0157372_10111568 | |||
| 1143 | Ga0157372_10119055 | |||
| 1144 | Ga0157372_10157079 | |||
| 1145 | Ga0157372_10185253 | |||
| 1146 | Ga0157372_10214327 | |||
| 1147 | Ga0157375_10000219 | |||
| 1148 | Ga0157375_10000616 | |||
| 1149 | Ga0157375_10013462 | |||
| 1150 | Ga0157375_10030799 | |||
| 1151 | Ga0157375_10055189 | |||
| 1152 | Ga0163163_10000388 | |||
| 1153 | Ga0163163_10022878 | |||
| 1154 | Ga0157380_10043637 | |||
| 1155 | Ga0157380_10049095 | |||
| 1156 | Ga0157380_10242238 | |||
| 1157 | Ga0157377_10002248 | |||
| 1158 | Ga0157377_10004867 | |||
| 1159 | Ga0157377_10005236 | |||
| 1160 | Ga0157379_10000078 | |||
| 1161 | Ga0157379_10039395 | |||
| 1162 | Ga0157379_10090138 | |||
| 1163 | Ga0157379_10098487 | |||
| 1164 | Ga0157379_10290973 | |||
| 1165 | Ga0157376_10000219 | |||
| 1166 | Ga0157376_10024890 | |||
| 1167 | Ga0157376_10037733 | |||
| 1168 | Ga0157376_10041030 | |||
| 1169 | Ga0157376_10082798 | |||
| 1170 | Ga0157376_10179620 | |||
| 1171 | Ga0182005_1000294 | |||
| 1172 | Ga0163161_10015478 | |||
| 1173 | Ga0163161_10019244 | |||
| 1174 | Ga0163161_10062866 | |||
| 1175 | Ga0213876_10010259 | |||
| 1176 | Ga0213876_10044704 | |||
| 1177 | Ga0209436_101389 | |||
| 1178 | Ga0207427_100204 | |||
| 1179 | Ga0209437_100048 | |||
| 1180 | Ga0209258_100032 | |||
| 1181 | Ga0209646_1000050 | |||
| 1182 | Ga0209646_1003487 | |||
| 1183 | Ga0209026_1000637 | |||
| 1184 | Ga0209148_1000223 | |||
| 1185 | Ga0209233_1000029 | |||
| 1186 | Ga0209455_1005960 | |||
| 1187 | Ga0209673_1000042 | |||
| 1188 | Ga0209564_1004940 | |||
| 1189 | Ga0209758_1003391 | |||
| 1190 | Ga0209758_1005114 | |||
| 1191 | Ga0209758_1010376 | |||
| 1192 | Ga0209050_1000295 | |||
| 1193 | Ga0209050_1001207 | |||
| 1194 | Ga0209050_1025068 | |||
| 1195 | Ga0207426_1000105 | |||
| 1196 | Ga0207426_1000711 | |||
| 1197 | Ga0207426_1001775 | |||
| 1198 | Ga0207426_1010051 | |||
| 1199 | Ga0209257_1000007 | |||
| 1200 | Ga0209257_1000128 | |||
| 1201 | Ga0209257_1001716 | |||
| 1202 | Ga0207656_10001244 | |||
| 1203 | Ga0207656_10045430 | |||
| 1204 | Ga0207688_10018799 | |||
| 1205 | Ga0207680_10000369 | |||
| 1206 | Ga0207680_10013164 | |||
| 1207 | Ga0207680_10023789 | |||
| 1208 | Ga0207680_10125019 | |||
| 1209 | Ga0207647_10000051 | |||
| 1210 | Ga0207647_10022032 | |||
| 1211 | Ga0207647_10085907 | |||
| 1212 | Ga0207645_10000156 | |||
| 1213 | Ga0207645_10003882 | |||
| 1214 | Ga0207645_10013421 | |||
| 1215 | Ga0207645_10096578 | |||
| 1216 | Ga0207643_10006662 | |||
| 1217 | Ga0207643_10011676 | |||
| 1218 | Ga0207643_10044052 | |||
| 1219 | Ga0207643_10077774 | |||
| 1220 | Ga0207705_10007511 | |||
| 1221 | Ga0207705_10049268 | |||
| 1222 | Ga0207705_10143653 | |||
| 1223 | Ga0207654_10000828 | |||
| 1224 | Ga0207654_10002743 | |||
| 1225 | Ga0207654_10004390 | |||
| 1226 | Ga0207654_10006614 | |||
| 1227 | Ga0207654_10007708 | |||
| 1228 | Ga0207707_10052527 | |||
| 1229 | Ga0207695_10000060 | |||
| 1230 | Ga0207695_10000185 | |||
| 1231 | Ga0207695_10000666 | |||
| 1232 | Ga0207695_10005639 | |||
| 1233 | Ga0207695_10019309 | |||
| 1234 | Ga0207695_10019941 | |||
| 1235 | Ga0207695_10021827 | |||
| 1236 | Ga0207695_10058175 | |||
| 1237 | Ga0207695_10124895 | |||
| 1238 | Ga0207695_10268643 | |||
| 1239 | Ga0207671_10002465 | |||
| 1240 | Ga0207671_10005680 | |||
| 1241 | Ga0207671_10009372 | |||
| 1242 | Ga0207671_10011264 | |||
| 1243 | Ga0207671_10011822 | |||
| 1244 | Ga0207671_10015343 | |||
| 1245 | Ga0207671_10023857 | |||
| 1246 | Ga0207671_10026174 | |||
| 1247 | Ga0207671_10035973 | |||
| 1248 | Ga0207660_10004270 | |||
| 1249 | Ga0207660_10009343 | |||
| 1250 | Ga0207657_10077204 | |||
| 1251 | Ga0207649_10001181 | |||
| 1252 | Ga0207652_10014701 | |||
| 1253 | Ga0207681_10079562 | |||
| 1254 | Ga0207681_10186620 | |||
| 1255 | Ga0207694_10011559 | |||
| 1256 | Ga0207694_10028134 | |||
| 1257 | Ga0207694_10059933 | |||
| 1258 | Ga0207650_10077799 | |||
| 1259 | Ga0207659_10032676 | |||
| 1260 | Ga0207659_10067892 | |||
| 1261 | Ga0207659_10069974 | |||
| 1262 | Ga0207644_10035849 | |||
| 1263 | Ga0207644_10083177 | |||
| 1264 | Ga0207706_10000122 | |||
| 1265 | Ga0207706_10004505 | |||
| 1266 | Ga0207706_10014606 | |||
| 1267 | Ga0207706_10022199 | |||
| 1268 | Ga0207706_10053352 | |||
| 1269 | Ga0207686_10001038 | |||
| 1270 | Ga0207709_10271318 | |||
| 1271 | Ga0207670_10026350 | |||
| 1272 | Ga0207670_10043575 | |||
| 1273 | Ga0207669_10043887 | |||
| 1274 | Ga0207704_10000041 | |||
| 1275 | Ga0207704_10200942 | |||
| 1276 | Ga0207691_10000014 | |||
| 1277 | Ga0207691_10001372 | |||
| 1278 | Ga0207691_10006843 | |||
| 1279 | Ga0207691_10052525 | |||
| 1280 | Ga0207691_10152025 | |||
| 1281 | Ga0207691_10186318 | |||
| 1282 | Ga0207689_10014672 | |||
| 1283 | Ga0207689_10016596 | |||
| 1284 | Ga0207689_10041962 | |||
| 1285 | Ga0207689_10075180 | |||
| 1286 | Ga0207661_10018492 | |||
| 1287 | Ga0207679_10000909 | |||
| 1288 | Ga0207679_10118647 | |||
| 1289 | Ga0207667_10000039 | |||
| 1290 | Ga0207667_10000084 | |||
| 1291 | Ga0207667_10001931 | |||
| 1292 | Ga0207667_10004246 | |||
| 1293 | Ga0207667_10017761 | |||
| 1294 | Ga0207667_10022635 | |||
| 1295 | Ga0207667_10203855 | |||
| 1296 | Ga0207651_10024826 | |||
| 1297 | Ga0207651_10026783 | |||
| 1298 | Ga0207651_10175114 | |||
| 1299 | Ga0207712_10047014 | |||
| 1300 | Ga0207712_10062662 | |||
| 1301 | Ga0207668_10000286 | |||
| 1302 | Ga0207668_10248282 | |||
| 1303 | Ga0207640_10157196 | |||
| 1304 | Ga0207658_10003829 | |||
| 1305 | Ga0207658_10008758 | |||
| 1306 | Ga0207658_10077582 | |||
| 1307 | Ga0207658_10096011 | |||
| 1308 | Ga0207677_10000815 | |||
| 1309 | Ga0207677_10031546 | |||
| 1310 | Ga0207677_10039672 | |||
| 1311 | Ga0207677_10053571 | |||
| 1312 | Ga0207677_10057635 | |||
| 1313 | Ga0207677_10114535 | |||
| 1314 | Ga0207677_10130379 | |||
| 1315 | Ga0207703_10001163 | |||
| 1316 | Ga0207703_10118699 | |||
| 1317 | Ga0207703_10360813 | |||
| 1318 | Ga0207639_10010664 | |||
| 1319 | Ga0207639_10022234 | |||
| 1320 | Ga0207639_10024756 | |||
| 1321 | Ga0207639_10027714 | |||
| 1322 | Ga0207678_10191739 | |||
| 1323 | Ga0207702_10000861 | |||
| 1324 | Ga0207702_10080774 | |||
| 1325 | Ga0207641_10000155 | |||
| 1326 | Ga0207641_10001712 | |||
| 1327 | Ga0207641_10036756 | |||
| 1328 | Ga0207641_10045902 | |||
| 1329 | Ga0207641_10070207 | |||
| 1330 | Ga0207641_10075528 | |||
| 1331 | Ga0207648_10000645 | |||
| 1332 | Ga0207648_10003712 | |||
| 1333 | Ga0207648_10004371 | |||
| 1334 | Ga0207648_10034959 | |||
| 1335 | Ga0207648_10054258 | |||
| 1336 | Ga0207676_10011233 | |||
| 1337 | Ga0207676_10031919 | |||
| 1338 | Ga0207676_10032674 | |||
| 1339 | Ga0207676_10252616 | |||
| 1340 | Ga0207676_10277714 | |||
| 1341 | Ga0207674_10001267 | |||
| 1342 | Ga0207674_10001616 | |||
| 1343 | Ga0207674_10003427 | |||
| 1344 | Ga0207674_10020871 | |||
| 1345 | Ga0207674_10199902 | |||
| 1346 | Ga0207675_100001183 | |||
| 1347 | Ga0207675_100019898 | |||
| 1348 | Ga0207675_100021831 | |||
| 1349 | Ga0207675_100056540 | |||
| 1350 | Ga0207675_100087317 | |||
| 1351 | Ga0207675_100118162 | |||
| 1352 | Ga0207683_10001922 | |||
| 1353 | Ga0207683_10023174 | |||
| 1354 | Ga0207698_10004138 | |||
| 1355 | Ga0207698_10004684 | |||
| 1356 | Ga0207698_10026987 | |||
| 1357 | Ga0207698_10102040 | |||
| 1358 | Ga0207698_10155181 | |||
| 1359 | Ga0207428_10011109 | |||
| 1360 | Ga0268266_10000088 | |||
| 1361 | Ga0268266_10000137 | |||
| 1362 | Ga0268266_10002464 | |||
| 1363 | Ga0268264_10000484 | |||
| 1364 | Ga0268264_10003582 | |||
| 1365 | Ga0268264_10004151 | |||
| 1366 | Ga0268264_10005674 | |||
| 1367 | Ga0307517_10000959 | |||
| 1368 | Ga0307517_10010052 | |||
| 1369 | Ga0307515_10000012 | |||
| 1370 | Ga0307515_10000363 | |||
| 1371 | Ga0265338_10031831 | |||
| 1372 | Ga0307511_10001671 | |||
| 1373 | Ga0265327_10000152 | |||
| 1374 | Ga0265327_10018278 | |||
| 1375 | Ga0307513_10053489 | |||
| 1376 | Ga0307513_10064861 | |||
| 1377 | Ga0307509_10006387 | |||
| 1378 | Ga0307509_10009690 | |||
| 1379 | Ga0307408_100003690 | |||
| 1380 | Ga0307408_100017838 | |||
| 1381 | Ga0307508_10001601 | |||
| 1382 | Ga0307516_10002853 | |||
| 1383 | Ga0307516_10112980 | |||
| 1384 | Ga0316577_10022831 | |||
| 1385 | Ga0307412_10078911 | |||
| 1386 | Ga0307416_100043251 | |||
| 1387 | Ga0307416_100284081 | |||
| 1388 | Ga0307414_10017794 | |||
| 1389 | Ga0307414_10083957 | |||
| 1390 | Ga0307411_10179015 | |||
| 1391 | Ga0307510_10000074 | |||
| 1392 | Ga0307510_10021413 | |||
| 1393 | Ga0373955_0160915 | |||
| 1394 | Ga0373927_0020017 | |||
| 1395 | Ga0373937_0030534 | |||
| 1396 | Ga0316584_0151445 | |||
| 1397 | Ga0395899_0004641 | |||
| 1398 | Ga0395900_0000014 | |||
| 1399 | Ga0395900_0000357 | |||
| 1400 | Ga0395898_0005171 | |||
| 1401 | Ga0395905_0000241 | |||
| 1402 | Ga0395905_0001914 | |||
| 1403 | Ga0395901_0002234 | |||
| 1404 | Ga0395901_0006039 | |||
| 1405 | Ga0436365_1727150 | |||
| 1406 | Ga0439436_0010284 | |||
| 1407 | Ga0439436_0013224 | |||
| 1408 | Ga0439439_0006910 | |||
| 1409 | Ga0439431_0001817 | |||
| 1410 | Ga0439431_0010470 | |||
| 1411 | Ga0439442_006236 | |||
| 1412 | Ga0439445_0005470 | |||
| 1413 | Ga0439449_0000332 | |||
| 1414 | Ga0439449_0031633 | |||
| 1415 | Ga0439457_002437 | |||
| 1416 | Ga0439462_0037047 | |||
| 1417 | Ga0450897_000991 | |||
| 1418 | Ga0439434_0007514 | |||
| 1419 | Ga0451577_0002166 | |||
| 1420 | Ga0451577_0002748 | |||
| 1421 | Ga0451577_0006701 | |||
| 1422 | Ga0451577_0035910 | |||
| 1423 | Ga0451577_0143130 | |||
| 1424 | Ga0451577_0195132 | |||
| 1425 | Ga0466969_0000940 | |||
| 1426 | Ga0466972_0000022 | |||
| 1427 | Ga0466972_0000108 | |||
| 1428 | Ga0466982_0064539 | |||
| 1429 | Ga0466965_0043861 | |||
| 1430 | Ga0466966_0025199 | |||
| 1431 | Ga0453684_0000771 | |||
| 1432 | Ga0453684_0001035 | |||
| 1433 | Ga0453684_0002604 | |||
| 1434 | Ga0453684_0004538 | |||
| 1435 | Ga0453684_0023677 | |||
| 1436 | Ga0453684_0029659 | |||
| 1437 | Ga0453684_0078113 | |||
| 1438 | Ga0453684_0113443 | |||
| 1439 | Ga0453684_0168128 | |||
| 1440 | Ga0466971_0015381 | |||
| 1441 | Ga0466968_0081558 | |||
| 1442 | Ga0466970_0000367 | |||
| 1443 | Ga0466957_0008234 | |||
| 1444 | Ga0466957_0027951 | |||
| 1445 | Ga0466957_0077549 | |||
| 1446 | Ga0466960_0063354 | |||
| 1447 | Ga0466959_0000025 | |||
| 1448 | Ga0466959_0023180 | |||
| 1449 | Ga0451576_0004004 | |||
| 1450 | Ga0451576_0015745 | |||
| 1451 | Ga0451576_0357748 | |||
| 1452 | Ga0495627_004527 | |||
| 1453 | Ga0495592_0031736 | |||
| 1454 | Ga0495592_0175138 | |||
| 1455 | Ga0495638_0000004 | |||
| 1456 | Ga0495638_0071686 | |||
| 1457 | Ga0495638_0148164 | |||
| 1458 | Ga0495606_0010248 | |||
| 1459 | Ga0495606_0064889 | |||
| 1460 | Ga0495608_0035559 | |||
| 1461 | Ga0495628_0017999 | |||
| 1462 | Ga0495644_0002493 | |||
| 1463 | Ga0495648_0000294 | |||
| 1464 | Ga0495652_0202937 | |||
| 1465 | Ga0495645_0194287 | |||
| 1466 | Ga0495633_0001374 | |||
| 1467 | Ga0495668_0001899 | |||
| 1468 | Ga0495668_0103065 | |||
| 1469 | Ga0495611_0000274 | |||
| 1470 | Ga0495611_0074110 | |||
| 1471 | Ga0495635_0105204 | |||
| 1472 | Ga0495661_0078724 | |||
| 1473 | Ga0495649_0031063 | |||
| 1474 | Ga0495649_0101118 | |||
| 1475 | Ga0495672_0057673 | |||
| 1476 | Ga0495687_000010 | |||
| 1477 | Ga0495675_0056842 | |||
| 1478 | Ga0495677_0035719 | |||
| 1479 | Ga0495686_0000102 | |||
| 1480 | Ga0495686_0057563 | |||
| 1481 | Ga0496102_0254332 | |||
| 1482 | Ga0496110_0437307 | |||
| 1483 | Ga0496111_0089179 | |||
| 1484 | Ga0496111_0166126 | |||
| 1485 | Ga0496112_0025653 | |||
| 1486 | Ga0496121_0000051 | |||
| 1487 | Ga0501298_003020 | |||
| 1488 | Ga0501300_002090 | |||
| 1489 | Ga0501031_0069882 | |||
| 1490 | Ga0501031_0090747 | |||
| 1491 | Ga0501034_0024528 | |||
| 1492 | Ga0501034_0086214 | |||
| 1493 | Ga0501034_0280666 | |||
| 1494 | Ga0501036_0009447 | |||
| 1495 | Ga0501037_0138367 | |||
| 1496 | Ga0501038_0013907 | |||
| 1497 | Ga0501038_0088589 | |||
| 1498 | Ga0501039_0162152 | |||
| 1499 | Ga0501040_0016966 | |||
| 1500 | Ga0501043_0154819 | |||
| 1501 | Ga0501047_0006633 | |||
| 1502 | Ga0501047_0031077 | |||
| 1503 | Ga0501047_0197182 | |||
| 1504 | Ga0501047_0229782 | |||
| 1505 | Ga0501047_0258629 | |||
| 1506 | Ga0501048_0199071 | |||
| 1507 | Ga0501072_0048071 | |||
| 1508 | Ga0501073_0021932 | |||
| 1509 | Ga0501076_0021489 | |||
| 1510 | Ga0501201_000025 | |||
| 1511 | Ga0501202_002827 | |||
| 1512 | Ga0501222_000486 | |||
| 1513 | Ga0501222_001469 | |||
| 1514 | Ga0501223_000781 | |||
| 1515 | Ga0501224_000108 | |||
| 1516 | Ga0501235_000528 | |||
| 1517 | Ga0501243_000071 | |||
| 1518 | Ga0501247_000431 | |||
| 1519 | Ga0501252_000336 | |||
| 1520 | Ga0501253_004592 | |||
| 1521 | Ga0501257_001403 | |||
| 1522 | Ga0501257_005312 | |||
| 1523 | Ga0501259_000621 | |||
| 1524 | Ga0501219_000215 | |||
| 1525 | Ga0501221_000830 | |||
| 1526 | Ga0501234_001058 | |||
| 1527 | Ga0501245_000770 | |||
| 1528 | Ga0501079_0025221 | |||
| 1529 | Ga0501081_0193466 | |||
| 1530 | Ga0501083_0018107 | |||
| 1531 | Ga0501241_000299 | |||
| 1532 | Ga0501264_000114 | |||
| 1533 | Ga0501044_0005828 | |||
| 1534 | Ga0501044_0085615 | |||
| 1535 | Ga0501044_0132553 | |||
| 1536 | Ga0501044_0256109 | |||
| 1537 | Ga0501284_00096 | |||
| 1538 | nmdc:mga05p37_18061_c1 | |||
| 1539 | nmdc:mga05p37_18797_c1 | |||
| 1540 | nmdc:mga05p37_201220_c1 | |||
| 1541 | nmdc:mga05p37_485917_c1 | |||
| 1542 | nmdc:mga09592_25098_c1 | |||
| 1543 | nmdc:mga06r32_11835_c1 | |||
| 1544 | nmdc:mga08y16_1505_c1 | |||
| 1545 | nmdc:mga08y16_192153_c1 | |||
| 1546 | nmdc:mga08y16_21207_c1 | |||
| 1547 | Ga0500635_0006413 | |||
| 1548 | Ga0500578_0000315 | |||
| 1549 | Ga0500644_0000032 | |||
| 1550 | Ga0500644_0005850 | |||
| 1551 | Ga0500646_0002064 | |||
| 1552 | Ga0500583_0000017 | |||
| 1553 | Ga0500583_0010310 | |||
| 1554 | Ga0500583_0024518 | |||
| 1555 | Ga0500562_013842 | |||
| 1556 | Ga0500569_000043 | |||
| 1557 | Ga0500607_043850 | |||
| 1558 | Ga0500642_0017763 | |||
| 1559 | Ga0500568_0013027 | |||
| 1560 | Ga0500568_0013112 | |||
| 1561 | Ga0500588_0041403 | |||
| 1562 | Ga0500590_008016 | |||
| 1563 | Ga0500604_0015350 | |||
| 1564 | Ga0500616_0000015 | |||
| 1565 | Ga0500616_0006711 | |||
| 1566 | Ga0500616_0030085 | |||
| 1567 | Ga0500622_0000075 | |||
| 1568 | Ga0500622_0000086 | |||
| 1569 | Ga0500622_0000093 | |||
| 1570 | Ga0500622_0002243 | |||
| 1571 | Ga0500622_0004441 | |||
| 1572 | Ga0500622_0085730 | |||
| 1573 | Ga0500633_0009997 | |||
| 1574 | Ga0500636_0032724 | |||
| 1575 | Ga0500636_0073176 | |||
| 1576 | Ga0501082_0022571 | |||
| 1577 | 2522549510 | |||
| 1578 | 2738730309 | |||
| 1579 | 2819577321 | |||
| 1580 | 2821140624 | |||
| 1581 | 2840678308 | |||
| 1582 | 2852627179 | |||
| 1583 | 2883071236 | |||
| 1584 | 2884791832 | |||
| 1585 | 2884935884 | |||
| 1586 | 2896086125 | |||
| 1587 | 2896115300 | |||
| 1588 | 2904473043 | |||
| 1589 | 2910250785 | |||
| 1590 | 2929178187 | |||
| 1591 | 2929240488 | |||
| 1592 | 2929922331 | |||
| 1593 | 2945980549 | |||
| 1594 | 2946013588 | |||
| 1595 | 8003156680 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ryt-assembly1.cif.gz_A | engineered beta-lactoglobulin: variant m107l | 0.9337 | 366 | 395 |
| 7z9z-assembly1.cif.gz_AAA-2 | mutant l39y of recombinant bovine beta-lactoglobulin in complex with pramocaine | 0.9312 | 366 | 395 |
| 7bvj-assembly4.cif.gz_D | udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) | 0.9009 | 2 | 336 |
| 6nor-assembly1.cif.gz_A | crystal structure of gend2 from gentamicin a biosynthesis in complex with nad | 0.8994 | 2 | 344 |
| 6a3j-assembly1.cif.gz_D | levoglucosan dehydrogenase, complex with nadh and l-sorbose | 0.8908 | 2 | 343 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ezyC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9557 | 3 | 116 | 3.40.50.720 |
| af_Q54H02_2_246_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9528 | 366 | 395 | 3.50.50.60 |
| af_Q04869_4_115_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9481 | 3 | 109 | 3.40.50.720 |
| 3q2kH01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9442 | 3 | 123 | 3.40.50.720 |
| af_B1WBV3_5_113_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9354 | 3 | 113 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X3RDH1-F1-model_v4 | Gfo/Idh/MocA family oxidoreductase | 0.9551 | 1 | 143 |
GO:0000166
|
| AF-A0A536UNG7-F1-model_v4 | Gfo/Idh/MocA family oxidoreductase | 0.9498 | 2 | 116 |
GO:0000166
|
| AF-A0A836SQT7-F1-model_v4 | Gfo/Idh/MocA family oxidoreductase | 0.9451 | 3 | 146 |
GO:0000166
|
| AF-A0A535DBZ8-F1-model_v4 | Gfo/Idh/MocA family oxidoreductase | 0.9434 | 1 | 146 |
GO:0000166
GO:0003824 |
| AF-A0A351MHT5-F1-model_v4 | Dehydrogenase | 0.9433 | 2 | 128 |
GO:0000166
GO:0016491 |