F481276
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 797 | 270 | 797 | 327 |
Family's Representative Sequence
| Representative Sequence | 3300049744|Ga0501083_0172471|Ga0501083_0172471_219_1355 |
| Length | 348 |
| Sequence | MAGRGAAAGETSGFQFLPPLAAEALHGFIVAFIVLNVIIGMVTYVTLLERKFAARMQSRIGPYRVGPHGLLQPIADALKLMMKEDVVPRLADRSVYNLAPIVFLVPCMFIFATLPFAPGLGIADLNIGILFFLAVSAMEVVGLFMGGWGSNNKYALLSAMRAVNQIISYDLPFIFVALVPVLFAGSLRLSDIAAAQGDLWYVAWFPFGTLAFLLYLVATLAAENRVPFDILEAESELVAGFRVEYSGMKFALIQLGEYAHMIGTSFLGALLFLGAWDGPWADASPWWGVLWFLLKAMFVFLLVTWIRWSFVRIRADQILAISWKLLLPASLLLLMATALQVVLTSGNG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 179 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 181 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 182 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 184 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 189 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 194 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 195 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 196 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 197 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 198 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 199 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 200 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 201 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 202 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 203 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 204 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 205 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 206 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 207 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 208 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 209 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 225 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 226 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 228 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 229 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 230 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 249 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 255 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 256 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 257 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 258 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 259 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.76 |
| Nodule | 0 |
| Rhizoplane | 1.13 |
| Rhizosphere | 97.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000120 | 3300003203 | Bacteria | 34396 |
| 2 | JGI25406J46586_10002893 | 3300003203 | Bacteria | 8098 |
| 3 | JGI25406J46586_10011300 | 3300003203 | Bacteria | 3923 |
| 4 | JGI26145J50221_1002098 | 3300003371 | Bacteria | 1567 |
| 5 | Ga0065704_10038053 | 3300005289 | Bacteria | 1109 |
| 6 | Ga0065712_10002361 | 3300005290 | Bacteria | 8212 |
| 7 | Ga0065712_10074863 | 3300005290 | Bacteria | 3992 |
| 8 | Ga0065715_10005733 | 3300005293 | Bacteria | 4040 |
| 9 | Ga0065715_10111155 | 3300005293 | Bacteria | 2586 |
| 10 | Ga0065715_10140436 | 3300005293 | Bacteria | 1862 |
| 11 | Ga0065715_10167217 | 3300005293 | Bacteria | 1576 |
| 12 | Ga0065707_10167099 | 3300005295 | Bacteria | 1514 |
| 13 | Ga0070676_10031221 | 3300005328 | Bacteria | 3044 |
| 14 | Ga0070676_10042099 | 3300005328 | Bacteria | 2650 |
| 15 | Ga0070690_100095889 | 3300005330 | Bacteria | 1960 |
| 16 | Ga0070690_100158211 | 3300005330 | Bacteria | 1550 |
| 17 | Ga0070670_100141714 | 3300005331 | Bacteria | 2079 |
| 18 | Ga0070670_100230156 | 3300005331 | Bacteria | 1613 |
| 19 | Ga0068869_100001496 | 3300005334 | Bacteria | 13845 |
| 20 | Ga0068869_100067405 | 3300005334 | Bacteria | 2640 |
| 21 | Ga0068869_100098310 | 3300005334 | Bacteria | 2211 |
| 22 | Ga0070666_10118073 | 3300005335 | Bacteria | 1838 |
| 23 | Ga0070680_100150746 | 3300005336 | Bacteria | 1952 |
| 24 | Ga0070682_100001865 | 3300005337 | Bacteria | 11757 |
| 25 | Ga0068868_100258448 | 3300005338 | Bacteria | 1468 |
| 26 | Ga0068868_100371607 | 3300005338 | Bacteria | 1229 |
| 27 | Ga0070660_100041666 | 3300005339 | Bacteria | 3500 |
| 28 | Ga0070689_100012412 | 3300005340 | Bacteria | 6137 |
| 29 | Ga0070689_100071487 | 3300005340 | Bacteria | 2711 |
| 30 | Ga0070689_100086855 | 3300005340 | Bacteria | 2460 |
| 31 | Ga0070691_10010154 | 3300005341 | Bacteria | 4294 |
| 32 | Ga0070691_10064022 | 3300005341 | Archaea | 1774 |
| 33 | Ga0070687_100015745 | 3300005343 | Bacteria | 3427 |
| 34 | Ga0070661_100000211 | 3300005344 | Bacteria | 48345 |
| 35 | Ga0070661_100022972 | 3300005344 | Bacteria | 4467 |
| 36 | Ga0070692_10001897 | 3300005345 | Bacteria | 7888 |
| 37 | Ga0070692_10006625 | 3300005345 | Bacteria | 5041 |
| 38 | Ga0070668_100044110 | 3300005347 | Bacteria | 3420 |
| 39 | Ga0070668_100049143 | 3300005347 | Bacteria | 3246 |
| 40 | Ga0070669_100012365 | 3300005353 | Bacteria | 6055 |
| 41 | Ga0070669_100017022 | 3300005353 | Bacteria | 5189 |
| 42 | Ga0070669_100031693 | 3300005353 | Bacteria | 3818 |
| 43 | Ga0070669_100066040 | 3300005353 | Bacteria | 2666 |
| 44 | Ga0070669_100281838 | 3300005353 | Bacteria | 1332 |
| 45 | Ga0070675_100003563 | 3300005354 | Bacteria | 11830 |
| 46 | Ga0070675_100011263 | 3300005354 | Bacteria | 7003 |
| 47 | Ga0070675_100016428 | 3300005354 | Bacteria | 5874 |
| 48 | Ga0070675_100367506 | 3300005354 | Bacteria | 1278 |
| 49 | Ga0070671_100044691 | 3300005355 | Bacteria | 3681 |
| 50 | Ga0070674_100003802 | 3300005356 | Bacteria | 8533 |
| 51 | Ga0070674_100149697 | 3300005356 | Bacteria | 1760 |
| 52 | Ga0070673_100005375 | 3300005364 | Bacteria | 8187 |
| 53 | Ga0070673_100079075 | 3300005364 | Bacteria | 2661 |
| 54 | Ga0070673_100095474 | 3300005364 | Bacteria | 2439 |
| 55 | Ga0070673_100241757 | 3300005364 | Bacteria | 1570 |
| 56 | Ga0070688_100025693 | 3300005365 | Bacteria | 3490 |
| 57 | Ga0070688_100348487 | 3300005365 | Bacteria | 1084 |
| 58 | Ga0070659_100001505 | 3300005366 | Bacteria | 16800 |
| 59 | Ga0070667_100034478 | 3300005367 | Bacteria | 4234 |
| 60 | Ga0070703_10000869 | 3300005406 | Bacteria | 9735 |
| 61 | Ga0070703_10006171 | 3300005406 | Bacteria | 3354 |
| 62 | Ga0070709_10086217 | 3300005434 | Unclassified | 2061 |
| 63 | Ga0070713_100171471 | 3300005436 | Bacteria | 1944 |
| 64 | Ga0070701_10017788 | 3300005438 | Bacteria | 3329 |
| 65 | Ga0070701_10033362 | 3300005438 | Bacteria | 2571 |
| 66 | Ga0070701_10084542 | 3300005438 | Bacteria | 1726 |
| 67 | Ga0070701_10087067 | 3300005438 | Bacteria | 1703 |
| 68 | Ga0070705_100001862 | 3300005440 | Bacteria | 10869 |
| 69 | Ga0070705_100005391 | 3300005440 | Bacteria | 6231 |
| 70 | Ga0070700_100028458 | 3300005441 | Bacteria | 3324 |
| 71 | Ga0070700_100075377 | 3300005441 | Bacteria | 2163 |
| 72 | Ga0070700_100199078 | 3300005441 | Bacteria | 1406 |
| 73 | Ga0070694_100003319 | 3300005444 | Bacteria | 9628 |
| 74 | Ga0070694_100006222 | 3300005444 | Bacteria | 7245 |
| 75 | Ga0070694_100019776 | 3300005444 | Bacteria | 4285 |
| 76 | Ga0070694_100047868 | 3300005444 | Bacteria | 2874 |
| 77 | Ga0070694_100059864 | 3300005444 | Bacteria | 2596 |
| 78 | Ga0070694_100348263 | 3300005444 | Bacteria | 1147 |
| 79 | Ga0070708_100018713 | 3300005445 | Bacteria | 5798 |
| 80 | Ga0070708_100042179 | 3300005445 | Bacteria | 4004 |
| 81 | Ga0070708_100086704 | 3300005445 | Bacteria | 2844 |
| 82 | Ga0070708_100108614 | 3300005445 | Bacteria | 2548 |
| 83 | Ga0070708_100187462 | 3300005445 | Bacteria | 1935 |
| 84 | Ga0070708_100350872 | 3300005445 | Bacteria | 1390 |
| 85 | Ga0070708_100353277 | 3300005445 | Unclassified | 1385 |
| 86 | Ga0070662_100006443 | 3300005457 | Bacteria | 7565 |
| 87 | Ga0070681_10050601 | 3300005458 | Bacteria | 4145 |
| 88 | Ga0070681_10070007 | 3300005458 | Bacteria | 3474 |
| 89 | Ga0068867_100006675 | 3300005459 | Bacteria | 8159 |
| 90 | Ga0068867_100038646 | 3300005459 | Bacteria | 3475 |
| 91 | Ga0068867_100084518 | 3300005459 | Bacteria | 2398 |
| 92 | Ga0068867_100092963 | 3300005459 | Bacteria | 2291 |
| 93 | Ga0070685_10045159 | 3300005466 | Bacteria | 2525 |
| 94 | Ga0070706_100003928 | 3300005467 | Bacteria | 14483 |
| 95 | Ga0070706_100008450 | 3300005467 | Bacteria | 9590 |
| 96 | Ga0070706_100044134 | 3300005467 | Bacteria | 4119 |
| 97 | Ga0070706_100217518 | 3300005467 | Bacteria | 1783 |
| 98 | Ga0070706_100307535 | 3300005467 | Bacteria | 1479 |
| 99 | Ga0070706_100341892 | 3300005467 | Bacteria | 1395 |
| 100 | Ga0070706_100384660 | 3300005467 | Bacteria | 1307 |
| 101 | Ga0070707_100000729 | 3300005468 | Bacteria | 32778 |
| 102 | Ga0070707_100045468 | 3300005468 | Bacteria | 4202 |
| 103 | Ga0070707_100055001 | 3300005468 | Bacteria | 3815 |
| 104 | Ga0070707_100151982 | 3300005468 | Bacteria | 2254 |
| 105 | Ga0070707_100268116 | 3300005468 | Bacteria | 1660 |
| 106 | Ga0070707_100466614 | 3300005468 | Bacteria | 1224 |
| 107 | Ga0070698_100004426 | 3300005471 | Bacteria | 15440 |
| 108 | Ga0070698_100007713 | 3300005471 | Bacteria | 11640 |
| 109 | Ga0070698_100010269 | 3300005471 | Bacteria | 10002 |
| 110 | Ga0070698_100016413 | 3300005471 | Bacteria | 7815 |
| 111 | Ga0070698_100336207 | 3300005471 | Bacteria | 1442 |
| 112 | Ga0070699_100000534 | 3300005518 | Bacteria | 36008 |
| 113 | Ga0070699_100000712 | 3300005518 | Bacteria | 30836 |
| 114 | Ga0070699_100003941 | 3300005518 | Bacteria | 13112 |
| 115 | Ga0070699_100008025 | 3300005518 | Bacteria | 9167 |
| 116 | Ga0070699_100020623 | 3300005518 | Bacteria | 5686 |
| 117 | Ga0070699_100023130 | 3300005518 | Bacteria | 5354 |
| 118 | Ga0070699_100080194 | 3300005518 | Bacteria | 2844 |
| 119 | Ga0070699_100178574 | 3300005518 | Bacteria | 1883 |
| 120 | Ga0070699_100234239 | 3300005518 | Bacteria | 1638 |
| 121 | Ga0070679_100008274 | 3300005530 | Bacteria | 9785 |
| 122 | Ga0070679_100459017 | 3300005530 | Bacteria | 1218 |
| 123 | Ga0070684_100063817 | 3300005535 | Bacteria | 3230 |
| 124 | Ga0070697_100001086 | 3300005536 | Bacteria | 20540 |
| 125 | Ga0070697_100008644 | 3300005536 | Bacteria | 7953 |
| 126 | Ga0070697_100017546 | 3300005536 | Bacteria | 5633 |
| 127 | Ga0070697_100047520 | 3300005536 | Bacteria | 3479 |
| 128 | Ga0070697_100048568 | 3300005536 | Bacteria | 3441 |
| 129 | Ga0070697_100059571 | 3300005536 | Bacteria | 3109 |
| 130 | Ga0070697_100099340 | 3300005536 | Bacteria | 2416 |
| 131 | Ga0070697_100139723 | 3300005536 | Bacteria | 2036 |
| 132 | Ga0070697_100258750 | 3300005536 | Bacteria | 1490 |
| 133 | Ga0070697_100341224 | 3300005536 | Bacteria | 1293 |
| 134 | Ga0068853_100000678 | 3300005539 | Bacteria | 23432 |
| 135 | Ga0070672_100035906 | 3300005543 | Bacteria | 3771 |
| 136 | Ga0070672_100049360 | 3300005543 | Bacteria | 3274 |
| 137 | Ga0070672_100050220 | 3300005543 | Bacteria | 3248 |
| 138 | Ga0070672_100084620 | 3300005543 | Bacteria | 2547 |
| 139 | Ga0070695_100000112 | 3300005545 | Bacteria | 36134 |
| 140 | Ga0070695_100002498 | 3300005545 | Bacteria | 10593 |
| 141 | Ga0070695_100004358 | 3300005545 | Bacteria | 8296 |
| 142 | Ga0070695_100010416 | 3300005545 | Bacteria | 5551 |
| 143 | Ga0070695_100021438 | 3300005545 | Bacteria | 3954 |
| 144 | Ga0070695_100069125 | 3300005545 | Bacteria | 2307 |
| 145 | Ga0070695_100337880 | 3300005545 | Bacteria | 1125 |
| 146 | Ga0070696_100004871 | 3300005546 | Bacteria | 8970 |
| 147 | Ga0070696_100011986 | 3300005546 | Bacteria | 5809 |
| 148 | Ga0070696_100018685 | 3300005546 | Bacteria | 4689 |
| 149 | Ga0070696_100247991 | 3300005546 | Bacteria | 1345 |
| 150 | Ga0070693_100000189 | 3300005547 | Bacteria | 28531 |
| 151 | Ga0070704_100001133 | 3300005549 | Bacteria | 13909 |
| 152 | Ga0070704_100002373 | 3300005549 | Bacteria | 10560 |
| 153 | Ga0070704_100014720 | 3300005549 | Bacteria | 4892 |
| 154 | Ga0070704_100028727 | 3300005549 | Bacteria | 3703 |
| 155 | Ga0070704_100043338 | 3300005549 | Bacteria | 3119 |
| 156 | Ga0070704_100069188 | 3300005549 | Bacteria | 2556 |
| 157 | Ga0070704_100100306 | 3300005549 | Bacteria | 2179 |
| 158 | Ga0070704_100118148 | 3300005549 | Bacteria | 2031 |
| 159 | Ga0068855_100015855 | 3300005563 | Bacteria | 9066 |
| 160 | Ga0070664_100006711 | 3300005564 | Bacteria | 9281 |
| 161 | Ga0070664_100015438 | 3300005564 | Bacteria | 6248 |
| 162 | Ga0070664_100148196 | 3300005564 | Bacteria | 2071 |
| 163 | Ga0070664_100230313 | 3300005564 | Unclassified | 1661 |
| 164 | Ga0068857_100008027 | 3300005577 | Bacteria | 9103 |
| 165 | Ga0068857_100085674 | 3300005577 | Bacteria | 2816 |
| 166 | Ga0068854_100002061 | 3300005578 | Bacteria | 12321 |
| 167 | Ga0068856_100008288 | 3300005614 | Bacteria | 10131 |
| 168 | Ga0068859_100008805 | 3300005617 | Bacteria | 10189 |
| 169 | Ga0068859_100046788 | 3300005617 | Bacteria | 4344 |
| 170 | Ga0068859_100065876 | 3300005617 | Bacteria | 3656 |
| 171 | Ga0068859_100102459 | 3300005617 | Bacteria | 2920 |
| 172 | Ga0068864_100021673 | 3300005618 | Bacteria | 5381 |
| 173 | Ga0068864_100037064 | 3300005618 | Bacteria | 4160 |
| 174 | Ga0068864_100061059 | 3300005618 | Bacteria | 3265 |
| 175 | Ga0068864_100061602 | 3300005618 | Bacteria | 3250 |
| 176 | Ga0068864_100170777 | 3300005618 | Bacteria | 1982 |
| 177 | Ga0068861_100005274 | 3300005719 | Bacteria | 8718 |
| 178 | Ga0068870_10010546 | 3300005840 | Bacteria | 4251 |
| 179 | Ga0068870_10010760 | 3300005840 | Bacteria | 4213 |
| 180 | Ga0068870_10092137 | 3300005840 | Bacteria | 1697 |
| 181 | Ga0068863_100005815 | 3300005841 | Bacteria | 12091 |
| 182 | Ga0068860_100027366 | 3300005843 | Bacteria | 5493 |
| 183 | Ga0068860_100083585 | 3300005843 | Bacteria | 3037 |
| 184 | Ga0068860_100116171 | 3300005843 | Bacteria | 2560 |
| 185 | Ga0068862_100015431 | 3300005844 | Bacteria | 6345 |
| 186 | Ga0068862_100026860 | 3300005844 | Bacteria | 4842 |
| 187 | Ga0068862_100039181 | 3300005844 | Bacteria | 4023 |
| 188 | Ga0068862_100095598 | 3300005844 | Bacteria | 2592 |
| 189 | Ga0068862_100209034 | 3300005844 | Bacteria | 1763 |
| 190 | Ga0068862_100258870 | 3300005844 | Bacteria | 1588 |
| 191 | Ga0081455_10000868 | 3300005937 | Bacteria | 39013 |
| 192 | Ga0081455_10064100 | 3300005937 | Bacteria | 3079 |
| 193 | Ga0081455_10189990 | 3300005937 | Bacteria | 1547 |
| 194 | Ga0081455_10293574 | 3300005937 | Bacteria | 1169 |
| 195 | Ga0081538_10003260 | 3300005981 | Bacteria | 15419 |
| 196 | Ga0081540_1019869 | 3300005983 | Bacteria | 4064 |
| 197 | Ga0081539_10000024 | 3300005985 | Bacteria | 354702 |
| 198 | Ga0081539_10000096 | 3300005985 | Bacteria | 204059 |
| 199 | Ga0081539_10000454 | 3300005985 | Bacteria | 87230 |
| 200 | Ga0081539_10002353 | 3300005985 | Bacteria | 27164 |
| 201 | Ga0075364_10078395 | 3300006051 | Bacteria | 2182 |
| 202 | Ga0075364_10234277 | 3300006051 | Bacteria | 1247 |
| 203 | Ga0070716_100035251 | 3300006173 | Bacteria | 2750 |
| 204 | Ga0075362_10000233 | 3300006177 | Bacteria | 15482 |
| 205 | Ga0075367_10140955 | 3300006178 | Bacteria | 1493 |
| 206 | Ga0075366_10068828 | 3300006195 | Bacteria | 2106 |
| 207 | Ga0097621_100159219 | 3300006237 | Bacteria | 1940 |
| 208 | Ga0075370_10042581 | 3300006353 | Bacteria | 2565 |
| 209 | Ga0068871_100116393 | 3300006358 | Bacteria | 2253 |
| 210 | Ga0075428_100001697 | 3300006844 | Bacteria | 23501 |
| 211 | Ga0075428_100003167 | 3300006844 | Bacteria | 17983 |
| 212 | Ga0075428_100004648 | 3300006844 | Bacteria | 15196 |
| 213 | Ga0075428_100004968 | 3300006844 | Bacteria | 14767 |
| 214 | Ga0075428_100006929 | 3300006844 | Bacteria | 12586 |
| 215 | Ga0075428_100012979 | 3300006844 | Bacteria | 9264 |
| 216 | Ga0075428_100036865 | 3300006844 | Bacteria | 5385 |
| 217 | Ga0075428_100119768 | 3300006844 | Unclassified | 2865 |
| 218 | Ga0075428_100123681 | 3300006844 | Bacteria | 2816 |
| 219 | Ga0075428_100131095 | 3300006844 | Bacteria | 2727 |
| 220 | Ga0075428_100151261 | 3300006844 | Bacteria | 2521 |
| 221 | Ga0075428_100172830 | 3300006844 | Bacteria | 2341 |
| 222 | Ga0075430_100000397 | 3300006846 | Bacteria | 32197 |
| 223 | Ga0075430_100003492 | 3300006846 | Bacteria | 13154 |
| 224 | Ga0075430_100004097 | 3300006846 | Bacteria | 12298 |
| 225 | Ga0075430_100007192 | 3300006846 | Bacteria | 9388 |
| 226 | Ga0075430_100016784 | 3300006846 | Bacteria | 6235 |
| 227 | Ga0075430_100028925 | 3300006846 | Bacteria | 4705 |
| 228 | Ga0075430_100029617 | 3300006846 | Bacteria | 4646 |
| 229 | Ga0075430_100032620 | 3300006846 | Bacteria | 4421 |
| 230 | Ga0075430_100315334 | 3300006846 | Bacteria | 1293 |
| 231 | Ga0075431_100000082 | 3300006847 | Bacteria | 56660 |
| 232 | Ga0075431_100000455 | 3300006847 | Bacteria | 33646 |
| 233 | Ga0075431_100000486 | 3300006847 | Bacteria | 32971 |
| 234 | Ga0075431_100001270 | 3300006847 | Bacteria | 22987 |
| 235 | Ga0075431_100001687 | 3300006847 | Bacteria | 20728 |
| 236 | Ga0075431_100001936 | 3300006847 | Bacteria | 19722 |
| 237 | Ga0075431_100046856 | 3300006847 | Bacteria | 4458 |
| 238 | Ga0075431_100052800 | 3300006847 | Bacteria | 4191 |
| 239 | Ga0075431_100227399 | 3300006847 | Bacteria | 1902 |
| 240 | Ga0075431_100263248 | 3300006847 | Bacteria | 1749 |
| 241 | Ga0075431_100294273 | 3300006847 | Bacteria | 1641 |
| 242 | Ga0075431_100433937 | 3300006847 | Bacteria | 1311 |
| 243 | Ga0075433_10000061 | 3300006852 | Bacteria | 47469 |
| 244 | Ga0075433_10000427 | 3300006852 | Bacteria | 27010 |
| 245 | Ga0075433_10000839 | 3300006852 | Bacteria | 21522 |
| 246 | Ga0075433_10002893 | 3300006852 | Bacteria | 13158 |
| 247 | Ga0075433_10005550 | 3300006852 | Bacteria | 9906 |
| 248 | Ga0075433_10006319 | 3300006852 | Bacteria | 9359 |
| 249 | Ga0075433_10059591 | 3300006852 | Bacteria | 3340 |
| 250 | Ga0075433_10079409 | 3300006852 | Bacteria | 2891 |
| 251 | Ga0075433_10098119 | 3300006852 | Bacteria | 2593 |
| 252 | Ga0075433_10108639 | 3300006852 | Bacteria | 2460 |
| 253 | Ga0075433_10163292 | 3300006852 | Bacteria | 1982 |
| 254 | Ga0075433_10181580 | 3300006852 | Bacteria | 1872 |
| 255 | Ga0075433_10189199 | 3300006852 | Bacteria | 1831 |
| 256 | Ga0075434_100000180 | 3300006871 | Bacteria | 41040 |
| 257 | Ga0075434_100001347 | 3300006871 | Bacteria | 20612 |
| 258 | Ga0075434_100008511 | 3300006871 | Bacteria | 9541 |
| 259 | Ga0075434_100017104 | 3300006871 | Bacteria | 6979 |
| 260 | Ga0075434_100023521 | 3300006871 | Bacteria | 6006 |
| 261 | Ga0075434_100062153 | 3300006871 | Bacteria | 3717 |
| 262 | Ga0075434_100073024 | 3300006871 | Bacteria | 3423 |
| 263 | Ga0075434_100085881 | 3300006871 | Bacteria | 3146 |
| 264 | Ga0075434_100094218 | 3300006871 | Bacteria | 2999 |
| 265 | Ga0075434_100119131 | 3300006871 | Unclassified | 2654 |
| 266 | Ga0075434_100239016 | 3300006871 | Bacteria | 1836 |
| 267 | Ga0075434_100257076 | 3300006871 | Bacteria | 1765 |
| 268 | Ga0075434_100306626 | 3300006871 | Bacteria | 1608 |
| 269 | Ga0075434_100348706 | 3300006871 | Bacteria | 1501 |
| 270 | Ga0075429_100000023 | 3300006880 | Bacteria | 68064 |
| 271 | Ga0075429_100002106 | 3300006880 | Bacteria | 16613 |
| 272 | Ga0075429_100002213 | 3300006880 | Bacteria | 16272 |
| 273 | Ga0075429_100002798 | 3300006880 | Bacteria | 14762 |
| 274 | Ga0075429_100002856 | 3300006880 | Bacteria | 14619 |
| 275 | Ga0075429_100014281 | 3300006880 | Bacteria | 6888 |
| 276 | Ga0075429_100015287 | 3300006880 | Bacteria | 6652 |
| 277 | Ga0075429_100022792 | 3300006880 | Bacteria | 5429 |
| 278 | Ga0075429_100023887 | 3300006880 | Bacteria | 5305 |
| 279 | Ga0075429_100063338 | 3300006880 | Bacteria | 3222 |
| 280 | Ga0075429_100064236 | 3300006880 | Bacteria | 3197 |
| 281 | Ga0075429_100143036 | 3300006880 | Bacteria | 2094 |
| 282 | Ga0075429_100185672 | 3300006880 | Bacteria | 1822 |
| 283 | Ga0068865_100283138 | 3300006881 | Bacteria | 1320 |
| 284 | Ga0075436_100002146 | 3300006914 | Bacteria | 13600 |
| 285 | Ga0075436_100105572 | 3300006914 | Bacteria | 1964 |
| 286 | Ga0075436_100115230 | 3300006914 | Bacteria | 1877 |
| 287 | Ga0097620_100008805 | 3300006931 | Bacteria | 10189 |
| 288 | Ga0097620_100046795 | 3300006931 | Bacteria | 4344 |
| 289 | Ga0097620_100065876 | 3300006931 | Bacteria | 3656 |
| 290 | Ga0097620_100102452 | 3300006931 | Bacteria | 2920 |
| 291 | Ga0075435_100017542 | 3300007076 | Bacteria | 5422 |
| 292 | Ga0075435_100051710 | 3300007076 | Bacteria | 3309 |
| 293 | Ga0075435_100063505 | 3300007076 | Bacteria | 2999 |
| 294 | Ga0075435_100099992 | 3300007076 | Bacteria | 2402 |
| 295 | Ga0075435_100128697 | 3300007076 | Bacteria | 2118 |
| 296 | Ga0075435_100191860 | 3300007076 | Bacteria | 1730 |
| 297 | Ga0075435_100195556 | 3300007076 | Bacteria | 1713 |
| 298 | Ga0075435_100243540 | 3300007076 | Bacteria | 1530 |
| 299 | Ga0075435_100250181 | 3300007076 | Bacteria | 1509 |
| 300 | Ga0075435_100291843 | 3300007076 | Bacteria | 1394 |
| 301 | Ga0099794_10004256 | 3300007265 | Bacteria | 5592 |
| 302 | Ga0099794_10130628 | 3300007265 | Bacteria | 1268 |
| 303 | Ga0105240_10155950 | 3300009093 | Bacteria | 2715 |
| 304 | Ga0111539_10000463 | 3300009094 | Bacteria | 51027 |
| 305 | Ga0111539_10001292 | 3300009094 | Bacteria | 33417 |
| 306 | Ga0111539_10001353 | 3300009094 | Bacteria | 32630 |
| 307 | Ga0111539_10001789 | 3300009094 | Bacteria | 28570 |
| 308 | Ga0111539_10002439 | 3300009094 | Bacteria | 24735 |
| 309 | Ga0111539_10006594 | 3300009094 | Bacteria | 14961 |
| 310 | Ga0111539_10012644 | 3300009094 | Bacteria | 10575 |
| 311 | Ga0111539_10024427 | 3300009094 | Bacteria | 7415 |
| 312 | Ga0111539_10114103 | 3300009094 | Bacteria | 3169 |
| 313 | Ga0111539_10135636 | 3300009094 | Bacteria | 2882 |
| 314 | Ga0111539_10250103 | 3300009094 | Bacteria | 2064 |
| 315 | Ga0111539_10505433 | 3300009094 | Bacteria | 1408 |
| 316 | Ga0105245_10290132 | 3300009098 | Bacteria | 1602 |
| 317 | Ga0114129_10000110 | 3300009147 | Bacteria | 81178 |
| 318 | Ga0114129_10000936 | 3300009147 | Bacteria | 38136 |
| 319 | Ga0114129_10001511 | 3300009147 | Bacteria | 31462 |
| 320 | Ga0114129_10002179 | 3300009147 | Bacteria | 26947 |
| 321 | Ga0114129_10003221 | 3300009147 | Bacteria | 22900 |
| 322 | Ga0114129_10013658 | 3300009147 | Bacteria | 11571 |
| 323 | Ga0114129_10020399 | 3300009147 | Bacteria | 9427 |
| 324 | Ga0114129_10044379 | 3300009147 | Bacteria | 6253 |
| 325 | Ga0114129_10082854 | 3300009147 | Bacteria | 4456 |
| 326 | Ga0114129_10094435 | 3300009147 | Bacteria | 4142 |
| 327 | Ga0114129_10115315 | 3300009147 | Bacteria | 3703 |
| 328 | Ga0114129_10408947 | 3300009147 | Bacteria | 1787 |
| 329 | Ga0114129_10452572 | 3300009147 | Bacteria | 1683 |
| 330 | Ga0114129_10574916 | 3300009147 | Bacteria | 1463 |
| 331 | Ga0114129_10634510 | 3300009147 | Unclassified | 1380 |
| 332 | Ga0105243_10016133 | 3300009148 | Bacteria | 5650 |
| 333 | Ga0105241_10001410 | 3300009174 | Bacteria | 18406 |
| 334 | Ga0105241_10041676 | 3300009174 | Bacteria | 3470 |
| 335 | Ga0105242_10140483 | 3300009176 | Bacteria | 2095 |
| 336 | Ga0105242_10572532 | 3300009176 | Bacteria | 1086 |
| 337 | Ga0105248_10025004 | 3300009177 | Bacteria | 6638 |
| 338 | Ga0105248_10194352 | 3300009177 | Bacteria | 2286 |
| 339 | Ga0105249_10008153 | 3300009553 | Bacteria | 9132 |
| 340 | Ga0105249_10608300 | 3300009553 | Bacteria | 1148 |
| 341 | Ga0105246_10047160 | 3300011119 | Bacteria | 2941 |
| 342 | Ga0105246_10337788 | 3300011119 | Bacteria | 1230 |
| 343 | Ga0157373_10015786 | 3300013100 | Bacteria | 5513 |
| 344 | Ga0157369_10017116 | 3300013105 | Bacteria | 8146 |
| 345 | Ga0157374_10233961 | 3300013296 | Bacteria | 1805 |
| 346 | Ga0157378_10060912 | 3300013297 | Bacteria | 3367 |
| 347 | Ga0157378_10227955 | 3300013297 | Bacteria | 1774 |
| 348 | Ga0157378_10263164 | 3300013297 | Bacteria | 1656 |
| 349 | Ga0163162_10055861 | 3300013306 | Bacteria | 3976 |
| 350 | Ga0163162_10103890 | 3300013306 | Bacteria | 2935 |
| 351 | Ga0163162_10244221 | 3300013306 | Bacteria | 1927 |
| 352 | Ga0157372_10008010 | 3300013307 | Bacteria | 11239 |
| 353 | Ga0157372_10074909 | 3300013307 | Bacteria | 3818 |
| 354 | Ga0157375_10010834 | 3300013308 | Bacteria | 8033 |
| 355 | Ga0157375_10049527 | 3300013308 | Bacteria | 4117 |
| 356 | Ga0157375_10120206 | 3300013308 | Bacteria | 2735 |
| 357 | Ga0157375_10137022 | 3300013308 | Bacteria | 2573 |
| 358 | Ga0163163_10065916 | 3300014325 | Bacteria | 3596 |
| 359 | Ga0163163_10108966 | 3300014325 | Bacteria | 2797 |
| 360 | Ga0157380_10003226 | 3300014326 | Bacteria | 11146 |
| 361 | Ga0157380_10056782 | 3300014326 | Bacteria | 3115 |
| 362 | Ga0157380_10148047 | 3300014326 | Bacteria | 2026 |
| 363 | Ga0157380_10209430 | 3300014326 | Bacteria | 1736 |
| 364 | Ga0157380_10443177 | 3300014326 | Bacteria | 1245 |
| 365 | Ga0157380_10546340 | 3300014326 | Bacteria | 1135 |
| 366 | Ga0157377_10043870 | 3300014745 | Bacteria | 2491 |
| 367 | Ga0157376_10140371 | 3300014969 | Bacteria | 2167 |
| 368 | Ga0207697_10001435 | 3300025315 | Bacteria | 13051 |
| 369 | Ga0207697_10109091 | 3300025315 | Bacteria | 1184 |
| 370 | Ga0207682_10003116 | 3300025893 | Bacteria | 7262 |
| 371 | Ga0207682_10110490 | 3300025893 | Bacteria | 1210 |
| 372 | Ga0207642_10093556 | 3300025899 | Bacteria | 1491 |
| 373 | Ga0207688_10001607 | 3300025901 | Bacteria | 11929 |
| 374 | Ga0207680_10023261 | 3300025903 | Bacteria | 3381 |
| 375 | Ga0207680_10106097 | 3300025903 | Bacteria | 1813 |
| 376 | Ga0207699_10042288 | 3300025906 | Bacteria | 2639 |
| 377 | Ga0207645_10000400 | 3300025907 | Bacteria | 35898 |
| 378 | Ga0207645_10231354 | 3300025907 | Bacteria | 1220 |
| 379 | Ga0207643_10000424 | 3300025908 | Bacteria | 27864 |
| 380 | Ga0207643_10012764 | 3300025908 | Bacteria | 4542 |
| 381 | Ga0207643_10016950 | 3300025908 | Bacteria | 3976 |
| 382 | Ga0207684_10000279 | 3300025910 | Bacteria | 74399 |
| 383 | Ga0207684_10084506 | 3300025910 | Bacteria | 2703 |
| 384 | Ga0207684_10237013 | 3300025910 | Bacteria | 1574 |
| 385 | Ga0207654_10002440 | 3300025911 | Bacteria | 9494 |
| 386 | Ga0207654_10058214 | 3300025911 | Bacteria | 2249 |
| 387 | Ga0207707_10000116 | 3300025912 | Bacteria | 81364 |
| 388 | Ga0207707_10053512 | 3300025912 | Bacteria | 3514 |
| 389 | Ga0207707_10350312 | 3300025912 | Bacteria | 1272 |
| 390 | Ga0207695_10205833 | 3300025913 | Bacteria | 1880 |
| 391 | Ga0207660_10003214 | 3300025917 | Bacteria | 10691 |
| 392 | Ga0207660_10332841 | 3300025917 | Bacteria | 1214 |
| 393 | Ga0207657_10000211 | 3300025919 | Bacteria | 60392 |
| 394 | Ga0207649_10009637 | 3300025920 | Bacteria | 5288 |
| 395 | Ga0207649_10041050 | 3300025920 | Bacteria | 2815 |
| 396 | Ga0207652_10003841 | 3300025921 | Bacteria | 12319 |
| 397 | Ga0207646_10001682 | 3300025922 | Bacteria | 26908 |
| 398 | Ga0207646_10023879 | 3300025922 | Bacteria | 5610 |
| 399 | Ga0207646_10039239 | 3300025922 | Bacteria | 4262 |
| 400 | Ga0207646_10063999 | 3300025922 | Bacteria | 3283 |
| 401 | Ga0207646_10203811 | 3300025922 | Bacteria | 1787 |
| 402 | Ga0207681_10004865 | 3300025923 | Bacteria | 8251 |
| 403 | Ga0207681_10008334 | 3300025923 | Bacteria | 6339 |
| 404 | Ga0207681_10070635 | 3300025923 | Unclassified | 2432 |
| 405 | Ga0207650_10147568 | 3300025925 | Bacteria | 1854 |
| 406 | Ga0207659_10003928 | 3300025926 | Bacteria | 8970 |
| 407 | Ga0207659_10004886 | 3300025926 | Bacteria | 8120 |
| 408 | Ga0207659_10010902 | 3300025926 | Bacteria | 5724 |
| 409 | Ga0207659_10051272 | 3300025926 | Bacteria | 2934 |
| 410 | Ga0207659_10203005 | 3300025926 | Bacteria | 1584 |
| 411 | Ga0207700_10089034 | 3300025928 | Bacteria | 2432 |
| 412 | Ga0207644_10087713 | 3300025931 | Bacteria | 2313 |
| 413 | Ga0207644_10237830 | 3300025931 | Bacteria | 1449 |
| 414 | Ga0207690_10001495 | 3300025932 | Bacteria | 14606 |
| 415 | Ga0207690_10099442 | 3300025932 | Bacteria | 2074 |
| 416 | Ga0207706_10108186 | 3300025933 | Bacteria | 2447 |
| 417 | Ga0207706_10350364 | 3300025933 | Bacteria | 1284 |
| 418 | Ga0207670_10024764 | 3300025936 | Bacteria | 3756 |
| 419 | Ga0207670_10090053 | 3300025936 | Bacteria | 2166 |
| 420 | Ga0207670_10336500 | 3300025936 | Bacteria | 1192 |
| 421 | Ga0207669_10005017 | 3300025937 | Bacteria | 5887 |
| 422 | Ga0207704_10144317 | 3300025938 | Bacteria | 1670 |
| 423 | Ga0207691_10009557 | 3300025940 | Bacteria | 9307 |
| 424 | Ga0207691_10010524 | 3300025940 | Bacteria | 8877 |
| 425 | Ga0207691_10035245 | 3300025940 | Bacteria | 4647 |
| 426 | Ga0207691_10041123 | 3300025940 | Bacteria | 4270 |
| 427 | Ga0207691_10071198 | 3300025940 | Bacteria | 3138 |
| 428 | Ga0207691_10170382 | 3300025940 | Bacteria | 1907 |
| 429 | Ga0207689_10000201 | 3300025942 | Bacteria | 52554 |
| 430 | Ga0207689_10006142 | 3300025942 | Bacteria | 10632 |
| 431 | Ga0207689_10044373 | 3300025942 | Bacteria | 3676 |
| 432 | Ga0207689_10044581 | 3300025942 | Bacteria | 3667 |
| 433 | Ga0207689_10046149 | 3300025942 | Bacteria | 3602 |
| 434 | Ga0207689_10091644 | 3300025942 | Bacteria | 2497 |
| 435 | Ga0207661_10031415 | 3300025944 | Bacteria | 4102 |
| 436 | Ga0207679_10000634 | 3300025945 | Bacteria | 23441 |
| 437 | Ga0207679_10010677 | 3300025945 | Bacteria | 5920 |
| 438 | Ga0207679_10066350 | 3300025945 | Bacteria | 2704 |
| 439 | Ga0207679_10205329 | 3300025945 | Unclassified | 1649 |
| 440 | Ga0207667_10000342 | 3300025949 | Bacteria | 63745 |
| 441 | Ga0207651_10007460 | 3300025960 | Bacteria | 5828 |
| 442 | Ga0207651_10030607 | 3300025960 | Bacteria | 3430 |
| 443 | Ga0207651_10051815 | 3300025960 | Bacteria | 2795 |
| 444 | Ga0207651_10052884 | 3300025960 | Bacteria | 2772 |
| 445 | Ga0207651_10061269 | 3300025960 | Bacteria | 2616 |
| 446 | Ga0207651_10286852 | 3300025960 | Bacteria | 1363 |
| 447 | Ga0207651_10301674 | 3300025960 | Unclassified | 1332 |
| 448 | Ga0207712_10061924 | 3300025961 | Bacteria | 2658 |
| 449 | Ga0207712_10063532 | 3300025961 | Bacteria | 2629 |
| 450 | Ga0207668_10016771 | 3300025972 | Bacteria | 4579 |
| 451 | Ga0207668_10086619 | 3300025972 | Bacteria | 2289 |
| 452 | Ga0207640_10010071 | 3300025981 | Bacteria | 5313 |
| 453 | Ga0207677_10145337 | 3300026023 | Bacteria | 1821 |
| 454 | Ga0207677_10224460 | 3300026023 | Bacteria | 1509 |
| 455 | Ga0207703_10029241 | 3300026035 | Bacteria | 4347 |
| 456 | Ga0207639_10004331 | 3300026041 | Bacteria | 9569 |
| 457 | Ga0207708_10012722 | 3300026075 | Bacteria | 6275 |
| 458 | Ga0207708_10170215 | 3300026075 | Bacteria | 1725 |
| 459 | Ga0207702_10001143 | 3300026078 | Bacteria | 27129 |
| 460 | Ga0207641_10034038 | 3300026088 | Bacteria | 4235 |
| 461 | Ga0207641_10201752 | 3300026088 | Bacteria | 1834 |
| 462 | Ga0207648_10001029 | 3300026089 | Bacteria | 31328 |
| 463 | Ga0207648_10018292 | 3300026089 | Bacteria | 6348 |
| 464 | Ga0207648_10033849 | 3300026089 | Bacteria | 4506 |
| 465 | Ga0207648_10082063 | 3300026089 | Bacteria | 2811 |
| 466 | Ga0207648_10091646 | 3300026089 | Bacteria | 2657 |
| 467 | Ga0207648_10104797 | 3300026089 | Bacteria | 2481 |
| 468 | Ga0207648_10128449 | 3300026089 | Bacteria | 2230 |
| 469 | Ga0207676_10026933 | 3300026095 | Bacteria | 4277 |
| 470 | Ga0207676_10048199 | 3300026095 | Bacteria | 3306 |
| 471 | Ga0207676_10048586 | 3300026095 | Bacteria | 3295 |
| 472 | Ga0207676_10062298 | 3300026095 | Bacteria | 2958 |
| 473 | Ga0207676_10106161 | 3300026095 | Bacteria | 2340 |
| 474 | Ga0207676_10143337 | 3300026095 | Bacteria | 2048 |
| 475 | Ga0207674_10000951 | 3300026116 | Bacteria | 37804 |
| 476 | Ga0207674_10050436 | 3300026116 | Bacteria | 4252 |
| 477 | Ga0207674_10131920 | 3300026116 | Bacteria | 2461 |
| 478 | Ga0207674_10141413 | 3300026116 | Bacteria | 2366 |
| 479 | Ga0207675_100000947 | 3300026118 | Bacteria | 28984 |
| 480 | Ga0207675_100012281 | 3300026118 | Bacteria | 8002 |
| 481 | Ga0207675_100043778 | 3300026118 | Bacteria | 4181 |
| 482 | Ga0207675_100322394 | 3300026118 | Bacteria | 1509 |
| 483 | Ga0207683_10035387 | 3300026121 | Bacteria | 4343 |
| 484 | Ga0209969_1001925 | 3300027360 | Bacteria | 2852 |
| 485 | Ga0209967_1002901 | 3300027364 | Bacteria | 2241 |
| 486 | Ga0209981_1000322 | 3300027378 | Bacteria | 6175 |
| 487 | Ga0209984_1003320 | 3300027424 | Bacteria | 1837 |
| 488 | Ga0209995_1000169 | 3300027471 | Bacteria | 10476 |
| 489 | Ga0209968_1007165 | 3300027526 | Bacteria | 1685 |
| 490 | Ga0209999_1000030 | 3300027543 | Bacteria | 15066 |
| 491 | Ga0209982_1000171 | 3300027552 | Bacteria | 7396 |
| 492 | Ga0209970_1001621 | 3300027614 | Bacteria | 3907 |
| 493 | Ga0210002_1000333 | 3300027617 | Bacteria | 6478 |
| 494 | Ga0209983_1004720 | 3300027665 | Bacteria | 2849 |
| 495 | Ga0209588_1003834 | 3300027671 | Bacteria | 4195 |
| 496 | Ga0209588_1013367 | 3300027671 | Bacteria | 2503 |
| 497 | Ga0209971_1000037 | 3300027682 | Bacteria | 45920 |
| 498 | Ga0209966_1000378 | 3300027695 | Bacteria | 13523 |
| 499 | Ga0209998_10000042 | 3300027717 | Bacteria | 51743 |
| 500 | Ga0209974_10000465 | 3300027876 | Bacteria | 13444 |
| 501 | Ga0209974_10028825 | 3300027876 | Bacteria | 1839 |
| 502 | Ga0207428_10000027 | 3300027907 | Bacteria | 250186 |
| 503 | Ga0207428_10000245 | 3300027907 | Bacteria | 74009 |
| 504 | Ga0207428_10000849 | 3300027907 | Bacteria | 34443 |
| 505 | Ga0207428_10007638 | 3300027907 | Bacteria | 9844 |
| 506 | Ga0207428_10007874 | 3300027907 | Bacteria | 9688 |
| 507 | Ga0207428_10008043 | 3300027907 | Bacteria | 9569 |
| 508 | Ga0207428_10011180 | 3300027907 | Bacteria | 7961 |
| 509 | Ga0207428_10020343 | 3300027907 | Bacteria | 5639 |
| 510 | Ga0207428_10053281 | 3300027907 | Bacteria | 3227 |
| 511 | Ga0207428_10104636 | 3300027907 | Unclassified | 2184 |
| 512 | Ga0207428_10218538 | 3300027907 | Bacteria | 1429 |
| 513 | Ga0268266_10304794 | 3300028379 | Bacteria | 1487 |
| 514 | Ga0268265_10005618 | 3300028380 | Bacteria | 8563 |
| 515 | Ga0268265_10007675 | 3300028380 | Bacteria | 7280 |
| 516 | Ga0268265_10031665 | 3300028380 | Bacteria | 3821 |
| 517 | Ga0268264_10009436 | 3300028381 | Bacteria | 8082 |
| 518 | Ga0268264_10016829 | 3300028381 | Bacteria | 5985 |
| 519 | Ga0268264_10087103 | 3300028381 | Bacteria | 2685 |
| 520 | Ga0268264_10113504 | 3300028381 | Bacteria | 2377 |
| 521 | Ga0307408_100029421 | 3300031548 | Bacteria | 3806 |
| 522 | Ga0307405_10243446 | 3300031731 | Bacteria | 1334 |
| 523 | Ga0307406_10012405 | 3300031901 | Bacteria | 4861 |
| 524 | Ga0307407_10068199 | 3300031903 | Bacteria | 2106 |
| 525 | Ga0307412_10085013 | 3300031911 | Bacteria | 2198 |
| 526 | Ga0307409_100144824 | 3300031995 | Bacteria | 2053 |
| 527 | Ga0307416_100034764 | 3300032002 | Bacteria | 3840 |
| 528 | Ga0307416_100369476 | 3300032002 | Bacteria | 1460 |
| 529 | Ga0307411_10062966 | 3300032005 | Bacteria | 2477 |
| 530 | Ga0307411_10093652 | 3300032005 | Bacteria | 2104 |
| 531 | Ga0307415_100176911 | 3300032126 | Bacteria | 1670 |
| 532 | Ga0373940_0010807 | 3300035088 | Bacteria | 2156 |
| 533 | Ga0373940_0042584 | 3300035088 | Bacteria | 1252 |
| 534 | Ga0373939_0007627 | 3300035114 | Bacteria | 2631 |
| 535 | Ga0373939_0047429 | 3300035114 | Bacteria | 1319 |
| 536 | Ga0373941_0025272 | 3300035115 | Bacteria | 1714 |
| 537 | Ga0373960_0007917 | 3300035121 | Bacteria | 2532 |
| 538 | Ga0373961_0003932 | 3300035241 | Bacteria | 3629 |
| 539 | Ga0373961_0022917 | 3300035241 | Bacteria | 1675 |
| 540 | Ga0373931_0071219 | 3300035691 | Bacteria | 1898 |
| 541 | Ga0373931_0137497 | 3300035691 | Bacteria | 1412 |
| 542 | Ga0395899_0040764 | 3300037312 | Bacteria | 3472 |
| 543 | Ga0395900_0002273 | 3300037418 | Bacteria | 21347 |
| 544 | Ga0395900_0068642 | 3300037418 | Bacteria | 3643 |
| 545 | Ga0395898_0027972 | 3300037466 | Bacteria | 5654 |
| 546 | Ga0395905_0017487 | 3300037471 | Bacteria | 6807 |
| 547 | Ga0395901_0012102 | 3300038443 | Bacteria | 8752 |
| 548 | Ga0395901_0138497 | 3300038443 | Bacteria | 2558 |
| 549 | Ga0439443_008792 | 3300042003 | Bacteria | 1434 |
| 550 | Ga0439448_0003901 | 3300042005 | Bacteria | 4178 |
| 551 | Ga0439458_0008625 | 3300042157 | Bacteria | 2272 |
| 552 | Ga0439435_0059568 | 3300042436 | Bacteria | 1110 |
| 553 | Ga0439464_0005441 | 3300042439 | Bacteria | 3293 |
| 554 | Ga0439460_0000197 | 3300042461 | Bacteria | 11816 |
| 555 | Ga0451577_0014387 | 3300042876 | Bacteria | 7379 |
| 556 | Ga0451577_0095273 | 3300042876 | Bacteria | 2658 |
| 557 | Ga0451577_0141580 | 3300042876 | Bacteria | 2161 |
| 558 | Ga0451577_0208828 | 3300042876 | Bacteria | 1763 |
| 559 | Ga0439440_0008018 | 3300042993 | Bacteria | 2159 |
| 560 | Ga0453683_0034615 | 3300044673 | Bacteria | 3184 |
| 561 | Ga0453683_0059377 | 3300044673 | Bacteria | 2391 |
| 562 | Ga0453683_0132955 | 3300044673 | Bacteria | 1569 |
| 563 | Ga0453684_0023625 | 3300044712 | Bacteria | 9036 |
| 564 | Ga0453684_0051367 | 3300044712 | Bacteria | 5405 |
| 565 | Ga0453684_0084974 | 3300044712 | Bacteria | 3934 |
| 566 | Ga0453684_0454702 | 3300044712 | Bacteria | 1425 |
| 567 | Ga0451576_0004364 | 3300045051 | Bacteria | 18442 |
| 568 | Ga0451576_0005141 | 3300045051 | Bacteria | 16570 |
| 569 | Ga0451576_0005764 | 3300045051 | Bacteria | 15422 |
| 570 | Ga0451576_0012148 | 3300045051 | Bacteria | 9709 |
| 571 | Ga0451576_0015985 | 3300045051 | Bacteria | 8295 |
| 572 | Ga0451576_0030406 | 3300045051 | Bacteria | 5771 |
| 573 | Ga0451576_0031179 | 3300045051 | Bacteria | 5686 |
| 574 | Ga0451576_0199378 | 3300045051 | Bacteria | 2090 |
| 575 | Ga0451576_0502673 | 3300045051 | Bacteria | 1273 |
| 576 | Ga0495603_0034875 | 3300046455 | Bacteria | 3024 |
| 577 | Ga0495580_0000727 | 3300046472 | Bacteria | 28206 |
| 578 | Ga0495580_0159997 | 3300046472 | Bacteria | 1559 |
| 579 | Ga0495584_0072522 | 3300046491 | Bacteria | 1730 |
| 580 | Ga0495594_0018287 | 3300046499 | Bacteria | 3711 |
| 581 | Ga0495642_0029831 | 3300046528 | Bacteria | 2180 |
| 582 | Ga0495642_0067145 | 3300046528 | Bacteria | 1495 |
| 583 | Ga0495598_0006886 | 3300046537 | Bacteria | 2583 |
| 584 | Ga0495656_0009898 | 3300046615 | Bacteria | 3446 |
| 585 | Ga0495635_0185823 | 3300046663 | Bacteria | 1412 |
| 586 | Ga0495659_0027336 | 3300046664 | Bacteria | 1967 |
| 587 | Ga0495659_0031074 | 3300046664 | Bacteria | 1861 |
| 588 | Ga0495588_0008264 | 3300046674 | Bacteria | 4767 |
| 589 | Ga0495599_0086526 | 3300046678 | Bacteria | 1957 |
| 590 | Ga0495669_0029039 | 3300046684 | Bacteria | 2424 |
| 591 | Ga0495669_0031228 | 3300046684 | Bacteria | 2339 |
| 592 | Ga0495670_0080606 | 3300046691 | Bacteria | 1658 |
| 593 | Ga0495636_0025947 | 3300047318 | Bacteria | 2381 |
| 594 | Ga0495676_0099207 | 3300047321 | Bacteria | 2159 |
| 595 | Ga0496102_0026670 | 3300048905 | Bacteria | 5156 |
| 596 | Ga0496106_0154774 | 3300048909 | Bacteria | 1810 |
| 597 | Ga0496109_0140292 | 3300048912 | Bacteria | 2260 |
| 598 | Ga0496109_0149751 | 3300048912 | Unclassified | 2184 |
| 599 | Ga0496109_0297097 | 3300048912 | Bacteria | 1523 |
| 600 | Ga0496109_0491597 | 3300048912 | Bacteria | 1158 |
| 601 | Ga0496110_0106836 | 3300048913 | Bacteria | 2512 |
| 602 | Ga0496112_0059047 | 3300048915 | Bacteria | 3779 |
| 603 | Ga0496113_0040027 | 3300048916 | Bacteria | 3453 |
| 604 | Ga0501036_0041097 | 3300049572 | Bacteria | 3914 |
| 605 | Ga0501036_0290159 | 3300049572 | Unclassified | 1369 |
| 606 | Ga0501038_0205571 | 3300049574 | Bacteria | 1578 |
| 607 | Ga0501039_0110564 | 3300049575 | Bacteria | 2148 |
| 608 | Ga0501040_0002340 | 3300049576 | Bacteria | 12167 |
| 609 | Ga0501040_0023651 | 3300049576 | Bacteria | 4120 |
| 610 | Ga0501040_0053982 | 3300049576 | Bacteria | 2754 |
| 611 | Ga0501040_0104051 | 3300049576 | Unclassified | 1982 |
| 612 | Ga0501040_0115082 | 3300049576 | Bacteria | 1883 |
| 613 | Ga0501040_0142611 | 3300049576 | Bacteria | 1688 |
| 614 | Ga0501041_0049602 | 3300049577 | Bacteria | 2557 |
| 615 | Ga0501042_0017571 | 3300049578 | Bacteria | 4935 |
| 616 | Ga0501042_0055506 | 3300049578 | Bacteria | 2827 |
| 617 | Ga0501042_0104850 | 3300049578 | Bacteria | 2034 |
| 618 | Ga0501046_0179348 | 3300049580 | Bacteria | 1585 |
| 619 | Ga0501048_0010077 | 3300049582 | Bacteria | 7069 |
| 620 | Ga0501067_0009738 | 3300049583 | Bacteria | 5319 |
| 621 | Ga0501067_0013133 | 3300049583 | Bacteria | 4584 |
| 622 | Ga0501067_0075644 | 3300049583 | Bacteria | 1866 |
| 623 | Ga0501068_0065483 | 3300049584 | Bacteria | 2212 |
| 624 | Ga0501069_0030155 | 3300049585 | Bacteria | 2978 |
| 625 | Ga0501069_0031286 | 3300049585 | Bacteria | 2926 |
| 626 | Ga0501070_0219408 | 3300049586 | Bacteria | 1560 |
| 627 | Ga0501071_0079021 | 3300049587 | Bacteria | 2405 |
| 628 | Ga0501072_0007493 | 3300049588 | Bacteria | 8282 |
| 629 | Ga0501072_0019990 | 3300049588 | Bacteria | 5185 |
| 630 | Ga0501072_0023580 | 3300049588 | Bacteria | 4780 |
| 631 | Ga0501072_0086981 | 3300049588 | Bacteria | 2480 |
| 632 | Ga0501072_0096516 | 3300049588 | Unclassified | 2349 |
| 633 | Ga0501072_0179995 | 3300049588 | Bacteria | 1686 |
| 634 | Ga0501072_0394853 | 3300049588 | Bacteria | 1097 |
| 635 | Ga0501074_0025264 | 3300049590 | Bacteria | 4315 |
| 636 | Ga0501074_0044488 | 3300049590 | Bacteria | 3214 |
| 637 | Ga0501074_0044826 | 3300049590 | Bacteria | 3200 |
| 638 | Ga0501074_0113887 | 3300049590 | Bacteria | 1935 |
| 639 | Ga0501074_0122781 | 3300049590 | Bacteria | 1858 |
| 640 | Ga0501074_0355578 | 3300049590 | Unclassified | 1039 |
| 641 | Ga0501075_0061209 | 3300049591 | Bacteria | 2836 |
| 642 | Ga0501075_0088260 | 3300049591 | Bacteria | 2351 |
| 643 | Ga0501075_0128849 | 3300049591 | Bacteria | 1927 |
| 644 | Ga0501075_0145497 | 3300049591 | Bacteria | 1806 |
| 645 | Ga0501076_0000831 | 3300049592 | Bacteria | 20044 |
| 646 | Ga0501076_0011802 | 3300049592 | Bacteria | 6525 |
| 647 | Ga0501076_0067189 | 3300049592 | Bacteria | 2862 |
| 648 | Ga0501076_0183162 | 3300049592 | Bacteria | 1708 |
| 649 | Ga0501077_0007379 | 3300049593 | Bacteria | 6777 |
| 650 | Ga0501077_0113638 | 3300049593 | Bacteria | 1717 |
| 651 | Ga0501077_0151814 | 3300049593 | Unclassified | 1470 |
| 652 | Ga0501077_0228384 | 3300049593 | Bacteria | 1183 |
| 653 | Ga0501249_009868 | 3300049679 | Bacteria | 1989 |
| 654 | Ga0501079_0005334 | 3300049741 | Bacteria | 9567 |
| 655 | Ga0501079_0011626 | 3300049741 | Bacteria | 6722 |
| 656 | Ga0501079_0018603 | 3300049741 | Bacteria | 5307 |
| 657 | Ga0501080_0110250 | 3300049742 | Bacteria | 2551 |
| 658 | Ga0501080_0137679 | 3300049742 | Bacteria | 2259 |
| 659 | Ga0501081_0001826 | 3300049743 | Bacteria | 13182 |
| 660 | Ga0501081_0002472 | 3300049743 | Bacteria | 11652 |
| 661 | Ga0501081_0005258 | 3300049743 | Bacteria | 8341 |
| 662 | Ga0501081_0010638 | 3300049743 | Bacteria | 6009 |
| 663 | Ga0501081_0055520 | 3300049743 | Bacteria | 2737 |
| 664 | Ga0501081_0282466 | 3300049743 | Unclassified | 1215 |
| 665 | Ga0501081_0291248 | 3300049743 | Bacteria | 1197 |
| 666 | Ga0501083_0172471 | 3300049744 | Bacteria | 1414 |
| 667 | Ga0501045_0008724 | 3300049824 | Bacteria | 7071 |
| 668 | Ga0501045_0071527 | 3300049824 | Bacteria | 2553 |
| 669 | nmdc:mga03683_4325_c1 | 3300050489 | Bacteria | 4696 |
| 670 | nmdc:mga00v17_123621_c1 | 3300050491 | Bacteria | 1650 |
| 671 | nmdc:mga00v17_190952_c1 | 3300050491 | Bacteria | 1323 |
| 672 | nmdc:mga00v17_2153_c1 | 3300050491 | Bacteria | 10125 |
| 673 | nmdc:mga0k408_10311_c1 | 3300050493 | Bacteria | 5051 |
| 674 | nmdc:mga06z11_18520_c1 | 3300050494 | Bacteria | 3182 |
| 675 | nmdc:mga06z11_36572_c1 | 3300050494 | Bacteria | 2425 |
| 676 | nmdc:mga07m45_9361_c1 | 3300050496 | Bacteria | 5079 |
| 677 | nmdc:mga05p37_11414_c1 | 3300050507 | Bacteria | 10575 |
| 678 | nmdc:mga05p37_115985_c1 | 3300050507 | Bacteria | 3292 |
| 679 | nmdc:mga05p37_13298_c1 | 3300050507 | Bacteria | 9856 |
| 680 | nmdc:mga05p37_140466_c1 | 3300050507 | Bacteria | 2959 |
| 681 | nmdc:mga05p37_155861_c1 | 3300050507 | Bacteria | 2791 |
| 682 | nmdc:mga05p37_17395_c1 | 3300050507 | Bacteria | 8675 |
| 683 | nmdc:mga05p37_175148_c1 | 3300050507 | Bacteria | 2614 |
| 684 | nmdc:mga05p37_1821_c1 | 3300050507 | Bacteria | 24853 |
| 685 | nmdc:mga05p37_221156_c1 | 3300050507 | Bacteria | 2285 |
| 686 | nmdc:mga05p37_2476_c1 | 3300050507 | Bacteria | 21484 |
| 687 | nmdc:mga05p37_26199_c1 | 3300050507 | Bacteria | 7090 |
| 688 | nmdc:mga05p37_405715_c1 | 3300050507 | Unclassified | 1590 |
| 689 | nmdc:mga05p37_42435_c1 | 3300050507 | Bacteria | 5589 |
| 690 | nmdc:mga05p37_63188_c1 | 3300050507 | Bacteria | 4556 |
| 691 | nmdc:mga05p37_68472_c1 | 3300050507 | Bacteria | 4365 |
| 692 | nmdc:mga05p37_7226_c1 | 3300050507 | Bacteria | 13099 |
| 693 | nmdc:mga05p37_7406_c1 | 3300050507 | Bacteria | 12949 |
| 694 | nmdc:mga05p37_769_c1 | 3300050507 | Bacteria | 35683 |
| 695 | nmdc:mga09592_10924_c1 | 3300050508 | Bacteria | 7389 |
| 696 | nmdc:mga09592_14652_c1 | 3300050508 | Bacteria | 6397 |
| 697 | nmdc:mga09592_148021_c1 | 3300050508 | Bacteria | 2025 |
| 698 | nmdc:mga09592_149660_c1 | 3300050508 | Bacteria | 2014 |
| 699 | nmdc:mga09592_187481_c1 | 3300050508 | Bacteria | 1790 |
| 700 | nmdc:mga09592_1944_c1 | 3300050508 | Bacteria | 16641 |
| 701 | nmdc:mga09592_2581_c1 | 3300050508 | Bacteria | 14667 |
| 702 | nmdc:mga09592_29511_c1 | 3300050508 | Bacteria | 4560 |
| 703 | nmdc:mga09592_3878_c1 | 3300050508 | Bacteria | 12046 |
| 704 | nmdc:mga09592_4509_c1 | 3300050508 | Bacteria | 11265 |
| 705 | nmdc:mga09592_5317_c1 | 3300050508 | Bacteria | 10464 |
| 706 | nmdc:mga09592_53687_c1 | 3300050508 | Bacteria | 3404 |
| 707 | nmdc:mga09592_54900_c1 | 3300050508 | Bacteria | 3366 |
| 708 | nmdc:mga09592_79360_c1 | 3300050508 | Unclassified | 2794 |
| 709 | nmdc:mga0qj67_1433_c1 | 3300050509 | Bacteria | 16698 |
| 710 | nmdc:mga0qj67_21599_c1 | 3300050509 | Bacteria | 4938 |
| 711 | nmdc:mga0qj67_22451_c1 | 3300050509 | Bacteria | 4847 |
| 712 | nmdc:mga0qj67_24945_c1 | 3300050509 | Bacteria | 4615 |
| 713 | nmdc:mga0qj67_26059_c1 | 3300050509 | Bacteria | 4525 |
| 714 | nmdc:mga0qj67_60996_c1 | 3300050509 | Bacteria | 2994 |
| 715 | nmdc:mga0qj67_7809_c1 | 3300050509 | Bacteria | 7907 |
| 716 | nmdc:mga0qj67_9223_c1 | 3300050509 | Bacteria | 7331 |
| 717 | nmdc:mga06r32_100838_c1 | 3300050510 | Bacteria | 2833 |
| 718 | nmdc:mga06r32_1744_c1 | 3300050510 | Bacteria | 19568 |
| 719 | nmdc:mga06r32_187312_c1 | 3300050510 | Bacteria | 2057 |
| 720 | nmdc:mga06r32_203185_c1 | 3300050510 | Bacteria | 1969 |
| 721 | nmdc:mga06r32_2396_c1 | 3300050510 | Bacteria | 16781 |
| 722 | nmdc:mga06r32_363805_c1 | 3300050510 | Bacteria | 1430 |
| 723 | nmdc:mga06r32_3786_c1 | 3300050510 | Bacteria | 13535 |
| 724 | nmdc:mga06r32_5775_c1 | 3300050510 | Bacteria | 11151 |
| 725 | nmdc:mga06r32_7977_c1 | 3300050510 | Bacteria | 9516 |
| 726 | nmdc:mga06r32_80134_c1 | 3300050510 | Bacteria | 3177 |
| 727 | nmdc:mga08y16_104951_c1 | 3300050511 | Bacteria | 2942 |
| 728 | nmdc:mga08y16_120242_c1 | 3300050511 | Bacteria | 2734 |
| 729 | nmdc:mga08y16_123507_c1 | 3300050511 | Bacteria | 2694 |
| 730 | nmdc:mga08y16_1306_c1 | 3300050511 | Bacteria | 24771 |
| 731 | nmdc:mga08y16_149523_c1 | 3300050511 | Bacteria | 2428 |
| 732 | nmdc:mga08y16_17787_c1 | 3300050511 | Bacteria | 7488 |
| 733 | nmdc:mga08y16_243078_c1 | 3300050511 | Bacteria | 1860 |
| 734 | nmdc:mga08y16_2919_c1 | 3300050511 | Bacteria | 17590 |
| 735 | nmdc:mga08y16_3252_c1 | 3300050511 | Bacteria | 16818 |
| 736 | nmdc:mga08y16_404214_c1 | 3300050511 | Bacteria | 1397 |
| 737 | nmdc:mga08y16_49615_c1 | 3300050511 | Bacteria | 4393 |
| 738 | nmdc:mga08y16_597_c1 | 3300050511 | Bacteria | 33660 |
| 739 | nmdc:mga08y16_83078_c1 | 3300050511 | Bacteria | 3338 |
| 740 | nmdc:mga08y16_8329_c1 | 3300050511 | Bacteria | 10851 |
| 741 | nmdc:mga08y16_91146_c1 | 3300050511 | Bacteria | 3177 |
| 742 | nmdc:mga0n895_101899_c1 | 3300050512 | Bacteria | 2881 |
| 743 | nmdc:mga0n895_1214_c1 | 3300050512 | Bacteria | 19023 |
| 744 | nmdc:mga0n895_150271_c1 | 3300050512 | Bacteria | 2359 |
| 745 | nmdc:mga0n895_2183_c1 | 3300050512 | Bacteria | 15126 |
| 746 | nmdc:mga0n895_22554_c1 | 3300050512 | Bacteria | 5904 |
| 747 | nmdc:mga0n895_231840_c1 | 3300050512 | Unclassified | 1874 |
| 748 | nmdc:mga0n895_258631_c1 | 3300050512 | Bacteria | 1767 |
| 749 | nmdc:mga0n895_300722_c1 | 3300050512 | Bacteria | 1626 |
| 750 | nmdc:mga0n895_347712_c1 | 3300050512 | Bacteria | 1502 |
| 751 | nmdc:mga0n895_46940_c1 | 3300050512 | Bacteria | 4222 |
| 752 | nmdc:mga0n895_477_c1 | 3300050512 | Bacteria | 26935 |
| 753 | nmdc:mga0n895_57044_c1 | 3300050512 | Bacteria | 3849 |
| 754 | nmdc:mga0n895_60106_c1 | 3300050512 | Bacteria | 3750 |
| 755 | nmdc:mga0n895_60201_c1 | 3300050512 | Bacteria | 3747 |
| 756 | nmdc:mga0n895_85010_c1 | 3300050512 | Bacteria | 3158 |
| 757 | nmdc:mga0n895_86246_c1 | 3300050512 | Bacteria | 3136 |
| 758 | nmdc:mga0rr50_122473_c1 | 3300050513 | Bacteria | 2072 |
| 759 | nmdc:mga0rr50_13734_c1 | 3300050513 | Bacteria | 5286 |
| 760 | nmdc:mga0rr50_149715_c1 | 3300050513 | Bacteria | 1885 |
| 761 | nmdc:mga0rr50_151274_c1 | 3300050513 | Bacteria | 1876 |
| 762 | nmdc:mga0rr50_203268_c1 | 3300050513 | Bacteria | 1629 |
| 763 | nmdc:mga0rr50_245903_c1 | 3300050513 | Bacteria | 1484 |
| 764 | nmdc:mga0rr50_46560_c1 | 3300050513 | Bacteria | 3194 |
| 765 | nmdc:mga0rr50_549_c1 | 3300050513 | Bacteria | 20121 |
| 766 | nmdc:mga0rr50_62866_c1 | 3300050513 | Bacteria | 2802 |
| 767 | nmdc:mga0rr50_75272_c1 | 3300050513 | Bacteria | 2587 |
| 768 | nmdc:mga08x19_16828_c1 | 3300050514 | Bacteria | 4465 |
| 769 | nmdc:mga08x19_1724_c1 | 3300050514 | Bacteria | 13452 |
| 770 | nmdc:mga0a205_106355_c1 | 3300050515 | Bacteria | 2704 |
| 771 | nmdc:mga0a205_1170_c1 | 3300050515 | Bacteria | 21857 |
| 772 | nmdc:mga0a205_132329_c1 | 3300050515 | Bacteria | 2395 |
| 773 | nmdc:mga0a205_1627_c1 | 3300050515 | Bacteria | 19317 |
| 774 | nmdc:mga0a205_186096_c1 | 3300050515 | Bacteria | 1970 |
| 775 | nmdc:mga0a205_1991_c1 | 3300050515 | Bacteria | 17807 |
| 776 | nmdc:mga0a205_227_c1 | 3300050515 | Bacteria | 39744 |
| 777 | nmdc:mga0a205_26128_c1 | 3300050515 | Bacteria | 5563 |
| 778 | nmdc:mga0a205_47712_c1 | 3300050515 | Bacteria | 2436 |
| 779 | nmdc:mga0a205_56926_c1 | 3300050515 | Bacteria | 3775 |
| 780 | nmdc:mga0a205_646_c1 | 3300050515 | Bacteria | 27674 |
| 781 | nmdc:mga0a205_68336_c1 | 3300050515 | Bacteria | 3432 |
| 782 | nmdc:mga0a205_8978_c1 | 3300050515 | Bacteria | 9109 |
| 783 | Ga0501084_0023135 | 3300054114 | Bacteria | 5187 |
| 784 | Ga0501084_0026115 | 3300054114 | Bacteria | 4872 |
| 785 | Ga0501084_0165102 | 3300054114 | Bacteria | 1869 |
| 786 | Ga0501082_0003845 | 3300060353 | Bacteria | 13129 |
| 787 | Ga0501082_0006260 | 3300060353 | Bacteria | 10330 |
| 788 | Ga0501082_0009259 | 3300060353 | Bacteria | 8489 |
| 789 | Ga0501082_0037237 | 3300060353 | Bacteria | 4193 |
| 790 | Ga0501082_0049357 | 3300060353 | Bacteria | 3629 |
| 791 | Ga0501082_0267343 | 3300060353 | Bacteria | 1488 |
| 792 | Ga0530510_0012598 | 3300061734 | Bacteria | 5944 |
| 793 | Ga0530510_0020309 | 3300061734 | Bacteria | 4722 |
| 794 | Ga0530510_0027054 | 3300061734 | Bacteria | 4108 |
| 795 | Ga0530510_0059589 | 3300061734 | Bacteria | 2762 |
| 796 | Ga0530510_0098316 | 3300061734 | Bacteria | 2140 |
| 797 | Ga0530510_0161310 | 3300061734 | Bacteria | 1658 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003371 | JGI26145J50221_1002098 | JGI26145J50221_10020982 | 288 |
| 2 | 3300049588 | Ga0501072_0394853 | Ga0501072_0394853_12_893 | 288 |
| 3 | 3300005444 | Ga0070694_100348263 | Ga0070694_1003482632 | 291 |
| 4 | 3300005518 | Ga0070699_100008025 | Ga0070699_1000080255 | 298 |
| 5 | 3300005347 | Ga0070668_100044110 | Ga0070668_1000441102 | 299 |
| 6 | 3300005353 | Ga0070669_100031693 | Ga0070669_1000316935 | 299 |
| 7 | 3300005543 | Ga0070672_100049360 | Ga0070672_1000493604 | 299 |
| 8 | 3300005843 | Ga0068860_100083585 | Ga0068860_1000835853 | 299 |
| 9 | 3300006844 | Ga0075428_100001697 | Ga0075428_10000169728 | 299 |
| 10 | 3300006846 | Ga0075430_100000397 | Ga0075430_10000039728 | 299 |
| 11 | 3300006847 | Ga0075431_100263248 | Ga0075431_1002632482 | 299 |
| 12 | 3300006847 | Ga0075431_100294273 | Ga0075431_1002942732 | 299 |
| 13 | 3300009148 | Ga0105243_10016133 | Ga0105243_100161335 | 299 |
| 14 | 3300009174 | Ga0105241_10041676 | Ga0105241_100416763 | 299 |
| 15 | 3300013297 | Ga0157378_10263164 | Ga0157378_102631641 | 299 |
| 16 | 3300013306 | Ga0163162_10103890 | Ga0163162_101038902 | 299 |
| 17 | 3300013308 | Ga0157375_10137022 | Ga0157375_101370221 | 299 |
| 18 | 3300014326 | Ga0157380_10148047 | Ga0157380_101480472 | 299 |
| 19 | 3300025911 | Ga0207654_10058214 | Ga0207654_100582143 | 299 |
| 20 | 3300025940 | Ga0207691_10035245 | Ga0207691_100352455 | 299 |
| 21 | 3300028381 | Ga0268264_10113504 | Ga0268264_101135042 | 299 |
| 22 | 3300046528 | Ga0495642_0029831 | Ga0495642_0029831_825_1814 | 299 |
| 23 | 3300050508 | nmdc:mga09592_4509_c1 | nmdc:mga09592_4509_c1_6102_7088 | 299 |
| 24 | 3300050509 | nmdc:mga0qj67_22451_c1 | nmdc:mga0qj67_22451_c1_572_1558 | 299 |
| 25 | 3300050510 | nmdc:mga06r32_187312_c1 | nmdc:mga06r32_187312_c1_669_1655 | 299 |
| 26 | 3300050507 | nmdc:mga05p37_221156_c1 | nmdc:mga05p37_221156_c1_1189_2175 | 300 |
| 27 | 3300050510 | nmdc:mga06r32_363805_c1 | nmdc:mga06r32_363805_c1_321_1307 | 300 |
| 28 | 3300049580 | Ga0501046_0179348 | Ga0501046_0179348_302_1306 | 303 |
| 29 | 3300003203 | JGI25406J46586_10002893 | JGI25406J46586_100028936 | 304 |
| 30 | 3300005985 | Ga0081539_10000096 | Ga0081539_1000009698 | 304 |
| 31 | 3300049576 | Ga0501040_0115082 | Ga0501040_0115082_755_1744 | 304 |
| 32 | 3300005468 | Ga0070707_100055001 | Ga0070707_1000550012 | 305 |
| 33 | 3300049574 | Ga0501038_0205571 | Ga0501038_0205571_636_1562 | 305 |
| 34 | 3300049743 | Ga0501081_0055520 | Ga0501081_0055520_1671_2660 | 305 |
| 35 | 3300049576 | Ga0501040_0142611 | Ga0501040_0142611_567_1559 | 306 |
| 36 | 3300049590 | Ga0501074_0355578 | Ga0501074_0355578_29_1021 | 306 |
| 37 | 3300049743 | Ga0501081_0005258 | Ga0501081_0005258_7317_8309 | 306 |
| 38 | 3300060353 | Ga0501082_0049357 | Ga0501082_0049357_855_1847 | 306 |
| 39 | 3300050513 | nmdc:mga0rr50_122473_c1 | nmdc:mga0rr50_122473_c1_314_1297 | 307 |
| 40 | 3300049591 | Ga0501075_0145497 | Ga0501075_0145497_639_1622 | 308 |
| 41 | 3300054114 | Ga0501084_0165102 | Ga0501084_0165102_115_1098 | 308 |
| 42 | 3300005467 | Ga0070706_100384660 | Ga0070706_1003846601 | 309 |
| 43 | 3300005468 | Ga0070707_100466614 | Ga0070707_1004666141 | 309 |
| 44 | 3300031548 | Ga0307408_100029421 | Ga0307408_1000294215 | 309 |
| 45 | 3300032005 | Ga0307411_10093652 | Ga0307411_100936523 | 309 |
| 46 | 3300061734 | Ga0530510_0098316 | Ga0530510_0098316_351_1358 | 309 |
| 47 | 3300005330 | Ga0070690_100095889 | Ga0070690_1000958892 | 311 |
| 48 | 3300005293 | Ga0065715_10111155 | Ga0065715_101111553 | 312 |
| 49 | 3300005328 | Ga0070676_10042099 | Ga0070676_100420995 | 312 |
| 50 | 3300005334 | Ga0068869_100001496 | Ga0068869_10000149610 | 312 |
| 51 | 3300005337 | Ga0070682_100001865 | Ga0070682_1000018656 | 312 |
| 52 | 3300005339 | Ga0070660_100041666 | Ga0070660_1000416664 | 312 |
| 53 | 3300005340 | Ga0070689_100012412 | Ga0070689_1000124125 | 312 |
| 54 | 3300005341 | Ga0070691_10010154 | Ga0070691_100101541 | 312 |
| 55 | 3300005344 | Ga0070661_100000211 | Ga0070661_1000002115 | 312 |
| 56 | 3300005345 | Ga0070692_10001897 | Ga0070692_100018972 | 312 |
| 57 | 3300005364 | Ga0070673_100241757 | Ga0070673_1002417572 | 312 |
| 58 | 3300005366 | Ga0070659_100001505 | Ga0070659_10000150513 | 312 |
| 59 | 3300005406 | Ga0070703_10000869 | Ga0070703_100008695 | 312 |
| 60 | 3300005438 | Ga0070701_10084542 | Ga0070701_100845422 | 312 |
| 61 | 3300005440 | Ga0070705_100005391 | Ga0070705_1000053915 | 312 |
| 62 | 3300005444 | Ga0070694_100003319 | Ga0070694_1000033193 | 312 |
| 63 | 3300005458 | Ga0070681_10050601 | Ga0070681_100506013 | 312 |
| 64 | 3300005459 | Ga0068867_100006675 | Ga0068867_1000066757 | 312 |
| 65 | 3300005530 | Ga0070679_100008274 | Ga0070679_1000082747 | 312 |
| 66 | 3300005535 | Ga0070684_100063817 | Ga0070684_1000638172 | 312 |
| 67 | 3300005539 | Ga0068853_100000678 | Ga0068853_10000067825 | 312 |
| 68 | 3300005543 | Ga0070672_100050220 | Ga0070672_1000502203 | 312 |
| 69 | 3300005545 | Ga0070695_100004358 | Ga0070695_1000043582 | 312 |
| 70 | 3300005546 | Ga0070696_100004871 | Ga0070696_1000048718 | 312 |
| 71 | 3300005547 | Ga0070693_100000189 | Ga0070693_10000018924 | 312 |
| 72 | 3300005549 | Ga0070704_100001133 | Ga0070704_10000113314 | 312 |
| 73 | 3300005563 | Ga0068855_100015855 | Ga0068855_1000158552 | 312 |
| 74 | 3300005564 | Ga0070664_100006711 | Ga0070664_1000067114 | 312 |
| 75 | 3300005577 | Ga0068857_100085674 | Ga0068857_1000856742 | 312 |
| 76 | 3300005578 | Ga0068854_100002061 | Ga0068854_10000206112 | 312 |
| 77 | 3300005614 | Ga0068856_100008288 | Ga0068856_1000082885 | 312 |
| 78 | 3300005617 | Ga0068859_100008805 | Ga0068859_1000088056 | 312 |
| 79 | 3300005618 | Ga0068864_100021673 | Ga0068864_1000216736 | 312 |
| 80 | 3300005840 | Ga0068870_10010760 | Ga0068870_100107605 | 312 |
| 81 | 3300005841 | Ga0068863_100005815 | Ga0068863_1000058155 | 312 |
| 82 | 3300005844 | Ga0068862_100015431 | Ga0068862_1000154313 | 312 |
| 83 | 3300005844 | Ga0068862_100258870 | Ga0068862_1002588702 | 312 |
| 84 | 3300006852 | Ga0075433_10079409 | Ga0075433_100794091 | 312 |
| 85 | 3300006871 | Ga0075434_100023521 | Ga0075434_1000235215 | 312 |
| 86 | 3300006931 | Ga0097620_100008805 | Ga0097620_1000088056 | 312 |
| 87 | 3300009093 | Ga0105240_10155950 | Ga0105240_101559502 | 312 |
| 88 | 3300009094 | Ga0111539_10114103 | Ga0111539_101141035 | 312 |
| 89 | 3300009147 | Ga0114129_10634510 | Ga0114129_106345102 | 312 |
| 90 | 3300009174 | Ga0105241_10001410 | Ga0105241_1000141010 | 312 |
| 91 | 3300011119 | Ga0105246_10047160 | Ga0105246_100471602 | 312 |
| 92 | 3300013100 | Ga0157373_10015786 | Ga0157373_100157863 | 312 |
| 93 | 3300013105 | Ga0157369_10017116 | Ga0157369_100171169 | 312 |
| 94 | 3300013307 | Ga0157372_10008010 | Ga0157372_100080102 | 312 |
| 95 | 3300013308 | Ga0157375_10049527 | Ga0157375_100495272 | 312 |
| 96 | 3300014325 | Ga0163163_10065916 | Ga0163163_100659165 | 312 |
| 97 | 3300025907 | Ga0207645_10000400 | Ga0207645_1000040016 | 312 |
| 98 | 3300025908 | Ga0207643_10000424 | Ga0207643_1000042421 | 312 |
| 99 | 3300025911 | Ga0207654_10002440 | Ga0207654_1000244010 | 312 |
| 100 | 3300025912 | Ga0207707_10000116 | Ga0207707_1000011632 | 312 |
| 101 | 3300025913 | Ga0207695_10205833 | Ga0207695_102058332 | 312 |
| 102 | 3300025917 | Ga0207660_10003214 | Ga0207660_100032147 | 312 |
| 103 | 3300025919 | Ga0207657_10000211 | Ga0207657_1000021131 | 312 |
| 104 | 3300025920 | Ga0207649_10009637 | Ga0207649_100096375 | 312 |
| 105 | 3300025921 | Ga0207652_10003841 | Ga0207652_100038416 | 312 |
| 106 | 3300025932 | Ga0207690_10001495 | Ga0207690_100014959 | 312 |
| 107 | 3300025933 | Ga0207706_10350364 | Ga0207706_103503642 | 312 |
| 108 | 3300025940 | Ga0207691_10009557 | Ga0207691_100095579 | 312 |
| 109 | 3300025942 | Ga0207689_10000201 | Ga0207689_1000020132 | 312 |
| 110 | 3300025945 | Ga0207679_10000634 | Ga0207679_1000063426 | 312 |
| 111 | 3300025949 | Ga0207667_10000342 | Ga0207667_100003425 | 312 |
| 112 | 3300025960 | Ga0207651_10051815 | Ga0207651_100518152 | 312 |
| 113 | 3300025981 | Ga0207640_10010071 | Ga0207640_100100713 | 312 |
| 114 | 3300026041 | Ga0207639_10004331 | Ga0207639_100043312 | 312 |
| 115 | 3300026078 | Ga0207702_10001143 | Ga0207702_1000114310 | 312 |
| 116 | 3300026089 | Ga0207648_10018292 | Ga0207648_100182925 | 312 |
| 117 | 3300026116 | Ga0207674_10000951 | Ga0207674_1000095114 | 312 |
| 118 | 3300027876 | Ga0209974_10028825 | Ga0209974_100288253 | 312 |
| 119 | 3300028380 | Ga0268265_10005618 | Ga0268265_100056188 | 312 |
| 120 | 3300028381 | Ga0268264_10009436 | Ga0268264_100094366 | 312 |
| 121 | 3300035114 | Ga0373939_0047429 | Ga0373939_0047429_41_1048 | 312 |
| 122 | 3300035121 | Ga0373960_0007917 | Ga0373960_0007917_577_1584 | 312 |
| 123 | 3300035241 | Ga0373961_0003932 | Ga0373961_0003932_1440_2447 | 312 |
| 124 | 3300042005 | Ga0439448_0003901 | Ga0439448_0003901_2604_3611 | 312 |
| 125 | 3300042157 | Ga0439458_0008625 | Ga0439458_0008625_281_1288 | 312 |
| 126 | 3300042876 | Ga0451577_0208828 | Ga0451577_0208828_269_1276 | 312 |
| 127 | 3300044712 | Ga0453684_0084974 | Ga0453684_0084974_1247_2254 | 312 |
| 128 | 3300045051 | Ga0451576_0005764 | Ga0451576_0005764_8404_9411 | 312 |
| 129 | 3300048905 | Ga0496102_0026670 | Ga0496102_0026670_1433_2440 | 312 |
| 130 | 3300048909 | Ga0496106_0154774 | Ga0496106_0154774_526_1533 | 312 |
| 131 | 3300048912 | Ga0496109_0140292 | Ga0496109_0140292_1117_2124 | 312 |
| 132 | 3300048915 | Ga0496112_0059047 | Ga0496112_0059047_1731_2738 | 312 |
| 133 | 3300050511 | nmdc:mga08y16_91146_c1 | nmdc:mga08y16_91146_c1_1708_2688 | 312 |
| 134 | 3300050512 | nmdc:mga0n895_347712_c1 | nmdc:mga0n895_347712_c1_219_1226 | 312 |
| 135 | 3300005468 | Ga0070707_100268116 | Ga0070707_1002681162 | 313 |
| 136 | 3300025922 | Ga0207646_10023879 | Ga0207646_100238792 | 313 |
| 137 | 3300049583 | Ga0501067_0075644 | Ga0501067_0075644_705_1712 | 313 |
| 138 | 3300049588 | Ga0501072_0023580 | Ga0501072_0023580_1769_2713 | 313 |
| 139 | 3300049590 | Ga0501074_0044488 | Ga0501074_0044488_1827_2771 | 313 |
| 140 | 3300005536 | Ga0070697_100017546 | Ga0070697_1000175466 | 314 |
| 141 | 3300013296 | Ga0157374_10233961 | Ga0157374_102339612 | 314 |
| 142 | 3300042876 | Ga0451577_0141580 | Ga0451577_0141580_902_1894 | 314 |
| 143 | 3300044712 | Ga0453684_0051367 | Ga0453684_0051367_250_1242 | 314 |
| 144 | 3300005356 | Ga0070674_100149697 | Ga0070674_1001496972 | 315 |
| 145 | 3300009147 | Ga0114129_10115315 | Ga0114129_101153154 | 315 |
| 146 | 3300009553 | Ga0105249_10608300 | Ga0105249_106083001 | 315 |
| 147 | 3300042876 | Ga0451577_0095273 | Ga0451577_0095273_218_1207 | 315 |
| 148 | 3300050507 | nmdc:mga05p37_140466_c1 | nmdc:mga05p37_140466_c1_587_1573 | 315 |
| 149 | 3300005364 | Ga0070673_100095474 | Ga0070673_1000954744 | 316 |
| 150 | 3300005564 | Ga0070664_100148196 | Ga0070664_1001481962 | 316 |
| 151 | 3300006852 | Ga0075433_10098119 | Ga0075433_100981192 | 316 |
| 152 | 3300025944 | Ga0207661_10031415 | Ga0207661_100314152 | 316 |
| 153 | 3300025960 | Ga0207651_10030607 | Ga0207651_100306072 | 316 |
| 154 | 3300035114 | Ga0373939_0007627 | Ga0373939_0007627_252_1226 | 316 |
| 155 | 3300050507 | nmdc:mga05p37_175148_c1 | nmdc:mga05p37_175148_c1_236_1231 | 316 |
| 156 | 3300050512 | nmdc:mga0n895_60201_c1 | nmdc:mga0n895_60201_c1_1620_2615 | 316 |
| 157 | 3300006847 | Ga0075431_100000486 | Ga0075431_1000004869 | 317 |
| 158 | 3300050510 | nmdc:mga06r32_1744_c1 | nmdc:mga06r32_1744_c1_11326_12312 | 317 |
| 159 | 3300061734 | Ga0530510_0027054 | Ga0530510_0027054_2872_3840 | 317 |
| 160 | 3300005438 | Ga0070701_10033362 | Ga0070701_100333622 | 318 |
| 161 | 3300005468 | Ga0070707_100151982 | Ga0070707_1001519822 | 318 |
| 162 | 3300005545 | Ga0070695_100337880 | Ga0070695_1003378801 | 318 |
| 163 | 3300005549 | Ga0070704_100028727 | Ga0070704_1000287273 | 318 |
| 164 | 3300005844 | Ga0068862_100095598 | Ga0068862_1000955982 | 318 |
| 165 | 3300009176 | Ga0105242_10572532 | Ga0105242_105725321 | 318 |
| 166 | 3300009177 | Ga0105248_10194352 | Ga0105248_101943521 | 318 |
| 167 | 3300025917 | Ga0207660_10332841 | Ga0207660_103328411 | 318 |
| 168 | 3300025922 | Ga0207646_10063999 | Ga0207646_100639991 | 318 |
| 169 | 3300025961 | Ga0207712_10063532 | Ga0207712_100635323 | 318 |
| 170 | 3300026075 | Ga0207708_10170215 | Ga0207708_101702153 | 318 |
| 171 | 3300026116 | Ga0207674_10131920 | Ga0207674_101319203 | 318 |
| 172 | 3300006880 | Ga0075429_100000023 | Ga0075429_10000002338 | 319 |
| 173 | 3300050515 | nmdc:mga0a205_26128_c1 | nmdc:mga0a205_26128_c1_3195_4163 | 319 |
| 174 | 3300050515 | nmdc:mga0a205_56926_c1 | nmdc:mga0a205_56926_c1_1144_2127 | 319 |
| 175 | 3300005844 | Ga0068862_100209034 | Ga0068862_1002090342 | 320 |
| 176 | 3300006852 | Ga0075433_10059591 | Ga0075433_100595914 | 320 |
| 177 | 3300006871 | Ga0075434_100017104 | Ga0075434_1000171042 | 320 |
| 178 | 3300006871 | Ga0075434_100119131 | Ga0075434_1001191315 | 320 |
| 179 | 3300007076 | Ga0075435_100051710 | Ga0075435_1000517105 | 320 |
| 180 | 3300046472 | Ga0495580_0159997 | Ga0495580_0159997_12_983 | 320 |
| 181 | 3300050512 | nmdc:mga0n895_22554_c1 | nmdc:mga0n895_22554_c1_4538_5506 | 320 |
| 182 | 3300050512 | nmdc:mga0n895_86246_c1 | nmdc:mga0n895_86246_c1_1120_2109 | 320 |
| 183 | 3300050513 | nmdc:mga0rr50_46560_c1 | nmdc:mga0rr50_46560_c1_37_1026 | 320 |
| 184 | 3300006852 | Ga0075433_10181580 | Ga0075433_101815803 | 321 |
| 185 | 3300006881 | Ga0068865_100283138 | Ga0068865_1002831382 | 321 |
| 186 | 3300007076 | Ga0075435_100099992 | Ga0075435_1000999924 | 321 |
| 187 | 3300025938 | Ga0207704_10144317 | Ga0207704_101443172 | 321 |
| 188 | 3300027907 | Ga0207428_10053281 | Ga0207428_100532813 | 321 |
| 189 | 3300046678 | Ga0495599_0086526 | Ga0495599_0086526_392_1381 | 321 |
| 190 | 3300050511 | nmdc:mga08y16_120242_c1 | nmdc:mga08y16_120242_c1_961_1947 | 321 |
| 191 | 3300050511 | nmdc:mga08y16_404214_c1 | nmdc:mga08y16_404214_c1_140_1114 | 321 |
| 192 | 3300050512 | nmdc:mga0n895_46940_c1 | nmdc:mga0n895_46940_c1_2375_3349 | 321 |
| 193 | 3300050513 | nmdc:mga0rr50_149715_c1 | nmdc:mga0rr50_149715_c1_377_1351 | 321 |
| 194 | 3300050515 | nmdc:mga0a205_68336_c1 | nmdc:mga0a205_68336_c1_1862_2836 | 321 |
| 195 | 3300005459 | Ga0068867_100092963 | Ga0068867_1000929632 | 323 |
| 196 | 3300005545 | Ga0070695_100069125 | Ga0070695_1000691252 | 323 |
| 197 | 3300005546 | Ga0070696_100018685 | Ga0070696_1000186856 | 323 |
| 198 | 3300013297 | Ga0157378_10060912 | Ga0157378_100609122 | 323 |
| 199 | 3300013297 | Ga0157378_10227955 | Ga0157378_102279552 | 323 |
| 200 | 3300014326 | Ga0157380_10209430 | Ga0157380_102094302 | 323 |
| 201 | 3300025899 | Ga0207642_10093556 | Ga0207642_100935562 | 323 |
| 202 | 3300026089 | Ga0207648_10091646 | Ga0207648_100916463 | 323 |
| 203 | 3300049588 | Ga0501072_0019990 | Ga0501072_0019990_182_1183 | 323 |
| 204 | 3300050511 | nmdc:mga08y16_83078_c1 | nmdc:mga08y16_83078_c1_1019_1999 | 323 |
| 205 | 3300005331 | Ga0070670_100230156 | Ga0070670_1002301562 | 324 |
| 206 | 3300005444 | Ga0070694_100047868 | Ga0070694_1000478682 | 324 |
| 207 | 3300005445 | Ga0070708_100108614 | Ga0070708_1001086142 | 324 |
| 208 | 3300005445 | Ga0070708_100187462 | Ga0070708_1001874622 | 324 |
| 209 | 3300005467 | Ga0070706_100003928 | Ga0070706_1000039288 | 324 |
| 210 | 3300005467 | Ga0070706_100044134 | Ga0070706_1000441342 | 324 |
| 211 | 3300005468 | Ga0070707_100045468 | Ga0070707_1000454683 | 324 |
| 212 | 3300005518 | Ga0070699_100234239 | Ga0070699_1002342391 | 324 |
| 213 | 3300005536 | Ga0070697_100047520 | Ga0070697_1000475202 | 324 |
| 214 | 3300005545 | Ga0070695_100002498 | Ga0070695_1000024986 | 324 |
| 215 | 3300005549 | Ga0070704_100043338 | Ga0070704_1000433382 | 324 |
| 216 | 3300005937 | Ga0081455_10000868 | Ga0081455_100008689 | 324 |
| 217 | 3300005937 | Ga0081455_10189990 | Ga0081455_101899902 | 324 |
| 218 | 3300006844 | Ga0075428_100003167 | Ga0075428_10000316714 | 324 |
| 219 | 3300006844 | Ga0075428_100172830 | Ga0075428_1001728303 | 324 |
| 220 | 3300006846 | Ga0075430_100003492 | Ga0075430_1000034923 | 324 |
| 221 | 3300006846 | Ga0075430_100007192 | Ga0075430_1000071923 | 324 |
| 222 | 3300006846 | Ga0075430_100028925 | Ga0075430_1000289252 | 324 |
| 223 | 3300006847 | Ga0075431_100001936 | Ga0075431_10000193616 | 324 |
| 224 | 3300006852 | Ga0075433_10000839 | Ga0075433_1000083915 | 324 |
| 225 | 3300006852 | Ga0075433_10006319 | Ga0075433_100063196 | 324 |
| 226 | 3300006852 | Ga0075433_10163292 | Ga0075433_101632922 | 324 |
| 227 | 3300006871 | Ga0075434_100001347 | Ga0075434_10000134714 | 324 |
| 228 | 3300006871 | Ga0075434_100094218 | Ga0075434_1000942183 | 324 |
| 229 | 3300006871 | Ga0075434_100239016 | Ga0075434_1002390162 | 324 |
| 230 | 3300006880 | Ga0075429_100002856 | Ga0075429_10000285610 | 324 |
| 231 | 3300006880 | Ga0075429_100143036 | Ga0075429_1001430363 | 324 |
| 232 | 3300006914 | Ga0075436_100105572 | Ga0075436_1001055722 | 324 |
| 233 | 3300007076 | Ga0075435_100243540 | Ga0075435_1002435401 | 324 |
| 234 | 3300009094 | Ga0111539_10001292 | Ga0111539_1000129224 | 324 |
| 235 | 3300009094 | Ga0111539_10001789 | Ga0111539_1000178919 | 324 |
| 236 | 3300009094 | Ga0111539_10250103 | Ga0111539_102501032 | 324 |
| 237 | 3300009094 | Ga0111539_10505433 | Ga0111539_105054332 | 324 |
| 238 | 3300009147 | Ga0114129_10408947 | Ga0114129_104089472 | 324 |
| 239 | 3300013307 | Ga0157372_10074909 | Ga0157372_100749095 | 324 |
| 240 | 3300014325 | Ga0163163_10108966 | Ga0163163_101089662 | 324 |
| 241 | 3300025910 | Ga0207684_10237013 | Ga0207684_102370132 | 324 |
| 242 | 3300025912 | Ga0207707_10350312 | Ga0207707_103503122 | 324 |
| 243 | 3300025922 | Ga0207646_10039239 | Ga0207646_100392393 | 324 |
| 244 | 3300025925 | Ga0207650_10147568 | Ga0207650_101475681 | 324 |
| 245 | 3300025942 | Ga0207689_10046149 | Ga0207689_100461492 | 324 |
| 246 | 3300025945 | Ga0207679_10066350 | Ga0207679_100663505 | 324 |
| 247 | 3300027360 | Ga0209969_1001925 | Ga0209969_10019253 | 324 |
| 248 | 3300027364 | Ga0209967_1002901 | Ga0209967_10029013 | 324 |
| 249 | 3300027378 | Ga0209981_1000322 | Ga0209981_10003223 | 324 |
| 250 | 3300027424 | Ga0209984_1003320 | Ga0209984_10033202 | 324 |
| 251 | 3300027471 | Ga0209995_1000169 | Ga0209995_100016911 | 324 |
| 252 | 3300027526 | Ga0209968_1007165 | Ga0209968_10071652 | 324 |
| 253 | 3300027543 | Ga0209999_1000030 | Ga0209999_100003012 | 324 |
| 254 | 3300027552 | Ga0209982_1000171 | Ga0209982_10001717 | 324 |
| 255 | 3300027617 | Ga0210002_1000333 | Ga0210002_10003332 | 324 |
| 256 | 3300027665 | Ga0209983_1004720 | Ga0209983_10047203 | 324 |
| 257 | 3300027682 | Ga0209971_1000037 | Ga0209971_100003736 | 324 |
| 258 | 3300027695 | Ga0209966_1000378 | Ga0209966_100037812 | 324 |
| 259 | 3300027717 | Ga0209998_10000042 | Ga0209998_1000004220 | 324 |
| 260 | 3300027876 | Ga0209974_10000465 | Ga0209974_100004658 | 324 |
| 261 | 3300027907 | Ga0207428_10000849 | Ga0207428_1000084916 | 324 |
| 262 | 3300027907 | Ga0207428_10007638 | Ga0207428_1000763811 | 324 |
| 263 | 3300031731 | Ga0307405_10243446 | Ga0307405_102434462 | 324 |
| 264 | 3300031901 | Ga0307406_10012405 | Ga0307406_100124057 | 324 |
| 265 | 3300032002 | Ga0307416_100369476 | Ga0307416_1003694762 | 324 |
| 266 | 3300035088 | Ga0373940_0042584 | Ga0373940_0042584_224_1207 | 324 |
| 267 | 3300035241 | Ga0373961_0022917 | Ga0373961_0022917_260_1243 | 324 |
| 268 | 3300035691 | Ga0373931_0071219 | Ga0373931_0071219_300_1283 | 324 |
| 269 | 3300037312 | Ga0395899_0040764 | Ga0395899_0040764_765_1754 | 324 |
| 270 | 3300037418 | Ga0395900_0002273 | Ga0395900_0002273_19606_20595 | 324 |
| 271 | 3300037466 | Ga0395898_0027972 | Ga0395898_0027972_2745_3734 | 324 |
| 272 | 3300038443 | Ga0395901_0012102 | Ga0395901_0012102_5107_6096 | 324 |
| 273 | 3300042439 | Ga0439464_0005441 | Ga0439464_0005441_2195_3229 | 324 |
| 274 | 3300042461 | Ga0439460_0000197 | Ga0439460_0000197_7185_8219 | 324 |
| 275 | 3300045051 | Ga0451576_0502673 | Ga0451576_0502673_178_1167 | 324 |
| 276 | 3300048912 | Ga0496109_0491597 | Ga0496109_0491597_162_1145 | 324 |
| 277 | 3300049576 | Ga0501040_0002340 | Ga0501040_0002340_6271_7254 | 324 |
| 278 | 3300049576 | Ga0501040_0023651 | Ga0501040_0023651_830_1819 | 324 |
| 279 | 3300049576 | Ga0501040_0104051 | Ga0501040_0104051_856_1845 | 324 |
| 280 | 3300049578 | Ga0501042_0104850 | Ga0501042_0104850_25_1014 | 324 |
| 281 | 3300049582 | Ga0501048_0010077 | Ga0501048_0010077_1236_2225 | 324 |
| 282 | 3300049588 | Ga0501072_0096516 | Ga0501072_0096516_889_1878 | 324 |
| 283 | 3300049590 | Ga0501074_0025264 | Ga0501074_0025264_3163_4152 | 324 |
| 284 | 3300049590 | Ga0501074_0044826 | Ga0501074_0044826_575_1558 | 324 |
| 285 | 3300049591 | Ga0501075_0128849 | Ga0501075_0128849_538_1527 | 324 |
| 286 | 3300049592 | Ga0501076_0011802 | Ga0501076_0011802_3634_4623 | 324 |
| 287 | 3300049679 | Ga0501249_009868 | Ga0501249_009868_892_1866 | 324 |
| 288 | 3300049741 | Ga0501079_0005334 | Ga0501079_0005334_2669_3658 | 324 |
| 289 | 3300049741 | Ga0501079_0018603 | Ga0501079_0018603_557_1540 | 324 |
| 290 | 3300049742 | Ga0501080_0110250 | Ga0501080_0110250_316_1305 | 324 |
| 291 | 3300049743 | Ga0501081_0002472 | Ga0501081_0002472_7570_8553 | 324 |
| 292 | 3300049744 | Ga0501083_0172471 | Ga0501083_0172471_219_1355 | 324 |
| 293 | 3300049824 | Ga0501045_0071527 | Ga0501045_0071527_108_1091 | 324 |
| 294 | 3300050507 | nmdc:mga05p37_68472_c1 | nmdc:mga05p37_68472_c1_495_1469 | 324 |
| 295 | 3300050508 | nmdc:mga09592_149660_c1 | nmdc:mga09592_149660_c1_896_1870 | 324 |
| 296 | 3300050508 | nmdc:mga09592_187481_c1 | nmdc:mga09592_187481_c1_108_1097 | 324 |
| 297 | 3300050508 | nmdc:mga09592_54900_c1 | nmdc:mga09592_54900_c1_1444_2427 | 324 |
| 298 | 3300050509 | nmdc:mga0qj67_24945_c1 | nmdc:mga0qj67_24945_c1_488_1462 | 324 |
| 299 | 3300050509 | nmdc:mga0qj67_60996_c1 | nmdc:mga0qj67_60996_c1_1751_2734 | 324 |
| 300 | 3300050510 | nmdc:mga06r32_100838_c1 | nmdc:mga06r32_100838_c1_1077_2051 | 324 |
| 301 | 3300050511 | nmdc:mga08y16_149523_c1 | nmdc:mga08y16_149523_c1_1118_2101 | 324 |
| 302 | 3300050511 | nmdc:mga08y16_3252_c1 | nmdc:mga08y16_3252_c1_14261_15250 | 324 |
| 303 | 3300050511 | nmdc:mga08y16_8329_c1 | nmdc:mga08y16_8329_c1_3791_4765 | 324 |
| 304 | 3300050512 | nmdc:mga0n895_101899_c1 | nmdc:mga0n895_101899_c1_1310_2293 | 324 |
| 305 | 3300050512 | nmdc:mga0n895_477_c1 | nmdc:mga0n895_477_c1_10922_11896 | 324 |
| 306 | 3300050512 | nmdc:mga0n895_57044_c1 | nmdc:mga0n895_57044_c1_474_1457 | 324 |
| 307 | 3300050514 | nmdc:mga08x19_16828_c1 | nmdc:mga08x19_16828_c1_831_1817 | 324 |
| 308 | 3300050515 | nmdc:mga0a205_646_c1 | nmdc:mga0a205_646_c1_19138_20112 | 324 |
| 309 | 3300054114 | Ga0501084_0026115 | Ga0501084_0026115_14_997 | 324 |
| 310 | 3300060353 | Ga0501082_0009259 | Ga0501082_0009259_1920_2909 | 324 |
| 311 | 3300060353 | Ga0501082_0037237 | Ga0501082_0037237_265_1248 | 324 |
| 312 | 3300005289 | Ga0065704_10038053 | Ga0065704_100380531 | 325 |
| 313 | 3300005290 | Ga0065712_10074863 | Ga0065712_100748635 | 325 |
| 314 | 3300005293 | Ga0065715_10167217 | Ga0065715_101672172 | 325 |
| 315 | 3300005295 | Ga0065707_10167099 | Ga0065707_101670992 | 325 |
| 316 | 3300005334 | Ga0068869_100067405 | Ga0068869_1000674052 | 325 |
| 317 | 3300005341 | Ga0070691_10064022 | Ga0070691_100640222 | 325 |
| 318 | 3300005354 | Ga0070675_100003563 | Ga0070675_10000356310 | 325 |
| 319 | 3300005354 | Ga0070675_100016428 | Ga0070675_1000164284 | 325 |
| 320 | 3300005364 | Ga0070673_100005375 | Ga0070673_1000053752 | 325 |
| 321 | 3300005365 | Ga0070688_100025693 | Ga0070688_1000256933 | 325 |
| 322 | 3300005406 | Ga0070703_10006171 | Ga0070703_100061714 | 325 |
| 323 | 3300005434 | Ga0070709_10086217 | Ga0070709_100862173 | 325 |
| 324 | 3300005441 | Ga0070700_100028458 | Ga0070700_1000284584 | 325 |
| 325 | 3300005441 | Ga0070700_100199078 | Ga0070700_1001990781 | 325 |
| 326 | 3300005444 | Ga0070694_100019776 | Ga0070694_1000197762 | 325 |
| 327 | 3300005445 | Ga0070708_100042179 | Ga0070708_1000421795 | 325 |
| 328 | 3300005445 | Ga0070708_100086704 | Ga0070708_1000867042 | 325 |
| 329 | 3300005445 | Ga0070708_100350872 | Ga0070708_1003508721 | 325 |
| 330 | 3300005445 | Ga0070708_100353277 | Ga0070708_1003532772 | 325 |
| 331 | 3300005467 | Ga0070706_100217518 | Ga0070706_1002175182 | 325 |
| 332 | 3300005467 | Ga0070706_100307535 | Ga0070706_1003075352 | 325 |
| 333 | 3300005467 | Ga0070706_100341892 | Ga0070706_1003418922 | 325 |
| 334 | 3300005471 | Ga0070698_100010269 | Ga0070698_1000102697 | 325 |
| 335 | 3300005471 | Ga0070698_100016413 | Ga0070698_1000164132 | 325 |
| 336 | 3300005471 | Ga0070698_100336207 | Ga0070698_1003362072 | 325 |
| 337 | 3300005518 | Ga0070699_100003941 | Ga0070699_1000039417 | 325 |
| 338 | 3300005518 | Ga0070699_100023130 | Ga0070699_1000231306 | 325 |
| 339 | 3300005518 | Ga0070699_100080194 | Ga0070699_1000801943 | 325 |
| 340 | 3300005518 | Ga0070699_100178574 | Ga0070699_1001785743 | 325 |
| 341 | 3300005530 | Ga0070679_100459017 | Ga0070679_1004590172 | 325 |
| 342 | 3300005536 | Ga0070697_100008644 | Ga0070697_1000086448 | 325 |
| 343 | 3300005536 | Ga0070697_100048568 | Ga0070697_1000485682 | 325 |
| 344 | 3300005536 | Ga0070697_100059571 | Ga0070697_1000595711 | 325 |
| 345 | 3300005536 | Ga0070697_100099340 | Ga0070697_1000993402 | 325 |
| 346 | 3300005536 | Ga0070697_100139723 | Ga0070697_1001397233 | 325 |
| 347 | 3300005536 | Ga0070697_100341224 | Ga0070697_1003412242 | 325 |
| 348 | 3300005543 | Ga0070672_100084620 | Ga0070672_1000846202 | 325 |
| 349 | 3300005545 | Ga0070695_100010416 | Ga0070695_1000104166 | 325 |
| 350 | 3300005545 | Ga0070695_100021438 | Ga0070695_1000214382 | 325 |
| 351 | 3300005546 | Ga0070696_100247991 | Ga0070696_1002479912 | 325 |
| 352 | 3300005549 | Ga0070704_100069188 | Ga0070704_1000691883 | 325 |
| 353 | 3300005549 | Ga0070704_100118148 | Ga0070704_1001181483 | 325 |
| 354 | 3300005564 | Ga0070664_100230313 | Ga0070664_1002303132 | 325 |
| 355 | 3300005617 | Ga0068859_100102459 | Ga0068859_1001024595 | 325 |
| 356 | 3300005840 | Ga0068870_10092137 | Ga0068870_100921371 | 325 |
| 357 | 3300005843 | Ga0068860_100027366 | Ga0068860_1000273662 | 325 |
| 358 | 3300005937 | Ga0081455_10064100 | Ga0081455_100641003 | 325 |
| 359 | 3300005937 | Ga0081455_10293574 | Ga0081455_102935742 | 325 |
| 360 | 3300005983 | Ga0081540_1019869 | Ga0081540_10198692 | 325 |
| 361 | 3300006051 | Ga0075364_10078395 | Ga0075364_100783952 | 325 |
| 362 | 3300006051 | Ga0075364_10234277 | Ga0075364_102342772 | 325 |
| 363 | 3300006173 | Ga0070716_100035251 | Ga0070716_1000352512 | 325 |
| 364 | 3300006177 | Ga0075362_10000233 | Ga0075362_100002338 | 325 |
| 365 | 3300006178 | Ga0075367_10140955 | Ga0075367_101409552 | 325 |
| 366 | 3300006195 | Ga0075366_10068828 | Ga0075366_100688282 | 325 |
| 367 | 3300006353 | Ga0075370_10042581 | Ga0075370_100425812 | 325 |
| 368 | 3300006844 | Ga0075428_100004968 | Ga0075428_10000496812 | 325 |
| 369 | 3300006844 | Ga0075428_100119768 | Ga0075428_1001197682 | 325 |
| 370 | 3300006844 | Ga0075428_100123681 | Ga0075428_1001236814 | 325 |
| 371 | 3300006844 | Ga0075428_100151261 | Ga0075428_1001512614 | 325 |
| 372 | 3300006846 | Ga0075430_100004097 | Ga0075430_10000409711 | 325 |
| 373 | 3300006846 | Ga0075430_100016784 | Ga0075430_1000167842 | 325 |
| 374 | 3300006847 | Ga0075431_100000082 | Ga0075431_10000008214 | 325 |
| 375 | 3300006847 | Ga0075431_100001270 | Ga0075431_10000127022 | 325 |
| 376 | 3300006847 | Ga0075431_100046856 | Ga0075431_1000468564 | 325 |
| 377 | 3300006847 | Ga0075431_100052800 | Ga0075431_1000528005 | 325 |
| 378 | 3300006847 | Ga0075431_100433937 | Ga0075431_1004339371 | 325 |
| 379 | 3300006852 | Ga0075433_10000427 | Ga0075433_1000042725 | 325 |
| 380 | 3300006852 | Ga0075433_10002893 | Ga0075433_100028938 | 325 |
| 381 | 3300006852 | Ga0075433_10108639 | Ga0075433_101086392 | 325 |
| 382 | 3300006871 | Ga0075434_100000180 | Ga0075434_10000018013 | 325 |
| 383 | 3300006871 | Ga0075434_100062153 | Ga0075434_1000621535 | 325 |
| 384 | 3300006871 | Ga0075434_100073024 | Ga0075434_1000730243 | 325 |
| 385 | 3300006871 | Ga0075434_100085881 | Ga0075434_1000858812 | 325 |
| 386 | 3300006880 | Ga0075429_100002106 | Ga0075429_10000210613 | 325 |
| 387 | 3300006880 | Ga0075429_100002798 | Ga0075429_10000279814 | 325 |
| 388 | 3300006880 | Ga0075429_100022792 | Ga0075429_1000227926 | 325 |
| 389 | 3300006880 | Ga0075429_100023887 | Ga0075429_1000238873 | 325 |
| 390 | 3300006880 | Ga0075429_100063338 | Ga0075429_1000633382 | 325 |
| 391 | 3300006914 | Ga0075436_100115230 | Ga0075436_1001152302 | 325 |
| 392 | 3300006931 | Ga0097620_100102452 | Ga0097620_1001024525 | 325 |
| 393 | 3300007076 | Ga0075435_100063505 | Ga0075435_1000635052 | 325 |
| 394 | 3300007076 | Ga0075435_100195556 | Ga0075435_1001955562 | 325 |
| 395 | 3300007265 | Ga0099794_10004256 | Ga0099794_100042562 | 325 |
| 396 | 3300007265 | Ga0099794_10130628 | Ga0099794_101306281 | 325 |
| 397 | 3300009094 | Ga0111539_10001353 | Ga0111539_1000135329 | 325 |
| 398 | 3300009094 | Ga0111539_10002439 | Ga0111539_1000243913 | 325 |
| 399 | 3300009094 | Ga0111539_10012644 | Ga0111539_100126449 | 325 |
| 400 | 3300009098 | Ga0105245_10290132 | Ga0105245_102901321 | 325 |
| 401 | 3300009147 | Ga0114129_10000110 | Ga0114129_1000011038 | 325 |
| 402 | 3300009147 | Ga0114129_10001511 | Ga0114129_1000151112 | 325 |
| 403 | 3300009147 | Ga0114129_10020399 | Ga0114129_100203995 | 325 |
| 404 | 3300009147 | Ga0114129_10044379 | Ga0114129_100443793 | 325 |
| 405 | 3300009147 | Ga0114129_10452572 | Ga0114129_104525722 | 325 |
| 406 | 3300009147 | Ga0114129_10574916 | Ga0114129_105749162 | 325 |
| 407 | 3300013308 | Ga0157375_10120206 | Ga0157375_101202064 | 325 |
| 408 | 3300014326 | Ga0157380_10546340 | Ga0157380_105463402 | 325 |
| 409 | 3300014969 | Ga0157376_10140371 | Ga0157376_101403711 | 325 |
| 410 | 3300025906 | Ga0207699_10042288 | Ga0207699_100422883 | 325 |
| 411 | 3300025910 | Ga0207684_10084506 | Ga0207684_100845065 | 325 |
| 412 | 3300025926 | Ga0207659_10003928 | Ga0207659_100039287 | 325 |
| 413 | 3300025926 | Ga0207659_10004886 | Ga0207659_100048865 | 325 |
| 414 | 3300025926 | Ga0207659_10010902 | Ga0207659_100109024 | 325 |
| 415 | 3300025936 | Ga0207670_10024764 | Ga0207670_100247643 | 325 |
| 416 | 3300025936 | Ga0207670_10336500 | Ga0207670_103365002 | 325 |
| 417 | 3300025940 | Ga0207691_10071198 | Ga0207691_100711984 | 325 |
| 418 | 3300025942 | Ga0207689_10006142 | Ga0207689_100061426 | 325 |
| 419 | 3300025945 | Ga0207679_10205329 | Ga0207679_102053292 | 325 |
| 420 | 3300025960 | Ga0207651_10061269 | Ga0207651_100612692 | 325 |
| 421 | 3300025960 | Ga0207651_10301674 | Ga0207651_103016742 | 325 |
| 422 | 3300026118 | Ga0207675_100322394 | Ga0207675_1003223942 | 325 |
| 423 | 3300027614 | Ga0209970_1001621 | Ga0209970_10016212 | 325 |
| 424 | 3300027671 | Ga0209588_1003834 | Ga0209588_10038343 | 325 |
| 425 | 3300027671 | Ga0209588_1013367 | Ga0209588_10133672 | 325 |
| 426 | 3300027907 | Ga0207428_10000027 | Ga0207428_10000027194 | 325 |
| 427 | 3300027907 | Ga0207428_10011180 | Ga0207428_100111808 | 325 |
| 428 | 3300027907 | Ga0207428_10020343 | Ga0207428_100203435 | 325 |
| 429 | 3300027907 | Ga0207428_10104636 | Ga0207428_101046362 | 325 |
| 430 | 3300028381 | Ga0268264_10016829 | Ga0268264_100168292 | 325 |
| 431 | 3300031903 | Ga0307407_10068199 | Ga0307407_100681992 | 325 |
| 432 | 3300032126 | Ga0307415_100176911 | Ga0307415_1001769111 | 325 |
| 433 | 3300035088 | Ga0373940_0010807 | Ga0373940_0010807_982_1971 | 325 |
| 434 | 3300035115 | Ga0373941_0025272 | Ga0373941_0025272_550_1539 | 325 |
| 435 | 3300042003 | Ga0439443_008792 | Ga0439443_008792_260_1246 | 325 |
| 436 | 3300042436 | Ga0439435_0059568 | Ga0439435_0059568_110_1090 | 325 |
| 437 | 3300044673 | Ga0453683_0034615 | Ga0453683_0034615_2126_3118 | 325 |
| 438 | 3300045051 | Ga0451576_0005141 | Ga0451576_0005141_8647_9669 | 325 |
| 439 | 3300045051 | Ga0451576_0030406 | Ga0451576_0030406_505_1527 | 325 |
| 440 | 3300045051 | Ga0451576_0199378 | Ga0451576_0199378_75_1064 | 325 |
| 441 | 3300046472 | Ga0495580_0000727 | Ga0495580_0000727_5685_6674 | 325 |
| 442 | 3300046537 | Ga0495598_0006886 | Ga0495598_0006886_634_1614 | 325 |
| 443 | 3300046615 | Ga0495656_0009898 | Ga0495656_0009898_2176_3156 | 325 |
| 444 | 3300046684 | Ga0495669_0029039 | Ga0495669_0029039_527_1522 | 325 |
| 445 | 3300046684 | Ga0495669_0031228 | Ga0495669_0031228_941_1927 | 325 |
| 446 | 3300046691 | Ga0495670_0080606 | Ga0495670_0080606_151_1137 | 325 |
| 447 | 3300048912 | Ga0496109_0149751 | Ga0496109_0149751_487_1467 | 325 |
| 448 | 3300048912 | Ga0496109_0297097 | Ga0496109_0297097_174_1175 | 325 |
| 449 | 3300048916 | Ga0496113_0040027 | Ga0496113_0040027_1153_2133 | 325 |
| 450 | 3300049572 | Ga0501036_0041097 | Ga0501036_0041097_1776_2753 | 325 |
| 451 | 3300049572 | Ga0501036_0290159 | Ga0501036_0290159_58_1050 | 325 |
| 452 | 3300049575 | Ga0501039_0110564 | Ga0501039_0110564_548_1549 | 325 |
| 453 | 3300049576 | Ga0501040_0053982 | Ga0501040_0053982_1288_2265 | 325 |
| 454 | 3300049577 | Ga0501041_0049602 | Ga0501041_0049602_67_1044 | 325 |
| 455 | 3300049578 | Ga0501042_0017571 | Ga0501042_0017571_2267_3262 | 325 |
| 456 | 3300049578 | Ga0501042_0055506 | Ga0501042_0055506_1268_2245 | 325 |
| 457 | 3300049583 | Ga0501067_0009738 | Ga0501067_0009738_374_1360 | 325 |
| 458 | 3300049585 | Ga0501069_0030155 | Ga0501069_0030155_391_1386 | 325 |
| 459 | 3300049588 | Ga0501072_0007493 | Ga0501072_0007493_1358_2335 | 325 |
| 460 | 3300049588 | Ga0501072_0086981 | Ga0501072_0086981_384_1379 | 325 |
| 461 | 3300049590 | Ga0501074_0113887 | Ga0501074_0113887_809_1786 | 325 |
| 462 | 3300049590 | Ga0501074_0122781 | Ga0501074_0122781_653_1639 | 325 |
| 463 | 3300049591 | Ga0501075_0088260 | Ga0501075_0088260_704_1702 | 325 |
| 464 | 3300049592 | Ga0501076_0000831 | Ga0501076_0000831_5363_6358 | 325 |
| 465 | 3300049592 | Ga0501076_0183162 | Ga0501076_0183162_446_1423 | 325 |
| 466 | 3300049593 | Ga0501077_0007379 | Ga0501077_0007379_887_1882 | 325 |
| 467 | 3300049593 | Ga0501077_0113638 | Ga0501077_0113638_566_1564 | 325 |
| 468 | 3300049593 | Ga0501077_0151814 | Ga0501077_0151814_10_1002 | 325 |
| 469 | 3300049742 | Ga0501080_0137679 | Ga0501080_0137679_403_1395 | 325 |
| 470 | 3300049743 | Ga0501081_0010638 | Ga0501081_0010638_4899_5894 | 325 |
| 471 | 3300049743 | Ga0501081_0282466 | Ga0501081_0282466_143_1135 | 325 |
| 472 | 3300049743 | Ga0501081_0291248 | Ga0501081_0291248_165_1154 | 325 |
| 473 | 3300049824 | Ga0501045_0008724 | Ga0501045_0008724_4009_5004 | 325 |
| 474 | 3300050489 | nmdc:mga03683_4325_c1 | nmdc:mga03683_4325_c1_168_1160 | 325 |
| 475 | 3300050491 | nmdc:mga00v17_123621_c1 | nmdc:mga00v17_123621_c1_197_1189 | 325 |
| 476 | 3300050491 | nmdc:mga00v17_190952_c1 | nmdc:mga00v17_190952_c1_156_1154 | 325 |
| 477 | 3300050491 | nmdc:mga00v17_2153_c1 | nmdc:mga00v17_2153_c1_6766_7758 | 325 |
| 478 | 3300050493 | nmdc:mga0k408_10311_c1 | nmdc:mga0k408_10311_c1_855_1847 | 325 |
| 479 | 3300050494 | nmdc:mga06z11_18520_c1 | nmdc:mga06z11_18520_c1_1856_2848 | 325 |
| 480 | 3300050494 | nmdc:mga06z11_36572_c1 | nmdc:mga06z11_36572_c1_1125_2117 | 325 |
| 481 | 3300050496 | nmdc:mga07m45_9361_c1 | nmdc:mga07m45_9361_c1_637_1623 | 325 |
| 482 | 3300050507 | nmdc:mga05p37_115985_c1 | nmdc:mga05p37_115985_c1_394_1383 | 325 |
| 483 | 3300050507 | nmdc:mga05p37_13298_c1 | nmdc:mga05p37_13298_c1_3736_4722 | 325 |
| 484 | 3300050507 | nmdc:mga05p37_17395_c1 | nmdc:mga05p37_17395_c1_2696_3691 | 325 |
| 485 | 3300050507 | nmdc:mga05p37_26199_c1 | nmdc:mga05p37_26199_c1_160_1143 | 325 |
| 486 | 3300050507 | nmdc:mga05p37_405715_c1 | nmdc:mga05p37_405715_c1_63_1043 | 325 |
| 487 | 3300050507 | nmdc:mga05p37_42435_c1 | nmdc:mga05p37_42435_c1_794_1783 | 325 |
| 488 | 3300050507 | nmdc:mga05p37_63188_c1 | nmdc:mga05p37_63188_c1_2251_3228 | 325 |
| 489 | 3300050507 | nmdc:mga05p37_7406_c1 | nmdc:mga05p37_7406_c1_9963_10952 | 325 |
| 490 | 3300050508 | nmdc:mga09592_1944_c1 | nmdc:mga09592_1944_c1_9317_10303 | 325 |
| 491 | 3300050508 | nmdc:mga09592_29511_c1 | nmdc:mga09592_29511_c1_3315_4298 | 325 |
| 492 | 3300050508 | nmdc:mga09592_3878_c1 | nmdc:mga09592_3878_c1_10871_11860 | 325 |
| 493 | 3300050508 | nmdc:mga09592_5317_c1 | nmdc:mga09592_5317_c1_4697_5686 | 325 |
| 494 | 3300050508 | nmdc:mga09592_53687_c1 | nmdc:mga09592_53687_c1_1947_2936 | 325 |
| 495 | 3300050509 | nmdc:mga0qj67_1433_c1 | nmdc:mga0qj67_1433_c1_10562_11557 | 325 |
| 496 | 3300050509 | nmdc:mga0qj67_21599_c1 | nmdc:mga0qj67_21599_c1_3812_4798 | 325 |
| 497 | 3300050509 | nmdc:mga0qj67_26059_c1 | nmdc:mga0qj67_26059_c1_1181_2161 | 325 |
| 498 | 3300050509 | nmdc:mga0qj67_9223_c1 | nmdc:mga0qj67_9223_c1_4246_5223 | 325 |
| 499 | 3300050510 | nmdc:mga06r32_3786_c1 | nmdc:mga06r32_3786_c1_4268_5254 | 325 |
| 500 | 3300050510 | nmdc:mga06r32_7977_c1 | nmdc:mga06r32_7977_c1_723_1718 | 325 |
| 501 | 3300050510 | nmdc:mga06r32_80134_c1 | nmdc:mga06r32_80134_c1_1124_2104 | 325 |
| 502 | 3300050511 | nmdc:mga08y16_104951_c1 | nmdc:mga08y16_104951_c1_1245_2225 | 325 |
| 503 | 3300050511 | nmdc:mga08y16_17787_c1 | nmdc:mga08y16_17787_c1_275_1264 | 325 |
| 504 | 3300050511 | nmdc:mga08y16_243078_c1 | nmdc:mga08y16_243078_c1_293_1279 | 325 |
| 505 | 3300050511 | nmdc:mga08y16_2919_c1 | nmdc:mga08y16_2919_c1_3268_4248 | 325 |
| 506 | 3300050511 | nmdc:mga08y16_49615_c1 | nmdc:mga08y16_49615_c1_770_1759 | 325 |
| 507 | 3300050512 | nmdc:mga0n895_2183_c1 | nmdc:mga0n895_2183_c1_10998_12020 | 325 |
| 508 | 3300050512 | nmdc:mga0n895_231840_c1 | nmdc:mga0n895_231840_c1_214_1194 | 325 |
| 509 | 3300050512 | nmdc:mga0n895_300722_c1 | nmdc:mga0n895_300722_c1_168_1163 | 325 |
| 510 | 3300050512 | nmdc:mga0n895_60106_c1 | nmdc:mga0n895_60106_c1_1791_2780 | 325 |
| 511 | 3300050512 | nmdc:mga0n895_85010_c1 | nmdc:mga0n895_85010_c1_44_1033 | 325 |
| 512 | 3300050513 | nmdc:mga0rr50_13734_c1 | nmdc:mga0rr50_13734_c1_167_1156 | 325 |
| 513 | 3300050513 | nmdc:mga0rr50_151274_c1 | nmdc:mga0rr50_151274_c1_442_1431 | 325 |
| 514 | 3300050515 | nmdc:mga0a205_106355_c1 | nmdc:mga0a205_106355_c1_442_1431 | 325 |
| 515 | 3300050515 | nmdc:mga0a205_132329_c1 | nmdc:mga0a205_132329_c1_86_1108 | 325 |
| 516 | 3300050515 | nmdc:mga0a205_186096_c1 | nmdc:mga0a205_186096_c1_442_1431 | 325 |
| 517 | 3300050515 | nmdc:mga0a205_227_c1 | nmdc:mga0a205_227_c1_27254_28243 | 325 |
| 518 | 3300050515 | nmdc:mga0a205_47712_c1 | nmdc:mga0a205_47712_c1_819_1805 | 325 |
| 519 | 3300050515 | nmdc:mga0a205_8978_c1 | nmdc:mga0a205_8978_c1_2051_3040 | 325 |
| 520 | 3300060353 | Ga0501082_0003845 | Ga0501082_0003845_2914_3909 | 325 |
| 521 | 3300061734 | Ga0530510_0012598 | Ga0530510_0012598_1922_2917 | 325 |
| 522 | 3300061734 | Ga0530510_0020309 | Ga0530510_0020309_2774_3769 | 325 |
| 523 | 3300061734 | Ga0530510_0059589 | Ga0530510_0059589_1454_2431 | 325 |
| 524 | 3300003203 | JGI25406J46586_10011300 | JGI25406J46586_100113003 | 326 |
| 525 | 3300005290 | Ga0065712_10002361 | Ga0065712_100023618 | 326 |
| 526 | 3300005293 | Ga0065715_10005733 | Ga0065715_100057335 | 326 |
| 527 | 3300005293 | Ga0065715_10140436 | Ga0065715_101404362 | 326 |
| 528 | 3300005328 | Ga0070676_10031221 | Ga0070676_100312212 | 326 |
| 529 | 3300005330 | Ga0070690_100158211 | Ga0070690_1001582112 | 326 |
| 530 | 3300005331 | Ga0070670_100141714 | Ga0070670_1001417142 | 326 |
| 531 | 3300005334 | Ga0068869_100098310 | Ga0068869_1000983102 | 326 |
| 532 | 3300005335 | Ga0070666_10118073 | Ga0070666_101180732 | 326 |
| 533 | 3300005336 | Ga0070680_100150746 | Ga0070680_1001507463 | 326 |
| 534 | 3300005338 | Ga0068868_100258448 | Ga0068868_1002584482 | 326 |
| 535 | 3300005338 | Ga0068868_100371607 | Ga0068868_1003716072 | 326 |
| 536 | 3300005340 | Ga0070689_100071487 | Ga0070689_1000714873 | 326 |
| 537 | 3300005340 | Ga0070689_100086855 | Ga0070689_1000868552 | 326 |
| 538 | 3300005343 | Ga0070687_100015745 | Ga0070687_1000157456 | 326 |
| 539 | 3300005344 | Ga0070661_100022972 | Ga0070661_1000229721 | 326 |
| 540 | 3300005345 | Ga0070692_10006625 | Ga0070692_100066252 | 326 |
| 541 | 3300005347 | Ga0070668_100049143 | Ga0070668_1000491431 | 326 |
| 542 | 3300005353 | Ga0070669_100012365 | Ga0070669_1000123652 | 326 |
| 543 | 3300005353 | Ga0070669_100017022 | Ga0070669_1000170225 | 326 |
| 544 | 3300005353 | Ga0070669_100066040 | Ga0070669_1000660402 | 326 |
| 545 | 3300005353 | Ga0070669_100281838 | Ga0070669_1002818381 | 326 |
| 546 | 3300005354 | Ga0070675_100011263 | Ga0070675_1000112631 | 326 |
| 547 | 3300005354 | Ga0070675_100367506 | Ga0070675_1003675061 | 326 |
| 548 | 3300005355 | Ga0070671_100044691 | Ga0070671_1000446912 | 326 |
| 549 | 3300005356 | Ga0070674_100003802 | Ga0070674_1000038028 | 326 |
| 550 | 3300005364 | Ga0070673_100079075 | Ga0070673_1000790752 | 326 |
| 551 | 3300005365 | Ga0070688_100348487 | Ga0070688_1003484871 | 326 |
| 552 | 3300005367 | Ga0070667_100034478 | Ga0070667_1000344783 | 326 |
| 553 | 3300005436 | Ga0070713_100171471 | Ga0070713_1001714712 | 326 |
| 554 | 3300005438 | Ga0070701_10017788 | Ga0070701_100177884 | 326 |
| 555 | 3300005438 | Ga0070701_10087067 | Ga0070701_100870672 | 326 |
| 556 | 3300005440 | Ga0070705_100001862 | Ga0070705_1000018627 | 326 |
| 557 | 3300005441 | Ga0070700_100075377 | Ga0070700_1000753772 | 326 |
| 558 | 3300005444 | Ga0070694_100006222 | Ga0070694_1000062225 | 326 |
| 559 | 3300005444 | Ga0070694_100059864 | Ga0070694_1000598643 | 326 |
| 560 | 3300005445 | Ga0070708_100018713 | Ga0070708_1000187132 | 326 |
| 561 | 3300005457 | Ga0070662_100006443 | Ga0070662_1000064438 | 326 |
| 562 | 3300005458 | Ga0070681_10070007 | Ga0070681_100700073 | 326 |
| 563 | 3300005459 | Ga0068867_100038646 | Ga0068867_1000386462 | 326 |
| 564 | 3300005459 | Ga0068867_100084518 | Ga0068867_1000845184 | 326 |
| 565 | 3300005466 | Ga0070685_10045159 | Ga0070685_100451594 | 326 |
| 566 | 3300005467 | Ga0070706_100008450 | Ga0070706_1000084505 | 326 |
| 567 | 3300005468 | Ga0070707_100000729 | Ga0070707_10000072913 | 326 |
| 568 | 3300005471 | Ga0070698_100004426 | Ga0070698_10000442611 | 326 |
| 569 | 3300005471 | Ga0070698_100007713 | Ga0070698_1000077138 | 326 |
| 570 | 3300005518 | Ga0070699_100000534 | Ga0070699_10000053412 | 326 |
| 571 | 3300005518 | Ga0070699_100000712 | Ga0070699_10000071211 | 326 |
| 572 | 3300005518 | Ga0070699_100020623 | Ga0070699_1000206234 | 326 |
| 573 | 3300005536 | Ga0070697_100001086 | Ga0070697_10000108614 | 326 |
| 574 | 3300005536 | Ga0070697_100258750 | Ga0070697_1002587502 | 326 |
| 575 | 3300005543 | Ga0070672_100035906 | Ga0070672_1000359062 | 326 |
| 576 | 3300005545 | Ga0070695_100000112 | Ga0070695_1000001128 | 326 |
| 577 | 3300005546 | Ga0070696_100011986 | Ga0070696_1000119862 | 326 |
| 578 | 3300005549 | Ga0070704_100002373 | Ga0070704_1000023732 | 326 |
| 579 | 3300005549 | Ga0070704_100014720 | Ga0070704_1000147206 | 326 |
| 580 | 3300005549 | Ga0070704_100100306 | Ga0070704_1001003062 | 326 |
| 581 | 3300005564 | Ga0070664_100015438 | Ga0070664_1000154383 | 326 |
| 582 | 3300005577 | Ga0068857_100008027 | Ga0068857_1000080276 | 326 |
| 583 | 3300005617 | Ga0068859_100046788 | Ga0068859_1000467885 | 326 |
| 584 | 3300005617 | Ga0068859_100065876 | Ga0068859_1000658764 | 326 |
| 585 | 3300005618 | Ga0068864_100037064 | Ga0068864_1000370644 | 326 |
| 586 | 3300005618 | Ga0068864_100061059 | Ga0068864_1000610594 | 326 |
| 587 | 3300005618 | Ga0068864_100061602 | Ga0068864_1000616025 | 326 |
| 588 | 3300005618 | Ga0068864_100170777 | Ga0068864_1001707773 | 326 |
| 589 | 3300005719 | Ga0068861_100005274 | Ga0068861_1000052746 | 326 |
| 590 | 3300005840 | Ga0068870_10010546 | Ga0068870_100105464 | 326 |
| 591 | 3300005843 | Ga0068860_100116171 | Ga0068860_1001161712 | 326 |
| 592 | 3300005844 | Ga0068862_100026860 | Ga0068862_1000268602 | 326 |
| 593 | 3300005844 | Ga0068862_100039181 | Ga0068862_1000391815 | 326 |
| 594 | 3300005981 | Ga0081538_10003260 | Ga0081538_100032608 | 326 |
| 595 | 3300005985 | Ga0081539_10000454 | Ga0081539_1000045428 | 326 |
| 596 | 3300006237 | Ga0097621_100159219 | Ga0097621_1001592192 | 326 |
| 597 | 3300006358 | Ga0068871_100116393 | Ga0068871_1001163932 | 326 |
| 598 | 3300006844 | Ga0075428_100004648 | Ga0075428_1000046489 | 326 |
| 599 | 3300006844 | Ga0075428_100006929 | Ga0075428_1000069296 | 326 |
| 600 | 3300006844 | Ga0075428_100012979 | Ga0075428_1000129795 | 326 |
| 601 | 3300006844 | Ga0075428_100036865 | Ga0075428_1000368655 | 326 |
| 602 | 3300006844 | Ga0075428_100131095 | Ga0075428_1001310954 | 326 |
| 603 | 3300006846 | Ga0075430_100029617 | Ga0075430_1000296175 | 326 |
| 604 | 3300006846 | Ga0075430_100032620 | Ga0075430_1000326205 | 326 |
| 605 | 3300006846 | Ga0075430_100315334 | Ga0075430_1003153342 | 326 |
| 606 | 3300006847 | Ga0075431_100000455 | Ga0075431_1000004559 | 326 |
| 607 | 3300006847 | Ga0075431_100001687 | Ga0075431_10000168715 | 326 |
| 608 | 3300006847 | Ga0075431_100227399 | Ga0075431_1002273992 | 326 |
| 609 | 3300006852 | Ga0075433_10000061 | Ga0075433_1000006145 | 326 |
| 610 | 3300006852 | Ga0075433_10005550 | Ga0075433_100055509 | 326 |
| 611 | 3300006852 | Ga0075433_10189199 | Ga0075433_101891992 | 326 |
| 612 | 3300006871 | Ga0075434_100257076 | Ga0075434_1002570762 | 326 |
| 613 | 3300006871 | Ga0075434_100306626 | Ga0075434_1003066262 | 326 |
| 614 | 3300006871 | Ga0075434_100348706 | Ga0075434_1003487062 | 326 |
| 615 | 3300006880 | Ga0075429_100002213 | Ga0075429_10000221311 | 326 |
| 616 | 3300006880 | Ga0075429_100014281 | Ga0075429_1000142818 | 326 |
| 617 | 3300006880 | Ga0075429_100015287 | Ga0075429_1000152874 | 326 |
| 618 | 3300006880 | Ga0075429_100064236 | Ga0075429_1000642365 | 326 |
| 619 | 3300006880 | Ga0075429_100185672 | Ga0075429_1001856722 | 326 |
| 620 | 3300006914 | Ga0075436_100002146 | Ga0075436_1000021464 | 326 |
| 621 | 3300006931 | Ga0097620_100046795 | Ga0097620_1000467955 | 326 |
| 622 | 3300006931 | Ga0097620_100065876 | Ga0097620_1000658764 | 326 |
| 623 | 3300007076 | Ga0075435_100017542 | Ga0075435_1000175423 | 326 |
| 624 | 3300007076 | Ga0075435_100128697 | Ga0075435_1001286973 | 326 |
| 625 | 3300007076 | Ga0075435_100191860 | Ga0075435_1001918602 | 326 |
| 626 | 3300007076 | Ga0075435_100291843 | Ga0075435_1002918432 | 326 |
| 627 | 3300009094 | Ga0111539_10000463 | Ga0111539_1000046357 | 326 |
| 628 | 3300009094 | Ga0111539_10006594 | Ga0111539_1000659411 | 326 |
| 629 | 3300009094 | Ga0111539_10024427 | Ga0111539_100244278 | 326 |
| 630 | 3300009094 | Ga0111539_10135636 | Ga0111539_101356362 | 326 |
| 631 | 3300009147 | Ga0114129_10000936 | Ga0114129_1000093610 | 326 |
| 632 | 3300009147 | Ga0114129_10002179 | Ga0114129_1000217926 | 326 |
| 633 | 3300009147 | Ga0114129_10003221 | Ga0114129_1000322118 | 326 |
| 634 | 3300009147 | Ga0114129_10013658 | Ga0114129_100136581 | 326 |
| 635 | 3300009147 | Ga0114129_10082854 | Ga0114129_100828545 | 326 |
| 636 | 3300009147 | Ga0114129_10094435 | Ga0114129_100944352 | 326 |
| 637 | 3300009176 | Ga0105242_10140483 | Ga0105242_101404831 | 326 |
| 638 | 3300009177 | Ga0105248_10025004 | Ga0105248_100250045 | 326 |
| 639 | 3300009553 | Ga0105249_10008153 | Ga0105249_100081534 | 326 |
| 640 | 3300011119 | Ga0105246_10337788 | Ga0105246_103377882 | 326 |
| 641 | 3300013306 | Ga0163162_10055861 | Ga0163162_100558613 | 326 |
| 642 | 3300013306 | Ga0163162_10244221 | Ga0163162_102442213 | 326 |
| 643 | 3300013308 | Ga0157375_10010834 | Ga0157375_100108348 | 326 |
| 644 | 3300014326 | Ga0157380_10003226 | Ga0157380_100032268 | 326 |
| 645 | 3300014326 | Ga0157380_10056782 | Ga0157380_100567822 | 326 |
| 646 | 3300014745 | Ga0157377_10043870 | Ga0157377_100438702 | 326 |
| 647 | 3300025315 | Ga0207697_10001435 | Ga0207697_1000143510 | 326 |
| 648 | 3300025315 | Ga0207697_10109091 | Ga0207697_101090912 | 326 |
| 649 | 3300025893 | Ga0207682_10003116 | Ga0207682_100031163 | 326 |
| 650 | 3300025893 | Ga0207682_10110490 | Ga0207682_101104902 | 326 |
| 651 | 3300025901 | Ga0207688_10001607 | Ga0207688_100016071 | 326 |
| 652 | 3300025903 | Ga0207680_10023261 | Ga0207680_100232612 | 326 |
| 653 | 3300025903 | Ga0207680_10106097 | Ga0207680_101060972 | 326 |
| 654 | 3300025907 | Ga0207645_10231354 | Ga0207645_102313542 | 326 |
| 655 | 3300025908 | Ga0207643_10012764 | Ga0207643_100127644 | 326 |
| 656 | 3300025908 | Ga0207643_10016950 | Ga0207643_100169503 | 326 |
| 657 | 3300025910 | Ga0207684_10000279 | Ga0207684_1000027961 | 326 |
| 658 | 3300025912 | Ga0207707_10053512 | Ga0207707_100535123 | 326 |
| 659 | 3300025920 | Ga0207649_10041050 | Ga0207649_100410502 | 326 |
| 660 | 3300025922 | Ga0207646_10001682 | Ga0207646_1000168211 | 326 |
| 661 | 3300025922 | Ga0207646_10203811 | Ga0207646_102038112 | 326 |
| 662 | 3300025923 | Ga0207681_10004865 | Ga0207681_100048655 | 326 |
| 663 | 3300025923 | Ga0207681_10008334 | Ga0207681_100083342 | 326 |
| 664 | 3300025923 | Ga0207681_10070635 | Ga0207681_100706352 | 326 |
| 665 | 3300025926 | Ga0207659_10051272 | Ga0207659_100512722 | 326 |
| 666 | 3300025926 | Ga0207659_10203005 | Ga0207659_102030052 | 326 |
| 667 | 3300025928 | Ga0207700_10089034 | Ga0207700_100890343 | 326 |
| 668 | 3300025931 | Ga0207644_10087713 | Ga0207644_100877132 | 326 |
| 669 | 3300025931 | Ga0207644_10237830 | Ga0207644_102378302 | 326 |
| 670 | 3300025932 | Ga0207690_10099442 | Ga0207690_100994422 | 326 |
| 671 | 3300025933 | Ga0207706_10108186 | Ga0207706_101081862 | 326 |
| 672 | 3300025936 | Ga0207670_10090053 | Ga0207670_100900532 | 326 |
| 673 | 3300025937 | Ga0207669_10005017 | Ga0207669_100050176 | 326 |
| 674 | 3300025940 | Ga0207691_10010524 | Ga0207691_100105248 | 326 |
| 675 | 3300025940 | Ga0207691_10041123 | Ga0207691_100411235 | 326 |
| 676 | 3300025940 | Ga0207691_10170382 | Ga0207691_101703822 | 326 |
| 677 | 3300025942 | Ga0207689_10044373 | Ga0207689_100443732 | 326 |
| 678 | 3300025942 | Ga0207689_10044581 | Ga0207689_100445813 | 326 |
| 679 | 3300025942 | Ga0207689_10091644 | Ga0207689_100916442 | 326 |
| 680 | 3300025945 | Ga0207679_10010677 | Ga0207679_100106776 | 326 |
| 681 | 3300025960 | Ga0207651_10007460 | Ga0207651_100074601 | 326 |
| 682 | 3300025960 | Ga0207651_10052884 | Ga0207651_100528844 | 326 |
| 683 | 3300025960 | Ga0207651_10286852 | Ga0207651_102868522 | 326 |
| 684 | 3300025961 | Ga0207712_10061924 | Ga0207712_100619244 | 326 |
| 685 | 3300025972 | Ga0207668_10016771 | Ga0207668_100167711 | 326 |
| 686 | 3300025972 | Ga0207668_10086619 | Ga0207668_100866194 | 326 |
| 687 | 3300026023 | Ga0207677_10145337 | Ga0207677_101453372 | 326 |
| 688 | 3300026023 | Ga0207677_10224460 | Ga0207677_102244602 | 326 |
| 689 | 3300026035 | Ga0207703_10029241 | Ga0207703_100292415 | 326 |
| 690 | 3300026075 | Ga0207708_10012722 | Ga0207708_100127225 | 326 |
| 691 | 3300026088 | Ga0207641_10034038 | Ga0207641_100340386 | 326 |
| 692 | 3300026088 | Ga0207641_10201752 | Ga0207641_102017522 | 326 |
| 693 | 3300026089 | Ga0207648_10001029 | Ga0207648_100010294 | 326 |
| 694 | 3300026089 | Ga0207648_10033849 | Ga0207648_100338491 | 326 |
| 695 | 3300026089 | Ga0207648_10082063 | Ga0207648_100820633 | 326 |
| 696 | 3300026089 | Ga0207648_10104797 | Ga0207648_101047972 | 326 |
| 697 | 3300026089 | Ga0207648_10128449 | Ga0207648_101284492 | 326 |
| 698 | 3300026095 | Ga0207676_10026933 | Ga0207676_100269334 | 326 |
| 699 | 3300026095 | Ga0207676_10048199 | Ga0207676_100481994 | 326 |
| 700 | 3300026095 | Ga0207676_10048586 | Ga0207676_100485862 | 326 |
| 701 | 3300026095 | Ga0207676_10062298 | Ga0207676_100622981 | 326 |
| 702 | 3300026095 | Ga0207676_10106161 | Ga0207676_101061612 | 326 |
| 703 | 3300026095 | Ga0207676_10143337 | Ga0207676_101433372 | 326 |
| 704 | 3300026116 | Ga0207674_10050436 | Ga0207674_100504362 | 326 |
| 705 | 3300026116 | Ga0207674_10141413 | Ga0207674_101414132 | 326 |
| 706 | 3300026118 | Ga0207675_100000947 | Ga0207675_10000094721 | 326 |
| 707 | 3300026118 | Ga0207675_100012281 | Ga0207675_1000122818 | 326 |
| 708 | 3300026118 | Ga0207675_100043778 | Ga0207675_1000437782 | 326 |
| 709 | 3300026121 | Ga0207683_10035387 | Ga0207683_100353872 | 326 |
| 710 | 3300027907 | Ga0207428_10000245 | Ga0207428_1000024536 | 326 |
| 711 | 3300027907 | Ga0207428_10007874 | Ga0207428_100078748 | 326 |
| 712 | 3300027907 | Ga0207428_10008043 | Ga0207428_100080432 | 326 |
| 713 | 3300027907 | Ga0207428_10218538 | Ga0207428_102185382 | 326 |
| 714 | 3300028379 | Ga0268266_10304794 | Ga0268266_103047942 | 326 |
| 715 | 3300028380 | Ga0268265_10007675 | Ga0268265_100076754 | 326 |
| 716 | 3300028380 | Ga0268265_10031665 | Ga0268265_100316655 | 326 |
| 717 | 3300028381 | Ga0268264_10087103 | Ga0268264_100871033 | 326 |
| 718 | 3300035691 | Ga0373931_0137497 | Ga0373931_0137497_392_1372 | 326 |
| 719 | 3300037418 | Ga0395900_0068642 | Ga0395900_0068642_2588_3601 | 326 |
| 720 | 3300037471 | Ga0395905_0017487 | Ga0395905_0017487_652_1665 | 326 |
| 721 | 3300038443 | Ga0395901_0138497 | Ga0395901_0138497_263_1276 | 326 |
| 722 | 3300042876 | Ga0451577_0014387 | Ga0451577_0014387_4636_5631 | 326 |
| 723 | 3300042993 | Ga0439440_0008018 | Ga0439440_0008018_318_1298 | 326 |
| 724 | 3300044673 | Ga0453683_0059377 | Ga0453683_0059377_1275_2270 | 326 |
| 725 | 3300044673 | Ga0453683_0132955 | Ga0453683_0132955_20_1015 | 326 |
| 726 | 3300044712 | Ga0453684_0023625 | Ga0453684_0023625_89_1084 | 326 |
| 727 | 3300044712 | Ga0453684_0454702 | Ga0453684_0454702_369_1370 | 326 |
| 728 | 3300045051 | Ga0451576_0004364 | Ga0451576_0004364_5688_6683 | 326 |
| 729 | 3300045051 | Ga0451576_0012148 | Ga0451576_0012148_2611_3606 | 326 |
| 730 | 3300045051 | Ga0451576_0015985 | Ga0451576_0015985_187_1188 | 326 |
| 731 | 3300045051 | Ga0451576_0031179 | Ga0451576_0031179_2351_3352 | 326 |
| 732 | 3300046455 | Ga0495603_0034875 | Ga0495603_0034875_1151_2152 | 326 |
| 733 | 3300046491 | Ga0495584_0072522 | Ga0495584_0072522_577_1581 | 326 |
| 734 | 3300046499 | Ga0495594_0018287 | Ga0495594_0018287_1229_2230 | 326 |
| 735 | 3300046528 | Ga0495642_0067145 | Ga0495642_0067145_51_1040 | 326 |
| 736 | 3300046663 | Ga0495635_0185823 | Ga0495635_0185823_292_1287 | 326 |
| 737 | 3300046664 | Ga0495659_0027336 | Ga0495659_0027336_917_1900 | 326 |
| 738 | 3300046664 | Ga0495659_0031074 | Ga0495659_0031074_571_1572 | 326 |
| 739 | 3300046674 | Ga0495588_0008264 | Ga0495588_0008264_2786_3787 | 326 |
| 740 | 3300047318 | Ga0495636_0025947 | Ga0495636_0025947_429_1430 | 326 |
| 741 | 3300047321 | Ga0495676_0099207 | Ga0495676_0099207_1042_2040 | 326 |
| 742 | 3300048913 | Ga0496110_0106836 | Ga0496110_0106836_904_1884 | 326 |
| 743 | 3300049583 | Ga0501067_0013133 | Ga0501067_0013133_302_1291 | 326 |
| 744 | 3300049584 | Ga0501068_0065483 | Ga0501068_0065483_1097_2089 | 326 |
| 745 | 3300049585 | Ga0501069_0031286 | Ga0501069_0031286_1157_2146 | 326 |
| 746 | 3300049586 | Ga0501070_0219408 | Ga0501070_0219408_133_1125 | 326 |
| 747 | 3300049587 | Ga0501071_0079021 | Ga0501071_0079021_1337_2329 | 326 |
| 748 | 3300049588 | Ga0501072_0179995 | Ga0501072_0179995_28_1020 | 326 |
| 749 | 3300049591 | Ga0501075_0061209 | Ga0501075_0061209_1817_2809 | 326 |
| 750 | 3300049592 | Ga0501076_0067189 | Ga0501076_0067189_342_1334 | 326 |
| 751 | 3300049593 | Ga0501077_0228384 | Ga0501077_0228384_113_1096 | 326 |
| 752 | 3300049741 | Ga0501079_0011626 | Ga0501079_0011626_2131_3123 | 326 |
| 753 | 3300049743 | Ga0501081_0001826 | Ga0501081_0001826_9264_10256 | 326 |
| 754 | 3300050507 | nmdc:mga05p37_11414_c1 | nmdc:mga05p37_11414_c1_1622_2602 | 326 |
| 755 | 3300050507 | nmdc:mga05p37_155861_c1 | nmdc:mga05p37_155861_c1_925_1917 | 326 |
| 756 | 3300050507 | nmdc:mga05p37_1821_c1 | nmdc:mga05p37_1821_c1_12787_13800 | 326 |
| 757 | 3300050507 | nmdc:mga05p37_2476_c1 | nmdc:mga05p37_2476_c1_8948_9940 | 326 |
| 758 | 3300050507 | nmdc:mga05p37_7226_c1 | nmdc:mga05p37_7226_c1_1343_2326 | 326 |
| 759 | 3300050507 | nmdc:mga05p37_769_c1 | nmdc:mga05p37_769_c1_3582_4595 | 326 |
| 760 | 3300050508 | nmdc:mga09592_10924_c1 | nmdc:mga09592_10924_c1_1357_2337 | 326 |
| 761 | 3300050508 | nmdc:mga09592_14652_c1 | nmdc:mga09592_14652_c1_713_1693 | 326 |
| 762 | 3300050508 | nmdc:mga09592_148021_c1 | nmdc:mga09592_148021_c1_659_1639 | 326 |
| 763 | 3300050508 | nmdc:mga09592_2581_c1 | nmdc:mga09592_2581_c1_5892_6905 | 326 |
| 764 | 3300050508 | nmdc:mga09592_79360_c1 | nmdc:mga09592_79360_c1_1245_2243 | 326 |
| 765 | 3300050509 | nmdc:mga0qj67_7809_c1 | nmdc:mga0qj67_7809_c1_457_1437 | 326 |
| 766 | 3300050510 | nmdc:mga06r32_203185_c1 | nmdc:mga06r32_203185_c1_275_1288 | 326 |
| 767 | 3300050510 | nmdc:mga06r32_2396_c1 | nmdc:mga06r32_2396_c1_1969_2949 | 326 |
| 768 | 3300050510 | nmdc:mga06r32_5775_c1 | nmdc:mga06r32_5775_c1_8366_9379 | 326 |
| 769 | 3300050511 | nmdc:mga08y16_123507_c1 | nmdc:mga08y16_123507_c1_418_1398 | 326 |
| 770 | 3300050511 | nmdc:mga08y16_1306_c1 | nmdc:mga08y16_1306_c1_10807_11805 | 326 |
| 771 | 3300050511 | nmdc:mga08y16_597_c1 | nmdc:mga08y16_597_c1_11803_12798 | 326 |
| 772 | 3300050512 | nmdc:mga0n895_1214_c1 | nmdc:mga0n895_1214_c1_8623_9636 | 326 |
| 773 | 3300050512 | nmdc:mga0n895_150271_c1 | nmdc:mga0n895_150271_c1_951_1952 | 326 |
| 774 | 3300050512 | nmdc:mga0n895_258631_c1 | nmdc:mga0n895_258631_c1_655_1650 | 326 |
| 775 | 3300050513 | nmdc:mga0rr50_203268_c1 | nmdc:mga0rr50_203268_c1_14_1009 | 326 |
| 776 | 3300050513 | nmdc:mga0rr50_245903_c1 | nmdc:mga0rr50_245903_c1_106_1107 | 326 |
| 777 | 3300050513 | nmdc:mga0rr50_549_c1 | nmdc:mga0rr50_549_c1_15067_16080 | 326 |
| 778 | 3300050513 | nmdc:mga0rr50_62866_c1 | nmdc:mga0rr50_62866_c1_1618_2598 | 326 |
| 779 | 3300050513 | nmdc:mga0rr50_75272_c1 | nmdc:mga0rr50_75272_c1_783_1784 | 326 |
| 780 | 3300050514 | nmdc:mga08x19_1724_c1 | nmdc:mga08x19_1724_c1_5215_6228 | 326 |
| 781 | 3300050515 | nmdc:mga0a205_1170_c1 | nmdc:mga0a205_1170_c1_16803_17816 | 326 |
| 782 | 3300050515 | nmdc:mga0a205_1627_c1 | nmdc:mga0a205_1627_c1_3265_4245 | 326 |
| 783 | 3300050515 | nmdc:mga0a205_1991_c1 | nmdc:mga0a205_1991_c1_125_1120 | 326 |
| 784 | 3300054114 | Ga0501084_0023135 | Ga0501084_0023135_2171_3163 | 326 |
| 785 | 3300060353 | Ga0501082_0006260 | Ga0501082_0006260_9034_10026 | 326 |
| 786 | 3300060353 | Ga0501082_0267343 | Ga0501082_0267343_243_1235 | 326 |
| 787 | 3300061734 | Ga0530510_0161310 | Ga0530510_0161310_408_1400 | 326 |
| 788 | 3300003203 | JGI25406J46586_10000120 | JGI25406J46586_1000012020 | 327 |
| 789 | 3300005985 | Ga0081539_10000024 | Ga0081539_1000002435 | 327 |
| 790 | 3300005985 | Ga0081539_10002353 | Ga0081539_1000235317 | 327 |
| 791 | 3300006871 | Ga0075434_100008511 | Ga0075434_10000851110 | 327 |
| 792 | 3300007076 | Ga0075435_100250181 | Ga0075435_1002501811 | 327 |
| 793 | 3300014326 | Ga0157380_10443177 | Ga0157380_104431772 | 327 |
| 794 | 3300031911 | Ga0307412_10085013 | Ga0307412_100850132 | 327 |
| 795 | 3300031995 | Ga0307409_100144824 | Ga0307409_1001448242 | 327 |
| 796 | 3300032002 | Ga0307416_100034764 | Ga0307416_1000347643 | 327 |
| 797 | 3300032005 | Ga0307411_10062966 | Ga0307411_100629662 | 327 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7nyh-assembly1.cif.gz_H | respiratory complex i from escherichia coli - focused refinement of membrane arm | 0.6345 | 46 | 319 |
| 7nyh-assembly1.cif.gz_H | respiratory complex i from escherichia coli - focused refinement of membrane arm | 0.6302 | 46 | 319 |
| 7nyv-assembly1.cif.gz_H | respiratory complex i from escherichia coli - conformation 3 | 0.622 | 46 | 319 |
| 7nyv-assembly1.cif.gz_H | respiratory complex i from escherichia coli - conformation 3 | 0.618 | 46 | 319 |
| 4he8-assembly2.cif.gz_C | crystal structure of the membrane domain of respiratory complex i from thermus thermophilus | 0.6081 | 1 | 319 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_E9AHC4_60_205_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.4757 | 132 | 245 | 1.20.140.150 |
| af_A0A078BPE5_147_314_1.20.120.30 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Aspartate receptor, ligand-binding domain | 0.3976 | 112 | 302 | 1.20.120.30 |
| af_A0A078BPE5_147_314_1.20.120.30 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Aspartate receptor, ligand-binding domain | 0.3851 | 112 | 302 | 1.20.120.30 |
| af_Q5ZCD0_7_178_1.20.1410.10 | Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain | 0.385 | 135 | 298 | 1.20.1410.10 |
| af_Q6AXM5_64_249_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.378 | 143 | 309 | 1.20.120.1760 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A521SWH1-F1-model_v4 | NADH-quinone oxidoreductase subunit H | 0.8448 | 172 | 323 |
GO:0003954
GO:0005886 GO:0009060 |
| AF-A0A151BD10-F1-model_v4 | NADH:ubiquinone oxidoreductase subunit H | 0.8293 | 145 | 318 |
GO:0003954
GO:0009060 GO:0016020 |
| AF-A0A2N6EKY7-F1-model_v4 | NADH-quinone oxidoreductase subunit H | 0.8272 | 142 | 320 |
GO:0003954
GO:0005886 GO:0009060 |
| AF-A0A521SWH1-F1-model_v4 | NADH-quinone oxidoreductase subunit H | 0.8141 | 172 | 323 |
GO:0003954
GO:0005886 GO:0009060 |
| AF-A0A3B8PYH2-F1-model_v4 | Hydroxyacid dehydrogenase | 0.8077 | 142 | 324 |
GO:0003954
GO:0005886 GO:0009060 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar