F481276

General Info

Members Datasets Scaffolds Average Seq Length
797 270 797 327

Family's Representative Sequence

Representative Sequence 3300049744|Ga0501083_0172471|Ga0501083_0172471_219_1355
Length 348
Sequence MAGRGAAAGETSGFQFLPPLAAEALHGFIVAFIVLNVIIGMVTYVTLLERKFAARMQSRIGPYRVGPHGLLQPIADALKLMMKEDVVPRLADRSVYNLAPIVFLVPCMFIFATLPFAPGLGIADLNIGILFFLAVSAMEVVGLFMGGWGSNNKYALLSAMRAVNQIISYDLPFIFVALVPVLFAGSLRLSDIAAAQGDLWYVAWFPFGTLAFLLYLVATLAAENRVPFDILEAESELVAGFRVEYSGMKFALIQLGEYAHMIGTSFLGALLFLGAWDGPWADASPWWGVLWFLLKAMFVFLLVTWIRWSFVRIRADQILAISWKLLLPASLLLLMATALQVVLTSGNG

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
188 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
189 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
190 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
191 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
199 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
200 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
201 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
202 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
203 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
204 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
205 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
206 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
207 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
212 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
213 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
214 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
218 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
221 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
222 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
255 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
256 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
257 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
258 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.76
Nodule 0
Rhizoplane 1.13
Rhizosphere 97.11
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000120 3300003203 Bacteria 34396
2 JGI25406J46586_10002893 3300003203 Bacteria 8098
3 JGI25406J46586_10011300 3300003203 Bacteria 3923
4 JGI26145J50221_1002098 3300003371 Bacteria 1567
5 Ga0065704_10038053 3300005289 Bacteria 1109
6 Ga0065712_10002361 3300005290 Bacteria 8212
7 Ga0065712_10074863 3300005290 Bacteria 3992
8 Ga0065715_10005733 3300005293 Bacteria 4040
9 Ga0065715_10111155 3300005293 Bacteria 2586
10 Ga0065715_10140436 3300005293 Bacteria 1862
11 Ga0065715_10167217 3300005293 Bacteria 1576
12 Ga0065707_10167099 3300005295 Bacteria 1514
13 Ga0070676_10031221 3300005328 Bacteria 3044
14 Ga0070676_10042099 3300005328 Bacteria 2650
15 Ga0070690_100095889 3300005330 Bacteria 1960
16 Ga0070690_100158211 3300005330 Bacteria 1550
17 Ga0070670_100141714 3300005331 Bacteria 2079
18 Ga0070670_100230156 3300005331 Bacteria 1613
19 Ga0068869_100001496 3300005334 Bacteria 13845
20 Ga0068869_100067405 3300005334 Bacteria 2640
21 Ga0068869_100098310 3300005334 Bacteria 2211
22 Ga0070666_10118073 3300005335 Bacteria 1838
23 Ga0070680_100150746 3300005336 Bacteria 1952
24 Ga0070682_100001865 3300005337 Bacteria 11757
25 Ga0068868_100258448 3300005338 Bacteria 1468
26 Ga0068868_100371607 3300005338 Bacteria 1229
27 Ga0070660_100041666 3300005339 Bacteria 3500
28 Ga0070689_100012412 3300005340 Bacteria 6137
29 Ga0070689_100071487 3300005340 Bacteria 2711
30 Ga0070689_100086855 3300005340 Bacteria 2460
31 Ga0070691_10010154 3300005341 Bacteria 4294
32 Ga0070691_10064022 3300005341 Archaea 1774
33 Ga0070687_100015745 3300005343 Bacteria 3427
34 Ga0070661_100000211 3300005344 Bacteria 48345
35 Ga0070661_100022972 3300005344 Bacteria 4467
36 Ga0070692_10001897 3300005345 Bacteria 7888
37 Ga0070692_10006625 3300005345 Bacteria 5041
38 Ga0070668_100044110 3300005347 Bacteria 3420
39 Ga0070668_100049143 3300005347 Bacteria 3246
40 Ga0070669_100012365 3300005353 Bacteria 6055
41 Ga0070669_100017022 3300005353 Bacteria 5189
42 Ga0070669_100031693 3300005353 Bacteria 3818
43 Ga0070669_100066040 3300005353 Bacteria 2666
44 Ga0070669_100281838 3300005353 Bacteria 1332
45 Ga0070675_100003563 3300005354 Bacteria 11830
46 Ga0070675_100011263 3300005354 Bacteria 7003
47 Ga0070675_100016428 3300005354 Bacteria 5874
48 Ga0070675_100367506 3300005354 Bacteria 1278
49 Ga0070671_100044691 3300005355 Bacteria 3681
50 Ga0070674_100003802 3300005356 Bacteria 8533
51 Ga0070674_100149697 3300005356 Bacteria 1760
52 Ga0070673_100005375 3300005364 Bacteria 8187
53 Ga0070673_100079075 3300005364 Bacteria 2661
54 Ga0070673_100095474 3300005364 Bacteria 2439
55 Ga0070673_100241757 3300005364 Bacteria 1570
56 Ga0070688_100025693 3300005365 Bacteria 3490
57 Ga0070688_100348487 3300005365 Bacteria 1084
58 Ga0070659_100001505 3300005366 Bacteria 16800
59 Ga0070667_100034478 3300005367 Bacteria 4234
60 Ga0070703_10000869 3300005406 Bacteria 9735
61 Ga0070703_10006171 3300005406 Bacteria 3354
62 Ga0070709_10086217 3300005434 Unclassified 2061
63 Ga0070713_100171471 3300005436 Bacteria 1944
64 Ga0070701_10017788 3300005438 Bacteria 3329
65 Ga0070701_10033362 3300005438 Bacteria 2571
66 Ga0070701_10084542 3300005438 Bacteria 1726
67 Ga0070701_10087067 3300005438 Bacteria 1703
68 Ga0070705_100001862 3300005440 Bacteria 10869
69 Ga0070705_100005391 3300005440 Bacteria 6231
70 Ga0070700_100028458 3300005441 Bacteria 3324
71 Ga0070700_100075377 3300005441 Bacteria 2163
72 Ga0070700_100199078 3300005441 Bacteria 1406
73 Ga0070694_100003319 3300005444 Bacteria 9628
74 Ga0070694_100006222 3300005444 Bacteria 7245
75 Ga0070694_100019776 3300005444 Bacteria 4285
76 Ga0070694_100047868 3300005444 Bacteria 2874
77 Ga0070694_100059864 3300005444 Bacteria 2596
78 Ga0070694_100348263 3300005444 Bacteria 1147
79 Ga0070708_100018713 3300005445 Bacteria 5798
80 Ga0070708_100042179 3300005445 Bacteria 4004
81 Ga0070708_100086704 3300005445 Bacteria 2844
82 Ga0070708_100108614 3300005445 Bacteria 2548
83 Ga0070708_100187462 3300005445 Bacteria 1935
84 Ga0070708_100350872 3300005445 Bacteria 1390
85 Ga0070708_100353277 3300005445 Unclassified 1385
86 Ga0070662_100006443 3300005457 Bacteria 7565
87 Ga0070681_10050601 3300005458 Bacteria 4145
88 Ga0070681_10070007 3300005458 Bacteria 3474
89 Ga0068867_100006675 3300005459 Bacteria 8159
90 Ga0068867_100038646 3300005459 Bacteria 3475
91 Ga0068867_100084518 3300005459 Bacteria 2398
92 Ga0068867_100092963 3300005459 Bacteria 2291
93 Ga0070685_10045159 3300005466 Bacteria 2525
94 Ga0070706_100003928 3300005467 Bacteria 14483
95 Ga0070706_100008450 3300005467 Bacteria 9590
96 Ga0070706_100044134 3300005467 Bacteria 4119
97 Ga0070706_100217518 3300005467 Bacteria 1783
98 Ga0070706_100307535 3300005467 Bacteria 1479
99 Ga0070706_100341892 3300005467 Bacteria 1395
100 Ga0070706_100384660 3300005467 Bacteria 1307
101 Ga0070707_100000729 3300005468 Bacteria 32778
102 Ga0070707_100045468 3300005468 Bacteria 4202
103 Ga0070707_100055001 3300005468 Bacteria 3815
104 Ga0070707_100151982 3300005468 Bacteria 2254
105 Ga0070707_100268116 3300005468 Bacteria 1660
106 Ga0070707_100466614 3300005468 Bacteria 1224
107 Ga0070698_100004426 3300005471 Bacteria 15440
108 Ga0070698_100007713 3300005471 Bacteria 11640
109 Ga0070698_100010269 3300005471 Bacteria 10002
110 Ga0070698_100016413 3300005471 Bacteria 7815
111 Ga0070698_100336207 3300005471 Bacteria 1442
112 Ga0070699_100000534 3300005518 Bacteria 36008
113 Ga0070699_100000712 3300005518 Bacteria 30836
114 Ga0070699_100003941 3300005518 Bacteria 13112
115 Ga0070699_100008025 3300005518 Bacteria 9167
116 Ga0070699_100020623 3300005518 Bacteria 5686
117 Ga0070699_100023130 3300005518 Bacteria 5354
118 Ga0070699_100080194 3300005518 Bacteria 2844
119 Ga0070699_100178574 3300005518 Bacteria 1883
120 Ga0070699_100234239 3300005518 Bacteria 1638
121 Ga0070679_100008274 3300005530 Bacteria 9785
122 Ga0070679_100459017 3300005530 Bacteria 1218
123 Ga0070684_100063817 3300005535 Bacteria 3230
124 Ga0070697_100001086 3300005536 Bacteria 20540
125 Ga0070697_100008644 3300005536 Bacteria 7953
126 Ga0070697_100017546 3300005536 Bacteria 5633
127 Ga0070697_100047520 3300005536 Bacteria 3479
128 Ga0070697_100048568 3300005536 Bacteria 3441
129 Ga0070697_100059571 3300005536 Bacteria 3109
130 Ga0070697_100099340 3300005536 Bacteria 2416
131 Ga0070697_100139723 3300005536 Bacteria 2036
132 Ga0070697_100258750 3300005536 Bacteria 1490
133 Ga0070697_100341224 3300005536 Bacteria 1293
134 Ga0068853_100000678 3300005539 Bacteria 23432
135 Ga0070672_100035906 3300005543 Bacteria 3771
136 Ga0070672_100049360 3300005543 Bacteria 3274
137 Ga0070672_100050220 3300005543 Bacteria 3248
138 Ga0070672_100084620 3300005543 Bacteria 2547
139 Ga0070695_100000112 3300005545 Bacteria 36134
140 Ga0070695_100002498 3300005545 Bacteria 10593
141 Ga0070695_100004358 3300005545 Bacteria 8296
142 Ga0070695_100010416 3300005545 Bacteria 5551
143 Ga0070695_100021438 3300005545 Bacteria 3954
144 Ga0070695_100069125 3300005545 Bacteria 2307
145 Ga0070695_100337880 3300005545 Bacteria 1125
146 Ga0070696_100004871 3300005546 Bacteria 8970
147 Ga0070696_100011986 3300005546 Bacteria 5809
148 Ga0070696_100018685 3300005546 Bacteria 4689
149 Ga0070696_100247991 3300005546 Bacteria 1345
150 Ga0070693_100000189 3300005547 Bacteria 28531
151 Ga0070704_100001133 3300005549 Bacteria 13909
152 Ga0070704_100002373 3300005549 Bacteria 10560
153 Ga0070704_100014720 3300005549 Bacteria 4892
154 Ga0070704_100028727 3300005549 Bacteria 3703
155 Ga0070704_100043338 3300005549 Bacteria 3119
156 Ga0070704_100069188 3300005549 Bacteria 2556
157 Ga0070704_100100306 3300005549 Bacteria 2179
158 Ga0070704_100118148 3300005549 Bacteria 2031
159 Ga0068855_100015855 3300005563 Bacteria 9066
160 Ga0070664_100006711 3300005564 Bacteria 9281
161 Ga0070664_100015438 3300005564 Bacteria 6248
162 Ga0070664_100148196 3300005564 Bacteria 2071
163 Ga0070664_100230313 3300005564 Unclassified 1661
164 Ga0068857_100008027 3300005577 Bacteria 9103
165 Ga0068857_100085674 3300005577 Bacteria 2816
166 Ga0068854_100002061 3300005578 Bacteria 12321
167 Ga0068856_100008288 3300005614 Bacteria 10131
168 Ga0068859_100008805 3300005617 Bacteria 10189
169 Ga0068859_100046788 3300005617 Bacteria 4344
170 Ga0068859_100065876 3300005617 Bacteria 3656
171 Ga0068859_100102459 3300005617 Bacteria 2920
172 Ga0068864_100021673 3300005618 Bacteria 5381
173 Ga0068864_100037064 3300005618 Bacteria 4160
174 Ga0068864_100061059 3300005618 Bacteria 3265
175 Ga0068864_100061602 3300005618 Bacteria 3250
176 Ga0068864_100170777 3300005618 Bacteria 1982
177 Ga0068861_100005274 3300005719 Bacteria 8718
178 Ga0068870_10010546 3300005840 Bacteria 4251
179 Ga0068870_10010760 3300005840 Bacteria 4213
180 Ga0068870_10092137 3300005840 Bacteria 1697
181 Ga0068863_100005815 3300005841 Bacteria 12091
182 Ga0068860_100027366 3300005843 Bacteria 5493
183 Ga0068860_100083585 3300005843 Bacteria 3037
184 Ga0068860_100116171 3300005843 Bacteria 2560
185 Ga0068862_100015431 3300005844 Bacteria 6345
186 Ga0068862_100026860 3300005844 Bacteria 4842
187 Ga0068862_100039181 3300005844 Bacteria 4023
188 Ga0068862_100095598 3300005844 Bacteria 2592
189 Ga0068862_100209034 3300005844 Bacteria 1763
190 Ga0068862_100258870 3300005844 Bacteria 1588
191 Ga0081455_10000868 3300005937 Bacteria 39013
192 Ga0081455_10064100 3300005937 Bacteria 3079
193 Ga0081455_10189990 3300005937 Bacteria 1547
194 Ga0081455_10293574 3300005937 Bacteria 1169
195 Ga0081538_10003260 3300005981 Bacteria 15419
196 Ga0081540_1019869 3300005983 Bacteria 4064
197 Ga0081539_10000024 3300005985 Bacteria 354702
198 Ga0081539_10000096 3300005985 Bacteria 204059
199 Ga0081539_10000454 3300005985 Bacteria 87230
200 Ga0081539_10002353 3300005985 Bacteria 27164
201 Ga0075364_10078395 3300006051 Bacteria 2182
202 Ga0075364_10234277 3300006051 Bacteria 1247
203 Ga0070716_100035251 3300006173 Bacteria 2750
204 Ga0075362_10000233 3300006177 Bacteria 15482
205 Ga0075367_10140955 3300006178 Bacteria 1493
206 Ga0075366_10068828 3300006195 Bacteria 2106
207 Ga0097621_100159219 3300006237 Bacteria 1940
208 Ga0075370_10042581 3300006353 Bacteria 2565
209 Ga0068871_100116393 3300006358 Bacteria 2253
210 Ga0075428_100001697 3300006844 Bacteria 23501
211 Ga0075428_100003167 3300006844 Bacteria 17983
212 Ga0075428_100004648 3300006844 Bacteria 15196
213 Ga0075428_100004968 3300006844 Bacteria 14767
214 Ga0075428_100006929 3300006844 Bacteria 12586
215 Ga0075428_100012979 3300006844 Bacteria 9264
216 Ga0075428_100036865 3300006844 Bacteria 5385
217 Ga0075428_100119768 3300006844 Unclassified 2865
218 Ga0075428_100123681 3300006844 Bacteria 2816
219 Ga0075428_100131095 3300006844 Bacteria 2727
220 Ga0075428_100151261 3300006844 Bacteria 2521
221 Ga0075428_100172830 3300006844 Bacteria 2341
222 Ga0075430_100000397 3300006846 Bacteria 32197
223 Ga0075430_100003492 3300006846 Bacteria 13154
224 Ga0075430_100004097 3300006846 Bacteria 12298
225 Ga0075430_100007192 3300006846 Bacteria 9388
226 Ga0075430_100016784 3300006846 Bacteria 6235
227 Ga0075430_100028925 3300006846 Bacteria 4705
228 Ga0075430_100029617 3300006846 Bacteria 4646
229 Ga0075430_100032620 3300006846 Bacteria 4421
230 Ga0075430_100315334 3300006846 Bacteria 1293
231 Ga0075431_100000082 3300006847 Bacteria 56660
232 Ga0075431_100000455 3300006847 Bacteria 33646
233 Ga0075431_100000486 3300006847 Bacteria 32971
234 Ga0075431_100001270 3300006847 Bacteria 22987
235 Ga0075431_100001687 3300006847 Bacteria 20728
236 Ga0075431_100001936 3300006847 Bacteria 19722
237 Ga0075431_100046856 3300006847 Bacteria 4458
238 Ga0075431_100052800 3300006847 Bacteria 4191
239 Ga0075431_100227399 3300006847 Bacteria 1902
240 Ga0075431_100263248 3300006847 Bacteria 1749
241 Ga0075431_100294273 3300006847 Bacteria 1641
242 Ga0075431_100433937 3300006847 Bacteria 1311
243 Ga0075433_10000061 3300006852 Bacteria 47469
244 Ga0075433_10000427 3300006852 Bacteria 27010
245 Ga0075433_10000839 3300006852 Bacteria 21522
246 Ga0075433_10002893 3300006852 Bacteria 13158
247 Ga0075433_10005550 3300006852 Bacteria 9906
248 Ga0075433_10006319 3300006852 Bacteria 9359
249 Ga0075433_10059591 3300006852 Bacteria 3340
250 Ga0075433_10079409 3300006852 Bacteria 2891
251 Ga0075433_10098119 3300006852 Bacteria 2593
252 Ga0075433_10108639 3300006852 Bacteria 2460
253 Ga0075433_10163292 3300006852 Bacteria 1982
254 Ga0075433_10181580 3300006852 Bacteria 1872
255 Ga0075433_10189199 3300006852 Bacteria 1831
256 Ga0075434_100000180 3300006871 Bacteria 41040
257 Ga0075434_100001347 3300006871 Bacteria 20612
258 Ga0075434_100008511 3300006871 Bacteria 9541
259 Ga0075434_100017104 3300006871 Bacteria 6979
260 Ga0075434_100023521 3300006871 Bacteria 6006
261 Ga0075434_100062153 3300006871 Bacteria 3717
262 Ga0075434_100073024 3300006871 Bacteria 3423
263 Ga0075434_100085881 3300006871 Bacteria 3146
264 Ga0075434_100094218 3300006871 Bacteria 2999
265 Ga0075434_100119131 3300006871 Unclassified 2654
266 Ga0075434_100239016 3300006871 Bacteria 1836
267 Ga0075434_100257076 3300006871 Bacteria 1765
268 Ga0075434_100306626 3300006871 Bacteria 1608
269 Ga0075434_100348706 3300006871 Bacteria 1501
270 Ga0075429_100000023 3300006880 Bacteria 68064
271 Ga0075429_100002106 3300006880 Bacteria 16613
272 Ga0075429_100002213 3300006880 Bacteria 16272
273 Ga0075429_100002798 3300006880 Bacteria 14762
274 Ga0075429_100002856 3300006880 Bacteria 14619
275 Ga0075429_100014281 3300006880 Bacteria 6888
276 Ga0075429_100015287 3300006880 Bacteria 6652
277 Ga0075429_100022792 3300006880 Bacteria 5429
278 Ga0075429_100023887 3300006880 Bacteria 5305
279 Ga0075429_100063338 3300006880 Bacteria 3222
280 Ga0075429_100064236 3300006880 Bacteria 3197
281 Ga0075429_100143036 3300006880 Bacteria 2094
282 Ga0075429_100185672 3300006880 Bacteria 1822
283 Ga0068865_100283138 3300006881 Bacteria 1320
284 Ga0075436_100002146 3300006914 Bacteria 13600
285 Ga0075436_100105572 3300006914 Bacteria 1964
286 Ga0075436_100115230 3300006914 Bacteria 1877
287 Ga0097620_100008805 3300006931 Bacteria 10189
288 Ga0097620_100046795 3300006931 Bacteria 4344
289 Ga0097620_100065876 3300006931 Bacteria 3656
290 Ga0097620_100102452 3300006931 Bacteria 2920
291 Ga0075435_100017542 3300007076 Bacteria 5422
292 Ga0075435_100051710 3300007076 Bacteria 3309
293 Ga0075435_100063505 3300007076 Bacteria 2999
294 Ga0075435_100099992 3300007076 Bacteria 2402
295 Ga0075435_100128697 3300007076 Bacteria 2118
296 Ga0075435_100191860 3300007076 Bacteria 1730
297 Ga0075435_100195556 3300007076 Bacteria 1713
298 Ga0075435_100243540 3300007076 Bacteria 1530
299 Ga0075435_100250181 3300007076 Bacteria 1509
300 Ga0075435_100291843 3300007076 Bacteria 1394
301 Ga0099794_10004256 3300007265 Bacteria 5592
302 Ga0099794_10130628 3300007265 Bacteria 1268
303 Ga0105240_10155950 3300009093 Bacteria 2715
304 Ga0111539_10000463 3300009094 Bacteria 51027
305 Ga0111539_10001292 3300009094 Bacteria 33417
306 Ga0111539_10001353 3300009094 Bacteria 32630
307 Ga0111539_10001789 3300009094 Bacteria 28570
308 Ga0111539_10002439 3300009094 Bacteria 24735
309 Ga0111539_10006594 3300009094 Bacteria 14961
310 Ga0111539_10012644 3300009094 Bacteria 10575
311 Ga0111539_10024427 3300009094 Bacteria 7415
312 Ga0111539_10114103 3300009094 Bacteria 3169
313 Ga0111539_10135636 3300009094 Bacteria 2882
314 Ga0111539_10250103 3300009094 Bacteria 2064
315 Ga0111539_10505433 3300009094 Bacteria 1408
316 Ga0105245_10290132 3300009098 Bacteria 1602
317 Ga0114129_10000110 3300009147 Bacteria 81178
318 Ga0114129_10000936 3300009147 Bacteria 38136
319 Ga0114129_10001511 3300009147 Bacteria 31462
320 Ga0114129_10002179 3300009147 Bacteria 26947
321 Ga0114129_10003221 3300009147 Bacteria 22900
322 Ga0114129_10013658 3300009147 Bacteria 11571
323 Ga0114129_10020399 3300009147 Bacteria 9427
324 Ga0114129_10044379 3300009147 Bacteria 6253
325 Ga0114129_10082854 3300009147 Bacteria 4456
326 Ga0114129_10094435 3300009147 Bacteria 4142
327 Ga0114129_10115315 3300009147 Bacteria 3703
328 Ga0114129_10408947 3300009147 Bacteria 1787
329 Ga0114129_10452572 3300009147 Bacteria 1683
330 Ga0114129_10574916 3300009147 Bacteria 1463
331 Ga0114129_10634510 3300009147 Unclassified 1380
332 Ga0105243_10016133 3300009148 Bacteria 5650
333 Ga0105241_10001410 3300009174 Bacteria 18406
334 Ga0105241_10041676 3300009174 Bacteria 3470
335 Ga0105242_10140483 3300009176 Bacteria 2095
336 Ga0105242_10572532 3300009176 Bacteria 1086
337 Ga0105248_10025004 3300009177 Bacteria 6638
338 Ga0105248_10194352 3300009177 Bacteria 2286
339 Ga0105249_10008153 3300009553 Bacteria 9132
340 Ga0105249_10608300 3300009553 Bacteria 1148
341 Ga0105246_10047160 3300011119 Bacteria 2941
342 Ga0105246_10337788 3300011119 Bacteria 1230
343 Ga0157373_10015786 3300013100 Bacteria 5513
344 Ga0157369_10017116 3300013105 Bacteria 8146
345 Ga0157374_10233961 3300013296 Bacteria 1805
346 Ga0157378_10060912 3300013297 Bacteria 3367
347 Ga0157378_10227955 3300013297 Bacteria 1774
348 Ga0157378_10263164 3300013297 Bacteria 1656
349 Ga0163162_10055861 3300013306 Bacteria 3976
350 Ga0163162_10103890 3300013306 Bacteria 2935
351 Ga0163162_10244221 3300013306 Bacteria 1927
352 Ga0157372_10008010 3300013307 Bacteria 11239
353 Ga0157372_10074909 3300013307 Bacteria 3818
354 Ga0157375_10010834 3300013308 Bacteria 8033
355 Ga0157375_10049527 3300013308 Bacteria 4117
356 Ga0157375_10120206 3300013308 Bacteria 2735
357 Ga0157375_10137022 3300013308 Bacteria 2573
358 Ga0163163_10065916 3300014325 Bacteria 3596
359 Ga0163163_10108966 3300014325 Bacteria 2797
360 Ga0157380_10003226 3300014326 Bacteria 11146
361 Ga0157380_10056782 3300014326 Bacteria 3115
362 Ga0157380_10148047 3300014326 Bacteria 2026
363 Ga0157380_10209430 3300014326 Bacteria 1736
364 Ga0157380_10443177 3300014326 Bacteria 1245
365 Ga0157380_10546340 3300014326 Bacteria 1135
366 Ga0157377_10043870 3300014745 Bacteria 2491
367 Ga0157376_10140371 3300014969 Bacteria 2167
368 Ga0207697_10001435 3300025315 Bacteria 13051
369 Ga0207697_10109091 3300025315 Bacteria 1184
370 Ga0207682_10003116 3300025893 Bacteria 7262
371 Ga0207682_10110490 3300025893 Bacteria 1210
372 Ga0207642_10093556 3300025899 Bacteria 1491
373 Ga0207688_10001607 3300025901 Bacteria 11929
374 Ga0207680_10023261 3300025903 Bacteria 3381
375 Ga0207680_10106097 3300025903 Bacteria 1813
376 Ga0207699_10042288 3300025906 Bacteria 2639
377 Ga0207645_10000400 3300025907 Bacteria 35898
378 Ga0207645_10231354 3300025907 Bacteria 1220
379 Ga0207643_10000424 3300025908 Bacteria 27864
380 Ga0207643_10012764 3300025908 Bacteria 4542
381 Ga0207643_10016950 3300025908 Bacteria 3976
382 Ga0207684_10000279 3300025910 Bacteria 74399
383 Ga0207684_10084506 3300025910 Bacteria 2703
384 Ga0207684_10237013 3300025910 Bacteria 1574
385 Ga0207654_10002440 3300025911 Bacteria 9494
386 Ga0207654_10058214 3300025911 Bacteria 2249
387 Ga0207707_10000116 3300025912 Bacteria 81364
388 Ga0207707_10053512 3300025912 Bacteria 3514
389 Ga0207707_10350312 3300025912 Bacteria 1272
390 Ga0207695_10205833 3300025913 Bacteria 1880
391 Ga0207660_10003214 3300025917 Bacteria 10691
392 Ga0207660_10332841 3300025917 Bacteria 1214
393 Ga0207657_10000211 3300025919 Bacteria 60392
394 Ga0207649_10009637 3300025920 Bacteria 5288
395 Ga0207649_10041050 3300025920 Bacteria 2815
396 Ga0207652_10003841 3300025921 Bacteria 12319
397 Ga0207646_10001682 3300025922 Bacteria 26908
398 Ga0207646_10023879 3300025922 Bacteria 5610
399 Ga0207646_10039239 3300025922 Bacteria 4262
400 Ga0207646_10063999 3300025922 Bacteria 3283
401 Ga0207646_10203811 3300025922 Bacteria 1787
402 Ga0207681_10004865 3300025923 Bacteria 8251
403 Ga0207681_10008334 3300025923 Bacteria 6339
404 Ga0207681_10070635 3300025923 Unclassified 2432
405 Ga0207650_10147568 3300025925 Bacteria 1854
406 Ga0207659_10003928 3300025926 Bacteria 8970
407 Ga0207659_10004886 3300025926 Bacteria 8120
408 Ga0207659_10010902 3300025926 Bacteria 5724
409 Ga0207659_10051272 3300025926 Bacteria 2934
410 Ga0207659_10203005 3300025926 Bacteria 1584
411 Ga0207700_10089034 3300025928 Bacteria 2432
412 Ga0207644_10087713 3300025931 Bacteria 2313
413 Ga0207644_10237830 3300025931 Bacteria 1449
414 Ga0207690_10001495 3300025932 Bacteria 14606
415 Ga0207690_10099442 3300025932 Bacteria 2074
416 Ga0207706_10108186 3300025933 Bacteria 2447
417 Ga0207706_10350364 3300025933 Bacteria 1284
418 Ga0207670_10024764 3300025936 Bacteria 3756
419 Ga0207670_10090053 3300025936 Bacteria 2166
420 Ga0207670_10336500 3300025936 Bacteria 1192
421 Ga0207669_10005017 3300025937 Bacteria 5887
422 Ga0207704_10144317 3300025938 Bacteria 1670
423 Ga0207691_10009557 3300025940 Bacteria 9307
424 Ga0207691_10010524 3300025940 Bacteria 8877
425 Ga0207691_10035245 3300025940 Bacteria 4647
426 Ga0207691_10041123 3300025940 Bacteria 4270
427 Ga0207691_10071198 3300025940 Bacteria 3138
428 Ga0207691_10170382 3300025940 Bacteria 1907
429 Ga0207689_10000201 3300025942 Bacteria 52554
430 Ga0207689_10006142 3300025942 Bacteria 10632
431 Ga0207689_10044373 3300025942 Bacteria 3676
432 Ga0207689_10044581 3300025942 Bacteria 3667
433 Ga0207689_10046149 3300025942 Bacteria 3602
434 Ga0207689_10091644 3300025942 Bacteria 2497
435 Ga0207661_10031415 3300025944 Bacteria 4102
436 Ga0207679_10000634 3300025945 Bacteria 23441
437 Ga0207679_10010677 3300025945 Bacteria 5920
438 Ga0207679_10066350 3300025945 Bacteria 2704
439 Ga0207679_10205329 3300025945 Unclassified 1649
440 Ga0207667_10000342 3300025949 Bacteria 63745
441 Ga0207651_10007460 3300025960 Bacteria 5828
442 Ga0207651_10030607 3300025960 Bacteria 3430
443 Ga0207651_10051815 3300025960 Bacteria 2795
444 Ga0207651_10052884 3300025960 Bacteria 2772
445 Ga0207651_10061269 3300025960 Bacteria 2616
446 Ga0207651_10286852 3300025960 Bacteria 1363
447 Ga0207651_10301674 3300025960 Unclassified 1332
448 Ga0207712_10061924 3300025961 Bacteria 2658
449 Ga0207712_10063532 3300025961 Bacteria 2629
450 Ga0207668_10016771 3300025972 Bacteria 4579
451 Ga0207668_10086619 3300025972 Bacteria 2289
452 Ga0207640_10010071 3300025981 Bacteria 5313
453 Ga0207677_10145337 3300026023 Bacteria 1821
454 Ga0207677_10224460 3300026023 Bacteria 1509
455 Ga0207703_10029241 3300026035 Bacteria 4347
456 Ga0207639_10004331 3300026041 Bacteria 9569
457 Ga0207708_10012722 3300026075 Bacteria 6275
458 Ga0207708_10170215 3300026075 Bacteria 1725
459 Ga0207702_10001143 3300026078 Bacteria 27129
460 Ga0207641_10034038 3300026088 Bacteria 4235
461 Ga0207641_10201752 3300026088 Bacteria 1834
462 Ga0207648_10001029 3300026089 Bacteria 31328
463 Ga0207648_10018292 3300026089 Bacteria 6348
464 Ga0207648_10033849 3300026089 Bacteria 4506
465 Ga0207648_10082063 3300026089 Bacteria 2811
466 Ga0207648_10091646 3300026089 Bacteria 2657
467 Ga0207648_10104797 3300026089 Bacteria 2481
468 Ga0207648_10128449 3300026089 Bacteria 2230
469 Ga0207676_10026933 3300026095 Bacteria 4277
470 Ga0207676_10048199 3300026095 Bacteria 3306
471 Ga0207676_10048586 3300026095 Bacteria 3295
472 Ga0207676_10062298 3300026095 Bacteria 2958
473 Ga0207676_10106161 3300026095 Bacteria 2340
474 Ga0207676_10143337 3300026095 Bacteria 2048
475 Ga0207674_10000951 3300026116 Bacteria 37804
476 Ga0207674_10050436 3300026116 Bacteria 4252
477 Ga0207674_10131920 3300026116 Bacteria 2461
478 Ga0207674_10141413 3300026116 Bacteria 2366
479 Ga0207675_100000947 3300026118 Bacteria 28984
480 Ga0207675_100012281 3300026118 Bacteria 8002
481 Ga0207675_100043778 3300026118 Bacteria 4181
482 Ga0207675_100322394 3300026118 Bacteria 1509
483 Ga0207683_10035387 3300026121 Bacteria 4343
484 Ga0209969_1001925 3300027360 Bacteria 2852
485 Ga0209967_1002901 3300027364 Bacteria 2241
486 Ga0209981_1000322 3300027378 Bacteria 6175
487 Ga0209984_1003320 3300027424 Bacteria 1837
488 Ga0209995_1000169 3300027471 Bacteria 10476
489 Ga0209968_1007165 3300027526 Bacteria 1685
490 Ga0209999_1000030 3300027543 Bacteria 15066
491 Ga0209982_1000171 3300027552 Bacteria 7396
492 Ga0209970_1001621 3300027614 Bacteria 3907
493 Ga0210002_1000333 3300027617 Bacteria 6478
494 Ga0209983_1004720 3300027665 Bacteria 2849
495 Ga0209588_1003834 3300027671 Bacteria 4195
496 Ga0209588_1013367 3300027671 Bacteria 2503
497 Ga0209971_1000037 3300027682 Bacteria 45920
498 Ga0209966_1000378 3300027695 Bacteria 13523
499 Ga0209998_10000042 3300027717 Bacteria 51743
500 Ga0209974_10000465 3300027876 Bacteria 13444
501 Ga0209974_10028825 3300027876 Bacteria 1839
502 Ga0207428_10000027 3300027907 Bacteria 250186
503 Ga0207428_10000245 3300027907 Bacteria 74009
504 Ga0207428_10000849 3300027907 Bacteria 34443
505 Ga0207428_10007638 3300027907 Bacteria 9844
506 Ga0207428_10007874 3300027907 Bacteria 9688
507 Ga0207428_10008043 3300027907 Bacteria 9569
508 Ga0207428_10011180 3300027907 Bacteria 7961
509 Ga0207428_10020343 3300027907 Bacteria 5639
510 Ga0207428_10053281 3300027907 Bacteria 3227
511 Ga0207428_10104636 3300027907 Unclassified 2184
512 Ga0207428_10218538 3300027907 Bacteria 1429
513 Ga0268266_10304794 3300028379 Bacteria 1487
514 Ga0268265_10005618 3300028380 Bacteria 8563
515 Ga0268265_10007675 3300028380 Bacteria 7280
516 Ga0268265_10031665 3300028380 Bacteria 3821
517 Ga0268264_10009436 3300028381 Bacteria 8082
518 Ga0268264_10016829 3300028381 Bacteria 5985
519 Ga0268264_10087103 3300028381 Bacteria 2685
520 Ga0268264_10113504 3300028381 Bacteria 2377
521 Ga0307408_100029421 3300031548 Bacteria 3806
522 Ga0307405_10243446 3300031731 Bacteria 1334
523 Ga0307406_10012405 3300031901 Bacteria 4861
524 Ga0307407_10068199 3300031903 Bacteria 2106
525 Ga0307412_10085013 3300031911 Bacteria 2198
526 Ga0307409_100144824 3300031995 Bacteria 2053
527 Ga0307416_100034764 3300032002 Bacteria 3840
528 Ga0307416_100369476 3300032002 Bacteria 1460
529 Ga0307411_10062966 3300032005 Bacteria 2477
530 Ga0307411_10093652 3300032005 Bacteria 2104
531 Ga0307415_100176911 3300032126 Bacteria 1670
532 Ga0373940_0010807 3300035088 Bacteria 2156
533 Ga0373940_0042584 3300035088 Bacteria 1252
534 Ga0373939_0007627 3300035114 Bacteria 2631
535 Ga0373939_0047429 3300035114 Bacteria 1319
536 Ga0373941_0025272 3300035115 Bacteria 1714
537 Ga0373960_0007917 3300035121 Bacteria 2532
538 Ga0373961_0003932 3300035241 Bacteria 3629
539 Ga0373961_0022917 3300035241 Bacteria 1675
540 Ga0373931_0071219 3300035691 Bacteria 1898
541 Ga0373931_0137497 3300035691 Bacteria 1412
542 Ga0395899_0040764 3300037312 Bacteria 3472
543 Ga0395900_0002273 3300037418 Bacteria 21347
544 Ga0395900_0068642 3300037418 Bacteria 3643
545 Ga0395898_0027972 3300037466 Bacteria 5654
546 Ga0395905_0017487 3300037471 Bacteria 6807
547 Ga0395901_0012102 3300038443 Bacteria 8752
548 Ga0395901_0138497 3300038443 Bacteria 2558
549 Ga0439443_008792 3300042003 Bacteria 1434
550 Ga0439448_0003901 3300042005 Bacteria 4178
551 Ga0439458_0008625 3300042157 Bacteria 2272
552 Ga0439435_0059568 3300042436 Bacteria 1110
553 Ga0439464_0005441 3300042439 Bacteria 3293
554 Ga0439460_0000197 3300042461 Bacteria 11816
555 Ga0451577_0014387 3300042876 Bacteria 7379
556 Ga0451577_0095273 3300042876 Bacteria 2658
557 Ga0451577_0141580 3300042876 Bacteria 2161
558 Ga0451577_0208828 3300042876 Bacteria 1763
559 Ga0439440_0008018 3300042993 Bacteria 2159
560 Ga0453683_0034615 3300044673 Bacteria 3184
561 Ga0453683_0059377 3300044673 Bacteria 2391
562 Ga0453683_0132955 3300044673 Bacteria 1569
563 Ga0453684_0023625 3300044712 Bacteria 9036
564 Ga0453684_0051367 3300044712 Bacteria 5405
565 Ga0453684_0084974 3300044712 Bacteria 3934
566 Ga0453684_0454702 3300044712 Bacteria 1425
567 Ga0451576_0004364 3300045051 Bacteria 18442
568 Ga0451576_0005141 3300045051 Bacteria 16570
569 Ga0451576_0005764 3300045051 Bacteria 15422
570 Ga0451576_0012148 3300045051 Bacteria 9709
571 Ga0451576_0015985 3300045051 Bacteria 8295
572 Ga0451576_0030406 3300045051 Bacteria 5771
573 Ga0451576_0031179 3300045051 Bacteria 5686
574 Ga0451576_0199378 3300045051 Bacteria 2090
575 Ga0451576_0502673 3300045051 Bacteria 1273
576 Ga0495603_0034875 3300046455 Bacteria 3024
577 Ga0495580_0000727 3300046472 Bacteria 28206
578 Ga0495580_0159997 3300046472 Bacteria 1559
579 Ga0495584_0072522 3300046491 Bacteria 1730
580 Ga0495594_0018287 3300046499 Bacteria 3711
581 Ga0495642_0029831 3300046528 Bacteria 2180
582 Ga0495642_0067145 3300046528 Bacteria 1495
583 Ga0495598_0006886 3300046537 Bacteria 2583
584 Ga0495656_0009898 3300046615 Bacteria 3446
585 Ga0495635_0185823 3300046663 Bacteria 1412
586 Ga0495659_0027336 3300046664 Bacteria 1967
587 Ga0495659_0031074 3300046664 Bacteria 1861
588 Ga0495588_0008264 3300046674 Bacteria 4767
589 Ga0495599_0086526 3300046678 Bacteria 1957
590 Ga0495669_0029039 3300046684 Bacteria 2424
591 Ga0495669_0031228 3300046684 Bacteria 2339
592 Ga0495670_0080606 3300046691 Bacteria 1658
593 Ga0495636_0025947 3300047318 Bacteria 2381
594 Ga0495676_0099207 3300047321 Bacteria 2159
595 Ga0496102_0026670 3300048905 Bacteria 5156
596 Ga0496106_0154774 3300048909 Bacteria 1810
597 Ga0496109_0140292 3300048912 Bacteria 2260
598 Ga0496109_0149751 3300048912 Unclassified 2184
599 Ga0496109_0297097 3300048912 Bacteria 1523
600 Ga0496109_0491597 3300048912 Bacteria 1158
601 Ga0496110_0106836 3300048913 Bacteria 2512
602 Ga0496112_0059047 3300048915 Bacteria 3779
603 Ga0496113_0040027 3300048916 Bacteria 3453
604 Ga0501036_0041097 3300049572 Bacteria 3914
605 Ga0501036_0290159 3300049572 Unclassified 1369
606 Ga0501038_0205571 3300049574 Bacteria 1578
607 Ga0501039_0110564 3300049575 Bacteria 2148
608 Ga0501040_0002340 3300049576 Bacteria 12167
609 Ga0501040_0023651 3300049576 Bacteria 4120
610 Ga0501040_0053982 3300049576 Bacteria 2754
611 Ga0501040_0104051 3300049576 Unclassified 1982
612 Ga0501040_0115082 3300049576 Bacteria 1883
613 Ga0501040_0142611 3300049576 Bacteria 1688
614 Ga0501041_0049602 3300049577 Bacteria 2557
615 Ga0501042_0017571 3300049578 Bacteria 4935
616 Ga0501042_0055506 3300049578 Bacteria 2827
617 Ga0501042_0104850 3300049578 Bacteria 2034
618 Ga0501046_0179348 3300049580 Bacteria 1585
619 Ga0501048_0010077 3300049582 Bacteria 7069
620 Ga0501067_0009738 3300049583 Bacteria 5319
621 Ga0501067_0013133 3300049583 Bacteria 4584
622 Ga0501067_0075644 3300049583 Bacteria 1866
623 Ga0501068_0065483 3300049584 Bacteria 2212
624 Ga0501069_0030155 3300049585 Bacteria 2978
625 Ga0501069_0031286 3300049585 Bacteria 2926
626 Ga0501070_0219408 3300049586 Bacteria 1560
627 Ga0501071_0079021 3300049587 Bacteria 2405
628 Ga0501072_0007493 3300049588 Bacteria 8282
629 Ga0501072_0019990 3300049588 Bacteria 5185
630 Ga0501072_0023580 3300049588 Bacteria 4780
631 Ga0501072_0086981 3300049588 Bacteria 2480
632 Ga0501072_0096516 3300049588 Unclassified 2349
633 Ga0501072_0179995 3300049588 Bacteria 1686
634 Ga0501072_0394853 3300049588 Bacteria 1097
635 Ga0501074_0025264 3300049590 Bacteria 4315
636 Ga0501074_0044488 3300049590 Bacteria 3214
637 Ga0501074_0044826 3300049590 Bacteria 3200
638 Ga0501074_0113887 3300049590 Bacteria 1935
639 Ga0501074_0122781 3300049590 Bacteria 1858
640 Ga0501074_0355578 3300049590 Unclassified 1039
641 Ga0501075_0061209 3300049591 Bacteria 2836
642 Ga0501075_0088260 3300049591 Bacteria 2351
643 Ga0501075_0128849 3300049591 Bacteria 1927
644 Ga0501075_0145497 3300049591 Bacteria 1806
645 Ga0501076_0000831 3300049592 Bacteria 20044
646 Ga0501076_0011802 3300049592 Bacteria 6525
647 Ga0501076_0067189 3300049592 Bacteria 2862
648 Ga0501076_0183162 3300049592 Bacteria 1708
649 Ga0501077_0007379 3300049593 Bacteria 6777
650 Ga0501077_0113638 3300049593 Bacteria 1717
651 Ga0501077_0151814 3300049593 Unclassified 1470
652 Ga0501077_0228384 3300049593 Bacteria 1183
653 Ga0501249_009868 3300049679 Bacteria 1989
654 Ga0501079_0005334 3300049741 Bacteria 9567
655 Ga0501079_0011626 3300049741 Bacteria 6722
656 Ga0501079_0018603 3300049741 Bacteria 5307
657 Ga0501080_0110250 3300049742 Bacteria 2551
658 Ga0501080_0137679 3300049742 Bacteria 2259
659 Ga0501081_0001826 3300049743 Bacteria 13182
660 Ga0501081_0002472 3300049743 Bacteria 11652
661 Ga0501081_0005258 3300049743 Bacteria 8341
662 Ga0501081_0010638 3300049743 Bacteria 6009
663 Ga0501081_0055520 3300049743 Bacteria 2737
664 Ga0501081_0282466 3300049743 Unclassified 1215
665 Ga0501081_0291248 3300049743 Bacteria 1197
666 Ga0501083_0172471 3300049744 Bacteria 1414
667 Ga0501045_0008724 3300049824 Bacteria 7071
668 Ga0501045_0071527 3300049824 Bacteria 2553
669 nmdc:mga03683_4325_c1 3300050489 Bacteria 4696
670 nmdc:mga00v17_123621_c1 3300050491 Bacteria 1650
671 nmdc:mga00v17_190952_c1 3300050491 Bacteria 1323
672 nmdc:mga00v17_2153_c1 3300050491 Bacteria 10125
673 nmdc:mga0k408_10311_c1 3300050493 Bacteria 5051
674 nmdc:mga06z11_18520_c1 3300050494 Bacteria 3182
675 nmdc:mga06z11_36572_c1 3300050494 Bacteria 2425
676 nmdc:mga07m45_9361_c1 3300050496 Bacteria 5079
677 nmdc:mga05p37_11414_c1 3300050507 Bacteria 10575
678 nmdc:mga05p37_115985_c1 3300050507 Bacteria 3292
679 nmdc:mga05p37_13298_c1 3300050507 Bacteria 9856
680 nmdc:mga05p37_140466_c1 3300050507 Bacteria 2959
681 nmdc:mga05p37_155861_c1 3300050507 Bacteria 2791
682 nmdc:mga05p37_17395_c1 3300050507 Bacteria 8675
683 nmdc:mga05p37_175148_c1 3300050507 Bacteria 2614
684 nmdc:mga05p37_1821_c1 3300050507 Bacteria 24853
685 nmdc:mga05p37_221156_c1 3300050507 Bacteria 2285
686 nmdc:mga05p37_2476_c1 3300050507 Bacteria 21484
687 nmdc:mga05p37_26199_c1 3300050507 Bacteria 7090
688 nmdc:mga05p37_405715_c1 3300050507 Unclassified 1590
689 nmdc:mga05p37_42435_c1 3300050507 Bacteria 5589
690 nmdc:mga05p37_63188_c1 3300050507 Bacteria 4556
691 nmdc:mga05p37_68472_c1 3300050507 Bacteria 4365
692 nmdc:mga05p37_7226_c1 3300050507 Bacteria 13099
693 nmdc:mga05p37_7406_c1 3300050507 Bacteria 12949
694 nmdc:mga05p37_769_c1 3300050507 Bacteria 35683
695 nmdc:mga09592_10924_c1 3300050508 Bacteria 7389
696 nmdc:mga09592_14652_c1 3300050508 Bacteria 6397
697 nmdc:mga09592_148021_c1 3300050508 Bacteria 2025
698 nmdc:mga09592_149660_c1 3300050508 Bacteria 2014
699 nmdc:mga09592_187481_c1 3300050508 Bacteria 1790
700 nmdc:mga09592_1944_c1 3300050508 Bacteria 16641
701 nmdc:mga09592_2581_c1 3300050508 Bacteria 14667
702 nmdc:mga09592_29511_c1 3300050508 Bacteria 4560
703 nmdc:mga09592_3878_c1 3300050508 Bacteria 12046
704 nmdc:mga09592_4509_c1 3300050508 Bacteria 11265
705 nmdc:mga09592_5317_c1 3300050508 Bacteria 10464
706 nmdc:mga09592_53687_c1 3300050508 Bacteria 3404
707 nmdc:mga09592_54900_c1 3300050508 Bacteria 3366
708 nmdc:mga09592_79360_c1 3300050508 Unclassified 2794
709 nmdc:mga0qj67_1433_c1 3300050509 Bacteria 16698
710 nmdc:mga0qj67_21599_c1 3300050509 Bacteria 4938
711 nmdc:mga0qj67_22451_c1 3300050509 Bacteria 4847
712 nmdc:mga0qj67_24945_c1 3300050509 Bacteria 4615
713 nmdc:mga0qj67_26059_c1 3300050509 Bacteria 4525
714 nmdc:mga0qj67_60996_c1 3300050509 Bacteria 2994
715 nmdc:mga0qj67_7809_c1 3300050509 Bacteria 7907
716 nmdc:mga0qj67_9223_c1 3300050509 Bacteria 7331
717 nmdc:mga06r32_100838_c1 3300050510 Bacteria 2833
718 nmdc:mga06r32_1744_c1 3300050510 Bacteria 19568
719 nmdc:mga06r32_187312_c1 3300050510 Bacteria 2057
720 nmdc:mga06r32_203185_c1 3300050510 Bacteria 1969
721 nmdc:mga06r32_2396_c1 3300050510 Bacteria 16781
722 nmdc:mga06r32_363805_c1 3300050510 Bacteria 1430
723 nmdc:mga06r32_3786_c1 3300050510 Bacteria 13535
724 nmdc:mga06r32_5775_c1 3300050510 Bacteria 11151
725 nmdc:mga06r32_7977_c1 3300050510 Bacteria 9516
726 nmdc:mga06r32_80134_c1 3300050510 Bacteria 3177
727 nmdc:mga08y16_104951_c1 3300050511 Bacteria 2942
728 nmdc:mga08y16_120242_c1 3300050511 Bacteria 2734
729 nmdc:mga08y16_123507_c1 3300050511 Bacteria 2694
730 nmdc:mga08y16_1306_c1 3300050511 Bacteria 24771
731 nmdc:mga08y16_149523_c1 3300050511 Bacteria 2428
732 nmdc:mga08y16_17787_c1 3300050511 Bacteria 7488
733 nmdc:mga08y16_243078_c1 3300050511 Bacteria 1860
734 nmdc:mga08y16_2919_c1 3300050511 Bacteria 17590
735 nmdc:mga08y16_3252_c1 3300050511 Bacteria 16818
736 nmdc:mga08y16_404214_c1 3300050511 Bacteria 1397
737 nmdc:mga08y16_49615_c1 3300050511 Bacteria 4393
738 nmdc:mga08y16_597_c1 3300050511 Bacteria 33660
739 nmdc:mga08y16_83078_c1 3300050511 Bacteria 3338
740 nmdc:mga08y16_8329_c1 3300050511 Bacteria 10851
741 nmdc:mga08y16_91146_c1 3300050511 Bacteria 3177
742 nmdc:mga0n895_101899_c1 3300050512 Bacteria 2881
743 nmdc:mga0n895_1214_c1 3300050512 Bacteria 19023
744 nmdc:mga0n895_150271_c1 3300050512 Bacteria 2359
745 nmdc:mga0n895_2183_c1 3300050512 Bacteria 15126
746 nmdc:mga0n895_22554_c1 3300050512 Bacteria 5904
747 nmdc:mga0n895_231840_c1 3300050512 Unclassified 1874
748 nmdc:mga0n895_258631_c1 3300050512 Bacteria 1767
749 nmdc:mga0n895_300722_c1 3300050512 Bacteria 1626
750 nmdc:mga0n895_347712_c1 3300050512 Bacteria 1502
751 nmdc:mga0n895_46940_c1 3300050512 Bacteria 4222
752 nmdc:mga0n895_477_c1 3300050512 Bacteria 26935
753 nmdc:mga0n895_57044_c1 3300050512 Bacteria 3849
754 nmdc:mga0n895_60106_c1 3300050512 Bacteria 3750
755 nmdc:mga0n895_60201_c1 3300050512 Bacteria 3747
756 nmdc:mga0n895_85010_c1 3300050512 Bacteria 3158
757 nmdc:mga0n895_86246_c1 3300050512 Bacteria 3136
758 nmdc:mga0rr50_122473_c1 3300050513 Bacteria 2072
759 nmdc:mga0rr50_13734_c1 3300050513 Bacteria 5286
760 nmdc:mga0rr50_149715_c1 3300050513 Bacteria 1885
761 nmdc:mga0rr50_151274_c1 3300050513 Bacteria 1876
762 nmdc:mga0rr50_203268_c1 3300050513 Bacteria 1629
763 nmdc:mga0rr50_245903_c1 3300050513 Bacteria 1484
764 nmdc:mga0rr50_46560_c1 3300050513 Bacteria 3194
765 nmdc:mga0rr50_549_c1 3300050513 Bacteria 20121
766 nmdc:mga0rr50_62866_c1 3300050513 Bacteria 2802
767 nmdc:mga0rr50_75272_c1 3300050513 Bacteria 2587
768 nmdc:mga08x19_16828_c1 3300050514 Bacteria 4465
769 nmdc:mga08x19_1724_c1 3300050514 Bacteria 13452
770 nmdc:mga0a205_106355_c1 3300050515 Bacteria 2704
771 nmdc:mga0a205_1170_c1 3300050515 Bacteria 21857
772 nmdc:mga0a205_132329_c1 3300050515 Bacteria 2395
773 nmdc:mga0a205_1627_c1 3300050515 Bacteria 19317
774 nmdc:mga0a205_186096_c1 3300050515 Bacteria 1970
775 nmdc:mga0a205_1991_c1 3300050515 Bacteria 17807
776 nmdc:mga0a205_227_c1 3300050515 Bacteria 39744
777 nmdc:mga0a205_26128_c1 3300050515 Bacteria 5563
778 nmdc:mga0a205_47712_c1 3300050515 Bacteria 2436
779 nmdc:mga0a205_56926_c1 3300050515 Bacteria 3775
780 nmdc:mga0a205_646_c1 3300050515 Bacteria 27674
781 nmdc:mga0a205_68336_c1 3300050515 Bacteria 3432
782 nmdc:mga0a205_8978_c1 3300050515 Bacteria 9109
783 Ga0501084_0023135 3300054114 Bacteria 5187
784 Ga0501084_0026115 3300054114 Bacteria 4872
785 Ga0501084_0165102 3300054114 Bacteria 1869
786 Ga0501082_0003845 3300060353 Bacteria 13129
787 Ga0501082_0006260 3300060353 Bacteria 10330
788 Ga0501082_0009259 3300060353 Bacteria 8489
789 Ga0501082_0037237 3300060353 Bacteria 4193
790 Ga0501082_0049357 3300060353 Bacteria 3629
791 Ga0501082_0267343 3300060353 Bacteria 1488
792 Ga0530510_0012598 3300061734 Bacteria 5944
793 Ga0530510_0020309 3300061734 Bacteria 4722
794 Ga0530510_0027054 3300061734 Bacteria 4108
795 Ga0530510_0059589 3300061734 Bacteria 2762
796 Ga0530510_0098316 3300061734 Bacteria 2140
797 Ga0530510_0161310 3300061734 Bacteria 1658

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003371 JGI26145J50221_1002098 JGI26145J50221_10020982 288
2 3300049588 Ga0501072_0394853 Ga0501072_0394853_12_893 288
3 3300005444 Ga0070694_100348263 Ga0070694_1003482632 291
4 3300005518 Ga0070699_100008025 Ga0070699_1000080255 298
5 3300005347 Ga0070668_100044110 Ga0070668_1000441102 299
6 3300005353 Ga0070669_100031693 Ga0070669_1000316935 299
7 3300005543 Ga0070672_100049360 Ga0070672_1000493604 299
8 3300005843 Ga0068860_100083585 Ga0068860_1000835853 299
9 3300006844 Ga0075428_100001697 Ga0075428_10000169728 299
10 3300006846 Ga0075430_100000397 Ga0075430_10000039728 299
11 3300006847 Ga0075431_100263248 Ga0075431_1002632482 299
12 3300006847 Ga0075431_100294273 Ga0075431_1002942732 299
13 3300009148 Ga0105243_10016133 Ga0105243_100161335 299
14 3300009174 Ga0105241_10041676 Ga0105241_100416763 299
15 3300013297 Ga0157378_10263164 Ga0157378_102631641 299
16 3300013306 Ga0163162_10103890 Ga0163162_101038902 299
17 3300013308 Ga0157375_10137022 Ga0157375_101370221 299
18 3300014326 Ga0157380_10148047 Ga0157380_101480472 299
19 3300025911 Ga0207654_10058214 Ga0207654_100582143 299
20 3300025940 Ga0207691_10035245 Ga0207691_100352455 299
21 3300028381 Ga0268264_10113504 Ga0268264_101135042 299
22 3300046528 Ga0495642_0029831 Ga0495642_0029831_825_1814 299
23 3300050508 nmdc:mga09592_4509_c1 nmdc:mga09592_4509_c1_6102_7088 299
24 3300050509 nmdc:mga0qj67_22451_c1 nmdc:mga0qj67_22451_c1_572_1558 299
25 3300050510 nmdc:mga06r32_187312_c1 nmdc:mga06r32_187312_c1_669_1655 299
26 3300050507 nmdc:mga05p37_221156_c1 nmdc:mga05p37_221156_c1_1189_2175 300
27 3300050510 nmdc:mga06r32_363805_c1 nmdc:mga06r32_363805_c1_321_1307 300
28 3300049580 Ga0501046_0179348 Ga0501046_0179348_302_1306 303
29 3300003203 JGI25406J46586_10002893 JGI25406J46586_100028936 304
30 3300005985 Ga0081539_10000096 Ga0081539_1000009698 304
31 3300049576 Ga0501040_0115082 Ga0501040_0115082_755_1744 304
32 3300005468 Ga0070707_100055001 Ga0070707_1000550012 305
33 3300049574 Ga0501038_0205571 Ga0501038_0205571_636_1562 305
34 3300049743 Ga0501081_0055520 Ga0501081_0055520_1671_2660 305
35 3300049576 Ga0501040_0142611 Ga0501040_0142611_567_1559 306
36 3300049590 Ga0501074_0355578 Ga0501074_0355578_29_1021 306
37 3300049743 Ga0501081_0005258 Ga0501081_0005258_7317_8309 306
38 3300060353 Ga0501082_0049357 Ga0501082_0049357_855_1847 306
39 3300050513 nmdc:mga0rr50_122473_c1 nmdc:mga0rr50_122473_c1_314_1297 307
40 3300049591 Ga0501075_0145497 Ga0501075_0145497_639_1622 308
41 3300054114 Ga0501084_0165102 Ga0501084_0165102_115_1098 308
42 3300005467 Ga0070706_100384660 Ga0070706_1003846601 309
43 3300005468 Ga0070707_100466614 Ga0070707_1004666141 309
44 3300031548 Ga0307408_100029421 Ga0307408_1000294215 309
45 3300032005 Ga0307411_10093652 Ga0307411_100936523 309
46 3300061734 Ga0530510_0098316 Ga0530510_0098316_351_1358 309
47 3300005330 Ga0070690_100095889 Ga0070690_1000958892 311
48 3300005293 Ga0065715_10111155 Ga0065715_101111553 312
49 3300005328 Ga0070676_10042099 Ga0070676_100420995 312
50 3300005334 Ga0068869_100001496 Ga0068869_10000149610 312
51 3300005337 Ga0070682_100001865 Ga0070682_1000018656 312
52 3300005339 Ga0070660_100041666 Ga0070660_1000416664 312
53 3300005340 Ga0070689_100012412 Ga0070689_1000124125 312
54 3300005341 Ga0070691_10010154 Ga0070691_100101541 312
55 3300005344 Ga0070661_100000211 Ga0070661_1000002115 312
56 3300005345 Ga0070692_10001897 Ga0070692_100018972 312
57 3300005364 Ga0070673_100241757 Ga0070673_1002417572 312
58 3300005366 Ga0070659_100001505 Ga0070659_10000150513 312
59 3300005406 Ga0070703_10000869 Ga0070703_100008695 312
60 3300005438 Ga0070701_10084542 Ga0070701_100845422 312
61 3300005440 Ga0070705_100005391 Ga0070705_1000053915 312
62 3300005444 Ga0070694_100003319 Ga0070694_1000033193 312
63 3300005458 Ga0070681_10050601 Ga0070681_100506013 312
64 3300005459 Ga0068867_100006675 Ga0068867_1000066757 312
65 3300005530 Ga0070679_100008274 Ga0070679_1000082747 312
66 3300005535 Ga0070684_100063817 Ga0070684_1000638172 312
67 3300005539 Ga0068853_100000678 Ga0068853_10000067825 312
68 3300005543 Ga0070672_100050220 Ga0070672_1000502203 312
69 3300005545 Ga0070695_100004358 Ga0070695_1000043582 312
70 3300005546 Ga0070696_100004871 Ga0070696_1000048718 312
71 3300005547 Ga0070693_100000189 Ga0070693_10000018924 312
72 3300005549 Ga0070704_100001133 Ga0070704_10000113314 312
73 3300005563 Ga0068855_100015855 Ga0068855_1000158552 312
74 3300005564 Ga0070664_100006711 Ga0070664_1000067114 312
75 3300005577 Ga0068857_100085674 Ga0068857_1000856742 312
76 3300005578 Ga0068854_100002061 Ga0068854_10000206112 312
77 3300005614 Ga0068856_100008288 Ga0068856_1000082885 312
78 3300005617 Ga0068859_100008805 Ga0068859_1000088056 312
79 3300005618 Ga0068864_100021673 Ga0068864_1000216736 312
80 3300005840 Ga0068870_10010760 Ga0068870_100107605 312
81 3300005841 Ga0068863_100005815 Ga0068863_1000058155 312
82 3300005844 Ga0068862_100015431 Ga0068862_1000154313 312
83 3300005844 Ga0068862_100258870 Ga0068862_1002588702 312
84 3300006852 Ga0075433_10079409 Ga0075433_100794091 312
85 3300006871 Ga0075434_100023521 Ga0075434_1000235215 312
86 3300006931 Ga0097620_100008805 Ga0097620_1000088056 312
87 3300009093 Ga0105240_10155950 Ga0105240_101559502 312
88 3300009094 Ga0111539_10114103 Ga0111539_101141035 312
89 3300009147 Ga0114129_10634510 Ga0114129_106345102 312
90 3300009174 Ga0105241_10001410 Ga0105241_1000141010 312
91 3300011119 Ga0105246_10047160 Ga0105246_100471602 312
92 3300013100 Ga0157373_10015786 Ga0157373_100157863 312
93 3300013105 Ga0157369_10017116 Ga0157369_100171169 312
94 3300013307 Ga0157372_10008010 Ga0157372_100080102 312
95 3300013308 Ga0157375_10049527 Ga0157375_100495272 312
96 3300014325 Ga0163163_10065916 Ga0163163_100659165 312
97 3300025907 Ga0207645_10000400 Ga0207645_1000040016 312
98 3300025908 Ga0207643_10000424 Ga0207643_1000042421 312
99 3300025911 Ga0207654_10002440 Ga0207654_1000244010 312
100 3300025912 Ga0207707_10000116 Ga0207707_1000011632 312
101 3300025913 Ga0207695_10205833 Ga0207695_102058332 312
102 3300025917 Ga0207660_10003214 Ga0207660_100032147 312
103 3300025919 Ga0207657_10000211 Ga0207657_1000021131 312
104 3300025920 Ga0207649_10009637 Ga0207649_100096375 312
105 3300025921 Ga0207652_10003841 Ga0207652_100038416 312
106 3300025932 Ga0207690_10001495 Ga0207690_100014959 312
107 3300025933 Ga0207706_10350364 Ga0207706_103503642 312
108 3300025940 Ga0207691_10009557 Ga0207691_100095579 312
109 3300025942 Ga0207689_10000201 Ga0207689_1000020132 312
110 3300025945 Ga0207679_10000634 Ga0207679_1000063426 312
111 3300025949 Ga0207667_10000342 Ga0207667_100003425 312
112 3300025960 Ga0207651_10051815 Ga0207651_100518152 312
113 3300025981 Ga0207640_10010071 Ga0207640_100100713 312
114 3300026041 Ga0207639_10004331 Ga0207639_100043312 312
115 3300026078 Ga0207702_10001143 Ga0207702_1000114310 312
116 3300026089 Ga0207648_10018292 Ga0207648_100182925 312
117 3300026116 Ga0207674_10000951 Ga0207674_1000095114 312
118 3300027876 Ga0209974_10028825 Ga0209974_100288253 312
119 3300028380 Ga0268265_10005618 Ga0268265_100056188 312
120 3300028381 Ga0268264_10009436 Ga0268264_100094366 312
121 3300035114 Ga0373939_0047429 Ga0373939_0047429_41_1048 312
122 3300035121 Ga0373960_0007917 Ga0373960_0007917_577_1584 312
123 3300035241 Ga0373961_0003932 Ga0373961_0003932_1440_2447 312
124 3300042005 Ga0439448_0003901 Ga0439448_0003901_2604_3611 312
125 3300042157 Ga0439458_0008625 Ga0439458_0008625_281_1288 312
126 3300042876 Ga0451577_0208828 Ga0451577_0208828_269_1276 312
127 3300044712 Ga0453684_0084974 Ga0453684_0084974_1247_2254 312
128 3300045051 Ga0451576_0005764 Ga0451576_0005764_8404_9411 312
129 3300048905 Ga0496102_0026670 Ga0496102_0026670_1433_2440 312
130 3300048909 Ga0496106_0154774 Ga0496106_0154774_526_1533 312
131 3300048912 Ga0496109_0140292 Ga0496109_0140292_1117_2124 312
132 3300048915 Ga0496112_0059047 Ga0496112_0059047_1731_2738 312
133 3300050511 nmdc:mga08y16_91146_c1 nmdc:mga08y16_91146_c1_1708_2688 312
134 3300050512 nmdc:mga0n895_347712_c1 nmdc:mga0n895_347712_c1_219_1226 312
135 3300005468 Ga0070707_100268116 Ga0070707_1002681162 313
136 3300025922 Ga0207646_10023879 Ga0207646_100238792 313
137 3300049583 Ga0501067_0075644 Ga0501067_0075644_705_1712 313
138 3300049588 Ga0501072_0023580 Ga0501072_0023580_1769_2713 313
139 3300049590 Ga0501074_0044488 Ga0501074_0044488_1827_2771 313
140 3300005536 Ga0070697_100017546 Ga0070697_1000175466 314
141 3300013296 Ga0157374_10233961 Ga0157374_102339612 314
142 3300042876 Ga0451577_0141580 Ga0451577_0141580_902_1894 314
143 3300044712 Ga0453684_0051367 Ga0453684_0051367_250_1242 314
144 3300005356 Ga0070674_100149697 Ga0070674_1001496972 315
145 3300009147 Ga0114129_10115315 Ga0114129_101153154 315
146 3300009553 Ga0105249_10608300 Ga0105249_106083001 315
147 3300042876 Ga0451577_0095273 Ga0451577_0095273_218_1207 315
148 3300050507 nmdc:mga05p37_140466_c1 nmdc:mga05p37_140466_c1_587_1573 315
149 3300005364 Ga0070673_100095474 Ga0070673_1000954744 316
150 3300005564 Ga0070664_100148196 Ga0070664_1001481962 316
151 3300006852 Ga0075433_10098119 Ga0075433_100981192 316
152 3300025944 Ga0207661_10031415 Ga0207661_100314152 316
153 3300025960 Ga0207651_10030607 Ga0207651_100306072 316
154 3300035114 Ga0373939_0007627 Ga0373939_0007627_252_1226 316
155 3300050507 nmdc:mga05p37_175148_c1 nmdc:mga05p37_175148_c1_236_1231 316
156 3300050512 nmdc:mga0n895_60201_c1 nmdc:mga0n895_60201_c1_1620_2615 316
157 3300006847 Ga0075431_100000486 Ga0075431_1000004869 317
158 3300050510 nmdc:mga06r32_1744_c1 nmdc:mga06r32_1744_c1_11326_12312 317
159 3300061734 Ga0530510_0027054 Ga0530510_0027054_2872_3840 317
160 3300005438 Ga0070701_10033362 Ga0070701_100333622 318
161 3300005468 Ga0070707_100151982 Ga0070707_1001519822 318
162 3300005545 Ga0070695_100337880 Ga0070695_1003378801 318
163 3300005549 Ga0070704_100028727 Ga0070704_1000287273 318
164 3300005844 Ga0068862_100095598 Ga0068862_1000955982 318
165 3300009176 Ga0105242_10572532 Ga0105242_105725321 318
166 3300009177 Ga0105248_10194352 Ga0105248_101943521 318
167 3300025917 Ga0207660_10332841 Ga0207660_103328411 318
168 3300025922 Ga0207646_10063999 Ga0207646_100639991 318
169 3300025961 Ga0207712_10063532 Ga0207712_100635323 318
170 3300026075 Ga0207708_10170215 Ga0207708_101702153 318
171 3300026116 Ga0207674_10131920 Ga0207674_101319203 318
172 3300006880 Ga0075429_100000023 Ga0075429_10000002338 319
173 3300050515 nmdc:mga0a205_26128_c1 nmdc:mga0a205_26128_c1_3195_4163 319
174 3300050515 nmdc:mga0a205_56926_c1 nmdc:mga0a205_56926_c1_1144_2127 319
175 3300005844 Ga0068862_100209034 Ga0068862_1002090342 320
176 3300006852 Ga0075433_10059591 Ga0075433_100595914 320
177 3300006871 Ga0075434_100017104 Ga0075434_1000171042 320
178 3300006871 Ga0075434_100119131 Ga0075434_1001191315 320
179 3300007076 Ga0075435_100051710 Ga0075435_1000517105 320
180 3300046472 Ga0495580_0159997 Ga0495580_0159997_12_983 320
181 3300050512 nmdc:mga0n895_22554_c1 nmdc:mga0n895_22554_c1_4538_5506 320
182 3300050512 nmdc:mga0n895_86246_c1 nmdc:mga0n895_86246_c1_1120_2109 320
183 3300050513 nmdc:mga0rr50_46560_c1 nmdc:mga0rr50_46560_c1_37_1026 320
184 3300006852 Ga0075433_10181580 Ga0075433_101815803 321
185 3300006881 Ga0068865_100283138 Ga0068865_1002831382 321
186 3300007076 Ga0075435_100099992 Ga0075435_1000999924 321
187 3300025938 Ga0207704_10144317 Ga0207704_101443172 321
188 3300027907 Ga0207428_10053281 Ga0207428_100532813 321
189 3300046678 Ga0495599_0086526 Ga0495599_0086526_392_1381 321
190 3300050511 nmdc:mga08y16_120242_c1 nmdc:mga08y16_120242_c1_961_1947 321
191 3300050511 nmdc:mga08y16_404214_c1 nmdc:mga08y16_404214_c1_140_1114 321
192 3300050512 nmdc:mga0n895_46940_c1 nmdc:mga0n895_46940_c1_2375_3349 321
193 3300050513 nmdc:mga0rr50_149715_c1 nmdc:mga0rr50_149715_c1_377_1351 321
194 3300050515 nmdc:mga0a205_68336_c1 nmdc:mga0a205_68336_c1_1862_2836 321
195 3300005459 Ga0068867_100092963 Ga0068867_1000929632 323
196 3300005545 Ga0070695_100069125 Ga0070695_1000691252 323
197 3300005546 Ga0070696_100018685 Ga0070696_1000186856 323
198 3300013297 Ga0157378_10060912 Ga0157378_100609122 323
199 3300013297 Ga0157378_10227955 Ga0157378_102279552 323
200 3300014326 Ga0157380_10209430 Ga0157380_102094302 323
201 3300025899 Ga0207642_10093556 Ga0207642_100935562 323
202 3300026089 Ga0207648_10091646 Ga0207648_100916463 323
203 3300049588 Ga0501072_0019990 Ga0501072_0019990_182_1183 323
204 3300050511 nmdc:mga08y16_83078_c1 nmdc:mga08y16_83078_c1_1019_1999 323
205 3300005331 Ga0070670_100230156 Ga0070670_1002301562 324
206 3300005444 Ga0070694_100047868 Ga0070694_1000478682 324
207 3300005445 Ga0070708_100108614 Ga0070708_1001086142 324
208 3300005445 Ga0070708_100187462 Ga0070708_1001874622 324
209 3300005467 Ga0070706_100003928 Ga0070706_1000039288 324
210 3300005467 Ga0070706_100044134 Ga0070706_1000441342 324
211 3300005468 Ga0070707_100045468 Ga0070707_1000454683 324
212 3300005518 Ga0070699_100234239 Ga0070699_1002342391 324
213 3300005536 Ga0070697_100047520 Ga0070697_1000475202 324
214 3300005545 Ga0070695_100002498 Ga0070695_1000024986 324
215 3300005549 Ga0070704_100043338 Ga0070704_1000433382 324
216 3300005937 Ga0081455_10000868 Ga0081455_100008689 324
217 3300005937 Ga0081455_10189990 Ga0081455_101899902 324
218 3300006844 Ga0075428_100003167 Ga0075428_10000316714 324
219 3300006844 Ga0075428_100172830 Ga0075428_1001728303 324
220 3300006846 Ga0075430_100003492 Ga0075430_1000034923 324
221 3300006846 Ga0075430_100007192 Ga0075430_1000071923 324
222 3300006846 Ga0075430_100028925 Ga0075430_1000289252 324
223 3300006847 Ga0075431_100001936 Ga0075431_10000193616 324
224 3300006852 Ga0075433_10000839 Ga0075433_1000083915 324
225 3300006852 Ga0075433_10006319 Ga0075433_100063196 324
226 3300006852 Ga0075433_10163292 Ga0075433_101632922 324
227 3300006871 Ga0075434_100001347 Ga0075434_10000134714 324
228 3300006871 Ga0075434_100094218 Ga0075434_1000942183 324
229 3300006871 Ga0075434_100239016 Ga0075434_1002390162 324
230 3300006880 Ga0075429_100002856 Ga0075429_10000285610 324
231 3300006880 Ga0075429_100143036 Ga0075429_1001430363 324
232 3300006914 Ga0075436_100105572 Ga0075436_1001055722 324
233 3300007076 Ga0075435_100243540 Ga0075435_1002435401 324
234 3300009094 Ga0111539_10001292 Ga0111539_1000129224 324
235 3300009094 Ga0111539_10001789 Ga0111539_1000178919 324
236 3300009094 Ga0111539_10250103 Ga0111539_102501032 324
237 3300009094 Ga0111539_10505433 Ga0111539_105054332 324
238 3300009147 Ga0114129_10408947 Ga0114129_104089472 324
239 3300013307 Ga0157372_10074909 Ga0157372_100749095 324
240 3300014325 Ga0163163_10108966 Ga0163163_101089662 324
241 3300025910 Ga0207684_10237013 Ga0207684_102370132 324
242 3300025912 Ga0207707_10350312 Ga0207707_103503122 324
243 3300025922 Ga0207646_10039239 Ga0207646_100392393 324
244 3300025925 Ga0207650_10147568 Ga0207650_101475681 324
245 3300025942 Ga0207689_10046149 Ga0207689_100461492 324
246 3300025945 Ga0207679_10066350 Ga0207679_100663505 324
247 3300027360 Ga0209969_1001925 Ga0209969_10019253 324
248 3300027364 Ga0209967_1002901 Ga0209967_10029013 324
249 3300027378 Ga0209981_1000322 Ga0209981_10003223 324
250 3300027424 Ga0209984_1003320 Ga0209984_10033202 324
251 3300027471 Ga0209995_1000169 Ga0209995_100016911 324
252 3300027526 Ga0209968_1007165 Ga0209968_10071652 324
253 3300027543 Ga0209999_1000030 Ga0209999_100003012 324
254 3300027552 Ga0209982_1000171 Ga0209982_10001717 324
255 3300027617 Ga0210002_1000333 Ga0210002_10003332 324
256 3300027665 Ga0209983_1004720 Ga0209983_10047203 324
257 3300027682 Ga0209971_1000037 Ga0209971_100003736 324
258 3300027695 Ga0209966_1000378 Ga0209966_100037812 324
259 3300027717 Ga0209998_10000042 Ga0209998_1000004220 324
260 3300027876 Ga0209974_10000465 Ga0209974_100004658 324
261 3300027907 Ga0207428_10000849 Ga0207428_1000084916 324
262 3300027907 Ga0207428_10007638 Ga0207428_1000763811 324
263 3300031731 Ga0307405_10243446 Ga0307405_102434462 324
264 3300031901 Ga0307406_10012405 Ga0307406_100124057 324
265 3300032002 Ga0307416_100369476 Ga0307416_1003694762 324
266 3300035088 Ga0373940_0042584 Ga0373940_0042584_224_1207 324
267 3300035241 Ga0373961_0022917 Ga0373961_0022917_260_1243 324
268 3300035691 Ga0373931_0071219 Ga0373931_0071219_300_1283 324
269 3300037312 Ga0395899_0040764 Ga0395899_0040764_765_1754 324
270 3300037418 Ga0395900_0002273 Ga0395900_0002273_19606_20595 324
271 3300037466 Ga0395898_0027972 Ga0395898_0027972_2745_3734 324
272 3300038443 Ga0395901_0012102 Ga0395901_0012102_5107_6096 324
273 3300042439 Ga0439464_0005441 Ga0439464_0005441_2195_3229 324
274 3300042461 Ga0439460_0000197 Ga0439460_0000197_7185_8219 324
275 3300045051 Ga0451576_0502673 Ga0451576_0502673_178_1167 324
276 3300048912 Ga0496109_0491597 Ga0496109_0491597_162_1145 324
277 3300049576 Ga0501040_0002340 Ga0501040_0002340_6271_7254 324
278 3300049576 Ga0501040_0023651 Ga0501040_0023651_830_1819 324
279 3300049576 Ga0501040_0104051 Ga0501040_0104051_856_1845 324
280 3300049578 Ga0501042_0104850 Ga0501042_0104850_25_1014 324
281 3300049582 Ga0501048_0010077 Ga0501048_0010077_1236_2225 324
282 3300049588 Ga0501072_0096516 Ga0501072_0096516_889_1878 324
283 3300049590 Ga0501074_0025264 Ga0501074_0025264_3163_4152 324
284 3300049590 Ga0501074_0044826 Ga0501074_0044826_575_1558 324
285 3300049591 Ga0501075_0128849 Ga0501075_0128849_538_1527 324
286 3300049592 Ga0501076_0011802 Ga0501076_0011802_3634_4623 324
287 3300049679 Ga0501249_009868 Ga0501249_009868_892_1866 324
288 3300049741 Ga0501079_0005334 Ga0501079_0005334_2669_3658 324
289 3300049741 Ga0501079_0018603 Ga0501079_0018603_557_1540 324
290 3300049742 Ga0501080_0110250 Ga0501080_0110250_316_1305 324
291 3300049743 Ga0501081_0002472 Ga0501081_0002472_7570_8553 324
292 3300049744 Ga0501083_0172471 Ga0501083_0172471_219_1355 324
293 3300049824 Ga0501045_0071527 Ga0501045_0071527_108_1091 324
294 3300050507 nmdc:mga05p37_68472_c1 nmdc:mga05p37_68472_c1_495_1469 324
295 3300050508 nmdc:mga09592_149660_c1 nmdc:mga09592_149660_c1_896_1870 324
296 3300050508 nmdc:mga09592_187481_c1 nmdc:mga09592_187481_c1_108_1097 324
297 3300050508 nmdc:mga09592_54900_c1 nmdc:mga09592_54900_c1_1444_2427 324
298 3300050509 nmdc:mga0qj67_24945_c1 nmdc:mga0qj67_24945_c1_488_1462 324
299 3300050509 nmdc:mga0qj67_60996_c1 nmdc:mga0qj67_60996_c1_1751_2734 324
300 3300050510 nmdc:mga06r32_100838_c1 nmdc:mga06r32_100838_c1_1077_2051 324
301 3300050511 nmdc:mga08y16_149523_c1 nmdc:mga08y16_149523_c1_1118_2101 324
302 3300050511 nmdc:mga08y16_3252_c1 nmdc:mga08y16_3252_c1_14261_15250 324
303 3300050511 nmdc:mga08y16_8329_c1 nmdc:mga08y16_8329_c1_3791_4765 324
304 3300050512 nmdc:mga0n895_101899_c1 nmdc:mga0n895_101899_c1_1310_2293 324
305 3300050512 nmdc:mga0n895_477_c1 nmdc:mga0n895_477_c1_10922_11896 324
306 3300050512 nmdc:mga0n895_57044_c1 nmdc:mga0n895_57044_c1_474_1457 324
307 3300050514 nmdc:mga08x19_16828_c1 nmdc:mga08x19_16828_c1_831_1817 324
308 3300050515 nmdc:mga0a205_646_c1 nmdc:mga0a205_646_c1_19138_20112 324
309 3300054114 Ga0501084_0026115 Ga0501084_0026115_14_997 324
310 3300060353 Ga0501082_0009259 Ga0501082_0009259_1920_2909 324
311 3300060353 Ga0501082_0037237 Ga0501082_0037237_265_1248 324
312 3300005289 Ga0065704_10038053 Ga0065704_100380531 325
313 3300005290 Ga0065712_10074863 Ga0065712_100748635 325
314 3300005293 Ga0065715_10167217 Ga0065715_101672172 325
315 3300005295 Ga0065707_10167099 Ga0065707_101670992 325
316 3300005334 Ga0068869_100067405 Ga0068869_1000674052 325
317 3300005341 Ga0070691_10064022 Ga0070691_100640222 325
318 3300005354 Ga0070675_100003563 Ga0070675_10000356310 325
319 3300005354 Ga0070675_100016428 Ga0070675_1000164284 325
320 3300005364 Ga0070673_100005375 Ga0070673_1000053752 325
321 3300005365 Ga0070688_100025693 Ga0070688_1000256933 325
322 3300005406 Ga0070703_10006171 Ga0070703_100061714 325
323 3300005434 Ga0070709_10086217 Ga0070709_100862173 325
324 3300005441 Ga0070700_100028458 Ga0070700_1000284584 325
325 3300005441 Ga0070700_100199078 Ga0070700_1001990781 325
326 3300005444 Ga0070694_100019776 Ga0070694_1000197762 325
327 3300005445 Ga0070708_100042179 Ga0070708_1000421795 325
328 3300005445 Ga0070708_100086704 Ga0070708_1000867042 325
329 3300005445 Ga0070708_100350872 Ga0070708_1003508721 325
330 3300005445 Ga0070708_100353277 Ga0070708_1003532772 325
331 3300005467 Ga0070706_100217518 Ga0070706_1002175182 325
332 3300005467 Ga0070706_100307535 Ga0070706_1003075352 325
333 3300005467 Ga0070706_100341892 Ga0070706_1003418922 325
334 3300005471 Ga0070698_100010269 Ga0070698_1000102697 325
335 3300005471 Ga0070698_100016413 Ga0070698_1000164132 325
336 3300005471 Ga0070698_100336207 Ga0070698_1003362072 325
337 3300005518 Ga0070699_100003941 Ga0070699_1000039417 325
338 3300005518 Ga0070699_100023130 Ga0070699_1000231306 325
339 3300005518 Ga0070699_100080194 Ga0070699_1000801943 325
340 3300005518 Ga0070699_100178574 Ga0070699_1001785743 325
341 3300005530 Ga0070679_100459017 Ga0070679_1004590172 325
342 3300005536 Ga0070697_100008644 Ga0070697_1000086448 325
343 3300005536 Ga0070697_100048568 Ga0070697_1000485682 325
344 3300005536 Ga0070697_100059571 Ga0070697_1000595711 325
345 3300005536 Ga0070697_100099340 Ga0070697_1000993402 325
346 3300005536 Ga0070697_100139723 Ga0070697_1001397233 325
347 3300005536 Ga0070697_100341224 Ga0070697_1003412242 325
348 3300005543 Ga0070672_100084620 Ga0070672_1000846202 325
349 3300005545 Ga0070695_100010416 Ga0070695_1000104166 325
350 3300005545 Ga0070695_100021438 Ga0070695_1000214382 325
351 3300005546 Ga0070696_100247991 Ga0070696_1002479912 325
352 3300005549 Ga0070704_100069188 Ga0070704_1000691883 325
353 3300005549 Ga0070704_100118148 Ga0070704_1001181483 325
354 3300005564 Ga0070664_100230313 Ga0070664_1002303132 325
355 3300005617 Ga0068859_100102459 Ga0068859_1001024595 325
356 3300005840 Ga0068870_10092137 Ga0068870_100921371 325
357 3300005843 Ga0068860_100027366 Ga0068860_1000273662 325
358 3300005937 Ga0081455_10064100 Ga0081455_100641003 325
359 3300005937 Ga0081455_10293574 Ga0081455_102935742 325
360 3300005983 Ga0081540_1019869 Ga0081540_10198692 325
361 3300006051 Ga0075364_10078395 Ga0075364_100783952 325
362 3300006051 Ga0075364_10234277 Ga0075364_102342772 325
363 3300006173 Ga0070716_100035251 Ga0070716_1000352512 325
364 3300006177 Ga0075362_10000233 Ga0075362_100002338 325
365 3300006178 Ga0075367_10140955 Ga0075367_101409552 325
366 3300006195 Ga0075366_10068828 Ga0075366_100688282 325
367 3300006353 Ga0075370_10042581 Ga0075370_100425812 325
368 3300006844 Ga0075428_100004968 Ga0075428_10000496812 325
369 3300006844 Ga0075428_100119768 Ga0075428_1001197682 325
370 3300006844 Ga0075428_100123681 Ga0075428_1001236814 325
371 3300006844 Ga0075428_100151261 Ga0075428_1001512614 325
372 3300006846 Ga0075430_100004097 Ga0075430_10000409711 325
373 3300006846 Ga0075430_100016784 Ga0075430_1000167842 325
374 3300006847 Ga0075431_100000082 Ga0075431_10000008214 325
375 3300006847 Ga0075431_100001270 Ga0075431_10000127022 325
376 3300006847 Ga0075431_100046856 Ga0075431_1000468564 325
377 3300006847 Ga0075431_100052800 Ga0075431_1000528005 325
378 3300006847 Ga0075431_100433937 Ga0075431_1004339371 325
379 3300006852 Ga0075433_10000427 Ga0075433_1000042725 325
380 3300006852 Ga0075433_10002893 Ga0075433_100028938 325
381 3300006852 Ga0075433_10108639 Ga0075433_101086392 325
382 3300006871 Ga0075434_100000180 Ga0075434_10000018013 325
383 3300006871 Ga0075434_100062153 Ga0075434_1000621535 325
384 3300006871 Ga0075434_100073024 Ga0075434_1000730243 325
385 3300006871 Ga0075434_100085881 Ga0075434_1000858812 325
386 3300006880 Ga0075429_100002106 Ga0075429_10000210613 325
387 3300006880 Ga0075429_100002798 Ga0075429_10000279814 325
388 3300006880 Ga0075429_100022792 Ga0075429_1000227926 325
389 3300006880 Ga0075429_100023887 Ga0075429_1000238873 325
390 3300006880 Ga0075429_100063338 Ga0075429_1000633382 325
391 3300006914 Ga0075436_100115230 Ga0075436_1001152302 325
392 3300006931 Ga0097620_100102452 Ga0097620_1001024525 325
393 3300007076 Ga0075435_100063505 Ga0075435_1000635052 325
394 3300007076 Ga0075435_100195556 Ga0075435_1001955562 325
395 3300007265 Ga0099794_10004256 Ga0099794_100042562 325
396 3300007265 Ga0099794_10130628 Ga0099794_101306281 325
397 3300009094 Ga0111539_10001353 Ga0111539_1000135329 325
398 3300009094 Ga0111539_10002439 Ga0111539_1000243913 325
399 3300009094 Ga0111539_10012644 Ga0111539_100126449 325
400 3300009098 Ga0105245_10290132 Ga0105245_102901321 325
401 3300009147 Ga0114129_10000110 Ga0114129_1000011038 325
402 3300009147 Ga0114129_10001511 Ga0114129_1000151112 325
403 3300009147 Ga0114129_10020399 Ga0114129_100203995 325
404 3300009147 Ga0114129_10044379 Ga0114129_100443793 325
405 3300009147 Ga0114129_10452572 Ga0114129_104525722 325
406 3300009147 Ga0114129_10574916 Ga0114129_105749162 325
407 3300013308 Ga0157375_10120206 Ga0157375_101202064 325
408 3300014326 Ga0157380_10546340 Ga0157380_105463402 325
409 3300014969 Ga0157376_10140371 Ga0157376_101403711 325
410 3300025906 Ga0207699_10042288 Ga0207699_100422883 325
411 3300025910 Ga0207684_10084506 Ga0207684_100845065 325
412 3300025926 Ga0207659_10003928 Ga0207659_100039287 325
413 3300025926 Ga0207659_10004886 Ga0207659_100048865 325
414 3300025926 Ga0207659_10010902 Ga0207659_100109024 325
415 3300025936 Ga0207670_10024764 Ga0207670_100247643 325
416 3300025936 Ga0207670_10336500 Ga0207670_103365002 325
417 3300025940 Ga0207691_10071198 Ga0207691_100711984 325
418 3300025942 Ga0207689_10006142 Ga0207689_100061426 325
419 3300025945 Ga0207679_10205329 Ga0207679_102053292 325
420 3300025960 Ga0207651_10061269 Ga0207651_100612692 325
421 3300025960 Ga0207651_10301674 Ga0207651_103016742 325
422 3300026118 Ga0207675_100322394 Ga0207675_1003223942 325
423 3300027614 Ga0209970_1001621 Ga0209970_10016212 325
424 3300027671 Ga0209588_1003834 Ga0209588_10038343 325
425 3300027671 Ga0209588_1013367 Ga0209588_10133672 325
426 3300027907 Ga0207428_10000027 Ga0207428_10000027194 325
427 3300027907 Ga0207428_10011180 Ga0207428_100111808 325
428 3300027907 Ga0207428_10020343 Ga0207428_100203435 325
429 3300027907 Ga0207428_10104636 Ga0207428_101046362 325
430 3300028381 Ga0268264_10016829 Ga0268264_100168292 325
431 3300031903 Ga0307407_10068199 Ga0307407_100681992 325
432 3300032126 Ga0307415_100176911 Ga0307415_1001769111 325
433 3300035088 Ga0373940_0010807 Ga0373940_0010807_982_1971 325
434 3300035115 Ga0373941_0025272 Ga0373941_0025272_550_1539 325
435 3300042003 Ga0439443_008792 Ga0439443_008792_260_1246 325
436 3300042436 Ga0439435_0059568 Ga0439435_0059568_110_1090 325
437 3300044673 Ga0453683_0034615 Ga0453683_0034615_2126_3118 325
438 3300045051 Ga0451576_0005141 Ga0451576_0005141_8647_9669 325
439 3300045051 Ga0451576_0030406 Ga0451576_0030406_505_1527 325
440 3300045051 Ga0451576_0199378 Ga0451576_0199378_75_1064 325
441 3300046472 Ga0495580_0000727 Ga0495580_0000727_5685_6674 325
442 3300046537 Ga0495598_0006886 Ga0495598_0006886_634_1614 325
443 3300046615 Ga0495656_0009898 Ga0495656_0009898_2176_3156 325
444 3300046684 Ga0495669_0029039 Ga0495669_0029039_527_1522 325
445 3300046684 Ga0495669_0031228 Ga0495669_0031228_941_1927 325
446 3300046691 Ga0495670_0080606 Ga0495670_0080606_151_1137 325
447 3300048912 Ga0496109_0149751 Ga0496109_0149751_487_1467 325
448 3300048912 Ga0496109_0297097 Ga0496109_0297097_174_1175 325
449 3300048916 Ga0496113_0040027 Ga0496113_0040027_1153_2133 325
450 3300049572 Ga0501036_0041097 Ga0501036_0041097_1776_2753 325
451 3300049572 Ga0501036_0290159 Ga0501036_0290159_58_1050 325
452 3300049575 Ga0501039_0110564 Ga0501039_0110564_548_1549 325
453 3300049576 Ga0501040_0053982 Ga0501040_0053982_1288_2265 325
454 3300049577 Ga0501041_0049602 Ga0501041_0049602_67_1044 325
455 3300049578 Ga0501042_0017571 Ga0501042_0017571_2267_3262 325
456 3300049578 Ga0501042_0055506 Ga0501042_0055506_1268_2245 325
457 3300049583 Ga0501067_0009738 Ga0501067_0009738_374_1360 325
458 3300049585 Ga0501069_0030155 Ga0501069_0030155_391_1386 325
459 3300049588 Ga0501072_0007493 Ga0501072_0007493_1358_2335 325
460 3300049588 Ga0501072_0086981 Ga0501072_0086981_384_1379 325
461 3300049590 Ga0501074_0113887 Ga0501074_0113887_809_1786 325
462 3300049590 Ga0501074_0122781 Ga0501074_0122781_653_1639 325
463 3300049591 Ga0501075_0088260 Ga0501075_0088260_704_1702 325
464 3300049592 Ga0501076_0000831 Ga0501076_0000831_5363_6358 325
465 3300049592 Ga0501076_0183162 Ga0501076_0183162_446_1423 325
466 3300049593 Ga0501077_0007379 Ga0501077_0007379_887_1882 325
467 3300049593 Ga0501077_0113638 Ga0501077_0113638_566_1564 325
468 3300049593 Ga0501077_0151814 Ga0501077_0151814_10_1002 325
469 3300049742 Ga0501080_0137679 Ga0501080_0137679_403_1395 325
470 3300049743 Ga0501081_0010638 Ga0501081_0010638_4899_5894 325
471 3300049743 Ga0501081_0282466 Ga0501081_0282466_143_1135 325
472 3300049743 Ga0501081_0291248 Ga0501081_0291248_165_1154 325
473 3300049824 Ga0501045_0008724 Ga0501045_0008724_4009_5004 325
474 3300050489 nmdc:mga03683_4325_c1 nmdc:mga03683_4325_c1_168_1160 325
475 3300050491 nmdc:mga00v17_123621_c1 nmdc:mga00v17_123621_c1_197_1189 325
476 3300050491 nmdc:mga00v17_190952_c1 nmdc:mga00v17_190952_c1_156_1154 325
477 3300050491 nmdc:mga00v17_2153_c1 nmdc:mga00v17_2153_c1_6766_7758 325
478 3300050493 nmdc:mga0k408_10311_c1 nmdc:mga0k408_10311_c1_855_1847 325
479 3300050494 nmdc:mga06z11_18520_c1 nmdc:mga06z11_18520_c1_1856_2848 325
480 3300050494 nmdc:mga06z11_36572_c1 nmdc:mga06z11_36572_c1_1125_2117 325
481 3300050496 nmdc:mga07m45_9361_c1 nmdc:mga07m45_9361_c1_637_1623 325
482 3300050507 nmdc:mga05p37_115985_c1 nmdc:mga05p37_115985_c1_394_1383 325
483 3300050507 nmdc:mga05p37_13298_c1 nmdc:mga05p37_13298_c1_3736_4722 325
484 3300050507 nmdc:mga05p37_17395_c1 nmdc:mga05p37_17395_c1_2696_3691 325
485 3300050507 nmdc:mga05p37_26199_c1 nmdc:mga05p37_26199_c1_160_1143 325
486 3300050507 nmdc:mga05p37_405715_c1 nmdc:mga05p37_405715_c1_63_1043 325
487 3300050507 nmdc:mga05p37_42435_c1 nmdc:mga05p37_42435_c1_794_1783 325
488 3300050507 nmdc:mga05p37_63188_c1 nmdc:mga05p37_63188_c1_2251_3228 325
489 3300050507 nmdc:mga05p37_7406_c1 nmdc:mga05p37_7406_c1_9963_10952 325
490 3300050508 nmdc:mga09592_1944_c1 nmdc:mga09592_1944_c1_9317_10303 325
491 3300050508 nmdc:mga09592_29511_c1 nmdc:mga09592_29511_c1_3315_4298 325
492 3300050508 nmdc:mga09592_3878_c1 nmdc:mga09592_3878_c1_10871_11860 325
493 3300050508 nmdc:mga09592_5317_c1 nmdc:mga09592_5317_c1_4697_5686 325
494 3300050508 nmdc:mga09592_53687_c1 nmdc:mga09592_53687_c1_1947_2936 325
495 3300050509 nmdc:mga0qj67_1433_c1 nmdc:mga0qj67_1433_c1_10562_11557 325
496 3300050509 nmdc:mga0qj67_21599_c1 nmdc:mga0qj67_21599_c1_3812_4798 325
497 3300050509 nmdc:mga0qj67_26059_c1 nmdc:mga0qj67_26059_c1_1181_2161 325
498 3300050509 nmdc:mga0qj67_9223_c1 nmdc:mga0qj67_9223_c1_4246_5223 325
499 3300050510 nmdc:mga06r32_3786_c1 nmdc:mga06r32_3786_c1_4268_5254 325
500 3300050510 nmdc:mga06r32_7977_c1 nmdc:mga06r32_7977_c1_723_1718 325
501 3300050510 nmdc:mga06r32_80134_c1 nmdc:mga06r32_80134_c1_1124_2104 325
502 3300050511 nmdc:mga08y16_104951_c1 nmdc:mga08y16_104951_c1_1245_2225 325
503 3300050511 nmdc:mga08y16_17787_c1 nmdc:mga08y16_17787_c1_275_1264 325
504 3300050511 nmdc:mga08y16_243078_c1 nmdc:mga08y16_243078_c1_293_1279 325
505 3300050511 nmdc:mga08y16_2919_c1 nmdc:mga08y16_2919_c1_3268_4248 325
506 3300050511 nmdc:mga08y16_49615_c1 nmdc:mga08y16_49615_c1_770_1759 325
507 3300050512 nmdc:mga0n895_2183_c1 nmdc:mga0n895_2183_c1_10998_12020 325
508 3300050512 nmdc:mga0n895_231840_c1 nmdc:mga0n895_231840_c1_214_1194 325
509 3300050512 nmdc:mga0n895_300722_c1 nmdc:mga0n895_300722_c1_168_1163 325
510 3300050512 nmdc:mga0n895_60106_c1 nmdc:mga0n895_60106_c1_1791_2780 325
511 3300050512 nmdc:mga0n895_85010_c1 nmdc:mga0n895_85010_c1_44_1033 325
512 3300050513 nmdc:mga0rr50_13734_c1 nmdc:mga0rr50_13734_c1_167_1156 325
513 3300050513 nmdc:mga0rr50_151274_c1 nmdc:mga0rr50_151274_c1_442_1431 325
514 3300050515 nmdc:mga0a205_106355_c1 nmdc:mga0a205_106355_c1_442_1431 325
515 3300050515 nmdc:mga0a205_132329_c1 nmdc:mga0a205_132329_c1_86_1108 325
516 3300050515 nmdc:mga0a205_186096_c1 nmdc:mga0a205_186096_c1_442_1431 325
517 3300050515 nmdc:mga0a205_227_c1 nmdc:mga0a205_227_c1_27254_28243 325
518 3300050515 nmdc:mga0a205_47712_c1 nmdc:mga0a205_47712_c1_819_1805 325
519 3300050515 nmdc:mga0a205_8978_c1 nmdc:mga0a205_8978_c1_2051_3040 325
520 3300060353 Ga0501082_0003845 Ga0501082_0003845_2914_3909 325
521 3300061734 Ga0530510_0012598 Ga0530510_0012598_1922_2917 325
522 3300061734 Ga0530510_0020309 Ga0530510_0020309_2774_3769 325
523 3300061734 Ga0530510_0059589 Ga0530510_0059589_1454_2431 325
524 3300003203 JGI25406J46586_10011300 JGI25406J46586_100113003 326
525 3300005290 Ga0065712_10002361 Ga0065712_100023618 326
526 3300005293 Ga0065715_10005733 Ga0065715_100057335 326
527 3300005293 Ga0065715_10140436 Ga0065715_101404362 326
528 3300005328 Ga0070676_10031221 Ga0070676_100312212 326
529 3300005330 Ga0070690_100158211 Ga0070690_1001582112 326
530 3300005331 Ga0070670_100141714 Ga0070670_1001417142 326
531 3300005334 Ga0068869_100098310 Ga0068869_1000983102 326
532 3300005335 Ga0070666_10118073 Ga0070666_101180732 326
533 3300005336 Ga0070680_100150746 Ga0070680_1001507463 326
534 3300005338 Ga0068868_100258448 Ga0068868_1002584482 326
535 3300005338 Ga0068868_100371607 Ga0068868_1003716072 326
536 3300005340 Ga0070689_100071487 Ga0070689_1000714873 326
537 3300005340 Ga0070689_100086855 Ga0070689_1000868552 326
538 3300005343 Ga0070687_100015745 Ga0070687_1000157456 326
539 3300005344 Ga0070661_100022972 Ga0070661_1000229721 326
540 3300005345 Ga0070692_10006625 Ga0070692_100066252 326
541 3300005347 Ga0070668_100049143 Ga0070668_1000491431 326
542 3300005353 Ga0070669_100012365 Ga0070669_1000123652 326
543 3300005353 Ga0070669_100017022 Ga0070669_1000170225 326
544 3300005353 Ga0070669_100066040 Ga0070669_1000660402 326
545 3300005353 Ga0070669_100281838 Ga0070669_1002818381 326
546 3300005354 Ga0070675_100011263 Ga0070675_1000112631 326
547 3300005354 Ga0070675_100367506 Ga0070675_1003675061 326
548 3300005355 Ga0070671_100044691 Ga0070671_1000446912 326
549 3300005356 Ga0070674_100003802 Ga0070674_1000038028 326
550 3300005364 Ga0070673_100079075 Ga0070673_1000790752 326
551 3300005365 Ga0070688_100348487 Ga0070688_1003484871 326
552 3300005367 Ga0070667_100034478 Ga0070667_1000344783 326
553 3300005436 Ga0070713_100171471 Ga0070713_1001714712 326
554 3300005438 Ga0070701_10017788 Ga0070701_100177884 326
555 3300005438 Ga0070701_10087067 Ga0070701_100870672 326
556 3300005440 Ga0070705_100001862 Ga0070705_1000018627 326
557 3300005441 Ga0070700_100075377 Ga0070700_1000753772 326
558 3300005444 Ga0070694_100006222 Ga0070694_1000062225 326
559 3300005444 Ga0070694_100059864 Ga0070694_1000598643 326
560 3300005445 Ga0070708_100018713 Ga0070708_1000187132 326
561 3300005457 Ga0070662_100006443 Ga0070662_1000064438 326
562 3300005458 Ga0070681_10070007 Ga0070681_100700073 326
563 3300005459 Ga0068867_100038646 Ga0068867_1000386462 326
564 3300005459 Ga0068867_100084518 Ga0068867_1000845184 326
565 3300005466 Ga0070685_10045159 Ga0070685_100451594 326
566 3300005467 Ga0070706_100008450 Ga0070706_1000084505 326
567 3300005468 Ga0070707_100000729 Ga0070707_10000072913 326
568 3300005471 Ga0070698_100004426 Ga0070698_10000442611 326
569 3300005471 Ga0070698_100007713 Ga0070698_1000077138 326
570 3300005518 Ga0070699_100000534 Ga0070699_10000053412 326
571 3300005518 Ga0070699_100000712 Ga0070699_10000071211 326
572 3300005518 Ga0070699_100020623 Ga0070699_1000206234 326
573 3300005536 Ga0070697_100001086 Ga0070697_10000108614 326
574 3300005536 Ga0070697_100258750 Ga0070697_1002587502 326
575 3300005543 Ga0070672_100035906 Ga0070672_1000359062 326
576 3300005545 Ga0070695_100000112 Ga0070695_1000001128 326
577 3300005546 Ga0070696_100011986 Ga0070696_1000119862 326
578 3300005549 Ga0070704_100002373 Ga0070704_1000023732 326
579 3300005549 Ga0070704_100014720 Ga0070704_1000147206 326
580 3300005549 Ga0070704_100100306 Ga0070704_1001003062 326
581 3300005564 Ga0070664_100015438 Ga0070664_1000154383 326
582 3300005577 Ga0068857_100008027 Ga0068857_1000080276 326
583 3300005617 Ga0068859_100046788 Ga0068859_1000467885 326
584 3300005617 Ga0068859_100065876 Ga0068859_1000658764 326
585 3300005618 Ga0068864_100037064 Ga0068864_1000370644 326
586 3300005618 Ga0068864_100061059 Ga0068864_1000610594 326
587 3300005618 Ga0068864_100061602 Ga0068864_1000616025 326
588 3300005618 Ga0068864_100170777 Ga0068864_1001707773 326
589 3300005719 Ga0068861_100005274 Ga0068861_1000052746 326
590 3300005840 Ga0068870_10010546 Ga0068870_100105464 326
591 3300005843 Ga0068860_100116171 Ga0068860_1001161712 326
592 3300005844 Ga0068862_100026860 Ga0068862_1000268602 326
593 3300005844 Ga0068862_100039181 Ga0068862_1000391815 326
594 3300005981 Ga0081538_10003260 Ga0081538_100032608 326
595 3300005985 Ga0081539_10000454 Ga0081539_1000045428 326
596 3300006237 Ga0097621_100159219 Ga0097621_1001592192 326
597 3300006358 Ga0068871_100116393 Ga0068871_1001163932 326
598 3300006844 Ga0075428_100004648 Ga0075428_1000046489 326
599 3300006844 Ga0075428_100006929 Ga0075428_1000069296 326
600 3300006844 Ga0075428_100012979 Ga0075428_1000129795 326
601 3300006844 Ga0075428_100036865 Ga0075428_1000368655 326
602 3300006844 Ga0075428_100131095 Ga0075428_1001310954 326
603 3300006846 Ga0075430_100029617 Ga0075430_1000296175 326
604 3300006846 Ga0075430_100032620 Ga0075430_1000326205 326
605 3300006846 Ga0075430_100315334 Ga0075430_1003153342 326
606 3300006847 Ga0075431_100000455 Ga0075431_1000004559 326
607 3300006847 Ga0075431_100001687 Ga0075431_10000168715 326
608 3300006847 Ga0075431_100227399 Ga0075431_1002273992 326
609 3300006852 Ga0075433_10000061 Ga0075433_1000006145 326
610 3300006852 Ga0075433_10005550 Ga0075433_100055509 326
611 3300006852 Ga0075433_10189199 Ga0075433_101891992 326
612 3300006871 Ga0075434_100257076 Ga0075434_1002570762 326
613 3300006871 Ga0075434_100306626 Ga0075434_1003066262 326
614 3300006871 Ga0075434_100348706 Ga0075434_1003487062 326
615 3300006880 Ga0075429_100002213 Ga0075429_10000221311 326
616 3300006880 Ga0075429_100014281 Ga0075429_1000142818 326
617 3300006880 Ga0075429_100015287 Ga0075429_1000152874 326
618 3300006880 Ga0075429_100064236 Ga0075429_1000642365 326
619 3300006880 Ga0075429_100185672 Ga0075429_1001856722 326
620 3300006914 Ga0075436_100002146 Ga0075436_1000021464 326
621 3300006931 Ga0097620_100046795 Ga0097620_1000467955 326
622 3300006931 Ga0097620_100065876 Ga0097620_1000658764 326
623 3300007076 Ga0075435_100017542 Ga0075435_1000175423 326
624 3300007076 Ga0075435_100128697 Ga0075435_1001286973 326
625 3300007076 Ga0075435_100191860 Ga0075435_1001918602 326
626 3300007076 Ga0075435_100291843 Ga0075435_1002918432 326
627 3300009094 Ga0111539_10000463 Ga0111539_1000046357 326
628 3300009094 Ga0111539_10006594 Ga0111539_1000659411 326
629 3300009094 Ga0111539_10024427 Ga0111539_100244278 326
630 3300009094 Ga0111539_10135636 Ga0111539_101356362 326
631 3300009147 Ga0114129_10000936 Ga0114129_1000093610 326
632 3300009147 Ga0114129_10002179 Ga0114129_1000217926 326
633 3300009147 Ga0114129_10003221 Ga0114129_1000322118 326
634 3300009147 Ga0114129_10013658 Ga0114129_100136581 326
635 3300009147 Ga0114129_10082854 Ga0114129_100828545 326
636 3300009147 Ga0114129_10094435 Ga0114129_100944352 326
637 3300009176 Ga0105242_10140483 Ga0105242_101404831 326
638 3300009177 Ga0105248_10025004 Ga0105248_100250045 326
639 3300009553 Ga0105249_10008153 Ga0105249_100081534 326
640 3300011119 Ga0105246_10337788 Ga0105246_103377882 326
641 3300013306 Ga0163162_10055861 Ga0163162_100558613 326
642 3300013306 Ga0163162_10244221 Ga0163162_102442213 326
643 3300013308 Ga0157375_10010834 Ga0157375_100108348 326
644 3300014326 Ga0157380_10003226 Ga0157380_100032268 326
645 3300014326 Ga0157380_10056782 Ga0157380_100567822 326
646 3300014745 Ga0157377_10043870 Ga0157377_100438702 326
647 3300025315 Ga0207697_10001435 Ga0207697_1000143510 326
648 3300025315 Ga0207697_10109091 Ga0207697_101090912 326
649 3300025893 Ga0207682_10003116 Ga0207682_100031163 326
650 3300025893 Ga0207682_10110490 Ga0207682_101104902 326
651 3300025901 Ga0207688_10001607 Ga0207688_100016071 326
652 3300025903 Ga0207680_10023261 Ga0207680_100232612 326
653 3300025903 Ga0207680_10106097 Ga0207680_101060972 326
654 3300025907 Ga0207645_10231354 Ga0207645_102313542 326
655 3300025908 Ga0207643_10012764 Ga0207643_100127644 326
656 3300025908 Ga0207643_10016950 Ga0207643_100169503 326
657 3300025910 Ga0207684_10000279 Ga0207684_1000027961 326
658 3300025912 Ga0207707_10053512 Ga0207707_100535123 326
659 3300025920 Ga0207649_10041050 Ga0207649_100410502 326
660 3300025922 Ga0207646_10001682 Ga0207646_1000168211 326
661 3300025922 Ga0207646_10203811 Ga0207646_102038112 326
662 3300025923 Ga0207681_10004865 Ga0207681_100048655 326
663 3300025923 Ga0207681_10008334 Ga0207681_100083342 326
664 3300025923 Ga0207681_10070635 Ga0207681_100706352 326
665 3300025926 Ga0207659_10051272 Ga0207659_100512722 326
666 3300025926 Ga0207659_10203005 Ga0207659_102030052 326
667 3300025928 Ga0207700_10089034 Ga0207700_100890343 326
668 3300025931 Ga0207644_10087713 Ga0207644_100877132 326
669 3300025931 Ga0207644_10237830 Ga0207644_102378302 326
670 3300025932 Ga0207690_10099442 Ga0207690_100994422 326
671 3300025933 Ga0207706_10108186 Ga0207706_101081862 326
672 3300025936 Ga0207670_10090053 Ga0207670_100900532 326
673 3300025937 Ga0207669_10005017 Ga0207669_100050176 326
674 3300025940 Ga0207691_10010524 Ga0207691_100105248 326
675 3300025940 Ga0207691_10041123 Ga0207691_100411235 326
676 3300025940 Ga0207691_10170382 Ga0207691_101703822 326
677 3300025942 Ga0207689_10044373 Ga0207689_100443732 326
678 3300025942 Ga0207689_10044581 Ga0207689_100445813 326
679 3300025942 Ga0207689_10091644 Ga0207689_100916442 326
680 3300025945 Ga0207679_10010677 Ga0207679_100106776 326
681 3300025960 Ga0207651_10007460 Ga0207651_100074601 326
682 3300025960 Ga0207651_10052884 Ga0207651_100528844 326
683 3300025960 Ga0207651_10286852 Ga0207651_102868522 326
684 3300025961 Ga0207712_10061924 Ga0207712_100619244 326
685 3300025972 Ga0207668_10016771 Ga0207668_100167711 326
686 3300025972 Ga0207668_10086619 Ga0207668_100866194 326
687 3300026023 Ga0207677_10145337 Ga0207677_101453372 326
688 3300026023 Ga0207677_10224460 Ga0207677_102244602 326
689 3300026035 Ga0207703_10029241 Ga0207703_100292415 326
690 3300026075 Ga0207708_10012722 Ga0207708_100127225 326
691 3300026088 Ga0207641_10034038 Ga0207641_100340386 326
692 3300026088 Ga0207641_10201752 Ga0207641_102017522 326
693 3300026089 Ga0207648_10001029 Ga0207648_100010294 326
694 3300026089 Ga0207648_10033849 Ga0207648_100338491 326
695 3300026089 Ga0207648_10082063 Ga0207648_100820633 326
696 3300026089 Ga0207648_10104797 Ga0207648_101047972 326
697 3300026089 Ga0207648_10128449 Ga0207648_101284492 326
698 3300026095 Ga0207676_10026933 Ga0207676_100269334 326
699 3300026095 Ga0207676_10048199 Ga0207676_100481994 326
700 3300026095 Ga0207676_10048586 Ga0207676_100485862 326
701 3300026095 Ga0207676_10062298 Ga0207676_100622981 326
702 3300026095 Ga0207676_10106161 Ga0207676_101061612 326
703 3300026095 Ga0207676_10143337 Ga0207676_101433372 326
704 3300026116 Ga0207674_10050436 Ga0207674_100504362 326
705 3300026116 Ga0207674_10141413 Ga0207674_101414132 326
706 3300026118 Ga0207675_100000947 Ga0207675_10000094721 326
707 3300026118 Ga0207675_100012281 Ga0207675_1000122818 326
708 3300026118 Ga0207675_100043778 Ga0207675_1000437782 326
709 3300026121 Ga0207683_10035387 Ga0207683_100353872 326
710 3300027907 Ga0207428_10000245 Ga0207428_1000024536 326
711 3300027907 Ga0207428_10007874 Ga0207428_100078748 326
712 3300027907 Ga0207428_10008043 Ga0207428_100080432 326
713 3300027907 Ga0207428_10218538 Ga0207428_102185382 326
714 3300028379 Ga0268266_10304794 Ga0268266_103047942 326
715 3300028380 Ga0268265_10007675 Ga0268265_100076754 326
716 3300028380 Ga0268265_10031665 Ga0268265_100316655 326
717 3300028381 Ga0268264_10087103 Ga0268264_100871033 326
718 3300035691 Ga0373931_0137497 Ga0373931_0137497_392_1372 326
719 3300037418 Ga0395900_0068642 Ga0395900_0068642_2588_3601 326
720 3300037471 Ga0395905_0017487 Ga0395905_0017487_652_1665 326
721 3300038443 Ga0395901_0138497 Ga0395901_0138497_263_1276 326
722 3300042876 Ga0451577_0014387 Ga0451577_0014387_4636_5631 326
723 3300042993 Ga0439440_0008018 Ga0439440_0008018_318_1298 326
724 3300044673 Ga0453683_0059377 Ga0453683_0059377_1275_2270 326
725 3300044673 Ga0453683_0132955 Ga0453683_0132955_20_1015 326
726 3300044712 Ga0453684_0023625 Ga0453684_0023625_89_1084 326
727 3300044712 Ga0453684_0454702 Ga0453684_0454702_369_1370 326
728 3300045051 Ga0451576_0004364 Ga0451576_0004364_5688_6683 326
729 3300045051 Ga0451576_0012148 Ga0451576_0012148_2611_3606 326
730 3300045051 Ga0451576_0015985 Ga0451576_0015985_187_1188 326
731 3300045051 Ga0451576_0031179 Ga0451576_0031179_2351_3352 326
732 3300046455 Ga0495603_0034875 Ga0495603_0034875_1151_2152 326
733 3300046491 Ga0495584_0072522 Ga0495584_0072522_577_1581 326
734 3300046499 Ga0495594_0018287 Ga0495594_0018287_1229_2230 326
735 3300046528 Ga0495642_0067145 Ga0495642_0067145_51_1040 326
736 3300046663 Ga0495635_0185823 Ga0495635_0185823_292_1287 326
737 3300046664 Ga0495659_0027336 Ga0495659_0027336_917_1900 326
738 3300046664 Ga0495659_0031074 Ga0495659_0031074_571_1572 326
739 3300046674 Ga0495588_0008264 Ga0495588_0008264_2786_3787 326
740 3300047318 Ga0495636_0025947 Ga0495636_0025947_429_1430 326
741 3300047321 Ga0495676_0099207 Ga0495676_0099207_1042_2040 326
742 3300048913 Ga0496110_0106836 Ga0496110_0106836_904_1884 326
743 3300049583 Ga0501067_0013133 Ga0501067_0013133_302_1291 326
744 3300049584 Ga0501068_0065483 Ga0501068_0065483_1097_2089 326
745 3300049585 Ga0501069_0031286 Ga0501069_0031286_1157_2146 326
746 3300049586 Ga0501070_0219408 Ga0501070_0219408_133_1125 326
747 3300049587 Ga0501071_0079021 Ga0501071_0079021_1337_2329 326
748 3300049588 Ga0501072_0179995 Ga0501072_0179995_28_1020 326
749 3300049591 Ga0501075_0061209 Ga0501075_0061209_1817_2809 326
750 3300049592 Ga0501076_0067189 Ga0501076_0067189_342_1334 326
751 3300049593 Ga0501077_0228384 Ga0501077_0228384_113_1096 326
752 3300049741 Ga0501079_0011626 Ga0501079_0011626_2131_3123 326
753 3300049743 Ga0501081_0001826 Ga0501081_0001826_9264_10256 326
754 3300050507 nmdc:mga05p37_11414_c1 nmdc:mga05p37_11414_c1_1622_2602 326
755 3300050507 nmdc:mga05p37_155861_c1 nmdc:mga05p37_155861_c1_925_1917 326
756 3300050507 nmdc:mga05p37_1821_c1 nmdc:mga05p37_1821_c1_12787_13800 326
757 3300050507 nmdc:mga05p37_2476_c1 nmdc:mga05p37_2476_c1_8948_9940 326
758 3300050507 nmdc:mga05p37_7226_c1 nmdc:mga05p37_7226_c1_1343_2326 326
759 3300050507 nmdc:mga05p37_769_c1 nmdc:mga05p37_769_c1_3582_4595 326
760 3300050508 nmdc:mga09592_10924_c1 nmdc:mga09592_10924_c1_1357_2337 326
761 3300050508 nmdc:mga09592_14652_c1 nmdc:mga09592_14652_c1_713_1693 326
762 3300050508 nmdc:mga09592_148021_c1 nmdc:mga09592_148021_c1_659_1639 326
763 3300050508 nmdc:mga09592_2581_c1 nmdc:mga09592_2581_c1_5892_6905 326
764 3300050508 nmdc:mga09592_79360_c1 nmdc:mga09592_79360_c1_1245_2243 326
765 3300050509 nmdc:mga0qj67_7809_c1 nmdc:mga0qj67_7809_c1_457_1437 326
766 3300050510 nmdc:mga06r32_203185_c1 nmdc:mga06r32_203185_c1_275_1288 326
767 3300050510 nmdc:mga06r32_2396_c1 nmdc:mga06r32_2396_c1_1969_2949 326
768 3300050510 nmdc:mga06r32_5775_c1 nmdc:mga06r32_5775_c1_8366_9379 326
769 3300050511 nmdc:mga08y16_123507_c1 nmdc:mga08y16_123507_c1_418_1398 326
770 3300050511 nmdc:mga08y16_1306_c1 nmdc:mga08y16_1306_c1_10807_11805 326
771 3300050511 nmdc:mga08y16_597_c1 nmdc:mga08y16_597_c1_11803_12798 326
772 3300050512 nmdc:mga0n895_1214_c1 nmdc:mga0n895_1214_c1_8623_9636 326
773 3300050512 nmdc:mga0n895_150271_c1 nmdc:mga0n895_150271_c1_951_1952 326
774 3300050512 nmdc:mga0n895_258631_c1 nmdc:mga0n895_258631_c1_655_1650 326
775 3300050513 nmdc:mga0rr50_203268_c1 nmdc:mga0rr50_203268_c1_14_1009 326
776 3300050513 nmdc:mga0rr50_245903_c1 nmdc:mga0rr50_245903_c1_106_1107 326
777 3300050513 nmdc:mga0rr50_549_c1 nmdc:mga0rr50_549_c1_15067_16080 326
778 3300050513 nmdc:mga0rr50_62866_c1 nmdc:mga0rr50_62866_c1_1618_2598 326
779 3300050513 nmdc:mga0rr50_75272_c1 nmdc:mga0rr50_75272_c1_783_1784 326
780 3300050514 nmdc:mga08x19_1724_c1 nmdc:mga08x19_1724_c1_5215_6228 326
781 3300050515 nmdc:mga0a205_1170_c1 nmdc:mga0a205_1170_c1_16803_17816 326
782 3300050515 nmdc:mga0a205_1627_c1 nmdc:mga0a205_1627_c1_3265_4245 326
783 3300050515 nmdc:mga0a205_1991_c1 nmdc:mga0a205_1991_c1_125_1120 326
784 3300054114 Ga0501084_0023135 Ga0501084_0023135_2171_3163 326
785 3300060353 Ga0501082_0006260 Ga0501082_0006260_9034_10026 326
786 3300060353 Ga0501082_0267343 Ga0501082_0267343_243_1235 326
787 3300061734 Ga0530510_0161310 Ga0530510_0161310_408_1400 326
788 3300003203 JGI25406J46586_10000120 JGI25406J46586_1000012020 327
789 3300005985 Ga0081539_10000024 Ga0081539_1000002435 327
790 3300005985 Ga0081539_10002353 Ga0081539_1000235317 327
791 3300006871 Ga0075434_100008511 Ga0075434_10000851110 327
792 3300007076 Ga0075435_100250181 Ga0075435_1002501811 327
793 3300014326 Ga0157380_10443177 Ga0157380_104431772 327
794 3300031911 Ga0307412_10085013 Ga0307412_100850132 327
795 3300031995 Ga0307409_100144824 Ga0307409_1001448242 327
796 3300032002 Ga0307416_100034764 Ga0307416_1000347643 327
797 3300032005 Ga0307411_10062966 Ga0307411_100629662 327

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00146

NADHdh

NADH dehydrogenase

29

338

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nyh-assembly1.cif.gz_H respiratory complex i from escherichia coli - focused refinement of membrane arm 0.6345 46 319
7nyh-assembly1.cif.gz_H respiratory complex i from escherichia coli - focused refinement of membrane arm 0.6302 46 319
7nyv-assembly1.cif.gz_H respiratory complex i from escherichia coli - conformation 3 0.622 46 319
7nyv-assembly1.cif.gz_H respiratory complex i from escherichia coli - conformation 3 0.618 46 319
4he8-assembly2.cif.gz_C crystal structure of the membrane domain of respiratory complex i from thermus thermophilus 0.6081 1 319
ID Description Score Start End Superfamily
af_E9AHC4_60_205_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4757 132 245 1.20.140.150
af_A0A078BPE5_147_314_1.20.120.30 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Aspartate receptor, ligand-binding domain 0.3976 112 302 1.20.120.30
af_A0A078BPE5_147_314_1.20.120.30 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Aspartate receptor, ligand-binding domain 0.3851 112 302 1.20.120.30
af_Q5ZCD0_7_178_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.385 135 298 1.20.1410.10
af_Q6AXM5_64_249_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.378 143 309 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A521SWH1-F1-model_v4 NADH-quinone oxidoreductase subunit H 0.8448 172 323 GO:0003954
GO:0005886
GO:0009060
AF-A0A151BD10-F1-model_v4 NADH:ubiquinone oxidoreductase subunit H 0.8293 145 318 GO:0003954
GO:0009060
GO:0016020
AF-A0A2N6EKY7-F1-model_v4 NADH-quinone oxidoreductase subunit H 0.8272 142 320 GO:0003954
GO:0005886
GO:0009060
AF-A0A521SWH1-F1-model_v4 NADH-quinone oxidoreductase subunit H 0.8141 172 323 GO:0003954
GO:0005886
GO:0009060
AF-A0A3B8PYH2-F1-model_v4 Hydroxyacid dehydrogenase 0.8077 142 324 GO:0003954
GO:0005886
GO:0009060

Feature Viewer

pLDDT pTM Quality
70.38 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map