F481341
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 799 | 368 | 799 | 140 |
Family's Representative Sequence
| Representative Sequence | 3300044712|Ga0453684_0101448|Ga0453684_0101448_2636_3157 |
| Length | 173 |
| Sequence | MGKGDSPTLPGPQPGDITAADTSTVLSTRSIAIMALERTLSIIKPDATRRNLTGKVNARLEEGGLRIVAQKRLQLTTAQAEGFYAVHAERPFFRDLVTFMTSGPVVVQVLEGENAVLRNREIMGATNPANAAAGTIRKDFAESIEANSVHGSDSLENARTEVAYFFSACEIVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 62 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 68 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 69 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 107 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 109 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 110 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 111 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 112 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 113 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 180 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 185 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 187 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 188 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 192 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 193 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 195 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 196 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 199 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 200 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 202 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 203 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 205 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 206 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 207 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 208 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 209 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 211 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 213 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 214 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 218 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 223 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 224 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 227 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 228 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 229 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 231 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 232 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 234 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 235 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 236 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 237 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 238 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 239 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 240 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 241 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 242 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 243 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 244 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 245 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 246 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 247 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 248 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 252 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 253 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 254 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 255 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 256 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 257 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 258 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 259 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 260 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 261 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 262 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 292 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 293 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 294 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 295 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 296 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 297 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 298 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 299 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 300 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 301 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 302 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 303 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 304 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 328 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 329 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 334 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 337 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 338 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 339 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 340 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 341 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 346 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 347 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 348 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 349 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 350 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 351 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 352 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 353 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 354 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 355 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 356 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 357 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 358 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 359 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 360 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 361 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 362 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 363 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 364 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 365 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.12 |
| Metatranscriptomes | 0.88 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.76 |
| Nodule | 0 |
| Rhizoplane | 0.88 |
| Rhizosphere | 87.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065165_1003558 | 3300005262 | Bacteria | 10770 |
| 2 | Ga0065707_10082138 | 3300005295 | Bacteria | 21055 |
| 3 | Ga0070658_10002834 | 3300005327 | Bacteria | 14407 |
| 4 | Ga0070658_10048640 | 3300005327 | Bacteria | 3433 |
| 5 | Ga0070658_10074304 | 3300005327 | Bacteria | 2788 |
| 6 | Ga0070658_11518601 | 3300005327 | Bacteria | 581 |
| 7 | Ga0070683_100166982 | 3300005329 | Bacteria | 2088 |
| 8 | Ga0070683_100245898 | 3300005329 | Bacteria | 1701 |
| 9 | Ga0070683_101039085 | 3300005329 | Bacteria | 787 |
| 10 | Ga0070690_100202829 | 3300005330 | Bacteria | 1381 |
| 11 | Ga0070690_100369722 | 3300005330 | Bacteria | 1045 |
| 12 | Ga0070670_100891014 | 3300005331 | Bacteria | 806 |
| 13 | Ga0068869_101940050 | 3300005334 | Bacteria | 528 |
| 14 | Ga0070666_10322205 | 3300005335 | Bacteria | 1103 |
| 15 | Ga0068868_100172392 | 3300005338 | Bacteria | 1791 |
| 16 | Ga0068868_100438038 | 3300005338 | Bacteria | 1134 |
| 17 | Ga0068868_100816262 | 3300005338 | Bacteria | 842 |
| 18 | Ga0068868_101274936 | 3300005338 | Bacteria | 682 |
| 19 | Ga0070660_100012199 | 3300005339 | Bacteria | 6135 |
| 20 | Ga0070660_100033220 | 3300005339 | Bacteria | 3887 |
| 21 | Ga0070689_100565888 | 3300005340 | Bacteria | 981 |
| 22 | Ga0070691_10615449 | 3300005341 | Bacteria | 643 |
| 23 | Ga0070687_100355430 | 3300005343 | Bacteria | 947 |
| 24 | Ga0070661_100423544 | 3300005344 | Bacteria | 1055 |
| 25 | Ga0070661_100577703 | 3300005344 | Bacteria | 907 |
| 26 | Ga0070661_100640874 | 3300005344 | Bacteria | 862 |
| 27 | Ga0070668_100013728 | 3300005347 | Bacteria | 6051 |
| 28 | Ga0070668_100021015 | 3300005347 | Bacteria | 4932 |
| 29 | Ga0070668_100371585 | 3300005347 | Bacteria | 1215 |
| 30 | Ga0070668_100414259 | 3300005347 | Bacteria | 1153 |
| 31 | Ga0070675_100048611 | 3300005354 | Bacteria | 3479 |
| 32 | Ga0070675_100255186 | 3300005354 | Bacteria | 1535 |
| 33 | Ga0070675_100973261 | 3300005354 | Bacteria | 779 |
| 34 | Ga0070675_101041660 | 3300005354 | Bacteria | 752 |
| 35 | Ga0070675_101272631 | 3300005354 | Bacteria | 677 |
| 36 | Ga0070674_100381483 | 3300005356 | Bacteria | 1147 |
| 37 | Ga0070673_100054087 | 3300005364 | Bacteria | 3157 |
| 38 | Ga0070673_100727102 | 3300005364 | Bacteria | 913 |
| 39 | Ga0070659_100495818 | 3300005366 | Bacteria | 1040 |
| 40 | Ga0070667_100034729 | 3300005367 | Bacteria | 4221 |
| 41 | Ga0070667_100386741 | 3300005367 | Bacteria | 1271 |
| 42 | Ga0070667_100600934 | 3300005367 | Bacteria | 1014 |
| 43 | Ga0070667_101156111 | 3300005367 | Bacteria | 724 |
| 44 | Ga0070709_10033191 | 3300005434 | Bacteria | 3119 |
| 45 | Ga0070714_100182974 | 3300005435 | Bacteria | 1908 |
| 46 | Ga0070713_100370088 | 3300005436 | Bacteria | 1333 |
| 47 | Ga0070713_100520776 | 3300005436 | Bacteria | 1124 |
| 48 | Ga0070710_10264912 | 3300005437 | Bacteria | 1109 |
| 49 | Ga0070710_10301080 | 3300005437 | Bacteria | 1046 |
| 50 | Ga0070711_100000579 | 3300005439 | Bacteria | 19103 |
| 51 | Ga0070711_100906234 | 3300005439 | Bacteria | 753 |
| 52 | Ga0070711_101510616 | 3300005439 | Bacteria | 586 |
| 53 | Ga0070708_100001209 | 3300005445 | Bacteria | 19895 |
| 54 | Ga0070708_101073968 | 3300005445 | Bacteria | 754 |
| 55 | Ga0070663_100145573 | 3300005455 | Bacteria | 1813 |
| 56 | Ga0070678_100111350 | 3300005456 | Bacteria | 2142 |
| 57 | Ga0070681_10133669 | 3300005458 | Bacteria | 2412 |
| 58 | Ga0070681_10138493 | 3300005458 | Bacteria | 2363 |
| 59 | Ga0070681_10887657 | 3300005458 | Bacteria | 810 |
| 60 | Ga0068867_100034276 | 3300005459 | Bacteria | 3679 |
| 61 | Ga0068867_100891518 | 3300005459 | Bacteria | 800 |
| 62 | Ga0070685_10047760 | 3300005466 | Bacteria | 2463 |
| 63 | Ga0070706_100000114 | 3300005467 | Bacteria | 98324 |
| 64 | Ga0070707_100037523 | 3300005468 | Bacteria | 4625 |
| 65 | Ga0070698_100003572 | 3300005471 | Bacteria | 17085 |
| 66 | Ga0070698_100196630 | 3300005471 | Bacteria | 1953 |
| 67 | Ga0070679_100008108 | 3300005530 | Bacteria | 9867 |
| 68 | Ga0070679_100133298 | 3300005530 | Bacteria | 2465 |
| 69 | Ga0070684_100114518 | 3300005535 | Bacteria | 2421 |
| 70 | Ga0070684_100145132 | 3300005535 | Bacteria | 2148 |
| 71 | Ga0070684_100149600 | 3300005535 | Bacteria | 2114 |
| 72 | Ga0070697_100007078 | 3300005536 | Bacteria | 8726 |
| 73 | Ga0070697_100164907 | 3300005536 | Bacteria | 1873 |
| 74 | Ga0068853_100124330 | 3300005539 | Bacteria | 2304 |
| 75 | Ga0068853_100168641 | 3300005539 | Bacteria | 1980 |
| 76 | Ga0068853_100386385 | 3300005539 | Bacteria | 1308 |
| 77 | Ga0068853_100956850 | 3300005539 | Bacteria | 824 |
| 78 | Ga0070672_101098974 | 3300005543 | Bacteria | 706 |
| 79 | Ga0070665_100002027 | 3300005548 | Bacteria | 22781 |
| 80 | Ga0070665_100003577 | 3300005548 | Bacteria | 16470 |
| 81 | Ga0070665_100038937 | 3300005548 | Bacteria | 4780 |
| 82 | Ga0070665_100060814 | 3300005548 | Bacteria | 3786 |
| 83 | Ga0070665_100127146 | 3300005548 | Bacteria | 2551 |
| 84 | Ga0070665_100253694 | 3300005548 | Bacteria | 1760 |
| 85 | Ga0070665_100258566 | 3300005548 | Bacteria | 1742 |
| 86 | Ga0070665_101287906 | 3300005548 | Bacteria | 741 |
| 87 | Ga0070704_100384850 | 3300005549 | Bacteria | 1193 |
| 88 | Ga0068855_100517072 | 3300005563 | Bacteria | 1295 |
| 89 | Ga0068855_101286399 | 3300005563 | Bacteria | 757 |
| 90 | Ga0068855_102163076 | 3300005563 | Bacteria | 559 |
| 91 | Ga0070664_100102651 | 3300005564 | Bacteria | 2488 |
| 92 | Ga0070664_100325916 | 3300005564 | Bacteria | 1393 |
| 93 | Ga0068857_100517918 | 3300005577 | Bacteria | 1121 |
| 94 | Ga0068857_100579002 | 3300005577 | Bacteria | 1059 |
| 95 | Ga0068857_100826386 | 3300005577 | Bacteria | 886 |
| 96 | Ga0068857_100961268 | 3300005577 | Bacteria | 821 |
| 97 | Ga0068857_101216416 | 3300005577 | Bacteria | 730 |
| 98 | Ga0068854_100263146 | 3300005578 | Bacteria | 1382 |
| 99 | Ga0068854_100513327 | 3300005578 | Bacteria | 1011 |
| 100 | Ga0068854_101440975 | 3300005578 | Bacteria | 624 |
| 101 | Ga0068856_100083626 | 3300005614 | Bacteria | 3170 |
| 102 | Ga0068856_100112827 | 3300005614 | Bacteria | 2716 |
| 103 | Ga0068856_100344597 | 3300005614 | Bacteria | 1508 |
| 104 | Ga0068856_100593425 | 3300005614 | Bacteria | 1129 |
| 105 | Ga0068852_100033207 | 3300005616 | Bacteria | 4282 |
| 106 | Ga0068852_100746482 | 3300005616 | Bacteria | 991 |
| 107 | Ga0068864_100149906 | 3300005618 | Bacteria | 2112 |
| 108 | Ga0068864_100174877 | 3300005618 | Bacteria | 1959 |
| 109 | Ga0068864_100562715 | 3300005618 | Bacteria | 1103 |
| 110 | Ga0068866_10223007 | 3300005718 | Bacteria | 1138 |
| 111 | Ga0068861_100002290 | 3300005719 | Bacteria | 12425 |
| 112 | Ga0068851_10549095 | 3300005834 | Bacteria | 698 |
| 113 | Ga0068870_10894200 | 3300005840 | Bacteria | 627 |
| 114 | Ga0068858_100269198 | 3300005842 | Bacteria | 1621 |
| 115 | Ga0068860_100006672 | 3300005843 | Bacteria | 11594 |
| 116 | Ga0068860_100010477 | 3300005843 | Bacteria | 9163 |
| 117 | Ga0068860_100201562 | 3300005843 | Bacteria | 1928 |
| 118 | Ga0068860_100492781 | 3300005843 | Bacteria | 1223 |
| 119 | Ga0068862_100069735 | 3300005844 | Bacteria | 3034 |
| 120 | Ga0068862_100376521 | 3300005844 | Bacteria | 1323 |
| 121 | Ga0081455_10000806 | 3300005937 | Bacteria | 40338 |
| 122 | Ga0081455_10117215 | 3300005937 | Bacteria | 2105 |
| 123 | Ga0081455_10203403 | 3300005937 | Bacteria | 1481 |
| 124 | Ga0081455_10256957 | 3300005937 | Bacteria | 1274 |
| 125 | Ga0081540_1004991 | 3300005983 | Bacteria | 9974 |
| 126 | Ga0081540_1032904 | 3300005983 | Bacteria | 2823 |
| 127 | Ga0081539_10010022 | 3300005985 | Bacteria | 7797 |
| 128 | Ga0070717_10000290 | 3300006028 | Bacteria | 33745 |
| 129 | Ga0075365_10019235 | 3300006038 | Bacteria | 4212 |
| 130 | Ga0075365_10206913 | 3300006038 | Bacteria | 1375 |
| 131 | Ga0075368_10090302 | 3300006042 | Bacteria | 1253 |
| 132 | Ga0075363_100045378 | 3300006048 | Bacteria | 2330 |
| 133 | Ga0075363_100609719 | 3300006048 | Bacteria | 654 |
| 134 | Ga0075364_10077688 | 3300006051 | Bacteria | 2192 |
| 135 | Ga0075364_10628679 | 3300006051 | Bacteria | 733 |
| 136 | Ga0075364_10654504 | 3300006051 | Bacteria | 717 |
| 137 | Ga0075432_10096927 | 3300006058 | Bacteria | 1086 |
| 138 | Ga0070715_10063594 | 3300006163 | Bacteria | 1627 |
| 139 | Ga0070715_10129677 | 3300006163 | Bacteria | 1212 |
| 140 | Ga0070715_10172437 | 3300006163 | Bacteria | 1079 |
| 141 | Ga0070712_100003789 | 3300006175 | Bacteria | 9313 |
| 142 | Ga0070712_100091326 | 3300006175 | Bacteria | 2231 |
| 143 | Ga0070712_100265700 | 3300006175 | Bacteria | 1376 |
| 144 | Ga0070712_101412594 | 3300006175 | Bacteria | 607 |
| 145 | Ga0075362_10003772 | 3300006177 | Bacteria | 5364 |
| 146 | Ga0075362_10005498 | 3300006177 | Bacteria | 4643 |
| 147 | Ga0075367_10023776 | 3300006178 | Bacteria | 3451 |
| 148 | Ga0075367_10263779 | 3300006178 | Bacteria | 1081 |
| 149 | Ga0075367_10400103 | 3300006178 | Bacteria | 868 |
| 150 | Ga0075369_10002609 | 3300006186 | Bacteria | 6454 |
| 151 | Ga0075369_10273997 | 3300006186 | Bacteria | 785 |
| 152 | Ga0097621_100075157 | 3300006237 | Bacteria | 2800 |
| 153 | Ga0097621_100483488 | 3300006237 | Bacteria | 1119 |
| 154 | Ga0097621_100534926 | 3300006237 | Bacteria | 1065 |
| 155 | Ga0097621_101176878 | 3300006237 | Bacteria | 722 |
| 156 | Ga0075370_10122037 | 3300006353 | Bacteria | 1517 |
| 157 | Ga0068871_100013417 | 3300006358 | Bacteria | 6082 |
| 158 | Ga0068871_100106979 | 3300006358 | Bacteria | 2349 |
| 159 | Ga0068871_100162683 | 3300006358 | Bacteria | 1909 |
| 160 | Ga0068871_100180015 | 3300006358 | Bacteria | 1816 |
| 161 | Ga0068871_100212153 | 3300006358 | Bacteria | 1675 |
| 162 | Ga0068871_100229864 | 3300006358 | Bacteria | 1610 |
| 163 | Ga0068871_100529831 | 3300006358 | Bacteria | 1065 |
| 164 | Ga0068871_100926426 | 3300006358 | Bacteria | 808 |
| 165 | Ga0075428_100744562 | 3300006844 | Bacteria | 1043 |
| 166 | Ga0075431_101216947 | 3300006847 | Bacteria | 716 |
| 167 | Ga0075433_10242694 | 3300006852 | Bacteria | 1599 |
| 168 | Ga0075434_100083305 | 3300006871 | Bacteria | 3196 |
| 169 | Ga0075429_100775711 | 3300006880 | Bacteria | 840 |
| 170 | Ga0075429_101229270 | 3300006880 | Bacteria | 654 |
| 171 | Ga0068865_100003415 | 3300006881 | Bacteria | 9500 |
| 172 | Ga0068865_100329570 | 3300006881 | Bacteria | 1230 |
| 173 | Ga0068865_101341899 | 3300006881 | Bacteria | 637 |
| 174 | Ga0097620_102137391 | 3300006931 | Bacteria | 618 |
| 175 | Ga0075435_100854815 | 3300007076 | Bacteria | 793 |
| 176 | Ga0105240_10116693 | 3300009093 | Bacteria | 3220 |
| 177 | Ga0105240_10215739 | 3300009093 | Bacteria | 2239 |
| 178 | Ga0105240_10431257 | 3300009093 | Bacteria | 1479 |
| 179 | Ga0105240_10624729 | 3300009093 | Bacteria | 1183 |
| 180 | Ga0105240_11005033 | 3300009093 | Bacteria | 892 |
| 181 | Ga0105240_11414497 | 3300009093 | Bacteria | 731 |
| 182 | Ga0111539_10805462 | 3300009094 | Bacteria | 1093 |
| 183 | Ga0111539_10879826 | 3300009094 | Bacteria | 1042 |
| 184 | Ga0105245_10019634 | 3300009098 | Bacteria | 5921 |
| 185 | Ga0105245_10177854 | 3300009098 | Bacteria | 2031 |
| 186 | Ga0105245_11284469 | 3300009098 | Bacteria | 781 |
| 187 | Ga0105241_10184909 | 3300009174 | Bacteria | 1731 |
| 188 | Ga0105241_10387720 | 3300009174 | Bacteria | 1222 |
| 189 | Ga0105241_10582075 | 3300009174 | Bacteria | 1009 |
| 190 | Ga0105241_10720818 | 3300009174 | Bacteria | 912 |
| 191 | Ga0105241_11094680 | 3300009174 | Bacteria | 750 |
| 192 | Ga0105242_10108470 | 3300009176 | Bacteria | 2363 |
| 193 | Ga0105248_10167031 | 3300009177 | Bacteria | 2480 |
| 194 | Ga0105248_10266351 | 3300009177 | Bacteria | 1929 |
| 195 | Ga0105248_10674314 | 3300009177 | Bacteria | 1166 |
| 196 | Ga0105237_10001366 | 3300009545 | Bacteria | 32234 |
| 197 | Ga0105237_10319155 | 3300009545 | Bacteria | 1557 |
| 198 | Ga0105237_10323101 | 3300009545 | Bacteria | 1547 |
| 199 | Ga0105237_12120253 | 3300009545 | Bacteria | 571 |
| 200 | Ga0105238_10057475 | 3300009551 | Bacteria | 3900 |
| 201 | Ga0105238_10265623 | 3300009551 | Bacteria | 1696 |
| 202 | Ga0105238_10347011 | 3300009551 | Bacteria | 1473 |
| 203 | Ga0105238_12110602 | 3300009551 | Bacteria | 598 |
| 204 | Ga0099796_10198378 | 3300010159 | Bacteria | 813 |
| 205 | Ga0105239_10001205 | 3300010375 | Bacteria | 35322 |
| 206 | Ga0105239_10006723 | 3300010375 | Bacteria | 13285 |
| 207 | Ga0105239_10036920 | 3300010375 | Bacteria | 5360 |
| 208 | Ga0105239_10037058 | 3300010375 | Bacteria | 5349 |
| 209 | Ga0105239_10268646 | 3300010375 | Bacteria | 1918 |
| 210 | Ga0105239_11232456 | 3300010375 | Bacteria | 862 |
| 211 | Ga0105239_11332958 | 3300010375 | Bacteria | 828 |
| 212 | Ga0105239_11732883 | 3300010375 | Bacteria | 723 |
| 213 | Ga0105239_12308651 | 3300010375 | Bacteria | 626 |
| 214 | Ga0105246_10085665 | 3300011119 | Bacteria | 2257 |
| 215 | Ga0105246_10133300 | 3300011119 | Bacteria | 1859 |
| 216 | Ga0105246_10317272 | 3300011119 | Bacteria | 1265 |
| 217 | Ga0157373_10086197 | 3300013100 | Bacteria | 2213 |
| 218 | Ga0157373_11084278 | 3300013100 | Bacteria | 600 |
| 219 | Ga0157371_10247348 | 3300013102 | Bacteria | 1283 |
| 220 | Ga0157369_10046598 | 3300013105 | Bacteria | 4711 |
| 221 | Ga0157369_10264089 | 3300013105 | Bacteria | 1795 |
| 222 | Ga0157369_10367000 | 3300013105 | Bacteria | 1494 |
| 223 | Ga0157369_10566676 | 3300013105 | Bacteria | 1173 |
| 224 | Ga0157369_10585996 | 3300013105 | Bacteria | 1152 |
| 225 | Ga0157378_10611371 | 3300013297 | Bacteria | 1102 |
| 226 | Ga0157378_11665573 | 3300013297 | Bacteria | 684 |
| 227 | Ga0163162_10061302 | 3300013306 | Bacteria | 3799 |
| 228 | Ga0163162_10090110 | 3300013306 | Bacteria | 3148 |
| 229 | Ga0163162_10760468 | 3300013306 | Bacteria | 1088 |
| 230 | Ga0163162_12615802 | 3300013306 | Bacteria | 581 |
| 231 | Ga0157372_10136745 | 3300013307 | Bacteria | 2822 |
| 232 | Ga0157372_11103637 | 3300013307 | Bacteria | 918 |
| 233 | Ga0157372_12629305 | 3300013307 | Bacteria | 578 |
| 234 | Ga0157375_10039100 | 3300013308 | Bacteria | 4562 |
| 235 | Ga0157375_11157164 | 3300013308 | Bacteria | 907 |
| 236 | Ga0157375_12539150 | 3300013308 | Bacteria | 612 |
| 237 | Ga0157375_12932832 | 3300013308 | Bacteria | 570 |
| 238 | Ga0163163_10097627 | 3300014325 | Bacteria | 2958 |
| 239 | Ga0163163_10517366 | 3300014325 | Bacteria | 1256 |
| 240 | Ga0157380_10031835 | 3300014326 | Bacteria | 4051 |
| 241 | Ga0182008_10196181 | 3300014497 | Bacteria | 1026 |
| 242 | Ga0157377_11146391 | 3300014745 | Bacteria | 598 |
| 243 | Ga0157379_10049892 | 3300014968 | Bacteria | 3737 |
| 244 | Ga0157379_10277336 | 3300014968 | Bacteria | 1525 |
| 245 | Ga0157379_11165176 | 3300014968 | Bacteria | 740 |
| 246 | Ga0157379_11368790 | 3300014968 | Bacteria | 685 |
| 247 | Ga0157376_10030553 | 3300014969 | Bacteria | 4303 |
| 248 | Ga0157376_10389639 | 3300014969 | Bacteria | 1344 |
| 249 | Ga0163161_10039338 | 3300017792 | Bacteria | 3394 |
| 250 | Ga0206355_1080318 | 3300020076 | Bacteria | 590 |
| 251 | Ga0206354_10945638 | 3300020081 | Bacteria | 593 |
| 252 | Ga0213873_10000006 | 3300021358 | Bacteria | 408723 |
| 253 | Ga0213872_10000983 | 3300021361 | Bacteria | 19936 |
| 254 | Ga0213872_10036611 | 3300021361 | Bacteria | 2242 |
| 255 | Ga0213872_10042438 | 3300021361 | Bacteria | 2074 |
| 256 | Ga0213872_10044484 | 3300021361 | Bacteria | 2020 |
| 257 | Ga0213872_10377652 | 3300021361 | Bacteria | 577 |
| 258 | Ga0213874_10285461 | 3300021377 | Bacteria | 617 |
| 259 | Ga0213876_10000004 | 3300021384 | Bacteria | 943822 |
| 260 | Ga0213876_10049016 | 3300021384 | Bacteria | 2231 |
| 261 | Ga0213876_10218025 | 3300021384 | Bacteria | 1015 |
| 262 | Ga0213875_10010160 | 3300021388 | Bacteria | 4729 |
| 263 | Ga0213875_10163320 | 3300021388 | Bacteria | 1045 |
| 264 | Ga0207427_103164 | 3300025231 | Bacteria | 3671 |
| 265 | Ga0209233_1000013 | 3300025261 | Bacteria | 1013785 |
| 266 | Ga0209233_1008420 | 3300025261 | Bacteria | 3195 |
| 267 | Ga0209025_1104234 | 3300025294 | Bacteria | 889 |
| 268 | Ga0209758_1110660 | 3300025297 | Bacteria | 761 |
| 269 | Ga0207656_10193494 | 3300025321 | Bacteria | 980 |
| 270 | Ga0207692_10358598 | 3300025898 | Bacteria | 900 |
| 271 | Ga0207642_10159764 | 3300025899 | Bacteria | 1209 |
| 272 | Ga0207688_10120782 | 3300025901 | Bacteria | 1529 |
| 273 | Ga0207680_10349009 | 3300025903 | Bacteria | 1039 |
| 274 | Ga0207647_10079224 | 3300025904 | Bacteria | 1972 |
| 275 | Ga0207685_10282088 | 3300025905 | Bacteria | 815 |
| 276 | Ga0207699_10174558 | 3300025906 | Bacteria | 1440 |
| 277 | Ga0207699_10643239 | 3300025906 | Bacteria | 774 |
| 278 | Ga0207645_10488504 | 3300025907 | Bacteria | 833 |
| 279 | Ga0207705_10102679 | 3300025909 | Bacteria | 2105 |
| 280 | Ga0207705_10402901 | 3300025909 | Bacteria | 1058 |
| 281 | Ga0207705_10453389 | 3300025909 | Bacteria | 994 |
| 282 | Ga0207684_10000187 | 3300025910 | Bacteria | 98338 |
| 283 | Ga0207654_10007677 | 3300025911 | Bacteria | 5442 |
| 284 | Ga0207654_10257806 | 3300025911 | Bacteria | 1171 |
| 285 | Ga0207654_10612417 | 3300025911 | Bacteria | 778 |
| 286 | Ga0207707_10002733 | 3300025912 | Bacteria | 15764 |
| 287 | Ga0207707_10236826 | 3300025912 | Bacteria | 1588 |
| 288 | Ga0207707_10590922 | 3300025912 | Bacteria | 940 |
| 289 | Ga0207707_11105971 | 3300025912 | Bacteria | 646 |
| 290 | Ga0207695_10005412 | 3300025913 | Bacteria | 16939 |
| 291 | Ga0207695_10254102 | 3300025913 | Bacteria | 1656 |
| 292 | Ga0207695_10275533 | 3300025913 | Bacteria | 1577 |
| 293 | Ga0207695_10285054 | 3300025913 | Bacteria | 1545 |
| 294 | Ga0207695_10436831 | 3300025913 | Bacteria | 1193 |
| 295 | Ga0207695_10465046 | 3300025913 | Bacteria | 1148 |
| 296 | Ga0207695_10530406 | 3300025913 | Bacteria | 1059 |
| 297 | Ga0207671_10000215 | 3300025914 | Bacteria | 87204 |
| 298 | Ga0207671_10119984 | 3300025914 | Bacteria | 2009 |
| 299 | Ga0207671_10497382 | 3300025914 | Bacteria | 972 |
| 300 | Ga0207671_10513523 | 3300025914 | Bacteria | 955 |
| 301 | Ga0207671_10524056 | 3300025914 | Bacteria | 945 |
| 302 | Ga0207671_10590595 | 3300025914 | Bacteria | 885 |
| 303 | Ga0207693_10002047 | 3300025915 | Bacteria | 17648 |
| 304 | Ga0207693_10025243 | 3300025915 | Bacteria | 4712 |
| 305 | Ga0207693_10088056 | 3300025915 | Bacteria | 2433 |
| 306 | Ga0207693_10132050 | 3300025915 | Bacteria | 1963 |
| 307 | Ga0207663_10313026 | 3300025916 | Bacteria | 1177 |
| 308 | Ga0207663_10338018 | 3300025916 | Bacteria | 1136 |
| 309 | Ga0207663_10436065 | 3300025916 | Bacteria | 1008 |
| 310 | Ga0207660_10207612 | 3300025917 | Bacteria | 1532 |
| 311 | Ga0207660_10353996 | 3300025917 | Bacteria | 1177 |
| 312 | Ga0207660_11103373 | 3300025917 | Bacteria | 646 |
| 313 | Ga0207662_10476222 | 3300025918 | Bacteria | 857 |
| 314 | Ga0207657_10019120 | 3300025919 | Bacteria | 6515 |
| 315 | Ga0207657_10046310 | 3300025919 | Bacteria | 3810 |
| 316 | Ga0207657_11271663 | 3300025919 | Bacteria | 557 |
| 317 | Ga0207649_10561743 | 3300025920 | Bacteria | 874 |
| 318 | Ga0207649_10614118 | 3300025920 | Bacteria | 837 |
| 319 | Ga0207649_10615911 | 3300025920 | Bacteria | 836 |
| 320 | Ga0207649_10666721 | 3300025920 | Bacteria | 805 |
| 321 | Ga0207652_10018130 | 3300025921 | Bacteria | 5770 |
| 322 | Ga0207652_10025573 | 3300025921 | Bacteria | 4909 |
| 323 | Ga0207652_10028271 | 3300025921 | Bacteria | 4677 |
| 324 | Ga0207652_10463688 | 3300025921 | Bacteria | 1142 |
| 325 | Ga0207646_10103202 | 3300025922 | Bacteria | 2557 |
| 326 | Ga0207646_11403347 | 3300025922 | Bacteria | 607 |
| 327 | Ga0207694_10110792 | 3300025924 | Bacteria | 2184 |
| 328 | Ga0207694_10134060 | 3300025924 | Bacteria | 1987 |
| 329 | Ga0207694_10379916 | 3300025924 | Bacteria | 1172 |
| 330 | Ga0207659_10152549 | 3300025926 | Bacteria | 1805 |
| 331 | Ga0207659_10911497 | 3300025926 | Bacteria | 756 |
| 332 | Ga0207687_10792244 | 3300025927 | Bacteria | 808 |
| 333 | Ga0207687_11794846 | 3300025927 | Bacteria | 525 |
| 334 | Ga0207700_10399523 | 3300025928 | Bacteria | 1204 |
| 335 | Ga0207700_10510114 | 3300025928 | Bacteria | 1065 |
| 336 | Ga0207664_10017404 | 3300025929 | Bacteria | 5267 |
| 337 | Ga0207644_10128669 | 3300025931 | Bacteria | 1936 |
| 338 | Ga0207644_11381410 | 3300025931 | Bacteria | 592 |
| 339 | Ga0207686_10019155 | 3300025934 | Bacteria | 3887 |
| 340 | Ga0207709_11217275 | 3300025935 | Bacteria | 621 |
| 341 | Ga0207669_10150377 | 3300025937 | Bacteria | 1630 |
| 342 | Ga0207704_10932533 | 3300025938 | Bacteria | 731 |
| 343 | Ga0207691_10962499 | 3300025940 | Bacteria | 713 |
| 344 | Ga0207691_11629941 | 3300025940 | Bacteria | 524 |
| 345 | Ga0207711_10586261 | 3300025941 | Bacteria | 1040 |
| 346 | Ga0207689_11264974 | 3300025942 | Bacteria | 620 |
| 347 | Ga0207661_10033505 | 3300025944 | Bacteria | 3988 |
| 348 | Ga0207661_10121335 | 3300025944 | Bacteria | 2226 |
| 349 | Ga0207661_10281971 | 3300025944 | Bacteria | 1485 |
| 350 | Ga0207661_10285298 | 3300025944 | Bacteria | 1476 |
| 351 | Ga0207679_10073357 | 3300025945 | Bacteria | 2589 |
| 352 | Ga0207667_10329217 | 3300025949 | Bacteria | 1560 |
| 353 | Ga0207667_10333950 | 3300025949 | Bacteria | 1547 |
| 354 | Ga0207667_10335622 | 3300025949 | Bacteria | 1543 |
| 355 | Ga0207667_10809122 | 3300025949 | Bacteria | 933 |
| 356 | Ga0207651_10205872 | 3300025960 | Bacteria | 1580 |
| 357 | Ga0207651_10351246 | 3300025960 | Bacteria | 1242 |
| 358 | Ga0207651_10376490 | 3300025960 | Bacteria | 1202 |
| 359 | Ga0207668_10004161 | 3300025972 | Bacteria | 8488 |
| 360 | Ga0207668_10012637 | 3300025972 | Bacteria | 5174 |
| 361 | Ga0207668_10695987 | 3300025972 | Bacteria | 893 |
| 362 | Ga0207640_10445781 | 3300025981 | Bacteria | 1065 |
| 363 | Ga0207640_11129328 | 3300025981 | Bacteria | 694 |
| 364 | Ga0207640_11509659 | 3300025981 | Bacteria | 604 |
| 365 | Ga0207640_12038871 | 3300025981 | Bacteria | 520 |
| 366 | Ga0207658_11174395 | 3300025986 | Bacteria | 701 |
| 367 | Ga0207677_10245656 | 3300026023 | Bacteria | 1451 |
| 368 | Ga0207677_10273867 | 3300026023 | Bacteria | 1382 |
| 369 | Ga0207677_10951401 | 3300026023 | Bacteria | 777 |
| 370 | Ga0207677_11699758 | 3300026023 | Bacteria | 585 |
| 371 | Ga0207703_10261252 | 3300026035 | Bacteria | 1565 |
| 372 | Ga0207703_10529254 | 3300026035 | Bacteria | 1109 |
| 373 | Ga0207639_10010321 | 3300026041 | Bacteria | 6466 |
| 374 | Ga0207639_10015553 | 3300026041 | Bacteria | 5371 |
| 375 | Ga0207639_10210219 | 3300026041 | Bacteria | 1674 |
| 376 | Ga0207639_11029158 | 3300026041 | Bacteria | 772 |
| 377 | Ga0207678_10154400 | 3300026067 | Bacteria | 1960 |
| 378 | Ga0207678_10200320 | 3300026067 | Bacteria | 1707 |
| 379 | Ga0207708_10645277 | 3300026075 | Bacteria | 901 |
| 380 | Ga0207702_10189328 | 3300026078 | Bacteria | 1900 |
| 381 | Ga0207702_10237444 | 3300026078 | Bacteria | 1706 |
| 382 | Ga0207702_10439001 | 3300026078 | Bacteria | 1265 |
| 383 | Ga0207676_10357734 | 3300026095 | Bacteria | 1352 |
| 384 | Ga0207676_11179140 | 3300026095 | Bacteria | 759 |
| 385 | Ga0207674_10081921 | 3300026116 | Bacteria | 3229 |
| 386 | Ga0207674_10118233 | 3300026116 | Bacteria | 2620 |
| 387 | Ga0207674_11114418 | 3300026116 | Bacteria | 759 |
| 388 | Ga0207674_11877331 | 3300026116 | Bacteria | 565 |
| 389 | Ga0207675_100011142 | 3300026118 | Bacteria | 8421 |
| 390 | Ga0207683_10012229 | 3300026121 | Bacteria | 7326 |
| 391 | Ga0207683_10036383 | 3300026121 | Bacteria | 4287 |
| 392 | Ga0207683_10081825 | 3300026121 | Bacteria | 2867 |
| 393 | Ga0207683_10429533 | 3300026121 | Bacteria | 1217 |
| 394 | Ga0207698_10034727 | 3300026142 | Bacteria | 3679 |
| 395 | Ga0207698_10656215 | 3300026142 | Bacteria | 1040 |
| 396 | Ga0209973_1012410 | 3300027252 | Bacteria | 1036 |
| 397 | Ga0209967_1057317 | 3300027364 | Bacteria | 602 |
| 398 | Ga0209971_1093380 | 3300027682 | Bacteria | 735 |
| 399 | Ga0209998_10044265 | 3300027717 | Bacteria | 1017 |
| 400 | Ga0209974_10004627 | 3300027876 | Bacteria | 4895 |
| 401 | Ga0209974_10063155 | 3300027876 | Bacteria | 1255 |
| 402 | Ga0268266_10000255 | 3300028379 | Bacteria | 89930 |
| 403 | Ga0268266_10004374 | 3300028379 | Bacteria | 13565 |
| 404 | Ga0268266_10027704 | 3300028379 | Bacteria | 4817 |
| 405 | Ga0268266_10092631 | 3300028379 | Bacteria | 2652 |
| 406 | Ga0268266_10196407 | 3300028379 | Bacteria | 1845 |
| 407 | Ga0268266_10239319 | 3300028379 | Bacteria | 1674 |
| 408 | Ga0268266_11441368 | 3300028379 | Bacteria | 664 |
| 409 | Ga0268266_12246922 | 3300028379 | Bacteria | 517 |
| 410 | Ga0268265_10383593 | 3300028380 | Bacteria | 1294 |
| 411 | Ga0268265_10478858 | 3300028380 | Bacteria | 1168 |
| 412 | Ga0268265_10537970 | 3300028380 | Bacteria | 1107 |
| 413 | Ga0268265_11192389 | 3300028380 | Bacteria | 759 |
| 414 | Ga0268264_10002617 | 3300028381 | Bacteria | 15732 |
| 415 | Ga0268264_10053068 | 3300028381 | Bacteria | 3382 |
| 416 | Ga0268264_10513500 | 3300028381 | Bacteria | 1170 |
| 417 | Ga0265318_10298392 | 3300028577 | Bacteria | 588 |
| 418 | Ga0265338_10000005 | 3300028800 | Bacteria | 571137 |
| 419 | Ga0265338_10011268 | 3300028800 | Bacteria | 10352 |
| 420 | Ga0265338_10097883 | 3300028800 | Bacteria | 2402 |
| 421 | Ga0265338_10293608 | 3300028800 | Bacteria | 1184 |
| 422 | Ga0265324_10152468 | 3300029957 | Bacteria | 785 |
| 423 | Ga0265330_10118365 | 3300031235 | Bacteria | 1129 |
| 424 | Ga0265332_10015915 | 3300031238 | Bacteria | 3319 |
| 425 | Ga0265332_10025815 | 3300031238 | Bacteria | 2579 |
| 426 | Ga0265332_10266006 | 3300031238 | Bacteria | 709 |
| 427 | Ga0265332_10343907 | 3300031238 | Bacteria | 616 |
| 428 | Ga0265328_10204374 | 3300031239 | Bacteria | 750 |
| 429 | Ga0265320_10001181 | 3300031240 | Bacteria | 19237 |
| 430 | Ga0265325_10000010 | 3300031241 | Bacteria | 172391 |
| 431 | Ga0265325_10058000 | 3300031241 | Bacteria | 1973 |
| 432 | Ga0265325_10204386 | 3300031241 | Bacteria | 909 |
| 433 | Ga0265340_10010366 | 3300031247 | Bacteria | 4985 |
| 434 | Ga0265340_10065981 | 3300031247 | Bacteria | 1723 |
| 435 | Ga0265339_10000373 | 3300031249 | Bacteria | 35286 |
| 436 | Ga0265339_10084492 | 3300031249 | Bacteria | 1673 |
| 437 | Ga0265331_10009117 | 3300031250 | Bacteria | 5601 |
| 438 | Ga0265331_10018151 | 3300031250 | Bacteria | 3654 |
| 439 | Ga0265316_10075465 | 3300031344 | Bacteria | 2592 |
| 440 | Ga0265316_10435102 | 3300031344 | Bacteria | 942 |
| 441 | Ga0265316_10666866 | 3300031344 | Bacteria | 734 |
| 442 | Ga0307513_10334202 | 3300031456 | Bacteria | 1268 |
| 443 | Ga0307513_10401987 | 3300031456 | Bacteria | 1104 |
| 444 | Ga0307513_10450900 | 3300031456 | Bacteria | 1011 |
| 445 | Ga0307408_100013197 | 3300031548 | Bacteria | 5485 |
| 446 | Ga0307408_101326995 | 3300031548 | Bacteria | 675 |
| 447 | Ga0265313_10000061 | 3300031595 | Bacteria | 107220 |
| 448 | Ga0265313_10000828 | 3300031595 | Bacteria | 31267 |
| 449 | Ga0265313_10028345 | 3300031595 | Bacteria | 2912 |
| 450 | Ga0307508_10327649 | 3300031616 | Bacteria | 1123 |
| 451 | Ga0316575_10184397 | 3300031665 | Bacteria | 867 |
| 452 | Ga0265314_10009980 | 3300031711 | Bacteria | 7965 |
| 453 | Ga0265314_10038094 | 3300031711 | Bacteria | 3477 |
| 454 | Ga0265314_10049498 | 3300031711 | Bacteria | 2941 |
| 455 | Ga0265342_10053041 | 3300031712 | Bacteria | 2414 |
| 456 | Ga0316576_10085879 | 3300031727 | Bacteria | 2339 |
| 457 | Ga0316576_10151481 | 3300031727 | Bacteria | 1748 |
| 458 | Ga0316578_10013246 | 3300031728 | Bacteria | 4369 |
| 459 | Ga0307405_10060563 | 3300031731 | Bacteria | 2389 |
| 460 | Ga0307405_10179371 | 3300031731 | Bacteria | 1519 |
| 461 | Ga0307405_10357061 | 3300031731 | Bacteria | 1129 |
| 462 | Ga0307405_10673941 | 3300031731 | Bacteria | 853 |
| 463 | Ga0307405_10905464 | 3300031731 | Bacteria | 746 |
| 464 | Ga0307413_11591256 | 3300031824 | Bacteria | 580 |
| 465 | Ga0307413_12139944 | 3300031824 | Bacteria | 506 |
| 466 | Ga0307406_10032811 | 3300031901 | Bacteria | 3172 |
| 467 | Ga0307406_10319090 | 3300031901 | Bacteria | 1201 |
| 468 | Ga0307406_10636970 | 3300031901 | Bacteria | 883 |
| 469 | Ga0307406_11955506 | 3300031901 | Bacteria | 523 |
| 470 | Ga0307412_10049726 | 3300031911 | Bacteria | 2763 |
| 471 | Ga0307412_10083369 | 3300031911 | Bacteria | 2216 |
| 472 | Ga0307412_10396299 | 3300031911 | Bacteria | 1122 |
| 473 | Ga0307412_10502805 | 3300031911 | Bacteria | 1009 |
| 474 | Ga0307412_11362387 | 3300031911 | Bacteria | 641 |
| 475 | Ga0307412_12216913 | 3300031911 | Bacteria | 511 |
| 476 | Ga0307409_100555221 | 3300031995 | Bacteria | 1128 |
| 477 | Ga0307416_100083043 | 3300032002 | Bacteria | 2716 |
| 478 | Ga0307416_100132367 | 3300032002 | Bacteria | 2248 |
| 479 | Ga0307416_100597755 | 3300032002 | Bacteria | 1183 |
| 480 | Ga0307416_100662297 | 3300032002 | Bacteria | 1130 |
| 481 | Ga0307416_100974942 | 3300032002 | Bacteria | 950 |
| 482 | Ga0307414_10225921 | 3300032004 | Bacteria | 1540 |
| 483 | Ga0307414_10357003 | 3300032004 | Bacteria | 1256 |
| 484 | Ga0307414_10395749 | 3300032004 | Bacteria | 1198 |
| 485 | Ga0307414_10846754 | 3300032004 | Bacteria | 836 |
| 486 | Ga0307411_11027870 | 3300032005 | Bacteria | 739 |
| 487 | Ga0307415_101269848 | 3300032126 | Bacteria | 696 |
| 488 | Ga0316593_10000847 | 3300032168 | Bacteria | 6190 |
| 489 | Ga0307510_10145191 | 3300033180 | Bacteria | 2007 |
| 490 | Ga0316596_1024650 | 3300033541 | Bacteria | 1545 |
| 491 | Ga0373948_0086003 | 3300034817 | Bacteria | 724 |
| 492 | Ga0373929_0188114 | 3300035085 | Bacteria | 573 |
| 493 | Ga0373940_0334055 | 3300035088 | Bacteria | 528 |
| 494 | Ga0373940_0356208 | 3300035088 | Bacteria | 514 |
| 495 | Ga0373944_0109144 | 3300035089 | Bacteria | 943 |
| 496 | Ga0373951_0198404 | 3300035091 | Bacteria | 584 |
| 497 | Ga0373951_0222829 | 3300035091 | Bacteria | 557 |
| 498 | Ga0373939_0064762 | 3300035114 | Bacteria | 1174 |
| 499 | Ga0373939_0122979 | 3300035114 | Bacteria | 918 |
| 500 | Ga0373941_0146263 | 3300035115 | Bacteria | 863 |
| 501 | Ga0373956_0450836 | 3300035119 | Bacteria | 614 |
| 502 | Ga0373956_0559276 | 3300035119 | Bacteria | 546 |
| 503 | Ga0373946_0093729 | 3300035171 | Bacteria | 1335 |
| 504 | Ga0373946_0374259 | 3300035171 | Bacteria | 716 |
| 505 | Ga0373942_0022446 | 3300035207 | Bacteria | 1601 |
| 506 | Ga0316574_0172536 | 3300035398 | Bacteria | 1392 |
| 507 | Ga0316574_0614307 | 3300035398 | Bacteria | 671 |
| 508 | Ga0373924_0223198 | 3300035410 | Bacteria | 833 |
| 509 | Ga0373931_0041082 | 3300035691 | Bacteria | 2429 |
| 510 | Ga0373931_0257423 | 3300035691 | Bacteria | 1064 |
| 511 | Ga0373935_1007584 | 3300035692 | Bacteria | 619 |
| 512 | Ga0373927_0236199 | 3300035695 | Bacteria | 1201 |
| 513 | Ga0373933_0564622 | 3300035724 | Bacteria | 747 |
| 514 | Ga0373947_0416397 | 3300035725 | Bacteria | 908 |
| 515 | Ga0373937_0210435 | 3300036401 | Bacteria | 1830 |
| 516 | Ga0373937_0670668 | 3300036401 | Bacteria | 983 |
| 517 | Ga0373937_1282315 | 3300036401 | Bacteria | 681 |
| 518 | Ga0316582_0003393 | 3300036647 | Bacteria | 7806 |
| 519 | Ga0316582_0115891 | 3300036647 | Bacteria | 1788 |
| 520 | Ga0316582_1015016 | 3300036647 | Bacteria | 566 |
| 521 | Ga0316584_0020971 | 3300036712 | Bacteria | 4746 |
| 522 | Ga0316584_0247088 | 3300036712 | Bacteria | 1304 |
| 523 | Ga0316584_0355146 | 3300036712 | Bacteria | 1052 |
| 524 | Ga0373925_0395997 | 3300037068 | Bacteria | 1126 |
| 525 | Ga0395899_0026647 | 3300037312 | Bacteria | 4361 |
| 526 | Ga0395899_0035389 | 3300037312 | Bacteria | 3749 |
| 527 | Ga0395899_0097318 | 3300037312 | Bacteria | 2127 |
| 528 | Ga0395899_0104340 | 3300037312 | Bacteria | 2043 |
| 529 | Ga0395900_0034816 | 3300037418 | Bacteria | 5187 |
| 530 | Ga0395900_0045605 | 3300037418 | Bacteria | 4515 |
| 531 | Ga0395900_0305576 | 3300037418 | Bacteria | 1575 |
| 532 | Ga0395900_0461224 | 3300037418 | Bacteria | 1225 |
| 533 | Ga0395900_0753309 | 3300037418 | Bacteria | 904 |
| 534 | Ga0395898_0210121 | 3300037466 | Bacteria | 1856 |
| 535 | Ga0436364_0264635 | 3300037853 | Bacteria | 1271 |
| 536 | Ga0436364_1059469 | 3300037853 | Bacteria | 1057 |
| 537 | Ga0436364_1079956 | 3300037853 | Bacteria | 49729 |
| 538 | Ga0395901_0005738 | 3300038443 | Bacteria | 12571 |
| 539 | Ga0395901_0015570 | 3300038443 | Bacteria | 7747 |
| 540 | Ga0395901_0107493 | 3300038443 | Bacteria | 2928 |
| 541 | Ga0395901_0377066 | 3300038443 | Bacteria | 1460 |
| 542 | Ga0395901_0783858 | 3300038443 | Bacteria | 944 |
| 543 | Ga0400486_27314 | 3300038742 | Bacteria | 2874 |
| 544 | Ga0400483_016015 | 3300039062 | Bacteria | 1457 |
| 545 | Ga0400483_086626 | 3300039062 | Bacteria | 4548 |
| 546 | Ga0400483_193353 | 3300039062 | Bacteria | 3912 |
| 547 | Ga0400487_30510 | 3300039110 | Bacteria | 1397 |
| 548 | Ga0436365_0095088 | 3300039437 | Bacteria | 1875 |
| 549 | Ga0436365_0974653 | 3300039437 | Bacteria | 10227 |
| 550 | Ga0436365_1018356 | 3300039437 | Bacteria | 621 |
| 551 | Ga0436365_1215130 | 3300039437 | Bacteria | 80243 |
| 552 | Ga0436365_1575237 | 3300039437 | Bacteria | 1477 |
| 553 | Ga0436360_0206959 | 3300039438 | Bacteria | 985 |
| 554 | Ga0436360_0218419 | 3300039438 | Bacteria | 2678 |
| 555 | Ga0436360_0317148 | 3300039438 | Bacteria | 950 |
| 556 | Ga0436360_0393048 | 3300039438 | Bacteria | 568 |
| 557 | Ga0436360_0505912 | 3300039438 | Bacteria | 2785 |
| 558 | Ga0436360_0560103 | 3300039438 | Bacteria | 851 |
| 559 | Ga0436360_0580300 | 3300039438 | Bacteria | 654 |
| 560 | Ga0436360_0878555 | 3300039438 | Unclassified | 984 |
| 561 | Ga0436360_1095219 | 3300039438 | Bacteria | 1237 |
| 562 | Ga0436361_0106955 | 3300039447 | Bacteria | 1028 |
| 563 | Ga0436361_0134909 | 3300039447 | Bacteria | 8959 |
| 564 | Ga0436361_0138415 | 3300039447 | Bacteria | 1706 |
| 565 | Ga0436361_0256903 | 3300039447 | Bacteria | 1418 |
| 566 | Ga0436361_0346208 | 3300039447 | Bacteria | 2614 |
| 567 | Ga0436361_0467613 | 3300039447 | Bacteria | 4134 |
| 568 | Ga0436361_0487620 | 3300039447 | Bacteria | 524 |
| 569 | Ga0436361_0549993 | 3300039447 | Bacteria | 2772 |
| 570 | Ga0436361_0599707 | 3300039447 | Bacteria | 661 |
| 571 | Ga0436361_0745675 | 3300039447 | Bacteria | 10221 |
| 572 | Ga0436361_0793900 | 3300039447 | Bacteria | 1391 |
| 573 | Ga0436361_1011398 | 3300039447 | Bacteria | 717 |
| 574 | Ga0436363_0680414 | 3300039450 | Bacteria | 2713 |
| 575 | Ga0436363_0974827 | 3300039450 | Bacteria | 948 |
| 576 | Ga0436362_0094317 | 3300039453 | Bacteria | 79076 |
| 577 | Ga0436362_0314308 | 3300039453 | Bacteria | 658 |
| 578 | Ga0436362_0483970 | 3300039453 | Bacteria | 539 |
| 579 | Ga0436362_0666367 | 3300039453 | Bacteria | 1051 |
| 580 | Ga0439466_0100923 | 3300041411 | Bacteria | 900 |
| 581 | Ga0439465_0041838 | 3300041413 | Bacteria | 1484 |
| 582 | Ga0439465_0069318 | 3300041413 | Bacteria | 1180 |
| 583 | Ga0451793_1667793 | 3300041452 | Bacteria | 1088 |
| 584 | Ga0451802_0135419 | 3300041460 | Bacteria | 880 |
| 585 | Ga0451804_0787161 | 3300041463 | Bacteria | 644 |
| 586 | Ga0451843_0179471 | 3300041509 | Bacteria | 773 |
| 587 | Ga0439441_031129 | 3300042001 | Bacteria | 1034 |
| 588 | Ga0439442_048632 | 3300042002 | Bacteria | 894 |
| 589 | Ga0439445_0040567 | 3300042004 | Bacteria | 1236 |
| 590 | Ga0439445_0085540 | 3300042004 | Bacteria | 884 |
| 591 | Ga0439445_0091446 | 3300042004 | Bacteria | 857 |
| 592 | Ga0439452_123423 | 3300042010 | Bacteria | 551 |
| 593 | Ga0439456_122885 | 3300042013 | Bacteria | 596 |
| 594 | Ga0451577_0000124 | 3300042876 | Bacteria | 169120 |
| 595 | Ga0451577_0001018 | 3300042876 | Bacteria | 40726 |
| 596 | Ga0451577_0106914 | 3300042876 | Bacteria | 2501 |
| 597 | Ga0451577_0176617 | 3300042876 | Bacteria | 1925 |
| 598 | Ga0451577_0181870 | 3300042876 | Bacteria | 1896 |
| 599 | Ga0451577_0224830 | 3300042876 | Bacteria | 1697 |
| 600 | Ga0466965_0105634 | 3300044683 | Bacteria | 1444 |
| 601 | Ga0453684_0000015 | 3300044712 | Bacteria | 969198 |
| 602 | Ga0453684_0000020 | 3300044712 | Bacteria | 879938 |
| 603 | Ga0453684_0000239 | 3300044712 | Bacteria | 235992 |
| 604 | Ga0453684_0000498 | 3300044712 | Bacteria | 153608 |
| 605 | Ga0453684_0022198 | 3300044712 | Bacteria | 9433 |
| 606 | Ga0453684_0026561 | 3300044712 | Bacteria | 8350 |
| 607 | Ga0453684_0101448 | 3300044712 | Bacteria | 3521 |
| 608 | Ga0466957_0884459 | 3300044842 | Bacteria | 638 |
| 609 | Ga0451576_0000040 | 3300045051 | Bacteria | 349778 |
| 610 | Ga0451576_0001132 | 3300045051 | Bacteria | 48307 |
| 611 | Ga0451576_0050028 | 3300045051 | Bacteria | 4385 |
| 612 | Ga0451576_0058213 | 3300045051 | Bacteria | 4039 |
| 613 | Ga0451576_0443241 | 3300045051 | Bacteria | 1363 |
| 614 | Ga0451576_0557249 | 3300045051 | Bacteria | 1204 |
| 615 | Ga0451576_1683978 | 3300045051 | Bacteria | 657 |
| 616 | Ga0495638_0003562 | 3300046460 | Bacteria | 12195 |
| 617 | Ga0495651_0141560 | 3300046462 | Bacteria | 1744 |
| 618 | Ga0495580_0244175 | 3300046472 | Bacteria | 1231 |
| 619 | Ga0495580_0771354 | 3300046472 | Bacteria | 625 |
| 620 | Ga0495582_0266015 | 3300046473 | Bacteria | 984 |
| 621 | Ga0495584_0273656 | 3300046491 | Bacteria | 858 |
| 622 | Ga0495583_0192270 | 3300046506 | Bacteria | 832 |
| 623 | Ga0495606_0195158 | 3300046507 | Bacteria | 1158 |
| 624 | Ga0495610_0149942 | 3300046512 | Bacteria | 996 |
| 625 | Ga0495628_0077221 | 3300046516 | Bacteria | 2591 |
| 626 | Ga0495628_0395705 | 3300046516 | Bacteria | 1010 |
| 627 | Ga0495643_0031204 | 3300046522 | Bacteria | 2967 |
| 628 | Ga0495648_0151786 | 3300046524 | Bacteria | 1208 |
| 629 | Ga0495598_0223787 | 3300046537 | Bacteria | 688 |
| 630 | Ga0495609_0068453 | 3300046538 | Bacteria | 1562 |
| 631 | Ga0495597_0057804 | 3300046542 | Bacteria | 1696 |
| 632 | Ga0495645_0502817 | 3300046543 | Bacteria | 757 |
| 633 | Ga0495645_0674327 | 3300046543 | Bacteria | 630 |
| 634 | Ga0495656_0610184 | 3300046615 | Bacteria | 584 |
| 635 | Ga0495625_0003057 | 3300046660 | Bacteria | 17149 |
| 636 | Ga0495661_0237856 | 3300046665 | Bacteria | 936 |
| 637 | Ga0495623_0215131 | 3300046679 | Bacteria | 1098 |
| 638 | Ga0495669_0112184 | 3300046684 | Bacteria | 1274 |
| 639 | Ga0495669_0266778 | 3300046684 | Bacteria | 823 |
| 640 | Ga0495670_0413751 | 3300046691 | Bacteria | 729 |
| 641 | Ga0495649_0266017 | 3300046694 | Bacteria | 878 |
| 642 | Ga0495589_0084446 | 3300046794 | Bacteria | 1543 |
| 643 | Ga0495636_0148726 | 3300047318 | Bacteria | 1049 |
| 644 | Ga0495676_0347164 | 3300047321 | Bacteria | 993 |
| 645 | Ga0495680_0036126 | 3300047322 | Bacteria | 3971 |
| 646 | Ga0495675_0248569 | 3300047444 | Bacteria | 1069 |
| 647 | Ga0495686_0278534 | 3300047472 | Bacteria | 930 |
| 648 | Ga0495602_0692626 | 3300048088 | Bacteria | 692 |
| 649 | Ga0496102_0183568 | 3300048905 | Bacteria | 1971 |
| 650 | Ga0496102_1267607 | 3300048905 | Bacteria | 656 |
| 651 | Ga0496110_1513745 | 3300048913 | Bacteria | 581 |
| 652 | Ga0496112_0322988 | 3300048915 | Bacteria | 1488 |
| 653 | Ga0496116_0292029 | 3300048919 | Bacteria | 782 |
| 654 | Ga0496117_0024717 | 3300048920 | Bacteria | 4740 |
| 655 | Ga0496118_0001677 | 3300048921 | Bacteria | 32432 |
| 656 | Ga0496118_0269869 | 3300048921 | Bacteria | 954 |
| 657 | Ga0496121_0038766 | 3300048924 | Bacteria | 4211 |
| 658 | Ga0496124_0325192 | 3300048927 | Bacteria | 1099 |
| 659 | Ga0496125_0001281 | 3300048928 | Bacteria | 37316 |
| 660 | Ga0496125_0458667 | 3300048928 | Bacteria | 728 |
| 661 | Ga0496126_0069667 | 3300048929 | Bacteria | 3136 |
| 662 | Ga0496126_0217471 | 3300048929 | Bacteria | 1607 |
| 663 | Ga0496126_0234042 | 3300048929 | Bacteria | 1538 |
| 664 | Ga0501290_015074 | 3300049513 | Bacteria | 1021 |
| 665 | Ga0501299_051601 | 3300049522 | Bacteria | 851 |
| 666 | Ga0501300_042680 | 3300049523 | Bacteria | 686 |
| 667 | Ga0501320_072924 | 3300049536 | Bacteria | 500 |
| 668 | Ga0501336_028113 | 3300049552 | Bacteria | 542 |
| 669 | Ga0501031_0608688 | 3300049568 | Bacteria | 703 |
| 670 | Ga0501031_0964382 | 3300049568 | Bacteria | 545 |
| 671 | Ga0501033_0185278 | 3300049570 | Bacteria | 1491 |
| 672 | Ga0501033_0296937 | 3300049570 | Bacteria | 1138 |
| 673 | Ga0501034_0000189 | 3300049571 | Bacteria | 115780 |
| 674 | Ga0501034_0001822 | 3300049571 | Bacteria | 27090 |
| 675 | Ga0501034_0037129 | 3300049571 | Bacteria | 4933 |
| 676 | Ga0501034_0284733 | 3300049571 | Bacteria | 1592 |
| 677 | Ga0501034_0339121 | 3300049571 | Bacteria | 1433 |
| 678 | Ga0501034_0503699 | 3300049571 | Bacteria | 1124 |
| 679 | Ga0501034_0836273 | 3300049571 | Bacteria | 811 |
| 680 | Ga0501034_0838718 | 3300049571 | Bacteria | 810 |
| 681 | Ga0501034_0887223 | 3300049571 | Bacteria | 780 |
| 682 | Ga0501034_0929161 | 3300049571 | Bacteria | 757 |
| 683 | Ga0501036_0538567 | 3300049572 | Bacteria | 971 |
| 684 | Ga0501037_0197960 | 3300049573 | Bacteria | 1421 |
| 685 | Ga0501037_0367776 | 3300049573 | Bacteria | 990 |
| 686 | Ga0501037_0412379 | 3300049573 | Bacteria | 925 |
| 687 | Ga0501037_0527697 | 3300049573 | Bacteria | 799 |
| 688 | Ga0501038_0111292 | 3300049574 | Bacteria | 2269 |
| 689 | Ga0501038_0259626 | 3300049574 | Bacteria | 1374 |
| 690 | Ga0501042_0038384 | 3300049578 | Bacteria | 3402 |
| 691 | Ga0501042_0309300 | 3300049578 | Bacteria | 1142 |
| 692 | Ga0501043_0207612 | 3300049579 | Bacteria | 1518 |
| 693 | Ga0501043_0215268 | 3300049579 | Bacteria | 1488 |
| 694 | Ga0501043_0513601 | 3300049579 | Bacteria | 894 |
| 695 | Ga0501043_0954139 | 3300049579 | Bacteria | 612 |
| 696 | Ga0501046_0241279 | 3300049580 | Bacteria | 1333 |
| 697 | Ga0501047_0003852 | 3300049581 | Bacteria | 14113 |
| 698 | Ga0501047_0125160 | 3300049581 | Bacteria | 2451 |
| 699 | Ga0501047_0247897 | 3300049581 | Bacteria | 1630 |
| 700 | Ga0501047_0746459 | 3300049581 | Bacteria | 795 |
| 701 | Ga0501047_0761417 | 3300049581 | Bacteria | 784 |
| 702 | Ga0501047_0902108 | 3300049581 | Bacteria | 697 |
| 703 | Ga0501048_0371991 | 3300049582 | Bacteria | 1020 |
| 704 | Ga0501048_1148095 | 3300049582 | Bacteria | 559 |
| 705 | Ga0501067_0002093 | 3300049583 | Bacteria | 10999 |
| 706 | Ga0501067_0104456 | 3300049583 | Bacteria | 1574 |
| 707 | Ga0501068_0271378 | 3300049584 | Bacteria | 1083 |
| 708 | Ga0501068_0387862 | 3300049584 | Bacteria | 900 |
| 709 | Ga0501070_0035746 | 3300049586 | Bacteria | 4149 |
| 710 | Ga0501070_0169440 | 3300049586 | Bacteria | 1799 |
| 711 | Ga0501070_0280088 | 3300049586 | Bacteria | 1361 |
| 712 | Ga0501070_0595941 | 3300049586 | Bacteria | 881 |
| 713 | Ga0501071_0808129 | 3300049587 | Bacteria | 723 |
| 714 | Ga0501071_0929740 | 3300049587 | Bacteria | 671 |
| 715 | Ga0501072_0040168 | 3300049588 | Bacteria | 3674 |
| 716 | Ga0501073_0036999 | 3300049589 | Bacteria | 3467 |
| 717 | Ga0501073_0137857 | 3300049589 | Bacteria | 1691 |
| 718 | Ga0501073_0138866 | 3300049589 | Bacteria | 1684 |
| 719 | Ga0501073_0177787 | 3300049589 | Bacteria | 1473 |
| 720 | Ga0501074_0278611 | 3300049590 | Bacteria | 1189 |
| 721 | Ga0501075_0145696 | 3300049591 | Bacteria | 1805 |
| 722 | Ga0501076_0268651 | 3300049592 | Bacteria | 1397 |
| 723 | Ga0501076_0481890 | 3300049592 | Bacteria | 1022 |
| 724 | Ga0501077_0155940 | 3300049593 | Bacteria | 1449 |
| 725 | Ga0501223_010163 | 3300049663 | Bacteria | 1898 |
| 726 | Ga0501257_000071 | 3300049686 | Bacteria | 26120 |
| 727 | Ga0501079_0445387 | 3300049741 | Bacteria | 1017 |
| 728 | Ga0501079_1451850 | 3300049741 | Bacteria | 540 |
| 729 | Ga0501080_0068191 | 3300049742 | Bacteria | 3309 |
| 730 | Ga0501080_0153043 | 3300049742 | Bacteria | 2131 |
| 731 | Ga0501080_0448187 | 3300049742 | Bacteria | 1157 |
| 732 | Ga0501080_0450733 | 3300049742 | Bacteria | 1154 |
| 733 | Ga0501080_0702166 | 3300049742 | Bacteria | 892 |
| 734 | Ga0501081_1212261 | 3300049743 | Bacteria | 572 |
| 735 | Ga0501083_0101700 | 3300049744 | Bacteria | 1894 |
| 736 | Ga0501083_0184331 | 3300049744 | Bacteria | 1362 |
| 737 | Ga0501083_0435517 | 3300049744 | Bacteria | 853 |
| 738 | Ga0501083_0961342 | 3300049744 | Unclassified | 556 |
| 739 | Ga0501280_000241 | 3300049776 | Bacteria | 13745 |
| 740 | Ga0501035_0018260 | 3300049822 | Bacteria | 6461 |
| 741 | Ga0501035_0103180 | 3300049822 | Bacteria | 2501 |
| 742 | Ga0501035_0365154 | 3300049822 | Bacteria | 1206 |
| 743 | Ga0501044_0010936 | 3300049823 | Bacteria | 9850 |
| 744 | Ga0501044_0097655 | 3300049823 | Bacteria | 2958 |
| 745 | Ga0501044_0098350 | 3300049823 | Bacteria | 2946 |
| 746 | Ga0501044_0295749 | 3300049823 | Bacteria | 1549 |
| 747 | Ga0501044_0319632 | 3300049823 | Bacteria | 1477 |
| 748 | Ga0501044_0448093 | 3300049823 | Bacteria | 1198 |
| 749 | Ga0501044_0460075 | 3300049823 | Bacteria | 1178 |
| 750 | Ga0501044_0680930 | 3300049823 | Bacteria | 915 |
| 751 | Ga0501044_1196283 | 3300049823 | Bacteria | 628 |
| 752 | nmdc:mga03683_13116_c1 | 3300050489 | Bacteria | 3043 |
| 753 | nmdc:mga03683_36229_c1 | 3300050489 | Bacteria | 2006 |
| 754 | nmdc:mga03n38_924791_c1 | 3300050490 | Bacteria | 513 |
| 755 | nmdc:mga0yw44_117091_c1 | 3300050492 | Bacteria | 1713 |
| 756 | nmdc:mga0yw44_506127_c1 | 3300050492 | Bacteria | 820 |
| 757 | nmdc:mga0yw44_55454_c1 | 3300050492 | Bacteria | 2412 |
| 758 | nmdc:mga0k408_184045_c1 | 3300050493 | Bacteria | 1246 |
| 759 | nmdc:mga0k408_232308_c1 | 3300050493 | Bacteria | 1101 |
| 760 | nmdc:mga06z11_14790_c2 | 3300050494 | Bacteria | 2218 |
| 761 | nmdc:mga06z11_91957_c1 | 3300050494 | Bacteria | 1649 |
| 762 | nmdc:mga09592_334936_c1 | 3300050508 | Bacteria | 1310 |
| 763 | nmdc:mga09592_694881_c1 | 3300050508 | Bacteria | 866 |
| 764 | nmdc:mga08y16_1182079_c1 | 3300050511 | Bacteria | 736 |
| 765 | nmdc:mga0rr50_495681_c1 | 3300050513 | Bacteria | 1038 |
| 766 | Ga0495612_0476287 | 3300053078 | Bacteria | 572 |
| 767 | Ga0500643_000167 | 3300053087 | Bacteria | 64874 |
| 768 | Ga0500647_0019249 | 3300053091 | Bacteria | 3169 |
| 769 | Ga0500651_0011019 | 3300053093 | Bacteria | 5439 |
| 770 | Ga0500651_0202100 | 3300053093 | Bacteria | 1172 |
| 771 | Ga0500641_0001255 | 3300053096 | Bacteria | 9021 |
| 772 | Ga0500650_0244184 | 3300053098 | Bacteria | 807 |
| 773 | Ga0500592_000645 | 3300053116 | Bacteria | 5726 |
| 774 | Ga0500594_0010595 | 3300053118 | Bacteria | 2143 |
| 775 | Ga0500597_077510 | 3300053120 | Bacteria | 1441 |
| 776 | Ga0500597_374149 | 3300053120 | Bacteria | 548 |
| 777 | Ga0500642_0179069 | 3300053130 | Bacteria | 991 |
| 778 | Ga0500652_000040 | 3300053131 | Bacteria | 68826 |
| 779 | Ga0500655_000021 | 3300053133 | Bacteria | 43984 |
| 780 | Ga0500568_0021313 | 3300053139 | Bacteria | 2790 |
| 781 | Ga0500577_0075845 | 3300053142 | Bacteria | 1330 |
| 782 | Ga0500590_093278 | 3300053148 | Bacteria | 1458 |
| 783 | Ga0500604_0000004 | 3300053151 | Bacteria | 146374 |
| 784 | Ga0500619_037630 | 3300053154 | Bacteria | 1513 |
| 785 | Ga0500627_0000972 | 3300053158 | Bacteria | 7767 |
| 786 | Ga0500636_0010464 | 3300053177 | Bacteria | 5413 |
| 787 | Ga0500570_002608 | 3300053724 | Bacteria | 9018 |
| 788 | Ga0500645_066729 | 3300053730 | Bacteria | 1036 |
| 789 | Ga0501084_0029187 | 3300054114 | Bacteria | 4613 |
| 790 | Ga0501084_0039486 | 3300054114 | Bacteria | 3948 |
| 791 | Ga0501084_0444935 | 3300054114 | Bacteria | 1095 |
| 792 | Ga0501084_0907523 | 3300054114 | Bacteria | 741 |
| 793 | Ga0501084_1310003 | 3300054114 | Bacteria | 607 |
| 794 | Ga0587111_0171786 | 3300060346 | Bacteria | 597 |
| 795 | Ga0501082_0016167 | 3300060353 | Bacteria | 6421 |
| 796 | Ga0501082_0117985 | 3300060353 | Bacteria | 2298 |
| 797 | Ga0501082_0496623 | 3300060353 | Bacteria | 1066 |
| 798 | Ga0501082_1027838 | 3300060353 | Bacteria | 721 |
| 799 | Ga0530510_0503986 | 3300061734 | Bacteria | 918 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005331 | Ga0070670_100891014 | Ga0070670_1008910141 | 138 |
| 2 | 3300005354 | Ga0070675_100048611 | Ga0070675_1000486112 | 139 |
| 3 | 3300005364 | Ga0070673_100727102 | Ga0070673_1007271021 | 139 |
| 4 | 3300005445 | Ga0070708_101073968 | Ga0070708_1010739682 | 139 |
| 5 | 3300005548 | Ga0070665_100038937 | Ga0070665_1000389374 | 139 |
| 6 | 3300005937 | Ga0081455_10203403 | Ga0081455_102034032 | 139 |
| 7 | 3300006852 | Ga0075433_10242694 | Ga0075433_102426942 | 139 |
| 8 | 3300009098 | Ga0105245_10177854 | Ga0105245_101778543 | 139 |
| 9 | 3300013307 | Ga0157372_12629305 | Ga0157372_126293051 | 139 |
| 10 | 3300020081 | Ga0206354_10945638 | Ga0206354_109456382 | 139 |
| 11 | 3300021384 | Ga0213876_10218025 | Ga0213876_102180252 | 139 |
| 12 | 3300025960 | Ga0207651_10376490 | Ga0207651_103764902 | 139 |
| 13 | 3300027252 | Ga0209973_1012410 | Ga0209973_10124102 | 139 |
| 14 | 3300027682 | Ga0209971_1093380 | Ga0209971_10933802 | 139 |
| 15 | 3300027717 | Ga0209998_10044265 | Ga0209998_100442652 | 139 |
| 16 | 3300027876 | Ga0209974_10004627 | Ga0209974_100046274 | 139 |
| 17 | 3300028379 | Ga0268266_10027704 | Ga0268266_100277043 | 139 |
| 18 | 3300032002 | Ga0307416_100662297 | Ga0307416_1006622973 | 139 |
| 19 | 3300033541 | Ga0316596_1024650 | Ga0316596_10246502 | 139 |
| 20 | 3300038443 | Ga0395901_0783858 | Ga0395901_0783858_477_896 | 139 |
| 21 | 3300039437 | Ga0436365_0095088 | Ga0436365_0095088_200_619 | 139 |
| 22 | 3300042004 | Ga0439445_0085540 | Ga0439445_0085540_105_524 | 139 |
| 23 | 3300046512 | Ga0495610_0149942 | Ga0495610_0149942_252_671 | 139 |
| 24 | 3300048929 | Ga0496126_0234042 | Ga0496126_0234042_713_1132 | 139 |
| 25 | 3300049593 | Ga0501077_0155940 | Ga0501077_0155940_515_934 | 139 |
| 26 | 3300053151 | Ga0500604_0000004 | Ga0500604_0000004_57988_58407 | 139 |
| 27 | 3300060353 | Ga0501082_1027838 | Ga0501082_1027838_200_619 | 139 |
| 28 | 3300005262 | Ga0065165_1003558 | Ga0065165_10035584 | 140 |
| 29 | 3300005295 | Ga0065707_10082138 | Ga0065707_1008213816 | 140 |
| 30 | 3300005327 | Ga0070658_10002834 | Ga0070658_1000283415 | 140 |
| 31 | 3300005327 | Ga0070658_10048640 | Ga0070658_100486402 | 140 |
| 32 | 3300005327 | Ga0070658_10074304 | Ga0070658_100743042 | 140 |
| 33 | 3300005327 | Ga0070658_11518601 | Ga0070658_115186011 | 140 |
| 34 | 3300005329 | Ga0070683_100166982 | Ga0070683_1001669824 | 140 |
| 35 | 3300005329 | Ga0070683_100245898 | Ga0070683_1002458982 | 140 |
| 36 | 3300005329 | Ga0070683_101039085 | Ga0070683_1010390851 | 140 |
| 37 | 3300005330 | Ga0070690_100202829 | Ga0070690_1002028294 | 140 |
| 38 | 3300005330 | Ga0070690_100369722 | Ga0070690_1003697221 | 140 |
| 39 | 3300005334 | Ga0068869_101940050 | Ga0068869_1019400501 | 140 |
| 40 | 3300005335 | Ga0070666_10322205 | Ga0070666_103222052 | 140 |
| 41 | 3300005338 | Ga0068868_100172392 | Ga0068868_1001723922 | 140 |
| 42 | 3300005338 | Ga0068868_100438038 | Ga0068868_1004380381 | 140 |
| 43 | 3300005338 | Ga0068868_100816262 | Ga0068868_1008162621 | 140 |
| 44 | 3300005338 | Ga0068868_101274936 | Ga0068868_1012749361 | 140 |
| 45 | 3300005339 | Ga0070660_100012199 | Ga0070660_1000121997 | 140 |
| 46 | 3300005339 | Ga0070660_100033220 | Ga0070660_1000332201 | 140 |
| 47 | 3300005340 | Ga0070689_100565888 | Ga0070689_1005658882 | 140 |
| 48 | 3300005341 | Ga0070691_10615449 | Ga0070691_106154491 | 140 |
| 49 | 3300005343 | Ga0070687_100355430 | Ga0070687_1003554302 | 140 |
| 50 | 3300005344 | Ga0070661_100423544 | Ga0070661_1004235442 | 140 |
| 51 | 3300005344 | Ga0070661_100577703 | Ga0070661_1005777032 | 140 |
| 52 | 3300005344 | Ga0070661_100640874 | Ga0070661_1006408742 | 140 |
| 53 | 3300005347 | Ga0070668_100013728 | Ga0070668_1000137284 | 140 |
| 54 | 3300005347 | Ga0070668_100021015 | Ga0070668_1000210154 | 140 |
| 55 | 3300005347 | Ga0070668_100371585 | Ga0070668_1003715852 | 140 |
| 56 | 3300005347 | Ga0070668_100414259 | Ga0070668_1004142592 | 140 |
| 57 | 3300005354 | Ga0070675_100255186 | Ga0070675_1002551861 | 140 |
| 58 | 3300005354 | Ga0070675_100973261 | Ga0070675_1009732611 | 140 |
| 59 | 3300005354 | Ga0070675_101041660 | Ga0070675_1010416601 | 140 |
| 60 | 3300005354 | Ga0070675_101272631 | Ga0070675_1012726311 | 140 |
| 61 | 3300005356 | Ga0070674_100381483 | Ga0070674_1003814831 | 140 |
| 62 | 3300005364 | Ga0070673_100054087 | Ga0070673_1000540872 | 140 |
| 63 | 3300005366 | Ga0070659_100495818 | Ga0070659_1004958182 | 140 |
| 64 | 3300005367 | Ga0070667_100034729 | Ga0070667_1000347292 | 140 |
| 65 | 3300005367 | Ga0070667_100386741 | Ga0070667_1003867411 | 140 |
| 66 | 3300005367 | Ga0070667_100600934 | Ga0070667_1006009342 | 140 |
| 67 | 3300005367 | Ga0070667_101156111 | Ga0070667_1011561111 | 140 |
| 68 | 3300005434 | Ga0070709_10033191 | Ga0070709_100331912 | 140 |
| 69 | 3300005435 | Ga0070714_100182974 | Ga0070714_1001829742 | 140 |
| 70 | 3300005436 | Ga0070713_100370088 | Ga0070713_1003700881 | 140 |
| 71 | 3300005436 | Ga0070713_100520776 | Ga0070713_1005207762 | 140 |
| 72 | 3300005437 | Ga0070710_10264912 | Ga0070710_102649121 | 140 |
| 73 | 3300005437 | Ga0070710_10301080 | Ga0070710_103010801 | 140 |
| 74 | 3300005439 | Ga0070711_100000579 | Ga0070711_1000005793 | 140 |
| 75 | 3300005439 | Ga0070711_100906234 | Ga0070711_1009062341 | 140 |
| 76 | 3300005439 | Ga0070711_101510616 | Ga0070711_1015106161 | 140 |
| 77 | 3300005445 | Ga0070708_100001209 | Ga0070708_1000012095 | 140 |
| 78 | 3300005455 | Ga0070663_100145573 | Ga0070663_1001455733 | 140 |
| 79 | 3300005456 | Ga0070678_100111350 | Ga0070678_1001113503 | 140 |
| 80 | 3300005458 | Ga0070681_10133669 | Ga0070681_101336694 | 140 |
| 81 | 3300005458 | Ga0070681_10138493 | Ga0070681_101384934 | 140 |
| 82 | 3300005458 | Ga0070681_10887657 | Ga0070681_108876572 | 140 |
| 83 | 3300005459 | Ga0068867_100034276 | Ga0068867_1000342762 | 140 |
| 84 | 3300005459 | Ga0068867_100891518 | Ga0068867_1008915181 | 140 |
| 85 | 3300005466 | Ga0070685_10047760 | Ga0070685_100477602 | 140 |
| 86 | 3300005467 | Ga0070706_100000114 | Ga0070706_10000011457 | 140 |
| 87 | 3300005468 | Ga0070707_100037523 | Ga0070707_1000375232 | 140 |
| 88 | 3300005471 | Ga0070698_100003572 | Ga0070698_1000035724 | 140 |
| 89 | 3300005471 | Ga0070698_100196630 | Ga0070698_1001966302 | 140 |
| 90 | 3300005530 | Ga0070679_100008108 | Ga0070679_1000081087 | 140 |
| 91 | 3300005530 | Ga0070679_100133298 | Ga0070679_1001332984 | 140 |
| 92 | 3300005535 | Ga0070684_100114518 | Ga0070684_1001145182 | 140 |
| 93 | 3300005535 | Ga0070684_100145132 | Ga0070684_1001451322 | 140 |
| 94 | 3300005535 | Ga0070684_100149600 | Ga0070684_1001496001 | 140 |
| 95 | 3300005536 | Ga0070697_100007078 | Ga0070697_1000070786 | 140 |
| 96 | 3300005536 | Ga0070697_100164907 | Ga0070697_1001649073 | 140 |
| 97 | 3300005539 | Ga0068853_100124330 | Ga0068853_1001243302 | 140 |
| 98 | 3300005539 | Ga0068853_100168641 | Ga0068853_1001686413 | 140 |
| 99 | 3300005539 | Ga0068853_100386385 | Ga0068853_1003863853 | 140 |
| 100 | 3300005539 | Ga0068853_100956850 | Ga0068853_1009568502 | 140 |
| 101 | 3300005543 | Ga0070672_101098974 | Ga0070672_1010989741 | 140 |
| 102 | 3300005548 | Ga0070665_100002027 | Ga0070665_1000020279 | 140 |
| 103 | 3300005548 | Ga0070665_100003577 | Ga0070665_1000035779 | 140 |
| 104 | 3300005548 | Ga0070665_100060814 | Ga0070665_1000608141 | 140 |
| 105 | 3300005548 | Ga0070665_100127146 | Ga0070665_1001271463 | 140 |
| 106 | 3300005548 | Ga0070665_100253694 | Ga0070665_1002536941 | 140 |
| 107 | 3300005548 | Ga0070665_100258566 | Ga0070665_1002585662 | 140 |
| 108 | 3300005548 | Ga0070665_101287906 | Ga0070665_1012879061 | 140 |
| 109 | 3300005549 | Ga0070704_100384850 | Ga0070704_1003848502 | 140 |
| 110 | 3300005563 | Ga0068855_100517072 | Ga0068855_1005170723 | 140 |
| 111 | 3300005563 | Ga0068855_101286399 | Ga0068855_1012863991 | 140 |
| 112 | 3300005563 | Ga0068855_102163076 | Ga0068855_1021630761 | 140 |
| 113 | 3300005564 | Ga0070664_100102651 | Ga0070664_1001026514 | 140 |
| 114 | 3300005564 | Ga0070664_100325916 | Ga0070664_1003259162 | 140 |
| 115 | 3300005577 | Ga0068857_100517918 | Ga0068857_1005179182 | 140 |
| 116 | 3300005577 | Ga0068857_100579002 | Ga0068857_1005790022 | 140 |
| 117 | 3300005577 | Ga0068857_100826386 | Ga0068857_1008263862 | 140 |
| 118 | 3300005577 | Ga0068857_100961268 | Ga0068857_1009612681 | 140 |
| 119 | 3300005577 | Ga0068857_101216416 | Ga0068857_1012164162 | 140 |
| 120 | 3300005578 | Ga0068854_100263146 | Ga0068854_1002631462 | 140 |
| 121 | 3300005578 | Ga0068854_100513327 | Ga0068854_1005133271 | 140 |
| 122 | 3300005578 | Ga0068854_101440975 | Ga0068854_1014409751 | 140 |
| 123 | 3300005614 | Ga0068856_100083626 | Ga0068856_1000836261 | 140 |
| 124 | 3300005614 | Ga0068856_100112827 | Ga0068856_1001128273 | 140 |
| 125 | 3300005614 | Ga0068856_100344597 | Ga0068856_1003445973 | 140 |
| 126 | 3300005614 | Ga0068856_100593425 | Ga0068856_1005934252 | 140 |
| 127 | 3300005616 | Ga0068852_100033207 | Ga0068852_1000332072 | 140 |
| 128 | 3300005616 | Ga0068852_100746482 | Ga0068852_1007464822 | 140 |
| 129 | 3300005618 | Ga0068864_100149906 | Ga0068864_1001499062 | 140 |
| 130 | 3300005618 | Ga0068864_100174877 | Ga0068864_1001748772 | 140 |
| 131 | 3300005618 | Ga0068864_100562715 | Ga0068864_1005627152 | 140 |
| 132 | 3300005718 | Ga0068866_10223007 | Ga0068866_102230072 | 140 |
| 133 | 3300005719 | Ga0068861_100002290 | Ga0068861_10000229012 | 140 |
| 134 | 3300005834 | Ga0068851_10549095 | Ga0068851_105490951 | 140 |
| 135 | 3300005840 | Ga0068870_10894200 | Ga0068870_108942001 | 140 |
| 136 | 3300005842 | Ga0068858_100269198 | Ga0068858_1002691984 | 140 |
| 137 | 3300005843 | Ga0068860_100006672 | Ga0068860_1000066722 | 140 |
| 138 | 3300005843 | Ga0068860_100010477 | Ga0068860_1000104777 | 140 |
| 139 | 3300005843 | Ga0068860_100201562 | Ga0068860_1002015622 | 140 |
| 140 | 3300005843 | Ga0068860_100492781 | Ga0068860_1004927812 | 140 |
| 141 | 3300005844 | Ga0068862_100069735 | Ga0068862_1000697352 | 140 |
| 142 | 3300005844 | Ga0068862_100376521 | Ga0068862_1003765213 | 140 |
| 143 | 3300005937 | Ga0081455_10000806 | Ga0081455_1000080622 | 140 |
| 144 | 3300005937 | Ga0081455_10117215 | Ga0081455_101172152 | 140 |
| 145 | 3300005937 | Ga0081455_10256957 | Ga0081455_102569571 | 140 |
| 146 | 3300005983 | Ga0081540_1004991 | Ga0081540_10049919 | 140 |
| 147 | 3300005983 | Ga0081540_1032904 | Ga0081540_10329043 | 140 |
| 148 | 3300005985 | Ga0081539_10010022 | Ga0081539_100100222 | 140 |
| 149 | 3300006028 | Ga0070717_10000290 | Ga0070717_1000029023 | 140 |
| 150 | 3300006038 | Ga0075365_10019235 | Ga0075365_100192352 | 140 |
| 151 | 3300006038 | Ga0075365_10206913 | Ga0075365_102069133 | 140 |
| 152 | 3300006042 | Ga0075368_10090302 | Ga0075368_100903022 | 140 |
| 153 | 3300006048 | Ga0075363_100045378 | Ga0075363_1000453783 | 140 |
| 154 | 3300006048 | Ga0075363_100609719 | Ga0075363_1006097191 | 140 |
| 155 | 3300006051 | Ga0075364_10077688 | Ga0075364_100776881 | 140 |
| 156 | 3300006051 | Ga0075364_10628679 | Ga0075364_106286792 | 140 |
| 157 | 3300006051 | Ga0075364_10654504 | Ga0075364_106545042 | 140 |
| 158 | 3300006058 | Ga0075432_10096927 | Ga0075432_100969272 | 140 |
| 159 | 3300006163 | Ga0070715_10063594 | Ga0070715_100635943 | 140 |
| 160 | 3300006163 | Ga0070715_10129677 | Ga0070715_101296772 | 140 |
| 161 | 3300006163 | Ga0070715_10172437 | Ga0070715_101724372 | 140 |
| 162 | 3300006175 | Ga0070712_100003789 | Ga0070712_1000037898 | 140 |
| 163 | 3300006175 | Ga0070712_100091326 | Ga0070712_1000913264 | 140 |
| 164 | 3300006175 | Ga0070712_100265700 | Ga0070712_1002657002 | 140 |
| 165 | 3300006175 | Ga0070712_101412594 | Ga0070712_1014125941 | 140 |
| 166 | 3300006177 | Ga0075362_10003772 | Ga0075362_100037725 | 140 |
| 167 | 3300006177 | Ga0075362_10005498 | Ga0075362_100054983 | 140 |
| 168 | 3300006178 | Ga0075367_10023776 | Ga0075367_100237764 | 140 |
| 169 | 3300006178 | Ga0075367_10263779 | Ga0075367_102637793 | 140 |
| 170 | 3300006178 | Ga0075367_10400103 | Ga0075367_104001032 | 140 |
| 171 | 3300006186 | Ga0075369_10002609 | Ga0075369_100026093 | 140 |
| 172 | 3300006186 | Ga0075369_10273997 | Ga0075369_102739972 | 140 |
| 173 | 3300006237 | Ga0097621_100075157 | Ga0097621_1000751571 | 140 |
| 174 | 3300006237 | Ga0097621_100483488 | Ga0097621_1004834882 | 140 |
| 175 | 3300006237 | Ga0097621_100534926 | Ga0097621_1005349262 | 140 |
| 176 | 3300006237 | Ga0097621_101176878 | Ga0097621_1011768782 | 140 |
| 177 | 3300006353 | Ga0075370_10122037 | Ga0075370_101220371 | 140 |
| 178 | 3300006358 | Ga0068871_100013417 | Ga0068871_1000134172 | 140 |
| 179 | 3300006358 | Ga0068871_100106979 | Ga0068871_1001069795 | 140 |
| 180 | 3300006358 | Ga0068871_100162683 | Ga0068871_1001626832 | 140 |
| 181 | 3300006358 | Ga0068871_100180015 | Ga0068871_1001800153 | 140 |
| 182 | 3300006358 | Ga0068871_100212153 | Ga0068871_1002121532 | 140 |
| 183 | 3300006358 | Ga0068871_100229864 | Ga0068871_1002298642 | 140 |
| 184 | 3300006358 | Ga0068871_100529831 | Ga0068871_1005298312 | 140 |
| 185 | 3300006358 | Ga0068871_100926426 | Ga0068871_1009264261 | 140 |
| 186 | 3300006844 | Ga0075428_100744562 | Ga0075428_1007445621 | 140 |
| 187 | 3300006847 | Ga0075431_101216947 | Ga0075431_1012169471 | 140 |
| 188 | 3300006871 | Ga0075434_100083305 | Ga0075434_1000833053 | 140 |
| 189 | 3300006880 | Ga0075429_100775711 | Ga0075429_1007757112 | 140 |
| 190 | 3300006880 | Ga0075429_101229270 | Ga0075429_1012292702 | 140 |
| 191 | 3300006881 | Ga0068865_100003415 | Ga0068865_1000034154 | 140 |
| 192 | 3300006881 | Ga0068865_100329570 | Ga0068865_1003295702 | 140 |
| 193 | 3300006881 | Ga0068865_101341899 | Ga0068865_1013418991 | 140 |
| 194 | 3300006931 | Ga0097620_102137391 | Ga0097620_1021373911 | 140 |
| 195 | 3300007076 | Ga0075435_100854815 | Ga0075435_1008548152 | 140 |
| 196 | 3300009093 | Ga0105240_10116693 | Ga0105240_101166933 | 140 |
| 197 | 3300009093 | Ga0105240_10215739 | Ga0105240_102157392 | 140 |
| 198 | 3300009093 | Ga0105240_10431257 | Ga0105240_104312572 | 140 |
| 199 | 3300009093 | Ga0105240_10624729 | Ga0105240_106247292 | 140 |
| 200 | 3300009093 | Ga0105240_11005033 | Ga0105240_110050332 | 140 |
| 201 | 3300009093 | Ga0105240_11414497 | Ga0105240_114144971 | 140 |
| 202 | 3300009094 | Ga0111539_10805462 | Ga0111539_108054622 | 140 |
| 203 | 3300009094 | Ga0111539_10879826 | Ga0111539_108798262 | 140 |
| 204 | 3300009098 | Ga0105245_10019634 | Ga0105245_100196343 | 140 |
| 205 | 3300009098 | Ga0105245_11284469 | Ga0105245_112844691 | 140 |
| 206 | 3300009174 | Ga0105241_10184909 | Ga0105241_101849093 | 140 |
| 207 | 3300009174 | Ga0105241_10387720 | Ga0105241_103877202 | 140 |
| 208 | 3300009174 | Ga0105241_10582075 | Ga0105241_105820752 | 140 |
| 209 | 3300009174 | Ga0105241_10720818 | Ga0105241_107208182 | 140 |
| 210 | 3300009174 | Ga0105241_11094680 | Ga0105241_110946801 | 140 |
| 211 | 3300009176 | Ga0105242_10108470 | Ga0105242_101084703 | 140 |
| 212 | 3300009177 | Ga0105248_10167031 | Ga0105248_101670313 | 140 |
| 213 | 3300009177 | Ga0105248_10266351 | Ga0105248_102663514 | 140 |
| 214 | 3300009177 | Ga0105248_10674314 | Ga0105248_106743143 | 140 |
| 215 | 3300009545 | Ga0105237_10001366 | Ga0105237_100013669 | 140 |
| 216 | 3300009545 | Ga0105237_10319155 | Ga0105237_103191552 | 140 |
| 217 | 3300009545 | Ga0105237_10323101 | Ga0105237_103231013 | 140 |
| 218 | 3300009545 | Ga0105237_12120253 | Ga0105237_121202531 | 140 |
| 219 | 3300009551 | Ga0105238_10057475 | Ga0105238_100574754 | 140 |
| 220 | 3300009551 | Ga0105238_10265623 | Ga0105238_102656233 | 140 |
| 221 | 3300009551 | Ga0105238_10347011 | Ga0105238_103470112 | 140 |
| 222 | 3300009551 | Ga0105238_12110602 | Ga0105238_121106021 | 140 |
| 223 | 3300010159 | Ga0099796_10198378 | Ga0099796_101983782 | 140 |
| 224 | 3300010375 | Ga0105239_10001205 | Ga0105239_1000120510 | 140 |
| 225 | 3300010375 | Ga0105239_10006723 | Ga0105239_100067236 | 140 |
| 226 | 3300010375 | Ga0105239_10036920 | Ga0105239_100369204 | 140 |
| 227 | 3300010375 | Ga0105239_10037058 | Ga0105239_100370586 | 140 |
| 228 | 3300010375 | Ga0105239_10268646 | Ga0105239_102686462 | 140 |
| 229 | 3300010375 | Ga0105239_11232456 | Ga0105239_112324562 | 140 |
| 230 | 3300010375 | Ga0105239_11332958 | Ga0105239_113329582 | 140 |
| 231 | 3300010375 | Ga0105239_11732883 | Ga0105239_117328831 | 140 |
| 232 | 3300010375 | Ga0105239_12308651 | Ga0105239_123086511 | 140 |
| 233 | 3300011119 | Ga0105246_10085665 | Ga0105246_100856654 | 140 |
| 234 | 3300011119 | Ga0105246_10133300 | Ga0105246_101333002 | 140 |
| 235 | 3300011119 | Ga0105246_10317272 | Ga0105246_103172722 | 140 |
| 236 | 3300013100 | Ga0157373_10086197 | Ga0157373_100861971 | 140 |
| 237 | 3300013100 | Ga0157373_11084278 | Ga0157373_110842781 | 140 |
| 238 | 3300013102 | Ga0157371_10247348 | Ga0157371_102473483 | 140 |
| 239 | 3300013105 | Ga0157369_10046598 | Ga0157369_100465984 | 140 |
| 240 | 3300013105 | Ga0157369_10264089 | Ga0157369_102640892 | 140 |
| 241 | 3300013105 | Ga0157369_10367000 | Ga0157369_103670002 | 140 |
| 242 | 3300013105 | Ga0157369_10566676 | Ga0157369_105666762 | 140 |
| 243 | 3300013105 | Ga0157369_10585996 | Ga0157369_105859962 | 140 |
| 244 | 3300013297 | Ga0157378_10611371 | Ga0157378_106113711 | 140 |
| 245 | 3300013297 | Ga0157378_11665573 | Ga0157378_116655731 | 140 |
| 246 | 3300013306 | Ga0163162_10061302 | Ga0163162_100613023 | 140 |
| 247 | 3300013306 | Ga0163162_10090110 | Ga0163162_100901102 | 140 |
| 248 | 3300013306 | Ga0163162_10760468 | Ga0163162_107604681 | 140 |
| 249 | 3300013306 | Ga0163162_12615802 | Ga0163162_126158021 | 140 |
| 250 | 3300013307 | Ga0157372_10136745 | Ga0157372_101367454 | 140 |
| 251 | 3300013307 | Ga0157372_11103637 | Ga0157372_111036372 | 140 |
| 252 | 3300013308 | Ga0157375_10039100 | Ga0157375_100391003 | 140 |
| 253 | 3300013308 | Ga0157375_11157164 | Ga0157375_111571642 | 140 |
| 254 | 3300013308 | Ga0157375_12539150 | Ga0157375_125391501 | 140 |
| 255 | 3300013308 | Ga0157375_12932832 | Ga0157375_129328321 | 140 |
| 256 | 3300014325 | Ga0163163_10097627 | Ga0163163_100976275 | 140 |
| 257 | 3300014325 | Ga0163163_10517366 | Ga0163163_105173662 | 140 |
| 258 | 3300014326 | Ga0157380_10031835 | Ga0157380_100318351 | 140 |
| 259 | 3300014497 | Ga0182008_10196181 | Ga0182008_101961811 | 140 |
| 260 | 3300014745 | Ga0157377_11146391 | Ga0157377_111463911 | 140 |
| 261 | 3300014968 | Ga0157379_10049892 | Ga0157379_100498922 | 140 |
| 262 | 3300014968 | Ga0157379_10277336 | Ga0157379_102773363 | 140 |
| 263 | 3300014968 | Ga0157379_11165176 | Ga0157379_111651761 | 140 |
| 264 | 3300014968 | Ga0157379_11368790 | Ga0157379_113687902 | 140 |
| 265 | 3300014969 | Ga0157376_10030553 | Ga0157376_100305533 | 140 |
| 266 | 3300014969 | Ga0157376_10389639 | Ga0157376_103896392 | 140 |
| 267 | 3300017792 | Ga0163161_10039338 | Ga0163161_100393385 | 140 |
| 268 | 3300020076 | Ga0206355_1080318 | Ga0206355_10803182 | 140 |
| 269 | 3300021358 | Ga0213873_10000006 | Ga0213873_10000006309 | 140 |
| 270 | 3300021361 | Ga0213872_10000983 | Ga0213872_1000098313 | 140 |
| 271 | 3300021361 | Ga0213872_10036611 | Ga0213872_100366111 | 140 |
| 272 | 3300021361 | Ga0213872_10042438 | Ga0213872_100424381 | 140 |
| 273 | 3300021361 | Ga0213872_10044484 | Ga0213872_100444842 | 140 |
| 274 | 3300021361 | Ga0213872_10377652 | Ga0213872_103776521 | 140 |
| 275 | 3300021377 | Ga0213874_10285461 | Ga0213874_102854612 | 140 |
| 276 | 3300021384 | Ga0213876_10000004 | Ga0213876_10000004815 | 140 |
| 277 | 3300021384 | Ga0213876_10049016 | Ga0213876_100490162 | 140 |
| 278 | 3300021388 | Ga0213875_10010160 | Ga0213875_100101603 | 140 |
| 279 | 3300021388 | Ga0213875_10163320 | Ga0213875_101633202 | 140 |
| 280 | 3300025231 | Ga0207427_103164 | Ga0207427_1031642 | 140 |
| 281 | 3300025261 | Ga0209233_1000013 | Ga0209233_1000013229 | 140 |
| 282 | 3300025261 | Ga0209233_1008420 | Ga0209233_10084202 | 140 |
| 283 | 3300025294 | Ga0209025_1104234 | Ga0209025_11042341 | 140 |
| 284 | 3300025297 | Ga0209758_1110660 | Ga0209758_11106601 | 140 |
| 285 | 3300025321 | Ga0207656_10193494 | Ga0207656_101934942 | 140 |
| 286 | 3300025898 | Ga0207692_10358598 | Ga0207692_103585981 | 140 |
| 287 | 3300025899 | Ga0207642_10159764 | Ga0207642_101597642 | 140 |
| 288 | 3300025901 | Ga0207688_10120782 | Ga0207688_101207822 | 140 |
| 289 | 3300025903 | Ga0207680_10349009 | Ga0207680_103490092 | 140 |
| 290 | 3300025904 | Ga0207647_10079224 | Ga0207647_100792242 | 140 |
| 291 | 3300025905 | Ga0207685_10282088 | Ga0207685_102820882 | 140 |
| 292 | 3300025906 | Ga0207699_10174558 | Ga0207699_101745582 | 140 |
| 293 | 3300025906 | Ga0207699_10643239 | Ga0207699_106432391 | 140 |
| 294 | 3300025907 | Ga0207645_10488504 | Ga0207645_104885042 | 140 |
| 295 | 3300025909 | Ga0207705_10102679 | Ga0207705_101026793 | 140 |
| 296 | 3300025909 | Ga0207705_10402901 | Ga0207705_104029012 | 140 |
| 297 | 3300025909 | Ga0207705_10453389 | Ga0207705_104533892 | 140 |
| 298 | 3300025910 | Ga0207684_10000187 | Ga0207684_1000018756 | 140 |
| 299 | 3300025911 | Ga0207654_10007677 | Ga0207654_100076772 | 140 |
| 300 | 3300025911 | Ga0207654_10257806 | Ga0207654_102578063 | 140 |
| 301 | 3300025911 | Ga0207654_10612417 | Ga0207654_106124171 | 140 |
| 302 | 3300025912 | Ga0207707_10002733 | Ga0207707_100027332 | 140 |
| 303 | 3300025912 | Ga0207707_10236826 | Ga0207707_102368262 | 140 |
| 304 | 3300025912 | Ga0207707_10590922 | Ga0207707_105909222 | 140 |
| 305 | 3300025912 | Ga0207707_11105971 | Ga0207707_111059711 | 140 |
| 306 | 3300025913 | Ga0207695_10005412 | Ga0207695_100054126 | 140 |
| 307 | 3300025913 | Ga0207695_10254102 | Ga0207695_102541022 | 140 |
| 308 | 3300025913 | Ga0207695_10275533 | Ga0207695_102755332 | 140 |
| 309 | 3300025913 | Ga0207695_10285054 | Ga0207695_102850543 | 140 |
| 310 | 3300025913 | Ga0207695_10436831 | Ga0207695_104368312 | 140 |
| 311 | 3300025913 | Ga0207695_10465046 | Ga0207695_104650462 | 140 |
| 312 | 3300025913 | Ga0207695_10530406 | Ga0207695_105304062 | 140 |
| 313 | 3300025914 | Ga0207671_10000215 | Ga0207671_1000021520 | 140 |
| 314 | 3300025914 | Ga0207671_10119984 | Ga0207671_101199843 | 140 |
| 315 | 3300025914 | Ga0207671_10497382 | Ga0207671_104973821 | 140 |
| 316 | 3300025914 | Ga0207671_10513523 | Ga0207671_105135232 | 140 |
| 317 | 3300025914 | Ga0207671_10524056 | Ga0207671_105240561 | 140 |
| 318 | 3300025914 | Ga0207671_10590595 | Ga0207671_105905951 | 140 |
| 319 | 3300025915 | Ga0207693_10002047 | Ga0207693_1000204714 | 140 |
| 320 | 3300025915 | Ga0207693_10025243 | Ga0207693_100252432 | 140 |
| 321 | 3300025915 | Ga0207693_10088056 | Ga0207693_100880562 | 140 |
| 322 | 3300025915 | Ga0207693_10132050 | Ga0207693_101320501 | 140 |
| 323 | 3300025916 | Ga0207663_10313026 | Ga0207663_103130263 | 140 |
| 324 | 3300025916 | Ga0207663_10338018 | Ga0207663_103380181 | 140 |
| 325 | 3300025916 | Ga0207663_10436065 | Ga0207663_104360651 | 140 |
| 326 | 3300025917 | Ga0207660_10207612 | Ga0207660_102076122 | 140 |
| 327 | 3300025917 | Ga0207660_10353996 | Ga0207660_103539961 | 140 |
| 328 | 3300025917 | Ga0207660_11103373 | Ga0207660_111033731 | 140 |
| 329 | 3300025918 | Ga0207662_10476222 | Ga0207662_104762223 | 140 |
| 330 | 3300025919 | Ga0207657_10019120 | Ga0207657_100191203 | 140 |
| 331 | 3300025919 | Ga0207657_10046310 | Ga0207657_100463101 | 140 |
| 332 | 3300025919 | Ga0207657_11271663 | Ga0207657_112716631 | 140 |
| 333 | 3300025920 | Ga0207649_10561743 | Ga0207649_105617432 | 140 |
| 334 | 3300025920 | Ga0207649_10614118 | Ga0207649_106141183 | 140 |
| 335 | 3300025920 | Ga0207649_10615911 | Ga0207649_106159112 | 140 |
| 336 | 3300025920 | Ga0207649_10666721 | Ga0207649_106667211 | 140 |
| 337 | 3300025921 | Ga0207652_10018130 | Ga0207652_100181309 | 140 |
| 338 | 3300025921 | Ga0207652_10025573 | Ga0207652_100255733 | 140 |
| 339 | 3300025921 | Ga0207652_10028271 | Ga0207652_100282712 | 140 |
| 340 | 3300025921 | Ga0207652_10463688 | Ga0207652_104636881 | 140 |
| 341 | 3300025922 | Ga0207646_10103202 | Ga0207646_101032023 | 140 |
| 342 | 3300025922 | Ga0207646_11403347 | Ga0207646_114033471 | 140 |
| 343 | 3300025924 | Ga0207694_10110792 | Ga0207694_101107923 | 140 |
| 344 | 3300025924 | Ga0207694_10134060 | Ga0207694_101340604 | 140 |
| 345 | 3300025924 | Ga0207694_10379916 | Ga0207694_103799162 | 140 |
| 346 | 3300025926 | Ga0207659_10152549 | Ga0207659_101525491 | 140 |
| 347 | 3300025926 | Ga0207659_10911497 | Ga0207659_109114971 | 140 |
| 348 | 3300025927 | Ga0207687_10792244 | Ga0207687_107922442 | 140 |
| 349 | 3300025927 | Ga0207687_11794846 | Ga0207687_117948461 | 140 |
| 350 | 3300025928 | Ga0207700_10399523 | Ga0207700_103995232 | 140 |
| 351 | 3300025928 | Ga0207700_10510114 | Ga0207700_105101142 | 140 |
| 352 | 3300025929 | Ga0207664_10017404 | Ga0207664_100174045 | 140 |
| 353 | 3300025931 | Ga0207644_10128669 | Ga0207644_101286694 | 140 |
| 354 | 3300025931 | Ga0207644_11381410 | Ga0207644_113814102 | 140 |
| 355 | 3300025934 | Ga0207686_10019155 | Ga0207686_100191554 | 140 |
| 356 | 3300025935 | Ga0207709_11217275 | Ga0207709_112172752 | 140 |
| 357 | 3300025937 | Ga0207669_10150377 | Ga0207669_101503774 | 140 |
| 358 | 3300025938 | Ga0207704_10932533 | Ga0207704_109325331 | 140 |
| 359 | 3300025940 | Ga0207691_10962499 | Ga0207691_109624992 | 140 |
| 360 | 3300025940 | Ga0207691_11629941 | Ga0207691_116299411 | 140 |
| 361 | 3300025941 | Ga0207711_10586261 | Ga0207711_105862612 | 140 |
| 362 | 3300025942 | Ga0207689_11264974 | Ga0207689_112649741 | 140 |
| 363 | 3300025944 | Ga0207661_10033505 | Ga0207661_100335051 | 140 |
| 364 | 3300025944 | Ga0207661_10121335 | Ga0207661_101213352 | 140 |
| 365 | 3300025944 | Ga0207661_10281971 | Ga0207661_102819712 | 140 |
| 366 | 3300025944 | Ga0207661_10285298 | Ga0207661_102852981 | 140 |
| 367 | 3300025945 | Ga0207679_10073357 | Ga0207679_100733573 | 140 |
| 368 | 3300025949 | Ga0207667_10329217 | Ga0207667_103292172 | 140 |
| 369 | 3300025949 | Ga0207667_10333950 | Ga0207667_103339501 | 140 |
| 370 | 3300025949 | Ga0207667_10335622 | Ga0207667_103356222 | 140 |
| 371 | 3300025949 | Ga0207667_10809122 | Ga0207667_108091222 | 140 |
| 372 | 3300025960 | Ga0207651_10205872 | Ga0207651_102058722 | 140 |
| 373 | 3300025960 | Ga0207651_10351246 | Ga0207651_103512462 | 140 |
| 374 | 3300025972 | Ga0207668_10004161 | Ga0207668_100041617 | 140 |
| 375 | 3300025972 | Ga0207668_10012637 | Ga0207668_100126372 | 140 |
| 376 | 3300025972 | Ga0207668_10695987 | Ga0207668_106959872 | 140 |
| 377 | 3300025981 | Ga0207640_10445781 | Ga0207640_104457812 | 140 |
| 378 | 3300025981 | Ga0207640_11129328 | Ga0207640_111293282 | 140 |
| 379 | 3300025981 | Ga0207640_11509659 | Ga0207640_115096591 | 140 |
| 380 | 3300025981 | Ga0207640_12038871 | Ga0207640_120388711 | 140 |
| 381 | 3300025986 | Ga0207658_11174395 | Ga0207658_111743952 | 140 |
| 382 | 3300026023 | Ga0207677_10245656 | Ga0207677_102456561 | 140 |
| 383 | 3300026023 | Ga0207677_10273867 | Ga0207677_102738672 | 140 |
| 384 | 3300026023 | Ga0207677_10951401 | Ga0207677_109514012 | 140 |
| 385 | 3300026023 | Ga0207677_11699758 | Ga0207677_116997581 | 140 |
| 386 | 3300026035 | Ga0207703_10261252 | Ga0207703_102612522 | 140 |
| 387 | 3300026035 | Ga0207703_10529254 | Ga0207703_105292542 | 140 |
| 388 | 3300026041 | Ga0207639_10010321 | Ga0207639_100103213 | 140 |
| 389 | 3300026041 | Ga0207639_10015553 | Ga0207639_100155532 | 140 |
| 390 | 3300026041 | Ga0207639_10210219 | Ga0207639_102102192 | 140 |
| 391 | 3300026041 | Ga0207639_11029158 | Ga0207639_110291582 | 140 |
| 392 | 3300026067 | Ga0207678_10154400 | Ga0207678_101544002 | 140 |
| 393 | 3300026067 | Ga0207678_10200320 | Ga0207678_102003202 | 140 |
| 394 | 3300026075 | Ga0207708_10645277 | Ga0207708_106452771 | 140 |
| 395 | 3300026078 | Ga0207702_10189328 | Ga0207702_101893281 | 140 |
| 396 | 3300026078 | Ga0207702_10237444 | Ga0207702_102374442 | 140 |
| 397 | 3300026078 | Ga0207702_10439001 | Ga0207702_104390011 | 140 |
| 398 | 3300026095 | Ga0207676_10357734 | Ga0207676_103577342 | 140 |
| 399 | 3300026095 | Ga0207676_11179140 | Ga0207676_111791402 | 140 |
| 400 | 3300026116 | Ga0207674_10081921 | Ga0207674_100819211 | 140 |
| 401 | 3300026116 | Ga0207674_10118233 | Ga0207674_101182335 | 140 |
| 402 | 3300026116 | Ga0207674_11114418 | Ga0207674_111144181 | 140 |
| 403 | 3300026116 | Ga0207674_11877331 | Ga0207674_118773312 | 140 |
| 404 | 3300026118 | Ga0207675_100011142 | Ga0207675_1000111424 | 140 |
| 405 | 3300026121 | Ga0207683_10012229 | Ga0207683_100122295 | 140 |
| 406 | 3300026121 | Ga0207683_10036383 | Ga0207683_100363835 | 140 |
| 407 | 3300026121 | Ga0207683_10081825 | Ga0207683_100818252 | 140 |
| 408 | 3300026121 | Ga0207683_10429533 | Ga0207683_104295331 | 140 |
| 409 | 3300026142 | Ga0207698_10034727 | Ga0207698_100347272 | 140 |
| 410 | 3300026142 | Ga0207698_10656215 | Ga0207698_106562152 | 140 |
| 411 | 3300027364 | Ga0209967_1057317 | Ga0209967_10573171 | 140 |
| 412 | 3300027876 | Ga0209974_10063155 | Ga0209974_100631552 | 140 |
| 413 | 3300028379 | Ga0268266_10000255 | Ga0268266_1000025556 | 140 |
| 414 | 3300028379 | Ga0268266_10004374 | Ga0268266_1000437415 | 140 |
| 415 | 3300028379 | Ga0268266_10092631 | Ga0268266_100926313 | 140 |
| 416 | 3300028379 | Ga0268266_10196407 | Ga0268266_101964072 | 140 |
| 417 | 3300028379 | Ga0268266_10239319 | Ga0268266_102393192 | 140 |
| 418 | 3300028379 | Ga0268266_11441368 | Ga0268266_114413681 | 140 |
| 419 | 3300028379 | Ga0268266_12246922 | Ga0268266_122469221 | 140 |
| 420 | 3300028380 | Ga0268265_10383593 | Ga0268265_103835933 | 140 |
| 421 | 3300028380 | Ga0268265_10478858 | Ga0268265_104788582 | 140 |
| 422 | 3300028380 | Ga0268265_10537970 | Ga0268265_105379701 | 140 |
| 423 | 3300028380 | Ga0268265_11192389 | Ga0268265_111923892 | 140 |
| 424 | 3300028381 | Ga0268264_10002617 | Ga0268264_100026178 | 140 |
| 425 | 3300028381 | Ga0268264_10053068 | Ga0268264_100530685 | 140 |
| 426 | 3300028381 | Ga0268264_10513500 | Ga0268264_105135002 | 140 |
| 427 | 3300028577 | Ga0265318_10298392 | Ga0265318_102983921 | 140 |
| 428 | 3300028800 | Ga0265338_10000005 | Ga0265338_1000000539 | 140 |
| 429 | 3300028800 | Ga0265338_10011268 | Ga0265338_100112684 | 140 |
| 430 | 3300028800 | Ga0265338_10097883 | Ga0265338_100978832 | 140 |
| 431 | 3300028800 | Ga0265338_10293608 | Ga0265338_102936081 | 140 |
| 432 | 3300029957 | Ga0265324_10152468 | Ga0265324_101524682 | 140 |
| 433 | 3300031235 | Ga0265330_10118365 | Ga0265330_101183652 | 140 |
| 434 | 3300031238 | Ga0265332_10015915 | Ga0265332_100159153 | 140 |
| 435 | 3300031238 | Ga0265332_10025815 | Ga0265332_100258152 | 140 |
| 436 | 3300031238 | Ga0265332_10266006 | Ga0265332_102660061 | 140 |
| 437 | 3300031238 | Ga0265332_10343907 | Ga0265332_103439071 | 140 |
| 438 | 3300031239 | Ga0265328_10204374 | Ga0265328_102043742 | 140 |
| 439 | 3300031240 | Ga0265320_10001181 | Ga0265320_100011818 | 140 |
| 440 | 3300031241 | Ga0265325_10000010 | Ga0265325_10000010145 | 140 |
| 441 | 3300031241 | Ga0265325_10058000 | Ga0265325_100580003 | 140 |
| 442 | 3300031241 | Ga0265325_10204386 | Ga0265325_102043862 | 140 |
| 443 | 3300031247 | Ga0265340_10010366 | Ga0265340_100103667 | 140 |
| 444 | 3300031247 | Ga0265340_10065981 | Ga0265340_100659811 | 140 |
| 445 | 3300031249 | Ga0265339_10000373 | Ga0265339_1000037330 | 140 |
| 446 | 3300031249 | Ga0265339_10084492 | Ga0265339_100844922 | 140 |
| 447 | 3300031250 | Ga0265331_10009117 | Ga0265331_100091175 | 140 |
| 448 | 3300031250 | Ga0265331_10018151 | Ga0265331_100181513 | 140 |
| 449 | 3300031344 | Ga0265316_10075465 | Ga0265316_100754653 | 140 |
| 450 | 3300031344 | Ga0265316_10435102 | Ga0265316_104351021 | 140 |
| 451 | 3300031344 | Ga0265316_10666866 | Ga0265316_106668662 | 140 |
| 452 | 3300031456 | Ga0307513_10334202 | Ga0307513_103342022 | 140 |
| 453 | 3300031456 | Ga0307513_10401987 | Ga0307513_104019872 | 140 |
| 454 | 3300031456 | Ga0307513_10450900 | Ga0307513_104509002 | 140 |
| 455 | 3300031548 | Ga0307408_100013197 | Ga0307408_1000131974 | 140 |
| 456 | 3300031548 | Ga0307408_101326995 | Ga0307408_1013269951 | 140 |
| 457 | 3300031595 | Ga0265313_10000061 | Ga0265313_1000006150 | 140 |
| 458 | 3300031595 | Ga0265313_10000828 | Ga0265313_1000082830 | 140 |
| 459 | 3300031595 | Ga0265313_10028345 | Ga0265313_100283452 | 140 |
| 460 | 3300031616 | Ga0307508_10327649 | Ga0307508_103276491 | 140 |
| 461 | 3300031665 | Ga0316575_10184397 | Ga0316575_101843971 | 140 |
| 462 | 3300031711 | Ga0265314_10009980 | Ga0265314_100099804 | 140 |
| 463 | 3300031711 | Ga0265314_10038094 | Ga0265314_100380942 | 140 |
| 464 | 3300031711 | Ga0265314_10049498 | Ga0265314_100494982 | 140 |
| 465 | 3300031712 | Ga0265342_10053041 | Ga0265342_100530412 | 140 |
| 466 | 3300031727 | Ga0316576_10085879 | Ga0316576_100858792 | 140 |
| 467 | 3300031727 | Ga0316576_10151481 | Ga0316576_101514812 | 140 |
| 468 | 3300031728 | Ga0316578_10013246 | Ga0316578_100132465 | 140 |
| 469 | 3300031731 | Ga0307405_10060563 | Ga0307405_100605632 | 140 |
| 470 | 3300031731 | Ga0307405_10179371 | Ga0307405_101793713 | 140 |
| 471 | 3300031731 | Ga0307405_10357061 | Ga0307405_103570611 | 140 |
| 472 | 3300031731 | Ga0307405_10673941 | Ga0307405_106739412 | 140 |
| 473 | 3300031731 | Ga0307405_10905464 | Ga0307405_109054642 | 140 |
| 474 | 3300031824 | Ga0307413_11591256 | Ga0307413_115912561 | 140 |
| 475 | 3300031824 | Ga0307413_12139944 | Ga0307413_121399441 | 140 |
| 476 | 3300031901 | Ga0307406_10032811 | Ga0307406_100328114 | 140 |
| 477 | 3300031901 | Ga0307406_10319090 | Ga0307406_103190903 | 140 |
| 478 | 3300031901 | Ga0307406_10636970 | Ga0307406_106369701 | 140 |
| 479 | 3300031901 | Ga0307406_11955506 | Ga0307406_119555061 | 140 |
| 480 | 3300031911 | Ga0307412_10049726 | Ga0307412_100497263 | 140 |
| 481 | 3300031911 | Ga0307412_10083369 | Ga0307412_100833692 | 140 |
| 482 | 3300031911 | Ga0307412_10396299 | Ga0307412_103962992 | 140 |
| 483 | 3300031911 | Ga0307412_10502805 | Ga0307412_105028052 | 140 |
| 484 | 3300031911 | Ga0307412_11362387 | Ga0307412_113623871 | 140 |
| 485 | 3300031911 | Ga0307412_12216913 | Ga0307412_122169131 | 140 |
| 486 | 3300031995 | Ga0307409_100555221 | Ga0307409_1005552211 | 140 |
| 487 | 3300032002 | Ga0307416_100083043 | Ga0307416_1000830434 | 140 |
| 488 | 3300032002 | Ga0307416_100132367 | Ga0307416_1001323674 | 140 |
| 489 | 3300032002 | Ga0307416_100597755 | Ga0307416_1005977554 | 140 |
| 490 | 3300032002 | Ga0307416_100974942 | Ga0307416_1009749422 | 140 |
| 491 | 3300032004 | Ga0307414_10225921 | Ga0307414_102259211 | 140 |
| 492 | 3300032004 | Ga0307414_10357003 | Ga0307414_103570033 | 140 |
| 493 | 3300032004 | Ga0307414_10395749 | Ga0307414_103957491 | 140 |
| 494 | 3300032004 | Ga0307414_10846754 | Ga0307414_108467541 | 140 |
| 495 | 3300032005 | Ga0307411_11027870 | Ga0307411_110278701 | 140 |
| 496 | 3300032126 | Ga0307415_101269848 | Ga0307415_1012698481 | 140 |
| 497 | 3300032168 | Ga0316593_10000847 | Ga0316593_100008479 | 140 |
| 498 | 3300033180 | Ga0307510_10145191 | Ga0307510_101451912 | 140 |
| 499 | 3300034817 | Ga0373948_0086003 | Ga0373948_0086003_54_476 | 140 |
| 500 | 3300035085 | Ga0373929_0188114 | Ga0373929_0188114_50_472 | 140 |
| 501 | 3300035088 | Ga0373940_0334055 | Ga0373940_0334055_16_438 | 140 |
| 502 | 3300035088 | Ga0373940_0356208 | Ga0373940_0356208_33_455 | 140 |
| 503 | 3300035089 | Ga0373944_0109144 | Ga0373944_0109144_333_755 | 140 |
| 504 | 3300035091 | Ga0373951_0198404 | Ga0373951_0198404_12_434 | 140 |
| 505 | 3300035091 | Ga0373951_0222829 | Ga0373951_0222829_51_473 | 140 |
| 506 | 3300035114 | Ga0373939_0064762 | Ga0373939_0064762_496_918 | 140 |
| 507 | 3300035114 | Ga0373939_0122979 | Ga0373939_0122979_45_467 | 140 |
| 508 | 3300035115 | Ga0373941_0146263 | Ga0373941_0146263_120_542 | 140 |
| 509 | 3300035119 | Ga0373956_0450836 | Ga0373956_0450836_38_460 | 140 |
| 510 | 3300035119 | Ga0373956_0559276 | Ga0373956_0559276_68_490 | 140 |
| 511 | 3300035171 | Ga0373946_0093729 | Ga0373946_0093729_25_447 | 140 |
| 512 | 3300035171 | Ga0373946_0374259 | Ga0373946_0374259_278_700 | 140 |
| 513 | 3300035207 | Ga0373942_0022446 | Ga0373942_0022446_472_894 | 140 |
| 514 | 3300035398 | Ga0316574_0172536 | Ga0316574_0172536_235_657 | 140 |
| 515 | 3300035398 | Ga0316574_0614307 | Ga0316574_0614307_167_589 | 140 |
| 516 | 3300035410 | Ga0373924_0223198 | Ga0373924_0223198_377_799 | 140 |
| 517 | 3300035691 | Ga0373931_0041082 | Ga0373931_0041082_649_1071 | 140 |
| 518 | 3300035691 | Ga0373931_0257423 | Ga0373931_0257423_221_649 | 140 |
| 519 | 3300035692 | Ga0373935_1007584 | Ga0373935_1007584_170_592 | 140 |
| 520 | 3300035695 | Ga0373927_0236199 | Ga0373927_0236199_540_962 | 140 |
| 521 | 3300035724 | Ga0373933_0564622 | Ga0373933_0564622_36_473 | 140 |
| 522 | 3300035725 | Ga0373947_0416397 | Ga0373947_0416397_17_439 | 140 |
| 523 | 3300036401 | Ga0373937_0210435 | Ga0373937_0210435_769_1191 | 140 |
| 524 | 3300036401 | Ga0373937_0670668 | Ga0373937_0670668_144_566 | 140 |
| 525 | 3300036401 | Ga0373937_1282315 | Ga0373937_1282315_175_597 | 140 |
| 526 | 3300036647 | Ga0316582_0003393 | Ga0316582_0003393_4305_4736 | 140 |
| 527 | 3300036647 | Ga0316582_0115891 | Ga0316582_0115891_40_471 | 140 |
| 528 | 3300036647 | Ga0316582_1015016 | Ga0316582_1015016_18_446 | 140 |
| 529 | 3300036712 | Ga0316584_0020971 | Ga0316584_0020971_2241_2663 | 140 |
| 530 | 3300036712 | Ga0316584_0247088 | Ga0316584_0247088_476_907 | 140 |
| 531 | 3300036712 | Ga0316584_0355146 | Ga0316584_0355146_57_479 | 140 |
| 532 | 3300037068 | Ga0373925_0395997 | Ga0373925_0395997_510_932 | 140 |
| 533 | 3300037312 | Ga0395899_0026647 | Ga0395899_0026647_1786_2379 | 140 |
| 534 | 3300037312 | Ga0395899_0035389 | Ga0395899_0035389_3111_3533 | 140 |
| 535 | 3300037312 | Ga0395899_0097318 | Ga0395899_0097318_1179_1601 | 140 |
| 536 | 3300037312 | Ga0395899_0104340 | Ga0395899_0104340_1398_1820 | 140 |
| 537 | 3300037418 | Ga0395900_0034816 | Ga0395900_0034816_3829_4251 | 140 |
| 538 | 3300037418 | Ga0395900_0045605 | Ga0395900_0045605_2963_3385 | 140 |
| 539 | 3300037418 | Ga0395900_0305576 | Ga0395900_0305576_1093_1515 | 140 |
| 540 | 3300037418 | Ga0395900_0461224 | Ga0395900_0461224_527_949 | 140 |
| 541 | 3300037418 | Ga0395900_0753309 | Ga0395900_0753309_449_871 | 140 |
| 542 | 3300037466 | Ga0395898_0210121 | Ga0395898_0210121_64_486 | 140 |
| 543 | 3300037853 | Ga0436364_0264635 | Ga0436364_0264635_426_848 | 140 |
| 544 | 3300037853 | Ga0436364_1059469 | Ga0436364_1059469_610_1032 | 140 |
| 545 | 3300037853 | Ga0436364_1079956 | Ga0436364_1079956_33149_33571 | 140 |
| 546 | 3300038443 | Ga0395901_0005738 | Ga0395901_0005738_397_819 | 140 |
| 547 | 3300038443 | Ga0395901_0015570 | Ga0395901_0015570_4763_5185 | 140 |
| 548 | 3300038443 | Ga0395901_0107493 | Ga0395901_0107493_383_805 | 140 |
| 549 | 3300038443 | Ga0395901_0377066 | Ga0395901_0377066_218_640 | 140 |
| 550 | 3300038742 | Ga0400486_27314 | Ga0400486_27314_872_1294 | 140 |
| 551 | 3300039062 | Ga0400483_016015 | Ga0400483_016015_18_440 | 140 |
| 552 | 3300039062 | Ga0400483_086626 | Ga0400483_086626_192_623 | 140 |
| 553 | 3300039062 | Ga0400483_193353 | Ga0400483_193353_2226_2657 | 140 |
| 554 | 3300039110 | Ga0400487_30510 | Ga0400487_30510_851_1273 | 140 |
| 555 | 3300039437 | Ga0436365_0974653 | Ga0436365_0974653_1407_1829 | 140 |
| 556 | 3300039437 | Ga0436365_1018356 | Ga0436365_1018356_73_495 | 140 |
| 557 | 3300039437 | Ga0436365_1215130 | Ga0436365_1215130_33035_33457 | 140 |
| 558 | 3300039437 | Ga0436365_1575237 | Ga0436365_1575237_178_600 | 140 |
| 559 | 3300039438 | Ga0436360_0206959 | Ga0436360_0206959_67_489 | 140 |
| 560 | 3300039438 | Ga0436360_0218419 | Ga0436360_0218419_170_592 | 140 |
| 561 | 3300039438 | Ga0436360_0317148 | Ga0436360_0317148_430_852 | 140 |
| 562 | 3300039438 | Ga0436360_0393048 | Ga0436360_0393048_33_455 | 140 |
| 563 | 3300039438 | Ga0436360_0505912 | Ga0436360_0505912_732_1160 | 140 |
| 564 | 3300039438 | Ga0436360_0560103 | Ga0436360_0560103_266_688 | 140 |
| 565 | 3300039438 | Ga0436360_0580300 | Ga0436360_0580300_53_478 | 140 |
| 566 | 3300039438 | Ga0436360_0878555 | Ga0436360_0878555_184_612 | 140 |
| 567 | 3300039438 | Ga0436360_1095219 | Ga0436360_1095219_243_665 | 140 |
| 568 | 3300039447 | Ga0436361_0106955 | Ga0436361_0106955_187_615 | 140 |
| 569 | 3300039447 | Ga0436361_0134909 | Ga0436361_0134909_6437_6859 | 140 |
| 570 | 3300039447 | Ga0436361_0138415 | Ga0436361_0138415_204_626 | 140 |
| 571 | 3300039447 | Ga0436361_0256903 | Ga0436361_0256903_822_1244 | 140 |
| 572 | 3300039447 | Ga0436361_0346208 | Ga0436361_0346208_1638_2060 | 140 |
| 573 | 3300039447 | Ga0436361_0467613 | Ga0436361_0467613_1039_1461 | 140 |
| 574 | 3300039447 | Ga0436361_0487620 | Ga0436361_0487620_41_463 | 140 |
| 575 | 3300039447 | Ga0436361_0549993 | Ga0436361_0549993_94_516 | 140 |
| 576 | 3300039447 | Ga0436361_0599707 | Ga0436361_0599707_44_466 | 140 |
| 577 | 3300039447 | Ga0436361_0745675 | Ga0436361_0745675_2725_3147 | 140 |
| 578 | 3300039447 | Ga0436361_0793900 | Ga0436361_0793900_642_1064 | 140 |
| 579 | 3300039447 | Ga0436361_1011398 | Ga0436361_1011398_194_616 | 140 |
| 580 | 3300039450 | Ga0436363_0680414 | Ga0436363_0680414_1327_1755 | 140 |
| 581 | 3300039450 | Ga0436363_0974827 | Ga0436363_0974827_161_583 | 140 |
| 582 | 3300039453 | Ga0436362_0094317 | Ga0436362_0094317_33035_33457 | 140 |
| 583 | 3300039453 | Ga0436362_0314308 | Ga0436362_0314308_10_432 | 140 |
| 584 | 3300039453 | Ga0436362_0483970 | Ga0436362_0483970_106_528 | 140 |
| 585 | 3300039453 | Ga0436362_0666367 | Ga0436362_0666367_587_1015 | 140 |
| 586 | 3300041411 | Ga0439466_0100923 | Ga0439466_0100923_392_814 | 140 |
| 587 | 3300041413 | Ga0439465_0041838 | Ga0439465_0041838_444_866 | 140 |
| 588 | 3300041413 | Ga0439465_0069318 | Ga0439465_0069318_135_557 | 140 |
| 589 | 3300041452 | Ga0451793_1667793 | Ga0451793_1667793_202_624 | 140 |
| 590 | 3300041460 | Ga0451802_0135419 | Ga0451802_0135419_54_476 | 140 |
| 591 | 3300041463 | Ga0451804_0787161 | Ga0451804_0787161_175_597 | 140 |
| 592 | 3300041509 | Ga0451843_0179471 | Ga0451843_0179471_21_443 | 140 |
| 593 | 3300042001 | Ga0439441_031129 | Ga0439441_031129_466_888 | 140 |
| 594 | 3300042002 | Ga0439442_048632 | Ga0439442_048632_133_555 | 140 |
| 595 | 3300042004 | Ga0439445_0040567 | Ga0439445_0040567_787_1209 | 140 |
| 596 | 3300042004 | Ga0439445_0091446 | Ga0439445_0091446_382_804 | 140 |
| 597 | 3300042010 | Ga0439452_123423 | Ga0439452_123423_116_538 | 140 |
| 598 | 3300042013 | Ga0439456_122885 | Ga0439456_122885_34_456 | 140 |
| 599 | 3300042876 | Ga0451577_0000124 | Ga0451577_0000124_118702_119139 | 140 |
| 600 | 3300042876 | Ga0451577_0001018 | Ga0451577_0001018_17913_18359 | 140 |
| 601 | 3300042876 | Ga0451577_0106914 | Ga0451577_0106914_424_846 | 140 |
| 602 | 3300042876 | Ga0451577_0176617 | Ga0451577_0176617_670_1092 | 140 |
| 603 | 3300042876 | Ga0451577_0181870 | Ga0451577_0181870_79_501 | 140 |
| 604 | 3300042876 | Ga0451577_0224830 | Ga0451577_0224830_590_1012 | 140 |
| 605 | 3300044683 | Ga0466965_0105634 | Ga0466965_0105634_116_538 | 140 |
| 606 | 3300044712 | Ga0453684_0000015 | Ga0453684_0000015_140295_140717 | 140 |
| 607 | 3300044712 | Ga0453684_0000020 | Ga0453684_0000020_141294_141716 | 140 |
| 608 | 3300044712 | Ga0453684_0000239 | Ga0453684_0000239_185822_186259 | 140 |
| 609 | 3300044712 | Ga0453684_0000498 | Ga0453684_0000498_88539_88985 | 140 |
| 610 | 3300044712 | Ga0453684_0022198 | Ga0453684_0022198_4778_5200 | 140 |
| 611 | 3300044712 | Ga0453684_0026561 | Ga0453684_0026561_1603_2025 | 140 |
| 612 | 3300044712 | Ga0453684_0101448 | Ga0453684_0101448_2636_3157 | 140 |
| 613 | 3300044842 | Ga0466957_0884459 | Ga0466957_0884459_174_596 | 140 |
| 614 | 3300045051 | Ga0451576_0000040 | Ga0451576_0000040_254046_254468 | 140 |
| 615 | 3300045051 | Ga0451576_0001132 | Ga0451576_0001132_43335_43757 | 140 |
| 616 | 3300045051 | Ga0451576_0050028 | Ga0451576_0050028_1540_1962 | 140 |
| 617 | 3300045051 | Ga0451576_0058213 | Ga0451576_0058213_1726_2148 | 140 |
| 618 | 3300045051 | Ga0451576_0443241 | Ga0451576_0443241_31_453 | 140 |
| 619 | 3300045051 | Ga0451576_0557249 | Ga0451576_0557249_91_528 | 140 |
| 620 | 3300045051 | Ga0451576_1683978 | Ga0451576_1683978_178_600 | 140 |
| 621 | 3300046460 | Ga0495638_0003562 | Ga0495638_0003562_1893_2324 | 140 |
| 622 | 3300046462 | Ga0495651_0141560 | Ga0495651_0141560_968_1390 | 140 |
| 623 | 3300046472 | Ga0495580_0244175 | Ga0495580_0244175_265_687 | 140 |
| 624 | 3300046472 | Ga0495580_0771354 | Ga0495580_0771354_21_443 | 140 |
| 625 | 3300046473 | Ga0495582_0266015 | Ga0495582_0266015_58_480 | 140 |
| 626 | 3300046491 | Ga0495584_0273656 | Ga0495584_0273656_247_669 | 140 |
| 627 | 3300046506 | Ga0495583_0192270 | Ga0495583_0192270_168_590 | 140 |
| 628 | 3300046507 | Ga0495606_0195158 | Ga0495606_0195158_30_452 | 140 |
| 629 | 3300046516 | Ga0495628_0077221 | Ga0495628_0077221_1813_2235 | 140 |
| 630 | 3300046516 | Ga0495628_0395705 | Ga0495628_0395705_130_552 | 140 |
| 631 | 3300046522 | Ga0495643_0031204 | Ga0495643_0031204_1619_2041 | 140 |
| 632 | 3300046524 | Ga0495648_0151786 | Ga0495648_0151786_615_1037 | 140 |
| 633 | 3300046537 | Ga0495598_0223787 | Ga0495598_0223787_162_584 | 140 |
| 634 | 3300046538 | Ga0495609_0068453 | Ga0495609_0068453_263_685 | 140 |
| 635 | 3300046542 | Ga0495597_0057804 | Ga0495597_0057804_1176_1598 | 140 |
| 636 | 3300046543 | Ga0495645_0502817 | Ga0495645_0502817_70_492 | 140 |
| 637 | 3300046543 | Ga0495645_0674327 | Ga0495645_0674327_23_445 | 140 |
| 638 | 3300046615 | Ga0495656_0610184 | Ga0495656_0610184_150_572 | 140 |
| 639 | 3300046660 | Ga0495625_0003057 | Ga0495625_0003057_7313_7744 | 140 |
| 640 | 3300046665 | Ga0495661_0237856 | Ga0495661_0237856_459_881 | 140 |
| 641 | 3300046679 | Ga0495623_0215131 | Ga0495623_0215131_603_1025 | 140 |
| 642 | 3300046684 | Ga0495669_0112184 | Ga0495669_0112184_797_1219 | 140 |
| 643 | 3300046684 | Ga0495669_0266778 | Ga0495669_0266778_213_635 | 140 |
| 644 | 3300046691 | Ga0495670_0413751 | Ga0495670_0413751_222_644 | 140 |
| 645 | 3300046694 | Ga0495649_0266017 | Ga0495649_0266017_129_551 | 140 |
| 646 | 3300046794 | Ga0495589_0084446 | Ga0495589_0084446_53_475 | 140 |
| 647 | 3300047318 | Ga0495636_0148726 | Ga0495636_0148726_443_865 | 140 |
| 648 | 3300047321 | Ga0495676_0347164 | Ga0495676_0347164_186_608 | 140 |
| 649 | 3300047322 | Ga0495680_0036126 | Ga0495680_0036126_3502_3924 | 140 |
| 650 | 3300047444 | Ga0495675_0248569 | Ga0495675_0248569_19_441 | 140 |
| 651 | 3300047472 | Ga0495686_0278534 | Ga0495686_0278534_412_834 | 140 |
| 652 | 3300048088 | Ga0495602_0692626 | Ga0495602_0692626_14_436 | 140 |
| 653 | 3300048905 | Ga0496102_0183568 | Ga0496102_0183568_244_666 | 140 |
| 654 | 3300048905 | Ga0496102_1267607 | Ga0496102_1267607_52_480 | 140 |
| 655 | 3300048913 | Ga0496110_1513745 | Ga0496110_1513745_53_475 | 140 |
| 656 | 3300048915 | Ga0496112_0322988 | Ga0496112_0322988_746_1168 | 140 |
| 657 | 3300048919 | Ga0496116_0292029 | Ga0496116_0292029_246_668 | 140 |
| 658 | 3300048920 | Ga0496117_0024717 | Ga0496117_0024717_3869_4291 | 140 |
| 659 | 3300048921 | Ga0496118_0001677 | Ga0496118_0001677_18515_18937 | 140 |
| 660 | 3300048921 | Ga0496118_0269869 | Ga0496118_0269869_507_938 | 140 |
| 661 | 3300048924 | Ga0496121_0038766 | Ga0496121_0038766_131_562 | 140 |
| 662 | 3300048927 | Ga0496124_0325192 | Ga0496124_0325192_165_587 | 140 |
| 663 | 3300048928 | Ga0496125_0001281 | Ga0496125_0001281_23224_23646 | 140 |
| 664 | 3300048928 | Ga0496125_0458667 | Ga0496125_0458667_95_517 | 140 |
| 665 | 3300048929 | Ga0496126_0069667 | Ga0496126_0069667_2188_2610 | 140 |
| 666 | 3300048929 | Ga0496126_0217471 | Ga0496126_0217471_573_995 | 140 |
| 667 | 3300049513 | Ga0501290_015074 | Ga0501290_015074_132_554 | 140 |
| 668 | 3300049522 | Ga0501299_051601 | Ga0501299_051601_351_773 | 140 |
| 669 | 3300049523 | Ga0501300_042680 | Ga0501300_042680_160_582 | 140 |
| 670 | 3300049536 | Ga0501320_072924 | Ga0501320_072924_61_483 | 140 |
| 671 | 3300049552 | Ga0501336_028113 | Ga0501336_028113_13_435 | 140 |
| 672 | 3300049568 | Ga0501031_0608688 | Ga0501031_0608688_132_554 | 140 |
| 673 | 3300049568 | Ga0501031_0964382 | Ga0501031_0964382_43_465 | 140 |
| 674 | 3300049570 | Ga0501033_0185278 | Ga0501033_0185278_864_1286 | 140 |
| 675 | 3300049570 | Ga0501033_0296937 | Ga0501033_0296937_468_890 | 140 |
| 676 | 3300049571 | Ga0501034_0000189 | Ga0501034_0000189_43028_43450 | 140 |
| 677 | 3300049571 | Ga0501034_0001822 | Ga0501034_0001822_20630_21052 | 140 |
| 678 | 3300049571 | Ga0501034_0037129 | Ga0501034_0037129_3277_3699 | 140 |
| 679 | 3300049571 | Ga0501034_0284733 | Ga0501034_0284733_745_1167 | 140 |
| 680 | 3300049571 | Ga0501034_0339121 | Ga0501034_0339121_630_1052 | 140 |
| 681 | 3300049571 | Ga0501034_0503699 | Ga0501034_0503699_188_610 | 140 |
| 682 | 3300049571 | Ga0501034_0836273 | Ga0501034_0836273_296_718 | 140 |
| 683 | 3300049571 | Ga0501034_0838718 | Ga0501034_0838718_108_530 | 140 |
| 684 | 3300049571 | Ga0501034_0887223 | Ga0501034_0887223_192_614 | 140 |
| 685 | 3300049571 | Ga0501034_0929161 | Ga0501034_0929161_268_690 | 140 |
| 686 | 3300049572 | Ga0501036_0538567 | Ga0501036_0538567_511_933 | 140 |
| 687 | 3300049573 | Ga0501037_0197960 | Ga0501037_0197960_325_747 | 140 |
| 688 | 3300049573 | Ga0501037_0367776 | Ga0501037_0367776_510_932 | 140 |
| 689 | 3300049573 | Ga0501037_0412379 | Ga0501037_0412379_339_761 | 140 |
| 690 | 3300049573 | Ga0501037_0527697 | Ga0501037_0527697_327_749 | 140 |
| 691 | 3300049574 | Ga0501038_0111292 | Ga0501038_0111292_1647_2069 | 140 |
| 692 | 3300049574 | Ga0501038_0259626 | Ga0501038_0259626_162_584 | 140 |
| 693 | 3300049578 | Ga0501042_0038384 | Ga0501042_0038384_2914_3336 | 140 |
| 694 | 3300049578 | Ga0501042_0309300 | Ga0501042_0309300_388_810 | 140 |
| 695 | 3300049579 | Ga0501043_0207612 | Ga0501043_0207612_975_1397 | 140 |
| 696 | 3300049579 | Ga0501043_0215268 | Ga0501043_0215268_641_1063 | 140 |
| 697 | 3300049579 | Ga0501043_0513601 | Ga0501043_0513601_336_758 | 140 |
| 698 | 3300049579 | Ga0501043_0954139 | Ga0501043_0954139_95_517 | 140 |
| 699 | 3300049580 | Ga0501046_0241279 | Ga0501046_0241279_837_1259 | 140 |
| 700 | 3300049581 | Ga0501047_0003852 | Ga0501047_0003852_9272_9706 | 140 |
| 701 | 3300049581 | Ga0501047_0125160 | Ga0501047_0125160_1828_2250 | 140 |
| 702 | 3300049581 | Ga0501047_0247897 | Ga0501047_0247897_427_849 | 140 |
| 703 | 3300049581 | Ga0501047_0746459 | Ga0501047_0746459_350_772 | 140 |
| 704 | 3300049581 | Ga0501047_0761417 | Ga0501047_0761417_315_737 | 140 |
| 705 | 3300049581 | Ga0501047_0902108 | Ga0501047_0902108_241_663 | 140 |
| 706 | 3300049582 | Ga0501048_0371991 | Ga0501048_0371991_364_798 | 140 |
| 707 | 3300049582 | Ga0501048_1148095 | Ga0501048_1148095_76_498 | 140 |
| 708 | 3300049583 | Ga0501067_0002093 | Ga0501067_0002093_6629_7051 | 140 |
| 709 | 3300049583 | Ga0501067_0104456 | Ga0501067_0104456_46_468 | 140 |
| 710 | 3300049584 | Ga0501068_0271378 | Ga0501068_0271378_241_663 | 140 |
| 711 | 3300049584 | Ga0501068_0387862 | Ga0501068_0387862_76_498 | 140 |
| 712 | 3300049586 | Ga0501070_0035746 | Ga0501070_0035746_288_710 | 140 |
| 713 | 3300049586 | Ga0501070_0169440 | Ga0501070_0169440_475_909 | 140 |
| 714 | 3300049586 | Ga0501070_0280088 | Ga0501070_0280088_905_1330 | 140 |
| 715 | 3300049586 | Ga0501070_0595941 | Ga0501070_0595941_348_791 | 140 |
| 716 | 3300049587 | Ga0501071_0808129 | Ga0501071_0808129_290_712 | 140 |
| 717 | 3300049587 | Ga0501071_0929740 | Ga0501071_0929740_84_506 | 140 |
| 718 | 3300049588 | Ga0501072_0040168 | Ga0501072_0040168_2805_3239 | 140 |
| 719 | 3300049589 | Ga0501073_0036999 | Ga0501073_0036999_2789_3211 | 140 |
| 720 | 3300049589 | Ga0501073_0137857 | Ga0501073_0137857_219_641 | 140 |
| 721 | 3300049589 | Ga0501073_0138866 | Ga0501073_0138866_799_1221 | 140 |
| 722 | 3300049589 | Ga0501073_0177787 | Ga0501073_0177787_879_1301 | 140 |
| 723 | 3300049590 | Ga0501074_0278611 | Ga0501074_0278611_229_651 | 140 |
| 724 | 3300049591 | Ga0501075_0145696 | Ga0501075_0145696_1106_1540 | 140 |
| 725 | 3300049592 | Ga0501076_0268651 | Ga0501076_0268651_870_1292 | 140 |
| 726 | 3300049592 | Ga0501076_0481890 | Ga0501076_0481890_358_780 | 140 |
| 727 | 3300049663 | Ga0501223_010163 | Ga0501223_010163_1278_1700 | 140 |
| 728 | 3300049686 | Ga0501257_000071 | Ga0501257_000071_5242_5664 | 140 |
| 729 | 3300049741 | Ga0501079_0445387 | Ga0501079_0445387_437_859 | 140 |
| 730 | 3300049741 | Ga0501079_1451850 | Ga0501079_1451850_74_511 | 140 |
| 731 | 3300049742 | Ga0501080_0068191 | Ga0501080_0068191_1672_2094 | 140 |
| 732 | 3300049742 | Ga0501080_0153043 | Ga0501080_0153043_366_788 | 140 |
| 733 | 3300049742 | Ga0501080_0448187 | Ga0501080_0448187_605_1027 | 140 |
| 734 | 3300049742 | Ga0501080_0450733 | Ga0501080_0450733_651_1073 | 140 |
| 735 | 3300049742 | Ga0501080_0702166 | Ga0501080_0702166_130_552 | 140 |
| 736 | 3300049743 | Ga0501081_1212261 | Ga0501081_1212261_49_471 | 140 |
| 737 | 3300049744 | Ga0501083_0101700 | Ga0501083_0101700_305_727 | 140 |
| 738 | 3300049744 | Ga0501083_0184331 | Ga0501083_0184331_531_953 | 140 |
| 739 | 3300049744 | Ga0501083_0435517 | Ga0501083_0435517_363_785 | 140 |
| 740 | 3300049744 | Ga0501083_0961342 | Ga0501083_0961342_39_473 | 140 |
| 741 | 3300049776 | Ga0501280_000241 | Ga0501280_000241_1618_2040 | 140 |
| 742 | 3300049822 | Ga0501035_0018260 | Ga0501035_0018260_3443_3865 | 140 |
| 743 | 3300049822 | Ga0501035_0103180 | Ga0501035_0103180_865_1287 | 140 |
| 744 | 3300049822 | Ga0501035_0365154 | Ga0501035_0365154_468_890 | 140 |
| 745 | 3300049823 | Ga0501044_0010936 | Ga0501044_0010936_3670_4092 | 140 |
| 746 | 3300049823 | Ga0501044_0097655 | Ga0501044_0097655_2449_2892 | 140 |
| 747 | 3300049823 | Ga0501044_0098350 | Ga0501044_0098350_2119_2541 | 140 |
| 748 | 3300049823 | Ga0501044_0295749 | Ga0501044_0295749_474_896 | 140 |
| 749 | 3300049823 | Ga0501044_0319632 | Ga0501044_0319632_676_1098 | 140 |
| 750 | 3300049823 | Ga0501044_0448093 | Ga0501044_0448093_140_574 | 140 |
| 751 | 3300049823 | Ga0501044_0460075 | Ga0501044_0460075_419_841 | 140 |
| 752 | 3300049823 | Ga0501044_0680930 | Ga0501044_0680930_139_561 | 140 |
| 753 | 3300049823 | Ga0501044_1196283 | Ga0501044_1196283_79_501 | 140 |
| 754 | 3300050489 | nmdc:mga03683_13116_c1 | nmdc:mga03683_13116_c1_1157_1579 | 140 |
| 755 | 3300050489 | nmdc:mga03683_36229_c1 | nmdc:mga03683_36229_c1_180_602 | 140 |
| 756 | 3300050490 | nmdc:mga03n38_924791_c1 | nmdc:mga03n38_924791_c1_32_454 | 140 |
| 757 | 3300050492 | nmdc:mga0yw44_117091_c1 | nmdc:mga0yw44_117091_c1_966_1388 | 140 |
| 758 | 3300050492 | nmdc:mga0yw44_506127_c1 | nmdc:mga0yw44_506127_c1_342_764 | 140 |
| 759 | 3300050492 | nmdc:mga0yw44_55454_c1 | nmdc:mga0yw44_55454_c1_113_535 | 140 |
| 760 | 3300050493 | nmdc:mga0k408_184045_c1 | nmdc:mga0k408_184045_c1_357_779 | 140 |
| 761 | 3300050493 | nmdc:mga0k408_232308_c1 | nmdc:mga0k408_232308_c1_163_585 | 140 |
| 762 | 3300050494 | nmdc:mga06z11_14790_c2 | nmdc:mga06z11_14790_c2_1618_2040 | 140 |
| 763 | 3300050494 | nmdc:mga06z11_91957_c1 | nmdc:mga06z11_91957_c1_991_1413 | 140 |
| 764 | 3300050508 | nmdc:mga09592_334936_c1 | nmdc:mga09592_334936_c1_590_1012 | 140 |
| 765 | 3300050508 | nmdc:mga09592_694881_c1 | nmdc:mga09592_694881_c1_201_641 | 140 |
| 766 | 3300050511 | nmdc:mga08y16_1182079_c1 | nmdc:mga08y16_1182079_c1_304_726 | 140 |
| 767 | 3300050513 | nmdc:mga0rr50_495681_c1 | nmdc:mga0rr50_495681_c1_147_584 | 140 |
| 768 | 3300053078 | Ga0495612_0476287 | Ga0495612_0476287_89_511 | 140 |
| 769 | 3300053087 | Ga0500643_000167 | Ga0500643_000167_15427_15849 | 140 |
| 770 | 3300053091 | Ga0500647_0019249 | Ga0500647_0019249_1330_1752 | 140 |
| 771 | 3300053093 | Ga0500651_0011019 | Ga0500651_0011019_1334_1756 | 140 |
| 772 | 3300053093 | Ga0500651_0202100 | Ga0500651_0202100_611_1033 | 140 |
| 773 | 3300053096 | Ga0500641_0001255 | Ga0500641_0001255_6482_6904 | 140 |
| 774 | 3300053098 | Ga0500650_0244184 | Ga0500650_0244184_65_487 | 140 |
| 775 | 3300053116 | Ga0500592_000645 | Ga0500592_000645_449_871 | 140 |
| 776 | 3300053118 | Ga0500594_0010595 | Ga0500594_0010595_1656_2078 | 140 |
| 777 | 3300053120 | Ga0500597_077510 | Ga0500597_077510_567_989 | 140 |
| 778 | 3300053120 | Ga0500597_374149 | Ga0500597_374149_37_459 | 140 |
| 779 | 3300053130 | Ga0500642_0179069 | Ga0500642_0179069_443_865 | 140 |
| 780 | 3300053131 | Ga0500652_000040 | Ga0500652_000040_53127_53549 | 140 |
| 781 | 3300053133 | Ga0500655_000021 | Ga0500655_000021_15265_15687 | 140 |
| 782 | 3300053139 | Ga0500568_0021313 | Ga0500568_0021313_1912_2334 | 140 |
| 783 | 3300053142 | Ga0500577_0075845 | Ga0500577_0075845_833_1255 | 140 |
| 784 | 3300053148 | Ga0500590_093278 | Ga0500590_093278_547_969 | 140 |
| 785 | 3300053154 | Ga0500619_037630 | Ga0500619_037630_79_501 | 140 |
| 786 | 3300053158 | Ga0500627_0000972 | Ga0500627_0000972_4969_5391 | 140 |
| 787 | 3300053177 | Ga0500636_0010464 | Ga0500636_0010464_1753_2175 | 140 |
| 788 | 3300053724 | Ga0500570_002608 | Ga0500570_002608_5092_5514 | 140 |
| 789 | 3300053730 | Ga0500645_066729 | Ga0500645_066729_253_675 | 140 |
| 790 | 3300054114 | Ga0501084_0029187 | Ga0501084_0029187_2269_2691 | 140 |
| 791 | 3300054114 | Ga0501084_0039486 | Ga0501084_0039486_2694_3116 | 140 |
| 792 | 3300054114 | Ga0501084_0444935 | Ga0501084_0444935_89_511 | 140 |
| 793 | 3300054114 | Ga0501084_0907523 | Ga0501084_0907523_289_711 | 140 |
| 794 | 3300054114 | Ga0501084_1310003 | Ga0501084_1310003_74_496 | 140 |
| 795 | 3300060346 | Ga0587111_0171786 | Ga0587111_0171786_73_495 | 140 |
| 796 | 3300060353 | Ga0501082_0016167 | Ga0501082_0016167_2271_2693 | 140 |
| 797 | 3300060353 | Ga0501082_0117985 | Ga0501082_0117985_40_462 | 140 |
| 798 | 3300060353 | Ga0501082_0496623 | Ga0501082_0496623_166_588 | 140 |
| 799 | 3300061734 | Ga0530510_0503986 | Ga0530510_0503986_283_705 | 140 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ay1-assembly5.cif.gz_E | crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori | 0.9932 | 4 | 138 |
| 2nck-assembly1.cif.gz_R | crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution | 0.9926 | 2 | 140 |
| 6ay1-assembly8.cif.gz_H | crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori | 0.9905 | 3 | 138 |
| 5v6d-assembly3.cif.gz_F | crystal structure of nucleoside diphosphate kinase from neisseria gonorrhoeae in complex with citrate | 0.9856 | 1 | 140 |
| 6aes-assembly2.cif.gz_B | crystal structure of nucleoside diphosphate kinase from pseudomonas aeruginosa at 3.55 a resolution. | 0.9851 | 1 | 140 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6Z7E5_29_180_3.30.70.141 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.985 | 3 | 133 | 3.30.70.141 |
| af_A4IG45_154_309_3.30.70.141 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9778 | 3 | 133 | 3.30.70.141 |
| af_C6T4F9_81_235_3.30.70.141 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9752 | 3 | 140 | 3.30.70.141 |
| 4w98A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.974 | 1 | 140 | 3.30.70.141 |
| 3vgvN00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9737 | 2 | 140 | 3.30.70.141 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E3IQ90-F1-model_v4 | Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) | 1.001 | 5 | 140 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |
| AF-A0A382TB58-F1-model_v4 | Nucleoside diphosphate kinase-like domain-containing protein | 1.001 | 4 | 140 |
GO:0004550
GO:0006183 GO:0006228 GO:0006241 |
| AF-A0A2E1TJE2-F1-model_v4 | Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) | 1 | 4 | 133 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |
| AF-A0A7V9YVH0-F1-model_v4 | deleted | 0.9999 | 3 | 140 |
|
| AF-B8GW43-F1-model_v4 | Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) | 0.9994 | 3 | 140 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar