F481341

General Info

Members Datasets Scaffolds Average Seq Length
799 368 799 140

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0101448|Ga0453684_0101448_2636_3157
Length 173
Sequence MGKGDSPTLPGPQPGDITAADTSTVLSTRSIAIMALERTLSIIKPDATRRNLTGKVNARLEEGGLRIVAQKRLQLTTAQAEGFYAVHAERPFFRDLVTFMTSGPVVVQVLEGENAVLRNREIMGATNPANAAAGTIRKDFAESIEANSVHGSDSLENARTEVAYFFSACEIVG

Samples

Sample ID Description Type Environment
1 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
109 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
110 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
115 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
182 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
183 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
184 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
185 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
186 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
187 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
188 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
189 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
190 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
191 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
194 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
195 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
198 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
199 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
209 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
211 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
213 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
214 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
215 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
216 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
217 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
218 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
219 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
220 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
221 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
222 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
223 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
225 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
227 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
228 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
231 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
236 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
239 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
240 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
241 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
242 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
243 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
244 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
245 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
246 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
247 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
248 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
249 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
250 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
251 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
252 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
253 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
254 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
255 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
256 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
257 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
258 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
259 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
260 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
261 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
262 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
263 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
264 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
265 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
266 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
267 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
268 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
269 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
272 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
273 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
274 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
275 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
276 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
277 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
278 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
279 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
280 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
281 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
282 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
283 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
284 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
285 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
286 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
287 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
288 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
289 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
290 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
291 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
292 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
295 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
296 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
297 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
298 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
299 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
300 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
301 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
302 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
303 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
304 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
318 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
319 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
320 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
321 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
322 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
323 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
324 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
325 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
326 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
327 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
328 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
329 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
330 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
331 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
332 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
333 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
334 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
336 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
337 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
338 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
339 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
340 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
341 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
342 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
343 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
344 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
345 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
346 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
347 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
348 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
349 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
350 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
351 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
352 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
353 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
354 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
355 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
356 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
357 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
358 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
359 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
360 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
361 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
362 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
363 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
364 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
365 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
366 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
368 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0.88
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.76
Nodule 0
Rhizoplane 0.88
Rhizosphere 87.61
Stem 0
Stem Tuber 0
Unclassified 4.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065165_1003558 3300005262 Bacteria 10770
2 Ga0065707_10082138 3300005295 Bacteria 21055
3 Ga0070658_10002834 3300005327 Bacteria 14407
4 Ga0070658_10048640 3300005327 Bacteria 3433
5 Ga0070658_10074304 3300005327 Bacteria 2788
6 Ga0070658_11518601 3300005327 Bacteria 581
7 Ga0070683_100166982 3300005329 Bacteria 2088
8 Ga0070683_100245898 3300005329 Bacteria 1701
9 Ga0070683_101039085 3300005329 Bacteria 787
10 Ga0070690_100202829 3300005330 Bacteria 1381
11 Ga0070690_100369722 3300005330 Bacteria 1045
12 Ga0070670_100891014 3300005331 Bacteria 806
13 Ga0068869_101940050 3300005334 Bacteria 528
14 Ga0070666_10322205 3300005335 Bacteria 1103
15 Ga0068868_100172392 3300005338 Bacteria 1791
16 Ga0068868_100438038 3300005338 Bacteria 1134
17 Ga0068868_100816262 3300005338 Bacteria 842
18 Ga0068868_101274936 3300005338 Bacteria 682
19 Ga0070660_100012199 3300005339 Bacteria 6135
20 Ga0070660_100033220 3300005339 Bacteria 3887
21 Ga0070689_100565888 3300005340 Bacteria 981
22 Ga0070691_10615449 3300005341 Bacteria 643
23 Ga0070687_100355430 3300005343 Bacteria 947
24 Ga0070661_100423544 3300005344 Bacteria 1055
25 Ga0070661_100577703 3300005344 Bacteria 907
26 Ga0070661_100640874 3300005344 Bacteria 862
27 Ga0070668_100013728 3300005347 Bacteria 6051
28 Ga0070668_100021015 3300005347 Bacteria 4932
29 Ga0070668_100371585 3300005347 Bacteria 1215
30 Ga0070668_100414259 3300005347 Bacteria 1153
31 Ga0070675_100048611 3300005354 Bacteria 3479
32 Ga0070675_100255186 3300005354 Bacteria 1535
33 Ga0070675_100973261 3300005354 Bacteria 779
34 Ga0070675_101041660 3300005354 Bacteria 752
35 Ga0070675_101272631 3300005354 Bacteria 677
36 Ga0070674_100381483 3300005356 Bacteria 1147
37 Ga0070673_100054087 3300005364 Bacteria 3157
38 Ga0070673_100727102 3300005364 Bacteria 913
39 Ga0070659_100495818 3300005366 Bacteria 1040
40 Ga0070667_100034729 3300005367 Bacteria 4221
41 Ga0070667_100386741 3300005367 Bacteria 1271
42 Ga0070667_100600934 3300005367 Bacteria 1014
43 Ga0070667_101156111 3300005367 Bacteria 724
44 Ga0070709_10033191 3300005434 Bacteria 3119
45 Ga0070714_100182974 3300005435 Bacteria 1908
46 Ga0070713_100370088 3300005436 Bacteria 1333
47 Ga0070713_100520776 3300005436 Bacteria 1124
48 Ga0070710_10264912 3300005437 Bacteria 1109
49 Ga0070710_10301080 3300005437 Bacteria 1046
50 Ga0070711_100000579 3300005439 Bacteria 19103
51 Ga0070711_100906234 3300005439 Bacteria 753
52 Ga0070711_101510616 3300005439 Bacteria 586
53 Ga0070708_100001209 3300005445 Bacteria 19895
54 Ga0070708_101073968 3300005445 Bacteria 754
55 Ga0070663_100145573 3300005455 Bacteria 1813
56 Ga0070678_100111350 3300005456 Bacteria 2142
57 Ga0070681_10133669 3300005458 Bacteria 2412
58 Ga0070681_10138493 3300005458 Bacteria 2363
59 Ga0070681_10887657 3300005458 Bacteria 810
60 Ga0068867_100034276 3300005459 Bacteria 3679
61 Ga0068867_100891518 3300005459 Bacteria 800
62 Ga0070685_10047760 3300005466 Bacteria 2463
63 Ga0070706_100000114 3300005467 Bacteria 98324
64 Ga0070707_100037523 3300005468 Bacteria 4625
65 Ga0070698_100003572 3300005471 Bacteria 17085
66 Ga0070698_100196630 3300005471 Bacteria 1953
67 Ga0070679_100008108 3300005530 Bacteria 9867
68 Ga0070679_100133298 3300005530 Bacteria 2465
69 Ga0070684_100114518 3300005535 Bacteria 2421
70 Ga0070684_100145132 3300005535 Bacteria 2148
71 Ga0070684_100149600 3300005535 Bacteria 2114
72 Ga0070697_100007078 3300005536 Bacteria 8726
73 Ga0070697_100164907 3300005536 Bacteria 1873
74 Ga0068853_100124330 3300005539 Bacteria 2304
75 Ga0068853_100168641 3300005539 Bacteria 1980
76 Ga0068853_100386385 3300005539 Bacteria 1308
77 Ga0068853_100956850 3300005539 Bacteria 824
78 Ga0070672_101098974 3300005543 Bacteria 706
79 Ga0070665_100002027 3300005548 Bacteria 22781
80 Ga0070665_100003577 3300005548 Bacteria 16470
81 Ga0070665_100038937 3300005548 Bacteria 4780
82 Ga0070665_100060814 3300005548 Bacteria 3786
83 Ga0070665_100127146 3300005548 Bacteria 2551
84 Ga0070665_100253694 3300005548 Bacteria 1760
85 Ga0070665_100258566 3300005548 Bacteria 1742
86 Ga0070665_101287906 3300005548 Bacteria 741
87 Ga0070704_100384850 3300005549 Bacteria 1193
88 Ga0068855_100517072 3300005563 Bacteria 1295
89 Ga0068855_101286399 3300005563 Bacteria 757
90 Ga0068855_102163076 3300005563 Bacteria 559
91 Ga0070664_100102651 3300005564 Bacteria 2488
92 Ga0070664_100325916 3300005564 Bacteria 1393
93 Ga0068857_100517918 3300005577 Bacteria 1121
94 Ga0068857_100579002 3300005577 Bacteria 1059
95 Ga0068857_100826386 3300005577 Bacteria 886
96 Ga0068857_100961268 3300005577 Bacteria 821
97 Ga0068857_101216416 3300005577 Bacteria 730
98 Ga0068854_100263146 3300005578 Bacteria 1382
99 Ga0068854_100513327 3300005578 Bacteria 1011
100 Ga0068854_101440975 3300005578 Bacteria 624
101 Ga0068856_100083626 3300005614 Bacteria 3170
102 Ga0068856_100112827 3300005614 Bacteria 2716
103 Ga0068856_100344597 3300005614 Bacteria 1508
104 Ga0068856_100593425 3300005614 Bacteria 1129
105 Ga0068852_100033207 3300005616 Bacteria 4282
106 Ga0068852_100746482 3300005616 Bacteria 991
107 Ga0068864_100149906 3300005618 Bacteria 2112
108 Ga0068864_100174877 3300005618 Bacteria 1959
109 Ga0068864_100562715 3300005618 Bacteria 1103
110 Ga0068866_10223007 3300005718 Bacteria 1138
111 Ga0068861_100002290 3300005719 Bacteria 12425
112 Ga0068851_10549095 3300005834 Bacteria 698
113 Ga0068870_10894200 3300005840 Bacteria 627
114 Ga0068858_100269198 3300005842 Bacteria 1621
115 Ga0068860_100006672 3300005843 Bacteria 11594
116 Ga0068860_100010477 3300005843 Bacteria 9163
117 Ga0068860_100201562 3300005843 Bacteria 1928
118 Ga0068860_100492781 3300005843 Bacteria 1223
119 Ga0068862_100069735 3300005844 Bacteria 3034
120 Ga0068862_100376521 3300005844 Bacteria 1323
121 Ga0081455_10000806 3300005937 Bacteria 40338
122 Ga0081455_10117215 3300005937 Bacteria 2105
123 Ga0081455_10203403 3300005937 Bacteria 1481
124 Ga0081455_10256957 3300005937 Bacteria 1274
125 Ga0081540_1004991 3300005983 Bacteria 9974
126 Ga0081540_1032904 3300005983 Bacteria 2823
127 Ga0081539_10010022 3300005985 Bacteria 7797
128 Ga0070717_10000290 3300006028 Bacteria 33745
129 Ga0075365_10019235 3300006038 Bacteria 4212
130 Ga0075365_10206913 3300006038 Bacteria 1375
131 Ga0075368_10090302 3300006042 Bacteria 1253
132 Ga0075363_100045378 3300006048 Bacteria 2330
133 Ga0075363_100609719 3300006048 Bacteria 654
134 Ga0075364_10077688 3300006051 Bacteria 2192
135 Ga0075364_10628679 3300006051 Bacteria 733
136 Ga0075364_10654504 3300006051 Bacteria 717
137 Ga0075432_10096927 3300006058 Bacteria 1086
138 Ga0070715_10063594 3300006163 Bacteria 1627
139 Ga0070715_10129677 3300006163 Bacteria 1212
140 Ga0070715_10172437 3300006163 Bacteria 1079
141 Ga0070712_100003789 3300006175 Bacteria 9313
142 Ga0070712_100091326 3300006175 Bacteria 2231
143 Ga0070712_100265700 3300006175 Bacteria 1376
144 Ga0070712_101412594 3300006175 Bacteria 607
145 Ga0075362_10003772 3300006177 Bacteria 5364
146 Ga0075362_10005498 3300006177 Bacteria 4643
147 Ga0075367_10023776 3300006178 Bacteria 3451
148 Ga0075367_10263779 3300006178 Bacteria 1081
149 Ga0075367_10400103 3300006178 Bacteria 868
150 Ga0075369_10002609 3300006186 Bacteria 6454
151 Ga0075369_10273997 3300006186 Bacteria 785
152 Ga0097621_100075157 3300006237 Bacteria 2800
153 Ga0097621_100483488 3300006237 Bacteria 1119
154 Ga0097621_100534926 3300006237 Bacteria 1065
155 Ga0097621_101176878 3300006237 Bacteria 722
156 Ga0075370_10122037 3300006353 Bacteria 1517
157 Ga0068871_100013417 3300006358 Bacteria 6082
158 Ga0068871_100106979 3300006358 Bacteria 2349
159 Ga0068871_100162683 3300006358 Bacteria 1909
160 Ga0068871_100180015 3300006358 Bacteria 1816
161 Ga0068871_100212153 3300006358 Bacteria 1675
162 Ga0068871_100229864 3300006358 Bacteria 1610
163 Ga0068871_100529831 3300006358 Bacteria 1065
164 Ga0068871_100926426 3300006358 Bacteria 808
165 Ga0075428_100744562 3300006844 Bacteria 1043
166 Ga0075431_101216947 3300006847 Bacteria 716
167 Ga0075433_10242694 3300006852 Bacteria 1599
168 Ga0075434_100083305 3300006871 Bacteria 3196
169 Ga0075429_100775711 3300006880 Bacteria 840
170 Ga0075429_101229270 3300006880 Bacteria 654
171 Ga0068865_100003415 3300006881 Bacteria 9500
172 Ga0068865_100329570 3300006881 Bacteria 1230
173 Ga0068865_101341899 3300006881 Bacteria 637
174 Ga0097620_102137391 3300006931 Bacteria 618
175 Ga0075435_100854815 3300007076 Bacteria 793
176 Ga0105240_10116693 3300009093 Bacteria 3220
177 Ga0105240_10215739 3300009093 Bacteria 2239
178 Ga0105240_10431257 3300009093 Bacteria 1479
179 Ga0105240_10624729 3300009093 Bacteria 1183
180 Ga0105240_11005033 3300009093 Bacteria 892
181 Ga0105240_11414497 3300009093 Bacteria 731
182 Ga0111539_10805462 3300009094 Bacteria 1093
183 Ga0111539_10879826 3300009094 Bacteria 1042
184 Ga0105245_10019634 3300009098 Bacteria 5921
185 Ga0105245_10177854 3300009098 Bacteria 2031
186 Ga0105245_11284469 3300009098 Bacteria 781
187 Ga0105241_10184909 3300009174 Bacteria 1731
188 Ga0105241_10387720 3300009174 Bacteria 1222
189 Ga0105241_10582075 3300009174 Bacteria 1009
190 Ga0105241_10720818 3300009174 Bacteria 912
191 Ga0105241_11094680 3300009174 Bacteria 750
192 Ga0105242_10108470 3300009176 Bacteria 2363
193 Ga0105248_10167031 3300009177 Bacteria 2480
194 Ga0105248_10266351 3300009177 Bacteria 1929
195 Ga0105248_10674314 3300009177 Bacteria 1166
196 Ga0105237_10001366 3300009545 Bacteria 32234
197 Ga0105237_10319155 3300009545 Bacteria 1557
198 Ga0105237_10323101 3300009545 Bacteria 1547
199 Ga0105237_12120253 3300009545 Bacteria 571
200 Ga0105238_10057475 3300009551 Bacteria 3900
201 Ga0105238_10265623 3300009551 Bacteria 1696
202 Ga0105238_10347011 3300009551 Bacteria 1473
203 Ga0105238_12110602 3300009551 Bacteria 598
204 Ga0099796_10198378 3300010159 Bacteria 813
205 Ga0105239_10001205 3300010375 Bacteria 35322
206 Ga0105239_10006723 3300010375 Bacteria 13285
207 Ga0105239_10036920 3300010375 Bacteria 5360
208 Ga0105239_10037058 3300010375 Bacteria 5349
209 Ga0105239_10268646 3300010375 Bacteria 1918
210 Ga0105239_11232456 3300010375 Bacteria 862
211 Ga0105239_11332958 3300010375 Bacteria 828
212 Ga0105239_11732883 3300010375 Bacteria 723
213 Ga0105239_12308651 3300010375 Bacteria 626
214 Ga0105246_10085665 3300011119 Bacteria 2257
215 Ga0105246_10133300 3300011119 Bacteria 1859
216 Ga0105246_10317272 3300011119 Bacteria 1265
217 Ga0157373_10086197 3300013100 Bacteria 2213
218 Ga0157373_11084278 3300013100 Bacteria 600
219 Ga0157371_10247348 3300013102 Bacteria 1283
220 Ga0157369_10046598 3300013105 Bacteria 4711
221 Ga0157369_10264089 3300013105 Bacteria 1795
222 Ga0157369_10367000 3300013105 Bacteria 1494
223 Ga0157369_10566676 3300013105 Bacteria 1173
224 Ga0157369_10585996 3300013105 Bacteria 1152
225 Ga0157378_10611371 3300013297 Bacteria 1102
226 Ga0157378_11665573 3300013297 Bacteria 684
227 Ga0163162_10061302 3300013306 Bacteria 3799
228 Ga0163162_10090110 3300013306 Bacteria 3148
229 Ga0163162_10760468 3300013306 Bacteria 1088
230 Ga0163162_12615802 3300013306 Bacteria 581
231 Ga0157372_10136745 3300013307 Bacteria 2822
232 Ga0157372_11103637 3300013307 Bacteria 918
233 Ga0157372_12629305 3300013307 Bacteria 578
234 Ga0157375_10039100 3300013308 Bacteria 4562
235 Ga0157375_11157164 3300013308 Bacteria 907
236 Ga0157375_12539150 3300013308 Bacteria 612
237 Ga0157375_12932832 3300013308 Bacteria 570
238 Ga0163163_10097627 3300014325 Bacteria 2958
239 Ga0163163_10517366 3300014325 Bacteria 1256
240 Ga0157380_10031835 3300014326 Bacteria 4051
241 Ga0182008_10196181 3300014497 Bacteria 1026
242 Ga0157377_11146391 3300014745 Bacteria 598
243 Ga0157379_10049892 3300014968 Bacteria 3737
244 Ga0157379_10277336 3300014968 Bacteria 1525
245 Ga0157379_11165176 3300014968 Bacteria 740
246 Ga0157379_11368790 3300014968 Bacteria 685
247 Ga0157376_10030553 3300014969 Bacteria 4303
248 Ga0157376_10389639 3300014969 Bacteria 1344
249 Ga0163161_10039338 3300017792 Bacteria 3394
250 Ga0206355_1080318 3300020076 Bacteria 590
251 Ga0206354_10945638 3300020081 Bacteria 593
252 Ga0213873_10000006 3300021358 Bacteria 408723
253 Ga0213872_10000983 3300021361 Bacteria 19936
254 Ga0213872_10036611 3300021361 Bacteria 2242
255 Ga0213872_10042438 3300021361 Bacteria 2074
256 Ga0213872_10044484 3300021361 Bacteria 2020
257 Ga0213872_10377652 3300021361 Bacteria 577
258 Ga0213874_10285461 3300021377 Bacteria 617
259 Ga0213876_10000004 3300021384 Bacteria 943822
260 Ga0213876_10049016 3300021384 Bacteria 2231
261 Ga0213876_10218025 3300021384 Bacteria 1015
262 Ga0213875_10010160 3300021388 Bacteria 4729
263 Ga0213875_10163320 3300021388 Bacteria 1045
264 Ga0207427_103164 3300025231 Bacteria 3671
265 Ga0209233_1000013 3300025261 Bacteria 1013785
266 Ga0209233_1008420 3300025261 Bacteria 3195
267 Ga0209025_1104234 3300025294 Bacteria 889
268 Ga0209758_1110660 3300025297 Bacteria 761
269 Ga0207656_10193494 3300025321 Bacteria 980
270 Ga0207692_10358598 3300025898 Bacteria 900
271 Ga0207642_10159764 3300025899 Bacteria 1209
272 Ga0207688_10120782 3300025901 Bacteria 1529
273 Ga0207680_10349009 3300025903 Bacteria 1039
274 Ga0207647_10079224 3300025904 Bacteria 1972
275 Ga0207685_10282088 3300025905 Bacteria 815
276 Ga0207699_10174558 3300025906 Bacteria 1440
277 Ga0207699_10643239 3300025906 Bacteria 774
278 Ga0207645_10488504 3300025907 Bacteria 833
279 Ga0207705_10102679 3300025909 Bacteria 2105
280 Ga0207705_10402901 3300025909 Bacteria 1058
281 Ga0207705_10453389 3300025909 Bacteria 994
282 Ga0207684_10000187 3300025910 Bacteria 98338
283 Ga0207654_10007677 3300025911 Bacteria 5442
284 Ga0207654_10257806 3300025911 Bacteria 1171
285 Ga0207654_10612417 3300025911 Bacteria 778
286 Ga0207707_10002733 3300025912 Bacteria 15764
287 Ga0207707_10236826 3300025912 Bacteria 1588
288 Ga0207707_10590922 3300025912 Bacteria 940
289 Ga0207707_11105971 3300025912 Bacteria 646
290 Ga0207695_10005412 3300025913 Bacteria 16939
291 Ga0207695_10254102 3300025913 Bacteria 1656
292 Ga0207695_10275533 3300025913 Bacteria 1577
293 Ga0207695_10285054 3300025913 Bacteria 1545
294 Ga0207695_10436831 3300025913 Bacteria 1193
295 Ga0207695_10465046 3300025913 Bacteria 1148
296 Ga0207695_10530406 3300025913 Bacteria 1059
297 Ga0207671_10000215 3300025914 Bacteria 87204
298 Ga0207671_10119984 3300025914 Bacteria 2009
299 Ga0207671_10497382 3300025914 Bacteria 972
300 Ga0207671_10513523 3300025914 Bacteria 955
301 Ga0207671_10524056 3300025914 Bacteria 945
302 Ga0207671_10590595 3300025914 Bacteria 885
303 Ga0207693_10002047 3300025915 Bacteria 17648
304 Ga0207693_10025243 3300025915 Bacteria 4712
305 Ga0207693_10088056 3300025915 Bacteria 2433
306 Ga0207693_10132050 3300025915 Bacteria 1963
307 Ga0207663_10313026 3300025916 Bacteria 1177
308 Ga0207663_10338018 3300025916 Bacteria 1136
309 Ga0207663_10436065 3300025916 Bacteria 1008
310 Ga0207660_10207612 3300025917 Bacteria 1532
311 Ga0207660_10353996 3300025917 Bacteria 1177
312 Ga0207660_11103373 3300025917 Bacteria 646
313 Ga0207662_10476222 3300025918 Bacteria 857
314 Ga0207657_10019120 3300025919 Bacteria 6515
315 Ga0207657_10046310 3300025919 Bacteria 3810
316 Ga0207657_11271663 3300025919 Bacteria 557
317 Ga0207649_10561743 3300025920 Bacteria 874
318 Ga0207649_10614118 3300025920 Bacteria 837
319 Ga0207649_10615911 3300025920 Bacteria 836
320 Ga0207649_10666721 3300025920 Bacteria 805
321 Ga0207652_10018130 3300025921 Bacteria 5770
322 Ga0207652_10025573 3300025921 Bacteria 4909
323 Ga0207652_10028271 3300025921 Bacteria 4677
324 Ga0207652_10463688 3300025921 Bacteria 1142
325 Ga0207646_10103202 3300025922 Bacteria 2557
326 Ga0207646_11403347 3300025922 Bacteria 607
327 Ga0207694_10110792 3300025924 Bacteria 2184
328 Ga0207694_10134060 3300025924 Bacteria 1987
329 Ga0207694_10379916 3300025924 Bacteria 1172
330 Ga0207659_10152549 3300025926 Bacteria 1805
331 Ga0207659_10911497 3300025926 Bacteria 756
332 Ga0207687_10792244 3300025927 Bacteria 808
333 Ga0207687_11794846 3300025927 Bacteria 525
334 Ga0207700_10399523 3300025928 Bacteria 1204
335 Ga0207700_10510114 3300025928 Bacteria 1065
336 Ga0207664_10017404 3300025929 Bacteria 5267
337 Ga0207644_10128669 3300025931 Bacteria 1936
338 Ga0207644_11381410 3300025931 Bacteria 592
339 Ga0207686_10019155 3300025934 Bacteria 3887
340 Ga0207709_11217275 3300025935 Bacteria 621
341 Ga0207669_10150377 3300025937 Bacteria 1630
342 Ga0207704_10932533 3300025938 Bacteria 731
343 Ga0207691_10962499 3300025940 Bacteria 713
344 Ga0207691_11629941 3300025940 Bacteria 524
345 Ga0207711_10586261 3300025941 Bacteria 1040
346 Ga0207689_11264974 3300025942 Bacteria 620
347 Ga0207661_10033505 3300025944 Bacteria 3988
348 Ga0207661_10121335 3300025944 Bacteria 2226
349 Ga0207661_10281971 3300025944 Bacteria 1485
350 Ga0207661_10285298 3300025944 Bacteria 1476
351 Ga0207679_10073357 3300025945 Bacteria 2589
352 Ga0207667_10329217 3300025949 Bacteria 1560
353 Ga0207667_10333950 3300025949 Bacteria 1547
354 Ga0207667_10335622 3300025949 Bacteria 1543
355 Ga0207667_10809122 3300025949 Bacteria 933
356 Ga0207651_10205872 3300025960 Bacteria 1580
357 Ga0207651_10351246 3300025960 Bacteria 1242
358 Ga0207651_10376490 3300025960 Bacteria 1202
359 Ga0207668_10004161 3300025972 Bacteria 8488
360 Ga0207668_10012637 3300025972 Bacteria 5174
361 Ga0207668_10695987 3300025972 Bacteria 893
362 Ga0207640_10445781 3300025981 Bacteria 1065
363 Ga0207640_11129328 3300025981 Bacteria 694
364 Ga0207640_11509659 3300025981 Bacteria 604
365 Ga0207640_12038871 3300025981 Bacteria 520
366 Ga0207658_11174395 3300025986 Bacteria 701
367 Ga0207677_10245656 3300026023 Bacteria 1451
368 Ga0207677_10273867 3300026023 Bacteria 1382
369 Ga0207677_10951401 3300026023 Bacteria 777
370 Ga0207677_11699758 3300026023 Bacteria 585
371 Ga0207703_10261252 3300026035 Bacteria 1565
372 Ga0207703_10529254 3300026035 Bacteria 1109
373 Ga0207639_10010321 3300026041 Bacteria 6466
374 Ga0207639_10015553 3300026041 Bacteria 5371
375 Ga0207639_10210219 3300026041 Bacteria 1674
376 Ga0207639_11029158 3300026041 Bacteria 772
377 Ga0207678_10154400 3300026067 Bacteria 1960
378 Ga0207678_10200320 3300026067 Bacteria 1707
379 Ga0207708_10645277 3300026075 Bacteria 901
380 Ga0207702_10189328 3300026078 Bacteria 1900
381 Ga0207702_10237444 3300026078 Bacteria 1706
382 Ga0207702_10439001 3300026078 Bacteria 1265
383 Ga0207676_10357734 3300026095 Bacteria 1352
384 Ga0207676_11179140 3300026095 Bacteria 759
385 Ga0207674_10081921 3300026116 Bacteria 3229
386 Ga0207674_10118233 3300026116 Bacteria 2620
387 Ga0207674_11114418 3300026116 Bacteria 759
388 Ga0207674_11877331 3300026116 Bacteria 565
389 Ga0207675_100011142 3300026118 Bacteria 8421
390 Ga0207683_10012229 3300026121 Bacteria 7326
391 Ga0207683_10036383 3300026121 Bacteria 4287
392 Ga0207683_10081825 3300026121 Bacteria 2867
393 Ga0207683_10429533 3300026121 Bacteria 1217
394 Ga0207698_10034727 3300026142 Bacteria 3679
395 Ga0207698_10656215 3300026142 Bacteria 1040
396 Ga0209973_1012410 3300027252 Bacteria 1036
397 Ga0209967_1057317 3300027364 Bacteria 602
398 Ga0209971_1093380 3300027682 Bacteria 735
399 Ga0209998_10044265 3300027717 Bacteria 1017
400 Ga0209974_10004627 3300027876 Bacteria 4895
401 Ga0209974_10063155 3300027876 Bacteria 1255
402 Ga0268266_10000255 3300028379 Bacteria 89930
403 Ga0268266_10004374 3300028379 Bacteria 13565
404 Ga0268266_10027704 3300028379 Bacteria 4817
405 Ga0268266_10092631 3300028379 Bacteria 2652
406 Ga0268266_10196407 3300028379 Bacteria 1845
407 Ga0268266_10239319 3300028379 Bacteria 1674
408 Ga0268266_11441368 3300028379 Bacteria 664
409 Ga0268266_12246922 3300028379 Bacteria 517
410 Ga0268265_10383593 3300028380 Bacteria 1294
411 Ga0268265_10478858 3300028380 Bacteria 1168
412 Ga0268265_10537970 3300028380 Bacteria 1107
413 Ga0268265_11192389 3300028380 Bacteria 759
414 Ga0268264_10002617 3300028381 Bacteria 15732
415 Ga0268264_10053068 3300028381 Bacteria 3382
416 Ga0268264_10513500 3300028381 Bacteria 1170
417 Ga0265318_10298392 3300028577 Bacteria 588
418 Ga0265338_10000005 3300028800 Bacteria 571137
419 Ga0265338_10011268 3300028800 Bacteria 10352
420 Ga0265338_10097883 3300028800 Bacteria 2402
421 Ga0265338_10293608 3300028800 Bacteria 1184
422 Ga0265324_10152468 3300029957 Bacteria 785
423 Ga0265330_10118365 3300031235 Bacteria 1129
424 Ga0265332_10015915 3300031238 Bacteria 3319
425 Ga0265332_10025815 3300031238 Bacteria 2579
426 Ga0265332_10266006 3300031238 Bacteria 709
427 Ga0265332_10343907 3300031238 Bacteria 616
428 Ga0265328_10204374 3300031239 Bacteria 750
429 Ga0265320_10001181 3300031240 Bacteria 19237
430 Ga0265325_10000010 3300031241 Bacteria 172391
431 Ga0265325_10058000 3300031241 Bacteria 1973
432 Ga0265325_10204386 3300031241 Bacteria 909
433 Ga0265340_10010366 3300031247 Bacteria 4985
434 Ga0265340_10065981 3300031247 Bacteria 1723
435 Ga0265339_10000373 3300031249 Bacteria 35286
436 Ga0265339_10084492 3300031249 Bacteria 1673
437 Ga0265331_10009117 3300031250 Bacteria 5601
438 Ga0265331_10018151 3300031250 Bacteria 3654
439 Ga0265316_10075465 3300031344 Bacteria 2592
440 Ga0265316_10435102 3300031344 Bacteria 942
441 Ga0265316_10666866 3300031344 Bacteria 734
442 Ga0307513_10334202 3300031456 Bacteria 1268
443 Ga0307513_10401987 3300031456 Bacteria 1104
444 Ga0307513_10450900 3300031456 Bacteria 1011
445 Ga0307408_100013197 3300031548 Bacteria 5485
446 Ga0307408_101326995 3300031548 Bacteria 675
447 Ga0265313_10000061 3300031595 Bacteria 107220
448 Ga0265313_10000828 3300031595 Bacteria 31267
449 Ga0265313_10028345 3300031595 Bacteria 2912
450 Ga0307508_10327649 3300031616 Bacteria 1123
451 Ga0316575_10184397 3300031665 Bacteria 867
452 Ga0265314_10009980 3300031711 Bacteria 7965
453 Ga0265314_10038094 3300031711 Bacteria 3477
454 Ga0265314_10049498 3300031711 Bacteria 2941
455 Ga0265342_10053041 3300031712 Bacteria 2414
456 Ga0316576_10085879 3300031727 Bacteria 2339
457 Ga0316576_10151481 3300031727 Bacteria 1748
458 Ga0316578_10013246 3300031728 Bacteria 4369
459 Ga0307405_10060563 3300031731 Bacteria 2389
460 Ga0307405_10179371 3300031731 Bacteria 1519
461 Ga0307405_10357061 3300031731 Bacteria 1129
462 Ga0307405_10673941 3300031731 Bacteria 853
463 Ga0307405_10905464 3300031731 Bacteria 746
464 Ga0307413_11591256 3300031824 Bacteria 580
465 Ga0307413_12139944 3300031824 Bacteria 506
466 Ga0307406_10032811 3300031901 Bacteria 3172
467 Ga0307406_10319090 3300031901 Bacteria 1201
468 Ga0307406_10636970 3300031901 Bacteria 883
469 Ga0307406_11955506 3300031901 Bacteria 523
470 Ga0307412_10049726 3300031911 Bacteria 2763
471 Ga0307412_10083369 3300031911 Bacteria 2216
472 Ga0307412_10396299 3300031911 Bacteria 1122
473 Ga0307412_10502805 3300031911 Bacteria 1009
474 Ga0307412_11362387 3300031911 Bacteria 641
475 Ga0307412_12216913 3300031911 Bacteria 511
476 Ga0307409_100555221 3300031995 Bacteria 1128
477 Ga0307416_100083043 3300032002 Bacteria 2716
478 Ga0307416_100132367 3300032002 Bacteria 2248
479 Ga0307416_100597755 3300032002 Bacteria 1183
480 Ga0307416_100662297 3300032002 Bacteria 1130
481 Ga0307416_100974942 3300032002 Bacteria 950
482 Ga0307414_10225921 3300032004 Bacteria 1540
483 Ga0307414_10357003 3300032004 Bacteria 1256
484 Ga0307414_10395749 3300032004 Bacteria 1198
485 Ga0307414_10846754 3300032004 Bacteria 836
486 Ga0307411_11027870 3300032005 Bacteria 739
487 Ga0307415_101269848 3300032126 Bacteria 696
488 Ga0316593_10000847 3300032168 Bacteria 6190
489 Ga0307510_10145191 3300033180 Bacteria 2007
490 Ga0316596_1024650 3300033541 Bacteria 1545
491 Ga0373948_0086003 3300034817 Bacteria 724
492 Ga0373929_0188114 3300035085 Bacteria 573
493 Ga0373940_0334055 3300035088 Bacteria 528
494 Ga0373940_0356208 3300035088 Bacteria 514
495 Ga0373944_0109144 3300035089 Bacteria 943
496 Ga0373951_0198404 3300035091 Bacteria 584
497 Ga0373951_0222829 3300035091 Bacteria 557
498 Ga0373939_0064762 3300035114 Bacteria 1174
499 Ga0373939_0122979 3300035114 Bacteria 918
500 Ga0373941_0146263 3300035115 Bacteria 863
501 Ga0373956_0450836 3300035119 Bacteria 614
502 Ga0373956_0559276 3300035119 Bacteria 546
503 Ga0373946_0093729 3300035171 Bacteria 1335
504 Ga0373946_0374259 3300035171 Bacteria 716
505 Ga0373942_0022446 3300035207 Bacteria 1601
506 Ga0316574_0172536 3300035398 Bacteria 1392
507 Ga0316574_0614307 3300035398 Bacteria 671
508 Ga0373924_0223198 3300035410 Bacteria 833
509 Ga0373931_0041082 3300035691 Bacteria 2429
510 Ga0373931_0257423 3300035691 Bacteria 1064
511 Ga0373935_1007584 3300035692 Bacteria 619
512 Ga0373927_0236199 3300035695 Bacteria 1201
513 Ga0373933_0564622 3300035724 Bacteria 747
514 Ga0373947_0416397 3300035725 Bacteria 908
515 Ga0373937_0210435 3300036401 Bacteria 1830
516 Ga0373937_0670668 3300036401 Bacteria 983
517 Ga0373937_1282315 3300036401 Bacteria 681
518 Ga0316582_0003393 3300036647 Bacteria 7806
519 Ga0316582_0115891 3300036647 Bacteria 1788
520 Ga0316582_1015016 3300036647 Bacteria 566
521 Ga0316584_0020971 3300036712 Bacteria 4746
522 Ga0316584_0247088 3300036712 Bacteria 1304
523 Ga0316584_0355146 3300036712 Bacteria 1052
524 Ga0373925_0395997 3300037068 Bacteria 1126
525 Ga0395899_0026647 3300037312 Bacteria 4361
526 Ga0395899_0035389 3300037312 Bacteria 3749
527 Ga0395899_0097318 3300037312 Bacteria 2127
528 Ga0395899_0104340 3300037312 Bacteria 2043
529 Ga0395900_0034816 3300037418 Bacteria 5187
530 Ga0395900_0045605 3300037418 Bacteria 4515
531 Ga0395900_0305576 3300037418 Bacteria 1575
532 Ga0395900_0461224 3300037418 Bacteria 1225
533 Ga0395900_0753309 3300037418 Bacteria 904
534 Ga0395898_0210121 3300037466 Bacteria 1856
535 Ga0436364_0264635 3300037853 Bacteria 1271
536 Ga0436364_1059469 3300037853 Bacteria 1057
537 Ga0436364_1079956 3300037853 Bacteria 49729
538 Ga0395901_0005738 3300038443 Bacteria 12571
539 Ga0395901_0015570 3300038443 Bacteria 7747
540 Ga0395901_0107493 3300038443 Bacteria 2928
541 Ga0395901_0377066 3300038443 Bacteria 1460
542 Ga0395901_0783858 3300038443 Bacteria 944
543 Ga0400486_27314 3300038742 Bacteria 2874
544 Ga0400483_016015 3300039062 Bacteria 1457
545 Ga0400483_086626 3300039062 Bacteria 4548
546 Ga0400483_193353 3300039062 Bacteria 3912
547 Ga0400487_30510 3300039110 Bacteria 1397
548 Ga0436365_0095088 3300039437 Bacteria 1875
549 Ga0436365_0974653 3300039437 Bacteria 10227
550 Ga0436365_1018356 3300039437 Bacteria 621
551 Ga0436365_1215130 3300039437 Bacteria 80243
552 Ga0436365_1575237 3300039437 Bacteria 1477
553 Ga0436360_0206959 3300039438 Bacteria 985
554 Ga0436360_0218419 3300039438 Bacteria 2678
555 Ga0436360_0317148 3300039438 Bacteria 950
556 Ga0436360_0393048 3300039438 Bacteria 568
557 Ga0436360_0505912 3300039438 Bacteria 2785
558 Ga0436360_0560103 3300039438 Bacteria 851
559 Ga0436360_0580300 3300039438 Bacteria 654
560 Ga0436360_0878555 3300039438 Unclassified 984
561 Ga0436360_1095219 3300039438 Bacteria 1237
562 Ga0436361_0106955 3300039447 Bacteria 1028
563 Ga0436361_0134909 3300039447 Bacteria 8959
564 Ga0436361_0138415 3300039447 Bacteria 1706
565 Ga0436361_0256903 3300039447 Bacteria 1418
566 Ga0436361_0346208 3300039447 Bacteria 2614
567 Ga0436361_0467613 3300039447 Bacteria 4134
568 Ga0436361_0487620 3300039447 Bacteria 524
569 Ga0436361_0549993 3300039447 Bacteria 2772
570 Ga0436361_0599707 3300039447 Bacteria 661
571 Ga0436361_0745675 3300039447 Bacteria 10221
572 Ga0436361_0793900 3300039447 Bacteria 1391
573 Ga0436361_1011398 3300039447 Bacteria 717
574 Ga0436363_0680414 3300039450 Bacteria 2713
575 Ga0436363_0974827 3300039450 Bacteria 948
576 Ga0436362_0094317 3300039453 Bacteria 79076
577 Ga0436362_0314308 3300039453 Bacteria 658
578 Ga0436362_0483970 3300039453 Bacteria 539
579 Ga0436362_0666367 3300039453 Bacteria 1051
580 Ga0439466_0100923 3300041411 Bacteria 900
581 Ga0439465_0041838 3300041413 Bacteria 1484
582 Ga0439465_0069318 3300041413 Bacteria 1180
583 Ga0451793_1667793 3300041452 Bacteria 1088
584 Ga0451802_0135419 3300041460 Bacteria 880
585 Ga0451804_0787161 3300041463 Bacteria 644
586 Ga0451843_0179471 3300041509 Bacteria 773
587 Ga0439441_031129 3300042001 Bacteria 1034
588 Ga0439442_048632 3300042002 Bacteria 894
589 Ga0439445_0040567 3300042004 Bacteria 1236
590 Ga0439445_0085540 3300042004 Bacteria 884
591 Ga0439445_0091446 3300042004 Bacteria 857
592 Ga0439452_123423 3300042010 Bacteria 551
593 Ga0439456_122885 3300042013 Bacteria 596
594 Ga0451577_0000124 3300042876 Bacteria 169120
595 Ga0451577_0001018 3300042876 Bacteria 40726
596 Ga0451577_0106914 3300042876 Bacteria 2501
597 Ga0451577_0176617 3300042876 Bacteria 1925
598 Ga0451577_0181870 3300042876 Bacteria 1896
599 Ga0451577_0224830 3300042876 Bacteria 1697
600 Ga0466965_0105634 3300044683 Bacteria 1444
601 Ga0453684_0000015 3300044712 Bacteria 969198
602 Ga0453684_0000020 3300044712 Bacteria 879938
603 Ga0453684_0000239 3300044712 Bacteria 235992
604 Ga0453684_0000498 3300044712 Bacteria 153608
605 Ga0453684_0022198 3300044712 Bacteria 9433
606 Ga0453684_0026561 3300044712 Bacteria 8350
607 Ga0453684_0101448 3300044712 Bacteria 3521
608 Ga0466957_0884459 3300044842 Bacteria 638
609 Ga0451576_0000040 3300045051 Bacteria 349778
610 Ga0451576_0001132 3300045051 Bacteria 48307
611 Ga0451576_0050028 3300045051 Bacteria 4385
612 Ga0451576_0058213 3300045051 Bacteria 4039
613 Ga0451576_0443241 3300045051 Bacteria 1363
614 Ga0451576_0557249 3300045051 Bacteria 1204
615 Ga0451576_1683978 3300045051 Bacteria 657
616 Ga0495638_0003562 3300046460 Bacteria 12195
617 Ga0495651_0141560 3300046462 Bacteria 1744
618 Ga0495580_0244175 3300046472 Bacteria 1231
619 Ga0495580_0771354 3300046472 Bacteria 625
620 Ga0495582_0266015 3300046473 Bacteria 984
621 Ga0495584_0273656 3300046491 Bacteria 858
622 Ga0495583_0192270 3300046506 Bacteria 832
623 Ga0495606_0195158 3300046507 Bacteria 1158
624 Ga0495610_0149942 3300046512 Bacteria 996
625 Ga0495628_0077221 3300046516 Bacteria 2591
626 Ga0495628_0395705 3300046516 Bacteria 1010
627 Ga0495643_0031204 3300046522 Bacteria 2967
628 Ga0495648_0151786 3300046524 Bacteria 1208
629 Ga0495598_0223787 3300046537 Bacteria 688
630 Ga0495609_0068453 3300046538 Bacteria 1562
631 Ga0495597_0057804 3300046542 Bacteria 1696
632 Ga0495645_0502817 3300046543 Bacteria 757
633 Ga0495645_0674327 3300046543 Bacteria 630
634 Ga0495656_0610184 3300046615 Bacteria 584
635 Ga0495625_0003057 3300046660 Bacteria 17149
636 Ga0495661_0237856 3300046665 Bacteria 936
637 Ga0495623_0215131 3300046679 Bacteria 1098
638 Ga0495669_0112184 3300046684 Bacteria 1274
639 Ga0495669_0266778 3300046684 Bacteria 823
640 Ga0495670_0413751 3300046691 Bacteria 729
641 Ga0495649_0266017 3300046694 Bacteria 878
642 Ga0495589_0084446 3300046794 Bacteria 1543
643 Ga0495636_0148726 3300047318 Bacteria 1049
644 Ga0495676_0347164 3300047321 Bacteria 993
645 Ga0495680_0036126 3300047322 Bacteria 3971
646 Ga0495675_0248569 3300047444 Bacteria 1069
647 Ga0495686_0278534 3300047472 Bacteria 930
648 Ga0495602_0692626 3300048088 Bacteria 692
649 Ga0496102_0183568 3300048905 Bacteria 1971
650 Ga0496102_1267607 3300048905 Bacteria 656
651 Ga0496110_1513745 3300048913 Bacteria 581
652 Ga0496112_0322988 3300048915 Bacteria 1488
653 Ga0496116_0292029 3300048919 Bacteria 782
654 Ga0496117_0024717 3300048920 Bacteria 4740
655 Ga0496118_0001677 3300048921 Bacteria 32432
656 Ga0496118_0269869 3300048921 Bacteria 954
657 Ga0496121_0038766 3300048924 Bacteria 4211
658 Ga0496124_0325192 3300048927 Bacteria 1099
659 Ga0496125_0001281 3300048928 Bacteria 37316
660 Ga0496125_0458667 3300048928 Bacteria 728
661 Ga0496126_0069667 3300048929 Bacteria 3136
662 Ga0496126_0217471 3300048929 Bacteria 1607
663 Ga0496126_0234042 3300048929 Bacteria 1538
664 Ga0501290_015074 3300049513 Bacteria 1021
665 Ga0501299_051601 3300049522 Bacteria 851
666 Ga0501300_042680 3300049523 Bacteria 686
667 Ga0501320_072924 3300049536 Bacteria 500
668 Ga0501336_028113 3300049552 Bacteria 542
669 Ga0501031_0608688 3300049568 Bacteria 703
670 Ga0501031_0964382 3300049568 Bacteria 545
671 Ga0501033_0185278 3300049570 Bacteria 1491
672 Ga0501033_0296937 3300049570 Bacteria 1138
673 Ga0501034_0000189 3300049571 Bacteria 115780
674 Ga0501034_0001822 3300049571 Bacteria 27090
675 Ga0501034_0037129 3300049571 Bacteria 4933
676 Ga0501034_0284733 3300049571 Bacteria 1592
677 Ga0501034_0339121 3300049571 Bacteria 1433
678 Ga0501034_0503699 3300049571 Bacteria 1124
679 Ga0501034_0836273 3300049571 Bacteria 811
680 Ga0501034_0838718 3300049571 Bacteria 810
681 Ga0501034_0887223 3300049571 Bacteria 780
682 Ga0501034_0929161 3300049571 Bacteria 757
683 Ga0501036_0538567 3300049572 Bacteria 971
684 Ga0501037_0197960 3300049573 Bacteria 1421
685 Ga0501037_0367776 3300049573 Bacteria 990
686 Ga0501037_0412379 3300049573 Bacteria 925
687 Ga0501037_0527697 3300049573 Bacteria 799
688 Ga0501038_0111292 3300049574 Bacteria 2269
689 Ga0501038_0259626 3300049574 Bacteria 1374
690 Ga0501042_0038384 3300049578 Bacteria 3402
691 Ga0501042_0309300 3300049578 Bacteria 1142
692 Ga0501043_0207612 3300049579 Bacteria 1518
693 Ga0501043_0215268 3300049579 Bacteria 1488
694 Ga0501043_0513601 3300049579 Bacteria 894
695 Ga0501043_0954139 3300049579 Bacteria 612
696 Ga0501046_0241279 3300049580 Bacteria 1333
697 Ga0501047_0003852 3300049581 Bacteria 14113
698 Ga0501047_0125160 3300049581 Bacteria 2451
699 Ga0501047_0247897 3300049581 Bacteria 1630
700 Ga0501047_0746459 3300049581 Bacteria 795
701 Ga0501047_0761417 3300049581 Bacteria 784
702 Ga0501047_0902108 3300049581 Bacteria 697
703 Ga0501048_0371991 3300049582 Bacteria 1020
704 Ga0501048_1148095 3300049582 Bacteria 559
705 Ga0501067_0002093 3300049583 Bacteria 10999
706 Ga0501067_0104456 3300049583 Bacteria 1574
707 Ga0501068_0271378 3300049584 Bacteria 1083
708 Ga0501068_0387862 3300049584 Bacteria 900
709 Ga0501070_0035746 3300049586 Bacteria 4149
710 Ga0501070_0169440 3300049586 Bacteria 1799
711 Ga0501070_0280088 3300049586 Bacteria 1361
712 Ga0501070_0595941 3300049586 Bacteria 881
713 Ga0501071_0808129 3300049587 Bacteria 723
714 Ga0501071_0929740 3300049587 Bacteria 671
715 Ga0501072_0040168 3300049588 Bacteria 3674
716 Ga0501073_0036999 3300049589 Bacteria 3467
717 Ga0501073_0137857 3300049589 Bacteria 1691
718 Ga0501073_0138866 3300049589 Bacteria 1684
719 Ga0501073_0177787 3300049589 Bacteria 1473
720 Ga0501074_0278611 3300049590 Bacteria 1189
721 Ga0501075_0145696 3300049591 Bacteria 1805
722 Ga0501076_0268651 3300049592 Bacteria 1397
723 Ga0501076_0481890 3300049592 Bacteria 1022
724 Ga0501077_0155940 3300049593 Bacteria 1449
725 Ga0501223_010163 3300049663 Bacteria 1898
726 Ga0501257_000071 3300049686 Bacteria 26120
727 Ga0501079_0445387 3300049741 Bacteria 1017
728 Ga0501079_1451850 3300049741 Bacteria 540
729 Ga0501080_0068191 3300049742 Bacteria 3309
730 Ga0501080_0153043 3300049742 Bacteria 2131
731 Ga0501080_0448187 3300049742 Bacteria 1157
732 Ga0501080_0450733 3300049742 Bacteria 1154
733 Ga0501080_0702166 3300049742 Bacteria 892
734 Ga0501081_1212261 3300049743 Bacteria 572
735 Ga0501083_0101700 3300049744 Bacteria 1894
736 Ga0501083_0184331 3300049744 Bacteria 1362
737 Ga0501083_0435517 3300049744 Bacteria 853
738 Ga0501083_0961342 3300049744 Unclassified 556
739 Ga0501280_000241 3300049776 Bacteria 13745
740 Ga0501035_0018260 3300049822 Bacteria 6461
741 Ga0501035_0103180 3300049822 Bacteria 2501
742 Ga0501035_0365154 3300049822 Bacteria 1206
743 Ga0501044_0010936 3300049823 Bacteria 9850
744 Ga0501044_0097655 3300049823 Bacteria 2958
745 Ga0501044_0098350 3300049823 Bacteria 2946
746 Ga0501044_0295749 3300049823 Bacteria 1549
747 Ga0501044_0319632 3300049823 Bacteria 1477
748 Ga0501044_0448093 3300049823 Bacteria 1198
749 Ga0501044_0460075 3300049823 Bacteria 1178
750 Ga0501044_0680930 3300049823 Bacteria 915
751 Ga0501044_1196283 3300049823 Bacteria 628
752 nmdc:mga03683_13116_c1 3300050489 Bacteria 3043
753 nmdc:mga03683_36229_c1 3300050489 Bacteria 2006
754 nmdc:mga03n38_924791_c1 3300050490 Bacteria 513
755 nmdc:mga0yw44_117091_c1 3300050492 Bacteria 1713
756 nmdc:mga0yw44_506127_c1 3300050492 Bacteria 820
757 nmdc:mga0yw44_55454_c1 3300050492 Bacteria 2412
758 nmdc:mga0k408_184045_c1 3300050493 Bacteria 1246
759 nmdc:mga0k408_232308_c1 3300050493 Bacteria 1101
760 nmdc:mga06z11_14790_c2 3300050494 Bacteria 2218
761 nmdc:mga06z11_91957_c1 3300050494 Bacteria 1649
762 nmdc:mga09592_334936_c1 3300050508 Bacteria 1310
763 nmdc:mga09592_694881_c1 3300050508 Bacteria 866
764 nmdc:mga08y16_1182079_c1 3300050511 Bacteria 736
765 nmdc:mga0rr50_495681_c1 3300050513 Bacteria 1038
766 Ga0495612_0476287 3300053078 Bacteria 572
767 Ga0500643_000167 3300053087 Bacteria 64874
768 Ga0500647_0019249 3300053091 Bacteria 3169
769 Ga0500651_0011019 3300053093 Bacteria 5439
770 Ga0500651_0202100 3300053093 Bacteria 1172
771 Ga0500641_0001255 3300053096 Bacteria 9021
772 Ga0500650_0244184 3300053098 Bacteria 807
773 Ga0500592_000645 3300053116 Bacteria 5726
774 Ga0500594_0010595 3300053118 Bacteria 2143
775 Ga0500597_077510 3300053120 Bacteria 1441
776 Ga0500597_374149 3300053120 Bacteria 548
777 Ga0500642_0179069 3300053130 Bacteria 991
778 Ga0500652_000040 3300053131 Bacteria 68826
779 Ga0500655_000021 3300053133 Bacteria 43984
780 Ga0500568_0021313 3300053139 Bacteria 2790
781 Ga0500577_0075845 3300053142 Bacteria 1330
782 Ga0500590_093278 3300053148 Bacteria 1458
783 Ga0500604_0000004 3300053151 Bacteria 146374
784 Ga0500619_037630 3300053154 Bacteria 1513
785 Ga0500627_0000972 3300053158 Bacteria 7767
786 Ga0500636_0010464 3300053177 Bacteria 5413
787 Ga0500570_002608 3300053724 Bacteria 9018
788 Ga0500645_066729 3300053730 Bacteria 1036
789 Ga0501084_0029187 3300054114 Bacteria 4613
790 Ga0501084_0039486 3300054114 Bacteria 3948
791 Ga0501084_0444935 3300054114 Bacteria 1095
792 Ga0501084_0907523 3300054114 Bacteria 741
793 Ga0501084_1310003 3300054114 Bacteria 607
794 Ga0587111_0171786 3300060346 Bacteria 597
795 Ga0501082_0016167 3300060353 Bacteria 6421
796 Ga0501082_0117985 3300060353 Bacteria 2298
797 Ga0501082_0496623 3300060353 Bacteria 1066
798 Ga0501082_1027838 3300060353 Bacteria 721
799 Ga0530510_0503986 3300061734 Bacteria 918

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100891014 Ga0070670_1008910141 138
2 3300005354 Ga0070675_100048611 Ga0070675_1000486112 139
3 3300005364 Ga0070673_100727102 Ga0070673_1007271021 139
4 3300005445 Ga0070708_101073968 Ga0070708_1010739682 139
5 3300005548 Ga0070665_100038937 Ga0070665_1000389374 139
6 3300005937 Ga0081455_10203403 Ga0081455_102034032 139
7 3300006852 Ga0075433_10242694 Ga0075433_102426942 139
8 3300009098 Ga0105245_10177854 Ga0105245_101778543 139
9 3300013307 Ga0157372_12629305 Ga0157372_126293051 139
10 3300020081 Ga0206354_10945638 Ga0206354_109456382 139
11 3300021384 Ga0213876_10218025 Ga0213876_102180252 139
12 3300025960 Ga0207651_10376490 Ga0207651_103764902 139
13 3300027252 Ga0209973_1012410 Ga0209973_10124102 139
14 3300027682 Ga0209971_1093380 Ga0209971_10933802 139
15 3300027717 Ga0209998_10044265 Ga0209998_100442652 139
16 3300027876 Ga0209974_10004627 Ga0209974_100046274 139
17 3300028379 Ga0268266_10027704 Ga0268266_100277043 139
18 3300032002 Ga0307416_100662297 Ga0307416_1006622973 139
19 3300033541 Ga0316596_1024650 Ga0316596_10246502 139
20 3300038443 Ga0395901_0783858 Ga0395901_0783858_477_896 139
21 3300039437 Ga0436365_0095088 Ga0436365_0095088_200_619 139
22 3300042004 Ga0439445_0085540 Ga0439445_0085540_105_524 139
23 3300046512 Ga0495610_0149942 Ga0495610_0149942_252_671 139
24 3300048929 Ga0496126_0234042 Ga0496126_0234042_713_1132 139
25 3300049593 Ga0501077_0155940 Ga0501077_0155940_515_934 139
26 3300053151 Ga0500604_0000004 Ga0500604_0000004_57988_58407 139
27 3300060353 Ga0501082_1027838 Ga0501082_1027838_200_619 139
28 3300005262 Ga0065165_1003558 Ga0065165_10035584 140
29 3300005295 Ga0065707_10082138 Ga0065707_1008213816 140
30 3300005327 Ga0070658_10002834 Ga0070658_1000283415 140
31 3300005327 Ga0070658_10048640 Ga0070658_100486402 140
32 3300005327 Ga0070658_10074304 Ga0070658_100743042 140
33 3300005327 Ga0070658_11518601 Ga0070658_115186011 140
34 3300005329 Ga0070683_100166982 Ga0070683_1001669824 140
35 3300005329 Ga0070683_100245898 Ga0070683_1002458982 140
36 3300005329 Ga0070683_101039085 Ga0070683_1010390851 140
37 3300005330 Ga0070690_100202829 Ga0070690_1002028294 140
38 3300005330 Ga0070690_100369722 Ga0070690_1003697221 140
39 3300005334 Ga0068869_101940050 Ga0068869_1019400501 140
40 3300005335 Ga0070666_10322205 Ga0070666_103222052 140
41 3300005338 Ga0068868_100172392 Ga0068868_1001723922 140
42 3300005338 Ga0068868_100438038 Ga0068868_1004380381 140
43 3300005338 Ga0068868_100816262 Ga0068868_1008162621 140
44 3300005338 Ga0068868_101274936 Ga0068868_1012749361 140
45 3300005339 Ga0070660_100012199 Ga0070660_1000121997 140
46 3300005339 Ga0070660_100033220 Ga0070660_1000332201 140
47 3300005340 Ga0070689_100565888 Ga0070689_1005658882 140
48 3300005341 Ga0070691_10615449 Ga0070691_106154491 140
49 3300005343 Ga0070687_100355430 Ga0070687_1003554302 140
50 3300005344 Ga0070661_100423544 Ga0070661_1004235442 140
51 3300005344 Ga0070661_100577703 Ga0070661_1005777032 140
52 3300005344 Ga0070661_100640874 Ga0070661_1006408742 140
53 3300005347 Ga0070668_100013728 Ga0070668_1000137284 140
54 3300005347 Ga0070668_100021015 Ga0070668_1000210154 140
55 3300005347 Ga0070668_100371585 Ga0070668_1003715852 140
56 3300005347 Ga0070668_100414259 Ga0070668_1004142592 140
57 3300005354 Ga0070675_100255186 Ga0070675_1002551861 140
58 3300005354 Ga0070675_100973261 Ga0070675_1009732611 140
59 3300005354 Ga0070675_101041660 Ga0070675_1010416601 140
60 3300005354 Ga0070675_101272631 Ga0070675_1012726311 140
61 3300005356 Ga0070674_100381483 Ga0070674_1003814831 140
62 3300005364 Ga0070673_100054087 Ga0070673_1000540872 140
63 3300005366 Ga0070659_100495818 Ga0070659_1004958182 140
64 3300005367 Ga0070667_100034729 Ga0070667_1000347292 140
65 3300005367 Ga0070667_100386741 Ga0070667_1003867411 140
66 3300005367 Ga0070667_100600934 Ga0070667_1006009342 140
67 3300005367 Ga0070667_101156111 Ga0070667_1011561111 140
68 3300005434 Ga0070709_10033191 Ga0070709_100331912 140
69 3300005435 Ga0070714_100182974 Ga0070714_1001829742 140
70 3300005436 Ga0070713_100370088 Ga0070713_1003700881 140
71 3300005436 Ga0070713_100520776 Ga0070713_1005207762 140
72 3300005437 Ga0070710_10264912 Ga0070710_102649121 140
73 3300005437 Ga0070710_10301080 Ga0070710_103010801 140
74 3300005439 Ga0070711_100000579 Ga0070711_1000005793 140
75 3300005439 Ga0070711_100906234 Ga0070711_1009062341 140
76 3300005439 Ga0070711_101510616 Ga0070711_1015106161 140
77 3300005445 Ga0070708_100001209 Ga0070708_1000012095 140
78 3300005455 Ga0070663_100145573 Ga0070663_1001455733 140
79 3300005456 Ga0070678_100111350 Ga0070678_1001113503 140
80 3300005458 Ga0070681_10133669 Ga0070681_101336694 140
81 3300005458 Ga0070681_10138493 Ga0070681_101384934 140
82 3300005458 Ga0070681_10887657 Ga0070681_108876572 140
83 3300005459 Ga0068867_100034276 Ga0068867_1000342762 140
84 3300005459 Ga0068867_100891518 Ga0068867_1008915181 140
85 3300005466 Ga0070685_10047760 Ga0070685_100477602 140
86 3300005467 Ga0070706_100000114 Ga0070706_10000011457 140
87 3300005468 Ga0070707_100037523 Ga0070707_1000375232 140
88 3300005471 Ga0070698_100003572 Ga0070698_1000035724 140
89 3300005471 Ga0070698_100196630 Ga0070698_1001966302 140
90 3300005530 Ga0070679_100008108 Ga0070679_1000081087 140
91 3300005530 Ga0070679_100133298 Ga0070679_1001332984 140
92 3300005535 Ga0070684_100114518 Ga0070684_1001145182 140
93 3300005535 Ga0070684_100145132 Ga0070684_1001451322 140
94 3300005535 Ga0070684_100149600 Ga0070684_1001496001 140
95 3300005536 Ga0070697_100007078 Ga0070697_1000070786 140
96 3300005536 Ga0070697_100164907 Ga0070697_1001649073 140
97 3300005539 Ga0068853_100124330 Ga0068853_1001243302 140
98 3300005539 Ga0068853_100168641 Ga0068853_1001686413 140
99 3300005539 Ga0068853_100386385 Ga0068853_1003863853 140
100 3300005539 Ga0068853_100956850 Ga0068853_1009568502 140
101 3300005543 Ga0070672_101098974 Ga0070672_1010989741 140
102 3300005548 Ga0070665_100002027 Ga0070665_1000020279 140
103 3300005548 Ga0070665_100003577 Ga0070665_1000035779 140
104 3300005548 Ga0070665_100060814 Ga0070665_1000608141 140
105 3300005548 Ga0070665_100127146 Ga0070665_1001271463 140
106 3300005548 Ga0070665_100253694 Ga0070665_1002536941 140
107 3300005548 Ga0070665_100258566 Ga0070665_1002585662 140
108 3300005548 Ga0070665_101287906 Ga0070665_1012879061 140
109 3300005549 Ga0070704_100384850 Ga0070704_1003848502 140
110 3300005563 Ga0068855_100517072 Ga0068855_1005170723 140
111 3300005563 Ga0068855_101286399 Ga0068855_1012863991 140
112 3300005563 Ga0068855_102163076 Ga0068855_1021630761 140
113 3300005564 Ga0070664_100102651 Ga0070664_1001026514 140
114 3300005564 Ga0070664_100325916 Ga0070664_1003259162 140
115 3300005577 Ga0068857_100517918 Ga0068857_1005179182 140
116 3300005577 Ga0068857_100579002 Ga0068857_1005790022 140
117 3300005577 Ga0068857_100826386 Ga0068857_1008263862 140
118 3300005577 Ga0068857_100961268 Ga0068857_1009612681 140
119 3300005577 Ga0068857_101216416 Ga0068857_1012164162 140
120 3300005578 Ga0068854_100263146 Ga0068854_1002631462 140
121 3300005578 Ga0068854_100513327 Ga0068854_1005133271 140
122 3300005578 Ga0068854_101440975 Ga0068854_1014409751 140
123 3300005614 Ga0068856_100083626 Ga0068856_1000836261 140
124 3300005614 Ga0068856_100112827 Ga0068856_1001128273 140
125 3300005614 Ga0068856_100344597 Ga0068856_1003445973 140
126 3300005614 Ga0068856_100593425 Ga0068856_1005934252 140
127 3300005616 Ga0068852_100033207 Ga0068852_1000332072 140
128 3300005616 Ga0068852_100746482 Ga0068852_1007464822 140
129 3300005618 Ga0068864_100149906 Ga0068864_1001499062 140
130 3300005618 Ga0068864_100174877 Ga0068864_1001748772 140
131 3300005618 Ga0068864_100562715 Ga0068864_1005627152 140
132 3300005718 Ga0068866_10223007 Ga0068866_102230072 140
133 3300005719 Ga0068861_100002290 Ga0068861_10000229012 140
134 3300005834 Ga0068851_10549095 Ga0068851_105490951 140
135 3300005840 Ga0068870_10894200 Ga0068870_108942001 140
136 3300005842 Ga0068858_100269198 Ga0068858_1002691984 140
137 3300005843 Ga0068860_100006672 Ga0068860_1000066722 140
138 3300005843 Ga0068860_100010477 Ga0068860_1000104777 140
139 3300005843 Ga0068860_100201562 Ga0068860_1002015622 140
140 3300005843 Ga0068860_100492781 Ga0068860_1004927812 140
141 3300005844 Ga0068862_100069735 Ga0068862_1000697352 140
142 3300005844 Ga0068862_100376521 Ga0068862_1003765213 140
143 3300005937 Ga0081455_10000806 Ga0081455_1000080622 140
144 3300005937 Ga0081455_10117215 Ga0081455_101172152 140
145 3300005937 Ga0081455_10256957 Ga0081455_102569571 140
146 3300005983 Ga0081540_1004991 Ga0081540_10049919 140
147 3300005983 Ga0081540_1032904 Ga0081540_10329043 140
148 3300005985 Ga0081539_10010022 Ga0081539_100100222 140
149 3300006028 Ga0070717_10000290 Ga0070717_1000029023 140
150 3300006038 Ga0075365_10019235 Ga0075365_100192352 140
151 3300006038 Ga0075365_10206913 Ga0075365_102069133 140
152 3300006042 Ga0075368_10090302 Ga0075368_100903022 140
153 3300006048 Ga0075363_100045378 Ga0075363_1000453783 140
154 3300006048 Ga0075363_100609719 Ga0075363_1006097191 140
155 3300006051 Ga0075364_10077688 Ga0075364_100776881 140
156 3300006051 Ga0075364_10628679 Ga0075364_106286792 140
157 3300006051 Ga0075364_10654504 Ga0075364_106545042 140
158 3300006058 Ga0075432_10096927 Ga0075432_100969272 140
159 3300006163 Ga0070715_10063594 Ga0070715_100635943 140
160 3300006163 Ga0070715_10129677 Ga0070715_101296772 140
161 3300006163 Ga0070715_10172437 Ga0070715_101724372 140
162 3300006175 Ga0070712_100003789 Ga0070712_1000037898 140
163 3300006175 Ga0070712_100091326 Ga0070712_1000913264 140
164 3300006175 Ga0070712_100265700 Ga0070712_1002657002 140
165 3300006175 Ga0070712_101412594 Ga0070712_1014125941 140
166 3300006177 Ga0075362_10003772 Ga0075362_100037725 140
167 3300006177 Ga0075362_10005498 Ga0075362_100054983 140
168 3300006178 Ga0075367_10023776 Ga0075367_100237764 140
169 3300006178 Ga0075367_10263779 Ga0075367_102637793 140
170 3300006178 Ga0075367_10400103 Ga0075367_104001032 140
171 3300006186 Ga0075369_10002609 Ga0075369_100026093 140
172 3300006186 Ga0075369_10273997 Ga0075369_102739972 140
173 3300006237 Ga0097621_100075157 Ga0097621_1000751571 140
174 3300006237 Ga0097621_100483488 Ga0097621_1004834882 140
175 3300006237 Ga0097621_100534926 Ga0097621_1005349262 140
176 3300006237 Ga0097621_101176878 Ga0097621_1011768782 140
177 3300006353 Ga0075370_10122037 Ga0075370_101220371 140
178 3300006358 Ga0068871_100013417 Ga0068871_1000134172 140
179 3300006358 Ga0068871_100106979 Ga0068871_1001069795 140
180 3300006358 Ga0068871_100162683 Ga0068871_1001626832 140
181 3300006358 Ga0068871_100180015 Ga0068871_1001800153 140
182 3300006358 Ga0068871_100212153 Ga0068871_1002121532 140
183 3300006358 Ga0068871_100229864 Ga0068871_1002298642 140
184 3300006358 Ga0068871_100529831 Ga0068871_1005298312 140
185 3300006358 Ga0068871_100926426 Ga0068871_1009264261 140
186 3300006844 Ga0075428_100744562 Ga0075428_1007445621 140
187 3300006847 Ga0075431_101216947 Ga0075431_1012169471 140
188 3300006871 Ga0075434_100083305 Ga0075434_1000833053 140
189 3300006880 Ga0075429_100775711 Ga0075429_1007757112 140
190 3300006880 Ga0075429_101229270 Ga0075429_1012292702 140
191 3300006881 Ga0068865_100003415 Ga0068865_1000034154 140
192 3300006881 Ga0068865_100329570 Ga0068865_1003295702 140
193 3300006881 Ga0068865_101341899 Ga0068865_1013418991 140
194 3300006931 Ga0097620_102137391 Ga0097620_1021373911 140
195 3300007076 Ga0075435_100854815 Ga0075435_1008548152 140
196 3300009093 Ga0105240_10116693 Ga0105240_101166933 140
197 3300009093 Ga0105240_10215739 Ga0105240_102157392 140
198 3300009093 Ga0105240_10431257 Ga0105240_104312572 140
199 3300009093 Ga0105240_10624729 Ga0105240_106247292 140
200 3300009093 Ga0105240_11005033 Ga0105240_110050332 140
201 3300009093 Ga0105240_11414497 Ga0105240_114144971 140
202 3300009094 Ga0111539_10805462 Ga0111539_108054622 140
203 3300009094 Ga0111539_10879826 Ga0111539_108798262 140
204 3300009098 Ga0105245_10019634 Ga0105245_100196343 140
205 3300009098 Ga0105245_11284469 Ga0105245_112844691 140
206 3300009174 Ga0105241_10184909 Ga0105241_101849093 140
207 3300009174 Ga0105241_10387720 Ga0105241_103877202 140
208 3300009174 Ga0105241_10582075 Ga0105241_105820752 140
209 3300009174 Ga0105241_10720818 Ga0105241_107208182 140
210 3300009174 Ga0105241_11094680 Ga0105241_110946801 140
211 3300009176 Ga0105242_10108470 Ga0105242_101084703 140
212 3300009177 Ga0105248_10167031 Ga0105248_101670313 140
213 3300009177 Ga0105248_10266351 Ga0105248_102663514 140
214 3300009177 Ga0105248_10674314 Ga0105248_106743143 140
215 3300009545 Ga0105237_10001366 Ga0105237_100013669 140
216 3300009545 Ga0105237_10319155 Ga0105237_103191552 140
217 3300009545 Ga0105237_10323101 Ga0105237_103231013 140
218 3300009545 Ga0105237_12120253 Ga0105237_121202531 140
219 3300009551 Ga0105238_10057475 Ga0105238_100574754 140
220 3300009551 Ga0105238_10265623 Ga0105238_102656233 140
221 3300009551 Ga0105238_10347011 Ga0105238_103470112 140
222 3300009551 Ga0105238_12110602 Ga0105238_121106021 140
223 3300010159 Ga0099796_10198378 Ga0099796_101983782 140
224 3300010375 Ga0105239_10001205 Ga0105239_1000120510 140
225 3300010375 Ga0105239_10006723 Ga0105239_100067236 140
226 3300010375 Ga0105239_10036920 Ga0105239_100369204 140
227 3300010375 Ga0105239_10037058 Ga0105239_100370586 140
228 3300010375 Ga0105239_10268646 Ga0105239_102686462 140
229 3300010375 Ga0105239_11232456 Ga0105239_112324562 140
230 3300010375 Ga0105239_11332958 Ga0105239_113329582 140
231 3300010375 Ga0105239_11732883 Ga0105239_117328831 140
232 3300010375 Ga0105239_12308651 Ga0105239_123086511 140
233 3300011119 Ga0105246_10085665 Ga0105246_100856654 140
234 3300011119 Ga0105246_10133300 Ga0105246_101333002 140
235 3300011119 Ga0105246_10317272 Ga0105246_103172722 140
236 3300013100 Ga0157373_10086197 Ga0157373_100861971 140
237 3300013100 Ga0157373_11084278 Ga0157373_110842781 140
238 3300013102 Ga0157371_10247348 Ga0157371_102473483 140
239 3300013105 Ga0157369_10046598 Ga0157369_100465984 140
240 3300013105 Ga0157369_10264089 Ga0157369_102640892 140
241 3300013105 Ga0157369_10367000 Ga0157369_103670002 140
242 3300013105 Ga0157369_10566676 Ga0157369_105666762 140
243 3300013105 Ga0157369_10585996 Ga0157369_105859962 140
244 3300013297 Ga0157378_10611371 Ga0157378_106113711 140
245 3300013297 Ga0157378_11665573 Ga0157378_116655731 140
246 3300013306 Ga0163162_10061302 Ga0163162_100613023 140
247 3300013306 Ga0163162_10090110 Ga0163162_100901102 140
248 3300013306 Ga0163162_10760468 Ga0163162_107604681 140
249 3300013306 Ga0163162_12615802 Ga0163162_126158021 140
250 3300013307 Ga0157372_10136745 Ga0157372_101367454 140
251 3300013307 Ga0157372_11103637 Ga0157372_111036372 140
252 3300013308 Ga0157375_10039100 Ga0157375_100391003 140
253 3300013308 Ga0157375_11157164 Ga0157375_111571642 140
254 3300013308 Ga0157375_12539150 Ga0157375_125391501 140
255 3300013308 Ga0157375_12932832 Ga0157375_129328321 140
256 3300014325 Ga0163163_10097627 Ga0163163_100976275 140
257 3300014325 Ga0163163_10517366 Ga0163163_105173662 140
258 3300014326 Ga0157380_10031835 Ga0157380_100318351 140
259 3300014497 Ga0182008_10196181 Ga0182008_101961811 140
260 3300014745 Ga0157377_11146391 Ga0157377_111463911 140
261 3300014968 Ga0157379_10049892 Ga0157379_100498922 140
262 3300014968 Ga0157379_10277336 Ga0157379_102773363 140
263 3300014968 Ga0157379_11165176 Ga0157379_111651761 140
264 3300014968 Ga0157379_11368790 Ga0157379_113687902 140
265 3300014969 Ga0157376_10030553 Ga0157376_100305533 140
266 3300014969 Ga0157376_10389639 Ga0157376_103896392 140
267 3300017792 Ga0163161_10039338 Ga0163161_100393385 140
268 3300020076 Ga0206355_1080318 Ga0206355_10803182 140
269 3300021358 Ga0213873_10000006 Ga0213873_10000006309 140
270 3300021361 Ga0213872_10000983 Ga0213872_1000098313 140
271 3300021361 Ga0213872_10036611 Ga0213872_100366111 140
272 3300021361 Ga0213872_10042438 Ga0213872_100424381 140
273 3300021361 Ga0213872_10044484 Ga0213872_100444842 140
274 3300021361 Ga0213872_10377652 Ga0213872_103776521 140
275 3300021377 Ga0213874_10285461 Ga0213874_102854612 140
276 3300021384 Ga0213876_10000004 Ga0213876_10000004815 140
277 3300021384 Ga0213876_10049016 Ga0213876_100490162 140
278 3300021388 Ga0213875_10010160 Ga0213875_100101603 140
279 3300021388 Ga0213875_10163320 Ga0213875_101633202 140
280 3300025231 Ga0207427_103164 Ga0207427_1031642 140
281 3300025261 Ga0209233_1000013 Ga0209233_1000013229 140
282 3300025261 Ga0209233_1008420 Ga0209233_10084202 140
283 3300025294 Ga0209025_1104234 Ga0209025_11042341 140
284 3300025297 Ga0209758_1110660 Ga0209758_11106601 140
285 3300025321 Ga0207656_10193494 Ga0207656_101934942 140
286 3300025898 Ga0207692_10358598 Ga0207692_103585981 140
287 3300025899 Ga0207642_10159764 Ga0207642_101597642 140
288 3300025901 Ga0207688_10120782 Ga0207688_101207822 140
289 3300025903 Ga0207680_10349009 Ga0207680_103490092 140
290 3300025904 Ga0207647_10079224 Ga0207647_100792242 140
291 3300025905 Ga0207685_10282088 Ga0207685_102820882 140
292 3300025906 Ga0207699_10174558 Ga0207699_101745582 140
293 3300025906 Ga0207699_10643239 Ga0207699_106432391 140
294 3300025907 Ga0207645_10488504 Ga0207645_104885042 140
295 3300025909 Ga0207705_10102679 Ga0207705_101026793 140
296 3300025909 Ga0207705_10402901 Ga0207705_104029012 140
297 3300025909 Ga0207705_10453389 Ga0207705_104533892 140
298 3300025910 Ga0207684_10000187 Ga0207684_1000018756 140
299 3300025911 Ga0207654_10007677 Ga0207654_100076772 140
300 3300025911 Ga0207654_10257806 Ga0207654_102578063 140
301 3300025911 Ga0207654_10612417 Ga0207654_106124171 140
302 3300025912 Ga0207707_10002733 Ga0207707_100027332 140
303 3300025912 Ga0207707_10236826 Ga0207707_102368262 140
304 3300025912 Ga0207707_10590922 Ga0207707_105909222 140
305 3300025912 Ga0207707_11105971 Ga0207707_111059711 140
306 3300025913 Ga0207695_10005412 Ga0207695_100054126 140
307 3300025913 Ga0207695_10254102 Ga0207695_102541022 140
308 3300025913 Ga0207695_10275533 Ga0207695_102755332 140
309 3300025913 Ga0207695_10285054 Ga0207695_102850543 140
310 3300025913 Ga0207695_10436831 Ga0207695_104368312 140
311 3300025913 Ga0207695_10465046 Ga0207695_104650462 140
312 3300025913 Ga0207695_10530406 Ga0207695_105304062 140
313 3300025914 Ga0207671_10000215 Ga0207671_1000021520 140
314 3300025914 Ga0207671_10119984 Ga0207671_101199843 140
315 3300025914 Ga0207671_10497382 Ga0207671_104973821 140
316 3300025914 Ga0207671_10513523 Ga0207671_105135232 140
317 3300025914 Ga0207671_10524056 Ga0207671_105240561 140
318 3300025914 Ga0207671_10590595 Ga0207671_105905951 140
319 3300025915 Ga0207693_10002047 Ga0207693_1000204714 140
320 3300025915 Ga0207693_10025243 Ga0207693_100252432 140
321 3300025915 Ga0207693_10088056 Ga0207693_100880562 140
322 3300025915 Ga0207693_10132050 Ga0207693_101320501 140
323 3300025916 Ga0207663_10313026 Ga0207663_103130263 140
324 3300025916 Ga0207663_10338018 Ga0207663_103380181 140
325 3300025916 Ga0207663_10436065 Ga0207663_104360651 140
326 3300025917 Ga0207660_10207612 Ga0207660_102076122 140
327 3300025917 Ga0207660_10353996 Ga0207660_103539961 140
328 3300025917 Ga0207660_11103373 Ga0207660_111033731 140
329 3300025918 Ga0207662_10476222 Ga0207662_104762223 140
330 3300025919 Ga0207657_10019120 Ga0207657_100191203 140
331 3300025919 Ga0207657_10046310 Ga0207657_100463101 140
332 3300025919 Ga0207657_11271663 Ga0207657_112716631 140
333 3300025920 Ga0207649_10561743 Ga0207649_105617432 140
334 3300025920 Ga0207649_10614118 Ga0207649_106141183 140
335 3300025920 Ga0207649_10615911 Ga0207649_106159112 140
336 3300025920 Ga0207649_10666721 Ga0207649_106667211 140
337 3300025921 Ga0207652_10018130 Ga0207652_100181309 140
338 3300025921 Ga0207652_10025573 Ga0207652_100255733 140
339 3300025921 Ga0207652_10028271 Ga0207652_100282712 140
340 3300025921 Ga0207652_10463688 Ga0207652_104636881 140
341 3300025922 Ga0207646_10103202 Ga0207646_101032023 140
342 3300025922 Ga0207646_11403347 Ga0207646_114033471 140
343 3300025924 Ga0207694_10110792 Ga0207694_101107923 140
344 3300025924 Ga0207694_10134060 Ga0207694_101340604 140
345 3300025924 Ga0207694_10379916 Ga0207694_103799162 140
346 3300025926 Ga0207659_10152549 Ga0207659_101525491 140
347 3300025926 Ga0207659_10911497 Ga0207659_109114971 140
348 3300025927 Ga0207687_10792244 Ga0207687_107922442 140
349 3300025927 Ga0207687_11794846 Ga0207687_117948461 140
350 3300025928 Ga0207700_10399523 Ga0207700_103995232 140
351 3300025928 Ga0207700_10510114 Ga0207700_105101142 140
352 3300025929 Ga0207664_10017404 Ga0207664_100174045 140
353 3300025931 Ga0207644_10128669 Ga0207644_101286694 140
354 3300025931 Ga0207644_11381410 Ga0207644_113814102 140
355 3300025934 Ga0207686_10019155 Ga0207686_100191554 140
356 3300025935 Ga0207709_11217275 Ga0207709_112172752 140
357 3300025937 Ga0207669_10150377 Ga0207669_101503774 140
358 3300025938 Ga0207704_10932533 Ga0207704_109325331 140
359 3300025940 Ga0207691_10962499 Ga0207691_109624992 140
360 3300025940 Ga0207691_11629941 Ga0207691_116299411 140
361 3300025941 Ga0207711_10586261 Ga0207711_105862612 140
362 3300025942 Ga0207689_11264974 Ga0207689_112649741 140
363 3300025944 Ga0207661_10033505 Ga0207661_100335051 140
364 3300025944 Ga0207661_10121335 Ga0207661_101213352 140
365 3300025944 Ga0207661_10281971 Ga0207661_102819712 140
366 3300025944 Ga0207661_10285298 Ga0207661_102852981 140
367 3300025945 Ga0207679_10073357 Ga0207679_100733573 140
368 3300025949 Ga0207667_10329217 Ga0207667_103292172 140
369 3300025949 Ga0207667_10333950 Ga0207667_103339501 140
370 3300025949 Ga0207667_10335622 Ga0207667_103356222 140
371 3300025949 Ga0207667_10809122 Ga0207667_108091222 140
372 3300025960 Ga0207651_10205872 Ga0207651_102058722 140
373 3300025960 Ga0207651_10351246 Ga0207651_103512462 140
374 3300025972 Ga0207668_10004161 Ga0207668_100041617 140
375 3300025972 Ga0207668_10012637 Ga0207668_100126372 140
376 3300025972 Ga0207668_10695987 Ga0207668_106959872 140
377 3300025981 Ga0207640_10445781 Ga0207640_104457812 140
378 3300025981 Ga0207640_11129328 Ga0207640_111293282 140
379 3300025981 Ga0207640_11509659 Ga0207640_115096591 140
380 3300025981 Ga0207640_12038871 Ga0207640_120388711 140
381 3300025986 Ga0207658_11174395 Ga0207658_111743952 140
382 3300026023 Ga0207677_10245656 Ga0207677_102456561 140
383 3300026023 Ga0207677_10273867 Ga0207677_102738672 140
384 3300026023 Ga0207677_10951401 Ga0207677_109514012 140
385 3300026023 Ga0207677_11699758 Ga0207677_116997581 140
386 3300026035 Ga0207703_10261252 Ga0207703_102612522 140
387 3300026035 Ga0207703_10529254 Ga0207703_105292542 140
388 3300026041 Ga0207639_10010321 Ga0207639_100103213 140
389 3300026041 Ga0207639_10015553 Ga0207639_100155532 140
390 3300026041 Ga0207639_10210219 Ga0207639_102102192 140
391 3300026041 Ga0207639_11029158 Ga0207639_110291582 140
392 3300026067 Ga0207678_10154400 Ga0207678_101544002 140
393 3300026067 Ga0207678_10200320 Ga0207678_102003202 140
394 3300026075 Ga0207708_10645277 Ga0207708_106452771 140
395 3300026078 Ga0207702_10189328 Ga0207702_101893281 140
396 3300026078 Ga0207702_10237444 Ga0207702_102374442 140
397 3300026078 Ga0207702_10439001 Ga0207702_104390011 140
398 3300026095 Ga0207676_10357734 Ga0207676_103577342 140
399 3300026095 Ga0207676_11179140 Ga0207676_111791402 140
400 3300026116 Ga0207674_10081921 Ga0207674_100819211 140
401 3300026116 Ga0207674_10118233 Ga0207674_101182335 140
402 3300026116 Ga0207674_11114418 Ga0207674_111144181 140
403 3300026116 Ga0207674_11877331 Ga0207674_118773312 140
404 3300026118 Ga0207675_100011142 Ga0207675_1000111424 140
405 3300026121 Ga0207683_10012229 Ga0207683_100122295 140
406 3300026121 Ga0207683_10036383 Ga0207683_100363835 140
407 3300026121 Ga0207683_10081825 Ga0207683_100818252 140
408 3300026121 Ga0207683_10429533 Ga0207683_104295331 140
409 3300026142 Ga0207698_10034727 Ga0207698_100347272 140
410 3300026142 Ga0207698_10656215 Ga0207698_106562152 140
411 3300027364 Ga0209967_1057317 Ga0209967_10573171 140
412 3300027876 Ga0209974_10063155 Ga0209974_100631552 140
413 3300028379 Ga0268266_10000255 Ga0268266_1000025556 140
414 3300028379 Ga0268266_10004374 Ga0268266_1000437415 140
415 3300028379 Ga0268266_10092631 Ga0268266_100926313 140
416 3300028379 Ga0268266_10196407 Ga0268266_101964072 140
417 3300028379 Ga0268266_10239319 Ga0268266_102393192 140
418 3300028379 Ga0268266_11441368 Ga0268266_114413681 140
419 3300028379 Ga0268266_12246922 Ga0268266_122469221 140
420 3300028380 Ga0268265_10383593 Ga0268265_103835933 140
421 3300028380 Ga0268265_10478858 Ga0268265_104788582 140
422 3300028380 Ga0268265_10537970 Ga0268265_105379701 140
423 3300028380 Ga0268265_11192389 Ga0268265_111923892 140
424 3300028381 Ga0268264_10002617 Ga0268264_100026178 140
425 3300028381 Ga0268264_10053068 Ga0268264_100530685 140
426 3300028381 Ga0268264_10513500 Ga0268264_105135002 140
427 3300028577 Ga0265318_10298392 Ga0265318_102983921 140
428 3300028800 Ga0265338_10000005 Ga0265338_1000000539 140
429 3300028800 Ga0265338_10011268 Ga0265338_100112684 140
430 3300028800 Ga0265338_10097883 Ga0265338_100978832 140
431 3300028800 Ga0265338_10293608 Ga0265338_102936081 140
432 3300029957 Ga0265324_10152468 Ga0265324_101524682 140
433 3300031235 Ga0265330_10118365 Ga0265330_101183652 140
434 3300031238 Ga0265332_10015915 Ga0265332_100159153 140
435 3300031238 Ga0265332_10025815 Ga0265332_100258152 140
436 3300031238 Ga0265332_10266006 Ga0265332_102660061 140
437 3300031238 Ga0265332_10343907 Ga0265332_103439071 140
438 3300031239 Ga0265328_10204374 Ga0265328_102043742 140
439 3300031240 Ga0265320_10001181 Ga0265320_100011818 140
440 3300031241 Ga0265325_10000010 Ga0265325_10000010145 140
441 3300031241 Ga0265325_10058000 Ga0265325_100580003 140
442 3300031241 Ga0265325_10204386 Ga0265325_102043862 140
443 3300031247 Ga0265340_10010366 Ga0265340_100103667 140
444 3300031247 Ga0265340_10065981 Ga0265340_100659811 140
445 3300031249 Ga0265339_10000373 Ga0265339_1000037330 140
446 3300031249 Ga0265339_10084492 Ga0265339_100844922 140
447 3300031250 Ga0265331_10009117 Ga0265331_100091175 140
448 3300031250 Ga0265331_10018151 Ga0265331_100181513 140
449 3300031344 Ga0265316_10075465 Ga0265316_100754653 140
450 3300031344 Ga0265316_10435102 Ga0265316_104351021 140
451 3300031344 Ga0265316_10666866 Ga0265316_106668662 140
452 3300031456 Ga0307513_10334202 Ga0307513_103342022 140
453 3300031456 Ga0307513_10401987 Ga0307513_104019872 140
454 3300031456 Ga0307513_10450900 Ga0307513_104509002 140
455 3300031548 Ga0307408_100013197 Ga0307408_1000131974 140
456 3300031548 Ga0307408_101326995 Ga0307408_1013269951 140
457 3300031595 Ga0265313_10000061 Ga0265313_1000006150 140
458 3300031595 Ga0265313_10000828 Ga0265313_1000082830 140
459 3300031595 Ga0265313_10028345 Ga0265313_100283452 140
460 3300031616 Ga0307508_10327649 Ga0307508_103276491 140
461 3300031665 Ga0316575_10184397 Ga0316575_101843971 140
462 3300031711 Ga0265314_10009980 Ga0265314_100099804 140
463 3300031711 Ga0265314_10038094 Ga0265314_100380942 140
464 3300031711 Ga0265314_10049498 Ga0265314_100494982 140
465 3300031712 Ga0265342_10053041 Ga0265342_100530412 140
466 3300031727 Ga0316576_10085879 Ga0316576_100858792 140
467 3300031727 Ga0316576_10151481 Ga0316576_101514812 140
468 3300031728 Ga0316578_10013246 Ga0316578_100132465 140
469 3300031731 Ga0307405_10060563 Ga0307405_100605632 140
470 3300031731 Ga0307405_10179371 Ga0307405_101793713 140
471 3300031731 Ga0307405_10357061 Ga0307405_103570611 140
472 3300031731 Ga0307405_10673941 Ga0307405_106739412 140
473 3300031731 Ga0307405_10905464 Ga0307405_109054642 140
474 3300031824 Ga0307413_11591256 Ga0307413_115912561 140
475 3300031824 Ga0307413_12139944 Ga0307413_121399441 140
476 3300031901 Ga0307406_10032811 Ga0307406_100328114 140
477 3300031901 Ga0307406_10319090 Ga0307406_103190903 140
478 3300031901 Ga0307406_10636970 Ga0307406_106369701 140
479 3300031901 Ga0307406_11955506 Ga0307406_119555061 140
480 3300031911 Ga0307412_10049726 Ga0307412_100497263 140
481 3300031911 Ga0307412_10083369 Ga0307412_100833692 140
482 3300031911 Ga0307412_10396299 Ga0307412_103962992 140
483 3300031911 Ga0307412_10502805 Ga0307412_105028052 140
484 3300031911 Ga0307412_11362387 Ga0307412_113623871 140
485 3300031911 Ga0307412_12216913 Ga0307412_122169131 140
486 3300031995 Ga0307409_100555221 Ga0307409_1005552211 140
487 3300032002 Ga0307416_100083043 Ga0307416_1000830434 140
488 3300032002 Ga0307416_100132367 Ga0307416_1001323674 140
489 3300032002 Ga0307416_100597755 Ga0307416_1005977554 140
490 3300032002 Ga0307416_100974942 Ga0307416_1009749422 140
491 3300032004 Ga0307414_10225921 Ga0307414_102259211 140
492 3300032004 Ga0307414_10357003 Ga0307414_103570033 140
493 3300032004 Ga0307414_10395749 Ga0307414_103957491 140
494 3300032004 Ga0307414_10846754 Ga0307414_108467541 140
495 3300032005 Ga0307411_11027870 Ga0307411_110278701 140
496 3300032126 Ga0307415_101269848 Ga0307415_1012698481 140
497 3300032168 Ga0316593_10000847 Ga0316593_100008479 140
498 3300033180 Ga0307510_10145191 Ga0307510_101451912 140
499 3300034817 Ga0373948_0086003 Ga0373948_0086003_54_476 140
500 3300035085 Ga0373929_0188114 Ga0373929_0188114_50_472 140
501 3300035088 Ga0373940_0334055 Ga0373940_0334055_16_438 140
502 3300035088 Ga0373940_0356208 Ga0373940_0356208_33_455 140
503 3300035089 Ga0373944_0109144 Ga0373944_0109144_333_755 140
504 3300035091 Ga0373951_0198404 Ga0373951_0198404_12_434 140
505 3300035091 Ga0373951_0222829 Ga0373951_0222829_51_473 140
506 3300035114 Ga0373939_0064762 Ga0373939_0064762_496_918 140
507 3300035114 Ga0373939_0122979 Ga0373939_0122979_45_467 140
508 3300035115 Ga0373941_0146263 Ga0373941_0146263_120_542 140
509 3300035119 Ga0373956_0450836 Ga0373956_0450836_38_460 140
510 3300035119 Ga0373956_0559276 Ga0373956_0559276_68_490 140
511 3300035171 Ga0373946_0093729 Ga0373946_0093729_25_447 140
512 3300035171 Ga0373946_0374259 Ga0373946_0374259_278_700 140
513 3300035207 Ga0373942_0022446 Ga0373942_0022446_472_894 140
514 3300035398 Ga0316574_0172536 Ga0316574_0172536_235_657 140
515 3300035398 Ga0316574_0614307 Ga0316574_0614307_167_589 140
516 3300035410 Ga0373924_0223198 Ga0373924_0223198_377_799 140
517 3300035691 Ga0373931_0041082 Ga0373931_0041082_649_1071 140
518 3300035691 Ga0373931_0257423 Ga0373931_0257423_221_649 140
519 3300035692 Ga0373935_1007584 Ga0373935_1007584_170_592 140
520 3300035695 Ga0373927_0236199 Ga0373927_0236199_540_962 140
521 3300035724 Ga0373933_0564622 Ga0373933_0564622_36_473 140
522 3300035725 Ga0373947_0416397 Ga0373947_0416397_17_439 140
523 3300036401 Ga0373937_0210435 Ga0373937_0210435_769_1191 140
524 3300036401 Ga0373937_0670668 Ga0373937_0670668_144_566 140
525 3300036401 Ga0373937_1282315 Ga0373937_1282315_175_597 140
526 3300036647 Ga0316582_0003393 Ga0316582_0003393_4305_4736 140
527 3300036647 Ga0316582_0115891 Ga0316582_0115891_40_471 140
528 3300036647 Ga0316582_1015016 Ga0316582_1015016_18_446 140
529 3300036712 Ga0316584_0020971 Ga0316584_0020971_2241_2663 140
530 3300036712 Ga0316584_0247088 Ga0316584_0247088_476_907 140
531 3300036712 Ga0316584_0355146 Ga0316584_0355146_57_479 140
532 3300037068 Ga0373925_0395997 Ga0373925_0395997_510_932 140
533 3300037312 Ga0395899_0026647 Ga0395899_0026647_1786_2379 140
534 3300037312 Ga0395899_0035389 Ga0395899_0035389_3111_3533 140
535 3300037312 Ga0395899_0097318 Ga0395899_0097318_1179_1601 140
536 3300037312 Ga0395899_0104340 Ga0395899_0104340_1398_1820 140
537 3300037418 Ga0395900_0034816 Ga0395900_0034816_3829_4251 140
538 3300037418 Ga0395900_0045605 Ga0395900_0045605_2963_3385 140
539 3300037418 Ga0395900_0305576 Ga0395900_0305576_1093_1515 140
540 3300037418 Ga0395900_0461224 Ga0395900_0461224_527_949 140
541 3300037418 Ga0395900_0753309 Ga0395900_0753309_449_871 140
542 3300037466 Ga0395898_0210121 Ga0395898_0210121_64_486 140
543 3300037853 Ga0436364_0264635 Ga0436364_0264635_426_848 140
544 3300037853 Ga0436364_1059469 Ga0436364_1059469_610_1032 140
545 3300037853 Ga0436364_1079956 Ga0436364_1079956_33149_33571 140
546 3300038443 Ga0395901_0005738 Ga0395901_0005738_397_819 140
547 3300038443 Ga0395901_0015570 Ga0395901_0015570_4763_5185 140
548 3300038443 Ga0395901_0107493 Ga0395901_0107493_383_805 140
549 3300038443 Ga0395901_0377066 Ga0395901_0377066_218_640 140
550 3300038742 Ga0400486_27314 Ga0400486_27314_872_1294 140
551 3300039062 Ga0400483_016015 Ga0400483_016015_18_440 140
552 3300039062 Ga0400483_086626 Ga0400483_086626_192_623 140
553 3300039062 Ga0400483_193353 Ga0400483_193353_2226_2657 140
554 3300039110 Ga0400487_30510 Ga0400487_30510_851_1273 140
555 3300039437 Ga0436365_0974653 Ga0436365_0974653_1407_1829 140
556 3300039437 Ga0436365_1018356 Ga0436365_1018356_73_495 140
557 3300039437 Ga0436365_1215130 Ga0436365_1215130_33035_33457 140
558 3300039437 Ga0436365_1575237 Ga0436365_1575237_178_600 140
559 3300039438 Ga0436360_0206959 Ga0436360_0206959_67_489 140
560 3300039438 Ga0436360_0218419 Ga0436360_0218419_170_592 140
561 3300039438 Ga0436360_0317148 Ga0436360_0317148_430_852 140
562 3300039438 Ga0436360_0393048 Ga0436360_0393048_33_455 140
563 3300039438 Ga0436360_0505912 Ga0436360_0505912_732_1160 140
564 3300039438 Ga0436360_0560103 Ga0436360_0560103_266_688 140
565 3300039438 Ga0436360_0580300 Ga0436360_0580300_53_478 140
566 3300039438 Ga0436360_0878555 Ga0436360_0878555_184_612 140
567 3300039438 Ga0436360_1095219 Ga0436360_1095219_243_665 140
568 3300039447 Ga0436361_0106955 Ga0436361_0106955_187_615 140
569 3300039447 Ga0436361_0134909 Ga0436361_0134909_6437_6859 140
570 3300039447 Ga0436361_0138415 Ga0436361_0138415_204_626 140
571 3300039447 Ga0436361_0256903 Ga0436361_0256903_822_1244 140
572 3300039447 Ga0436361_0346208 Ga0436361_0346208_1638_2060 140
573 3300039447 Ga0436361_0467613 Ga0436361_0467613_1039_1461 140
574 3300039447 Ga0436361_0487620 Ga0436361_0487620_41_463 140
575 3300039447 Ga0436361_0549993 Ga0436361_0549993_94_516 140
576 3300039447 Ga0436361_0599707 Ga0436361_0599707_44_466 140
577 3300039447 Ga0436361_0745675 Ga0436361_0745675_2725_3147 140
578 3300039447 Ga0436361_0793900 Ga0436361_0793900_642_1064 140
579 3300039447 Ga0436361_1011398 Ga0436361_1011398_194_616 140
580 3300039450 Ga0436363_0680414 Ga0436363_0680414_1327_1755 140
581 3300039450 Ga0436363_0974827 Ga0436363_0974827_161_583 140
582 3300039453 Ga0436362_0094317 Ga0436362_0094317_33035_33457 140
583 3300039453 Ga0436362_0314308 Ga0436362_0314308_10_432 140
584 3300039453 Ga0436362_0483970 Ga0436362_0483970_106_528 140
585 3300039453 Ga0436362_0666367 Ga0436362_0666367_587_1015 140
586 3300041411 Ga0439466_0100923 Ga0439466_0100923_392_814 140
587 3300041413 Ga0439465_0041838 Ga0439465_0041838_444_866 140
588 3300041413 Ga0439465_0069318 Ga0439465_0069318_135_557 140
589 3300041452 Ga0451793_1667793 Ga0451793_1667793_202_624 140
590 3300041460 Ga0451802_0135419 Ga0451802_0135419_54_476 140
591 3300041463 Ga0451804_0787161 Ga0451804_0787161_175_597 140
592 3300041509 Ga0451843_0179471 Ga0451843_0179471_21_443 140
593 3300042001 Ga0439441_031129 Ga0439441_031129_466_888 140
594 3300042002 Ga0439442_048632 Ga0439442_048632_133_555 140
595 3300042004 Ga0439445_0040567 Ga0439445_0040567_787_1209 140
596 3300042004 Ga0439445_0091446 Ga0439445_0091446_382_804 140
597 3300042010 Ga0439452_123423 Ga0439452_123423_116_538 140
598 3300042013 Ga0439456_122885 Ga0439456_122885_34_456 140
599 3300042876 Ga0451577_0000124 Ga0451577_0000124_118702_119139 140
600 3300042876 Ga0451577_0001018 Ga0451577_0001018_17913_18359 140
601 3300042876 Ga0451577_0106914 Ga0451577_0106914_424_846 140
602 3300042876 Ga0451577_0176617 Ga0451577_0176617_670_1092 140
603 3300042876 Ga0451577_0181870 Ga0451577_0181870_79_501 140
604 3300042876 Ga0451577_0224830 Ga0451577_0224830_590_1012 140
605 3300044683 Ga0466965_0105634 Ga0466965_0105634_116_538 140
606 3300044712 Ga0453684_0000015 Ga0453684_0000015_140295_140717 140
607 3300044712 Ga0453684_0000020 Ga0453684_0000020_141294_141716 140
608 3300044712 Ga0453684_0000239 Ga0453684_0000239_185822_186259 140
609 3300044712 Ga0453684_0000498 Ga0453684_0000498_88539_88985 140
610 3300044712 Ga0453684_0022198 Ga0453684_0022198_4778_5200 140
611 3300044712 Ga0453684_0026561 Ga0453684_0026561_1603_2025 140
612 3300044712 Ga0453684_0101448 Ga0453684_0101448_2636_3157 140
613 3300044842 Ga0466957_0884459 Ga0466957_0884459_174_596 140
614 3300045051 Ga0451576_0000040 Ga0451576_0000040_254046_254468 140
615 3300045051 Ga0451576_0001132 Ga0451576_0001132_43335_43757 140
616 3300045051 Ga0451576_0050028 Ga0451576_0050028_1540_1962 140
617 3300045051 Ga0451576_0058213 Ga0451576_0058213_1726_2148 140
618 3300045051 Ga0451576_0443241 Ga0451576_0443241_31_453 140
619 3300045051 Ga0451576_0557249 Ga0451576_0557249_91_528 140
620 3300045051 Ga0451576_1683978 Ga0451576_1683978_178_600 140
621 3300046460 Ga0495638_0003562 Ga0495638_0003562_1893_2324 140
622 3300046462 Ga0495651_0141560 Ga0495651_0141560_968_1390 140
623 3300046472 Ga0495580_0244175 Ga0495580_0244175_265_687 140
624 3300046472 Ga0495580_0771354 Ga0495580_0771354_21_443 140
625 3300046473 Ga0495582_0266015 Ga0495582_0266015_58_480 140
626 3300046491 Ga0495584_0273656 Ga0495584_0273656_247_669 140
627 3300046506 Ga0495583_0192270 Ga0495583_0192270_168_590 140
628 3300046507 Ga0495606_0195158 Ga0495606_0195158_30_452 140
629 3300046516 Ga0495628_0077221 Ga0495628_0077221_1813_2235 140
630 3300046516 Ga0495628_0395705 Ga0495628_0395705_130_552 140
631 3300046522 Ga0495643_0031204 Ga0495643_0031204_1619_2041 140
632 3300046524 Ga0495648_0151786 Ga0495648_0151786_615_1037 140
633 3300046537 Ga0495598_0223787 Ga0495598_0223787_162_584 140
634 3300046538 Ga0495609_0068453 Ga0495609_0068453_263_685 140
635 3300046542 Ga0495597_0057804 Ga0495597_0057804_1176_1598 140
636 3300046543 Ga0495645_0502817 Ga0495645_0502817_70_492 140
637 3300046543 Ga0495645_0674327 Ga0495645_0674327_23_445 140
638 3300046615 Ga0495656_0610184 Ga0495656_0610184_150_572 140
639 3300046660 Ga0495625_0003057 Ga0495625_0003057_7313_7744 140
640 3300046665 Ga0495661_0237856 Ga0495661_0237856_459_881 140
641 3300046679 Ga0495623_0215131 Ga0495623_0215131_603_1025 140
642 3300046684 Ga0495669_0112184 Ga0495669_0112184_797_1219 140
643 3300046684 Ga0495669_0266778 Ga0495669_0266778_213_635 140
644 3300046691 Ga0495670_0413751 Ga0495670_0413751_222_644 140
645 3300046694 Ga0495649_0266017 Ga0495649_0266017_129_551 140
646 3300046794 Ga0495589_0084446 Ga0495589_0084446_53_475 140
647 3300047318 Ga0495636_0148726 Ga0495636_0148726_443_865 140
648 3300047321 Ga0495676_0347164 Ga0495676_0347164_186_608 140
649 3300047322 Ga0495680_0036126 Ga0495680_0036126_3502_3924 140
650 3300047444 Ga0495675_0248569 Ga0495675_0248569_19_441 140
651 3300047472 Ga0495686_0278534 Ga0495686_0278534_412_834 140
652 3300048088 Ga0495602_0692626 Ga0495602_0692626_14_436 140
653 3300048905 Ga0496102_0183568 Ga0496102_0183568_244_666 140
654 3300048905 Ga0496102_1267607 Ga0496102_1267607_52_480 140
655 3300048913 Ga0496110_1513745 Ga0496110_1513745_53_475 140
656 3300048915 Ga0496112_0322988 Ga0496112_0322988_746_1168 140
657 3300048919 Ga0496116_0292029 Ga0496116_0292029_246_668 140
658 3300048920 Ga0496117_0024717 Ga0496117_0024717_3869_4291 140
659 3300048921 Ga0496118_0001677 Ga0496118_0001677_18515_18937 140
660 3300048921 Ga0496118_0269869 Ga0496118_0269869_507_938 140
661 3300048924 Ga0496121_0038766 Ga0496121_0038766_131_562 140
662 3300048927 Ga0496124_0325192 Ga0496124_0325192_165_587 140
663 3300048928 Ga0496125_0001281 Ga0496125_0001281_23224_23646 140
664 3300048928 Ga0496125_0458667 Ga0496125_0458667_95_517 140
665 3300048929 Ga0496126_0069667 Ga0496126_0069667_2188_2610 140
666 3300048929 Ga0496126_0217471 Ga0496126_0217471_573_995 140
667 3300049513 Ga0501290_015074 Ga0501290_015074_132_554 140
668 3300049522 Ga0501299_051601 Ga0501299_051601_351_773 140
669 3300049523 Ga0501300_042680 Ga0501300_042680_160_582 140
670 3300049536 Ga0501320_072924 Ga0501320_072924_61_483 140
671 3300049552 Ga0501336_028113 Ga0501336_028113_13_435 140
672 3300049568 Ga0501031_0608688 Ga0501031_0608688_132_554 140
673 3300049568 Ga0501031_0964382 Ga0501031_0964382_43_465 140
674 3300049570 Ga0501033_0185278 Ga0501033_0185278_864_1286 140
675 3300049570 Ga0501033_0296937 Ga0501033_0296937_468_890 140
676 3300049571 Ga0501034_0000189 Ga0501034_0000189_43028_43450 140
677 3300049571 Ga0501034_0001822 Ga0501034_0001822_20630_21052 140
678 3300049571 Ga0501034_0037129 Ga0501034_0037129_3277_3699 140
679 3300049571 Ga0501034_0284733 Ga0501034_0284733_745_1167 140
680 3300049571 Ga0501034_0339121 Ga0501034_0339121_630_1052 140
681 3300049571 Ga0501034_0503699 Ga0501034_0503699_188_610 140
682 3300049571 Ga0501034_0836273 Ga0501034_0836273_296_718 140
683 3300049571 Ga0501034_0838718 Ga0501034_0838718_108_530 140
684 3300049571 Ga0501034_0887223 Ga0501034_0887223_192_614 140
685 3300049571 Ga0501034_0929161 Ga0501034_0929161_268_690 140
686 3300049572 Ga0501036_0538567 Ga0501036_0538567_511_933 140
687 3300049573 Ga0501037_0197960 Ga0501037_0197960_325_747 140
688 3300049573 Ga0501037_0367776 Ga0501037_0367776_510_932 140
689 3300049573 Ga0501037_0412379 Ga0501037_0412379_339_761 140
690 3300049573 Ga0501037_0527697 Ga0501037_0527697_327_749 140
691 3300049574 Ga0501038_0111292 Ga0501038_0111292_1647_2069 140
692 3300049574 Ga0501038_0259626 Ga0501038_0259626_162_584 140
693 3300049578 Ga0501042_0038384 Ga0501042_0038384_2914_3336 140
694 3300049578 Ga0501042_0309300 Ga0501042_0309300_388_810 140
695 3300049579 Ga0501043_0207612 Ga0501043_0207612_975_1397 140
696 3300049579 Ga0501043_0215268 Ga0501043_0215268_641_1063 140
697 3300049579 Ga0501043_0513601 Ga0501043_0513601_336_758 140
698 3300049579 Ga0501043_0954139 Ga0501043_0954139_95_517 140
699 3300049580 Ga0501046_0241279 Ga0501046_0241279_837_1259 140
700 3300049581 Ga0501047_0003852 Ga0501047_0003852_9272_9706 140
701 3300049581 Ga0501047_0125160 Ga0501047_0125160_1828_2250 140
702 3300049581 Ga0501047_0247897 Ga0501047_0247897_427_849 140
703 3300049581 Ga0501047_0746459 Ga0501047_0746459_350_772 140
704 3300049581 Ga0501047_0761417 Ga0501047_0761417_315_737 140
705 3300049581 Ga0501047_0902108 Ga0501047_0902108_241_663 140
706 3300049582 Ga0501048_0371991 Ga0501048_0371991_364_798 140
707 3300049582 Ga0501048_1148095 Ga0501048_1148095_76_498 140
708 3300049583 Ga0501067_0002093 Ga0501067_0002093_6629_7051 140
709 3300049583 Ga0501067_0104456 Ga0501067_0104456_46_468 140
710 3300049584 Ga0501068_0271378 Ga0501068_0271378_241_663 140
711 3300049584 Ga0501068_0387862 Ga0501068_0387862_76_498 140
712 3300049586 Ga0501070_0035746 Ga0501070_0035746_288_710 140
713 3300049586 Ga0501070_0169440 Ga0501070_0169440_475_909 140
714 3300049586 Ga0501070_0280088 Ga0501070_0280088_905_1330 140
715 3300049586 Ga0501070_0595941 Ga0501070_0595941_348_791 140
716 3300049587 Ga0501071_0808129 Ga0501071_0808129_290_712 140
717 3300049587 Ga0501071_0929740 Ga0501071_0929740_84_506 140
718 3300049588 Ga0501072_0040168 Ga0501072_0040168_2805_3239 140
719 3300049589 Ga0501073_0036999 Ga0501073_0036999_2789_3211 140
720 3300049589 Ga0501073_0137857 Ga0501073_0137857_219_641 140
721 3300049589 Ga0501073_0138866 Ga0501073_0138866_799_1221 140
722 3300049589 Ga0501073_0177787 Ga0501073_0177787_879_1301 140
723 3300049590 Ga0501074_0278611 Ga0501074_0278611_229_651 140
724 3300049591 Ga0501075_0145696 Ga0501075_0145696_1106_1540 140
725 3300049592 Ga0501076_0268651 Ga0501076_0268651_870_1292 140
726 3300049592 Ga0501076_0481890 Ga0501076_0481890_358_780 140
727 3300049663 Ga0501223_010163 Ga0501223_010163_1278_1700 140
728 3300049686 Ga0501257_000071 Ga0501257_000071_5242_5664 140
729 3300049741 Ga0501079_0445387 Ga0501079_0445387_437_859 140
730 3300049741 Ga0501079_1451850 Ga0501079_1451850_74_511 140
731 3300049742 Ga0501080_0068191 Ga0501080_0068191_1672_2094 140
732 3300049742 Ga0501080_0153043 Ga0501080_0153043_366_788 140
733 3300049742 Ga0501080_0448187 Ga0501080_0448187_605_1027 140
734 3300049742 Ga0501080_0450733 Ga0501080_0450733_651_1073 140
735 3300049742 Ga0501080_0702166 Ga0501080_0702166_130_552 140
736 3300049743 Ga0501081_1212261 Ga0501081_1212261_49_471 140
737 3300049744 Ga0501083_0101700 Ga0501083_0101700_305_727 140
738 3300049744 Ga0501083_0184331 Ga0501083_0184331_531_953 140
739 3300049744 Ga0501083_0435517 Ga0501083_0435517_363_785 140
740 3300049744 Ga0501083_0961342 Ga0501083_0961342_39_473 140
741 3300049776 Ga0501280_000241 Ga0501280_000241_1618_2040 140
742 3300049822 Ga0501035_0018260 Ga0501035_0018260_3443_3865 140
743 3300049822 Ga0501035_0103180 Ga0501035_0103180_865_1287 140
744 3300049822 Ga0501035_0365154 Ga0501035_0365154_468_890 140
745 3300049823 Ga0501044_0010936 Ga0501044_0010936_3670_4092 140
746 3300049823 Ga0501044_0097655 Ga0501044_0097655_2449_2892 140
747 3300049823 Ga0501044_0098350 Ga0501044_0098350_2119_2541 140
748 3300049823 Ga0501044_0295749 Ga0501044_0295749_474_896 140
749 3300049823 Ga0501044_0319632 Ga0501044_0319632_676_1098 140
750 3300049823 Ga0501044_0448093 Ga0501044_0448093_140_574 140
751 3300049823 Ga0501044_0460075 Ga0501044_0460075_419_841 140
752 3300049823 Ga0501044_0680930 Ga0501044_0680930_139_561 140
753 3300049823 Ga0501044_1196283 Ga0501044_1196283_79_501 140
754 3300050489 nmdc:mga03683_13116_c1 nmdc:mga03683_13116_c1_1157_1579 140
755 3300050489 nmdc:mga03683_36229_c1 nmdc:mga03683_36229_c1_180_602 140
756 3300050490 nmdc:mga03n38_924791_c1 nmdc:mga03n38_924791_c1_32_454 140
757 3300050492 nmdc:mga0yw44_117091_c1 nmdc:mga0yw44_117091_c1_966_1388 140
758 3300050492 nmdc:mga0yw44_506127_c1 nmdc:mga0yw44_506127_c1_342_764 140
759 3300050492 nmdc:mga0yw44_55454_c1 nmdc:mga0yw44_55454_c1_113_535 140
760 3300050493 nmdc:mga0k408_184045_c1 nmdc:mga0k408_184045_c1_357_779 140
761 3300050493 nmdc:mga0k408_232308_c1 nmdc:mga0k408_232308_c1_163_585 140
762 3300050494 nmdc:mga06z11_14790_c2 nmdc:mga06z11_14790_c2_1618_2040 140
763 3300050494 nmdc:mga06z11_91957_c1 nmdc:mga06z11_91957_c1_991_1413 140
764 3300050508 nmdc:mga09592_334936_c1 nmdc:mga09592_334936_c1_590_1012 140
765 3300050508 nmdc:mga09592_694881_c1 nmdc:mga09592_694881_c1_201_641 140
766 3300050511 nmdc:mga08y16_1182079_c1 nmdc:mga08y16_1182079_c1_304_726 140
767 3300050513 nmdc:mga0rr50_495681_c1 nmdc:mga0rr50_495681_c1_147_584 140
768 3300053078 Ga0495612_0476287 Ga0495612_0476287_89_511 140
769 3300053087 Ga0500643_000167 Ga0500643_000167_15427_15849 140
770 3300053091 Ga0500647_0019249 Ga0500647_0019249_1330_1752 140
771 3300053093 Ga0500651_0011019 Ga0500651_0011019_1334_1756 140
772 3300053093 Ga0500651_0202100 Ga0500651_0202100_611_1033 140
773 3300053096 Ga0500641_0001255 Ga0500641_0001255_6482_6904 140
774 3300053098 Ga0500650_0244184 Ga0500650_0244184_65_487 140
775 3300053116 Ga0500592_000645 Ga0500592_000645_449_871 140
776 3300053118 Ga0500594_0010595 Ga0500594_0010595_1656_2078 140
777 3300053120 Ga0500597_077510 Ga0500597_077510_567_989 140
778 3300053120 Ga0500597_374149 Ga0500597_374149_37_459 140
779 3300053130 Ga0500642_0179069 Ga0500642_0179069_443_865 140
780 3300053131 Ga0500652_000040 Ga0500652_000040_53127_53549 140
781 3300053133 Ga0500655_000021 Ga0500655_000021_15265_15687 140
782 3300053139 Ga0500568_0021313 Ga0500568_0021313_1912_2334 140
783 3300053142 Ga0500577_0075845 Ga0500577_0075845_833_1255 140
784 3300053148 Ga0500590_093278 Ga0500590_093278_547_969 140
785 3300053154 Ga0500619_037630 Ga0500619_037630_79_501 140
786 3300053158 Ga0500627_0000972 Ga0500627_0000972_4969_5391 140
787 3300053177 Ga0500636_0010464 Ga0500636_0010464_1753_2175 140
788 3300053724 Ga0500570_002608 Ga0500570_002608_5092_5514 140
789 3300053730 Ga0500645_066729 Ga0500645_066729_253_675 140
790 3300054114 Ga0501084_0029187 Ga0501084_0029187_2269_2691 140
791 3300054114 Ga0501084_0039486 Ga0501084_0039486_2694_3116 140
792 3300054114 Ga0501084_0444935 Ga0501084_0444935_89_511 140
793 3300054114 Ga0501084_0907523 Ga0501084_0907523_289_711 140
794 3300054114 Ga0501084_1310003 Ga0501084_1310003_74_496 140
795 3300060346 Ga0587111_0171786 Ga0587111_0171786_73_495 140
796 3300060353 Ga0501082_0016167 Ga0501082_0016167_2271_2693 140
797 3300060353 Ga0501082_0117985 Ga0501082_0117985_40_462 140
798 3300060353 Ga0501082_0496623 Ga0501082_0496623_166_588 140
799 3300061734 Ga0530510_0503986 Ga0530510_0503986_283_705 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00334

NDK

Nucleoside diphosphate kinase

37

171

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ay1-assembly5.cif.gz_E crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori 0.9932 4 138
2nck-assembly1.cif.gz_R crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution 0.9926 2 140
6ay1-assembly8.cif.gz_H crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori 0.9905 3 138
5v6d-assembly3.cif.gz_F crystal structure of nucleoside diphosphate kinase from neisseria gonorrhoeae in complex with citrate 0.9856 1 140
6aes-assembly2.cif.gz_B crystal structure of nucleoside diphosphate kinase from pseudomonas aeruginosa at 3.55 a resolution. 0.9851 1 140
ID Description Score Start End Superfamily
af_Q6Z7E5_29_180_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.985 3 133 3.30.70.141
af_A4IG45_154_309_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9778 3 133 3.30.70.141
af_C6T4F9_81_235_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9752 3 140 3.30.70.141
4w98A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.974 1 140 3.30.70.141
3vgvN00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9737 2 140 3.30.70.141
ID Description Score Start End GO Terms
AF-A0A2E3IQ90-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 1.001 5 140 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A382TB58-F1-model_v4 Nucleoside diphosphate kinase-like domain-containing protein 1.001 4 140 GO:0004550
GO:0006183
GO:0006228
GO:0006241
AF-A0A2E1TJE2-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 1 4 133 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A7V9YVH0-F1-model_v4 deleted 0.9999 3 140
AF-B8GW43-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 0.9994 3 140 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872

Feature Viewer

pLDDT pTM Quality
96.78 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map