F481358

General Info

Members Datasets Scaffolds Average Seq Length
799 343 666 193

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221616|2644096828
Length 191
Sequence TVPSPVTAEVEVRRSRFIALATPVADRDEALAEVARLRTEHPGANHVCWALLAGGHSGMSDDGEPSGTAGRPILEVLRHHDLDGVLGAVVRYFGGVKLGAGGLMRAYTDAIAAALLDAPLIERVPETVLAVLADYADAERIRRWADGEGHETGDAEYGGAVRFTLRLPTMQAAAARDAVRDLTQGRAVVEG

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231006 Pseudomonas sp. GM17 Isolate Nodule
4 2511231007 Pseudomonas sp. GM18 Isolate Nodule
5 2511231008 Pseudomonas sp. GM21 Isolate Nodule
6 2511231010 Pseudomonas sp. GM25 Isolate Nodule
7 2511231024 Pseudomonas sp. GM84 Isolate Nodule
8 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
9 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
10 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
11 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
12 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
13 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
14 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
15 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
16 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
17 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
18 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
19 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
20 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
21 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
22 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
23 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
24 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
25 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
26 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
27 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
28 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
29 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
30 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
31 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
32 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
33 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
34 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
35 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
36 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
37 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
38 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
39 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
40 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
41 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
42 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
43 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
44 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
45 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
46 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
47 2643221616 Leifsonia sp. Root227 Isolate Unclassified
48 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
49 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
50 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
51 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
52 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
53 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
54 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
55 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
56 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
57 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
58 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
59 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
60 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
61 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
62 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
63 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
64 2765235841 Pseudomonas putida AA7 Isolate Unclassified
65 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
66 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
67 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
68 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
69 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
70 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
71 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
72 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
73 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
74 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
75 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
76 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
77 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
78 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
79 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
80 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
81 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
82 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
83 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
84 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
85 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
86 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
87 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
88 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
89 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
90 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
91 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
92 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
93 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
94 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
95 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
96 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
97 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
98 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
99 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
100 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
101 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
102 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
103 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
104 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
105 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
106 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
107 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
108 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
109 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
110 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
111 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
112 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
113 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
114 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
115 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
116 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
117 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
118 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
119 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
120 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
121 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
122 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
123 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
124 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
125 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
126 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
127 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
128 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
129 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
130 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
131 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
132 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
133 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
134 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
135 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
136 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
137 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
138 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
139 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
140 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
141 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
142 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
143 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
144 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
145 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
146 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
147 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
148 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
149 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
150 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
151 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
152 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
153 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
154 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
155 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
156 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
157 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
158 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
159 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
160 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
161 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
162 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
163 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
164 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
165 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
166 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
167 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
168 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
169 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
175 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
176 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
178 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
179 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
181 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
182 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
201 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
202 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
205 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
206 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
207 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
208 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
209 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
210 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
211 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
218 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
219 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
220 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
221 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
222 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
223 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
224 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
225 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
226 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
227 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
228 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
229 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
230 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
231 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
232 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
233 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
234 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
235 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
236 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
237 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
238 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
239 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
240 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
241 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
242 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
245 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
248 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
249 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
250 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
251 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
252 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
253 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
254 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
255 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
256 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
257 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
258 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
259 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
260 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
261 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
262 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
263 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
264 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
265 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
266 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
267 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
268 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
269 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
270 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
271 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
272 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
273 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
274 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
275 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
276 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
277 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
278 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
279 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
280 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
281 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
282 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
283 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
284 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
285 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
286 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
287 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
288 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
289 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
290 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
291 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
292 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
293 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
294 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
297 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
298 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
299 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
302 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
303 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
304 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
305 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
306 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
307 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
308 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
309 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
310 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
311 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
312 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
313 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
314 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
315 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
316 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
318 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
319 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
320 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
321 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
322 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
323 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
324 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
325 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
326 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
327 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
328 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
329 8052494512 Pseudomonas putida LD6 Isolate Unclassified
330 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
331 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
332 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
333 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
334 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
335 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
336 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
337 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
338 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
339 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
340 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
341 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
342 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
343 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.35
Metatranscriptomes 0
Isolates 16.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.63
Nodule 1.63
Rhizoplane 5.76
Rhizosphere 71.59
Stem 0
Stem Tuber 0
Unclassified 15.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_527 2124908027 Bacteria 2861
2 SwRhRL2b_contig_299650 2162886007 Bacteria 2527
3 JGI25162J39368_1000195 3300002737 Bacteria 63625
4 JGI25154J39366_1003084 3300002738 Bacteria 3743
5 JGI25163J39215_1000418 3300002771 Bacteria 13218
6 JGI25163J39215_1000826 3300002771 Bacteria 7437
7 JGI25164J39214_1000258 3300002772 Bacteria 39842
8 JGI25164J39214_1000484 3300002772 Bacteria 19655
9 JGI25165J46597_1000222 3300003214 Bacteria 79609
10 JGI25165J46597_1000291 3300003214 Bacteria 63625
11 Ga0055538_1000267 3300003751 Bacteria 27438
12 Ga0055539_1000295 3300003752 Bacteria 27433
13 Ga0055533_1000065 3300003756 Bacteria 166911
14 Ga0055532_1000322 3300003758 Bacteria 27406
15 Ga0055525_1000083 3300003759 Bacteria 157373
16 Ga0055535_1005578 3300003761 Bacteria 2725
17 Ga0055536_1000395 3300003781 Bacteria 31658
18 Ga0055536_1000864 3300003781 Bacteria 19705
19 Ga0055530_10001160 3300003791 Bacteria 20422
20 Ga0055540_1000891 3300003792 Bacteria 19698
21 Ga0055541_1000040 3300003841 Bacteria 166911
22 Ga0065704_10073486 3300005289 Bacteria 7109
23 Ga0065704_10119875 3300005289 Bacteria 1777
24 Ga0065712_10068989 3300005290 Bacteria 8362
25 Ga0065712_10074699 3300005290 Bacteria 4020
26 Ga0070670_100001525 3300005331 Bacteria 18646
27 Ga0070670_100228414 3300005331 Bacteria 1619
28 Ga0070661_100000207 3300005344 Bacteria 48797
29 Ga0070661_100271885 3300005344 Bacteria 1312
30 Ga0070669_100000375 3300005353 Bacteria 34357
31 Ga0070662_100000137 3300005457 Bacteria 41312
32 Ga0068853_100008175 3300005539 Bacteria 8398
33 Ga0070665_100045655 3300005548 Bacteria 4400
34 Ga0070664_100000135 3300005564 Bacteria 49349
35 Ga0070664_100091601 3300005564 Bacteria 2631
36 Ga0068854_100005640 3300005578 Bacteria 7906
37 Ga0068851_10000004 3300005834 Bacteria 269685
38 Ga0075364_10064984 3300006051 Bacteria 2395
39 Ga0075364_10549978 3300006051 Bacteria 789
40 Ga0075432_10001582 3300006058 Bacteria 7464
41 Ga0075432_10006749 3300006058 Bacteria 3911
42 Ga0075436_100113795 3300006914 Bacteria 1890
43 Ga0075436_100243202 3300006914 Bacteria 1280
44 Ga0099823_1000076 3300006944 Bacteria 47206
45 Ga0099823_1044080 3300006944 Bacteria 3044
46 Ga0079104_1028786 3300006946 Bacteria 1408
47 Ga0105251_10000131 3300009011 Bacteria 75293
48 Ga0105251_10000400 3300009011 Bacteria 42392
49 Ga0105251_10002201 3300009011 Bacteria 15583
50 Ga0105251_10002405 3300009011 Bacteria 14780
51 Ga0105251_10004775 3300009011 Bacteria 9070
52 Ga0105251_10005811 3300009011 Bacteria 7994
53 Ga0105251_10011415 3300009011 Bacteria 5078
54 Ga0105251_10048596 3300009011 Bacteria 2033
55 Ga0105251_10073975 3300009011 Bacteria 1583
56 Ga0105251_10078248 3300009011 Bacteria 1532
57 Ga0105251_10215463 3300009011 Bacteria 864
58 Ga0105244_10000154 3300009036 Bacteria 72483
59 Ga0105244_10000571 3300009036 Bacteria 33026
60 Ga0105244_10003031 3300009036 Bacteria 12329
61 Ga0105244_10003274 3300009036 Bacteria 11661
62 Ga0105244_10006565 3300009036 Bacteria 7502
63 Ga0105244_10011667 3300009036 Bacteria 5246
64 Ga0105244_10017112 3300009036 Bacteria 4108
65 Ga0105244_10017980 3300009036 Bacteria 3979
66 Ga0105244_10036609 3300009036 Bacteria 2570
67 Ga0105244_10057286 3300009036 Bacteria 1969
68 Ga0105244_10208327 3300009036 Bacteria 920
69 Ga0105244_10237172 3300009036 Bacteria 852
70 Ga0105250_10000142 3300009092 Bacteria 62647
71 Ga0105250_10000163 3300009092 Bacteria 57464
72 Ga0105250_10005933 3300009092 Bacteria 5403
73 Ga0105250_10057589 3300009092 Bacteria 1560
74 Ga0105250_10171541 3300009092 Bacteria 908
75 Ga0105250_10202353 3300009092 Bacteria 838
76 Ga0105250_10252257 3300009092 Bacteria 754
77 Ga0105243_10000225 3300009148 Bacteria 65179
78 Ga0105243_10004738 3300009148 Bacteria 10701
79 Ga0105243_10026659 3300009148 Bacteria 4424
80 Ga0105243_10030281 3300009148 Bacteria 4165
81 Ga0105243_10047509 3300009148 Bacteria 3380
82 Ga0105243_10912923 3300009148 Bacteria 874
83 Ga0105243_11316135 3300009148 Bacteria 740
84 Ga0105242_10008316 3300009176 Bacteria 7971
85 Ga0105237_10000613 3300009545 Bacteria 49795
86 Ga0105246_10000422 3300011119 Bacteria 22599
87 Ga0105246_10001667 3300011119 Bacteria 13223
88 Ga0105246_10012923 3300011119 Bacteria 5222
89 Ga0105246_10099770 3300011119 Bacteria 2111
90 Ga0157373_10008874 3300013100 Bacteria 7443
91 Ga0157373_10011562 3300013100 Bacteria 6488
92 Ga0157373_10032977 3300013100 Bacteria 3728
93 Ga0157373_10091613 3300013100 Bacteria 2141
94 Ga0157371_10000648 3300013102 Bacteria 41246
95 Ga0157371_10005241 3300013102 Bacteria 11009
96 Ga0157371_10008005 3300013102 Bacteria 8470
97 Ga0157371_10032367 3300013102 Bacteria 3763
98 Ga0157370_10020532 3300013104 Bacteria 6595
99 Ga0157370_10343980 3300013104 Bacteria 1375
100 Ga0157369_10008487 3300013105 Bacteria 11781
101 Ga0157369_10014101 3300013105 Bacteria 9034
102 Ga0157369_10105524 3300013105 Bacteria 3000
103 Ga0163162_10250905 3300013306 Bacteria 1901
104 Ga0163162_10878263 3300013306 Bacteria 1011
105 Ga0157372_10029092 3300013307 Bacteria 6029
106 Ga0157372_10160310 3300013307 Bacteria 2600
107 Ga0157375_10019953 3300013308 Bacteria 6112
108 Ga0157375_10232635 3300013308 Bacteria 2002
109 Ga0182008_10001048 3300014497 Bacteria 19175
110 Ga0182008_10041131 3300014497 Bacteria 2306
111 Ga0182008_10053410 3300014497 Bacteria 2000
112 Ga0182008_10409810 3300014497 Bacteria 730
113 Ga0182006_1002067 3300015261 Bacteria 11247
114 Ga0182006_1003200 3300015261 Bacteria 8521
115 Ga0182006_1104444 3300015261 Bacteria 1002
116 Ga0182007_10000375 3300015262 Bacteria 28103
117 Ga0182007_10007413 3300015262 Bacteria 4602
118 Ga0182005_1000897 3300015265 Bacteria 13043
119 Ga0182005_1000957 3300015265 Bacteria 12563
120 Ga0182005_1025955 3300015265 Bacteria 1598
121 Ga0182005_1033185 3300015265 Bacteria 1405
122 Ga0182005_1039739 3300015265 Bacteria 1279
123 Ga0163161_10126158 3300017792 Bacteria 1927
124 Ga0163161_10226304 3300017792 Bacteria 1450
125 Ga0163161_10284316 3300017792 Bacteria 1298
126 Ga0163161_10917291 3300017792 Bacteria 743
127 Ga0209435_100395 3300025206 Bacteria 9410
128 Ga0209760_100296 3300025207 Bacteria 17284
129 Ga0209760_100435 3300025207 Bacteria 9820
130 Ga0209784_100028 3300025224 Bacteria 357464
131 Ga0209566_100028 3300025225 Bacteria 357464
132 Ga0209674_100047 3300025226 Bacteria 357464
133 Ga0209147_100031 3300025229 Bacteria 357464
134 Ga0209563_100050 3300025230 Bacteria 357464
135 Ga0207427_100063 3300025231 Bacteria 177711
136 Ga0207427_100067 3300025231 Bacteria 164839
137 Ga0209437_100016 3300025233 Bacteria 710118
138 Ga0209437_100133 3300025233 Bacteria 178493
139 Ga0209258_100170 3300025242 Bacteria 145191
140 Ga0207425_1040909 3300025245 Bacteria 883
141 Ga0209646_1000444 3300025246 Bacteria 22148
142 Ga0209677_100029 3300025253 Bacteria 357464
143 Ga0209759_1003775 3300025256 Bacteria 5909
144 Ga0209233_1000133 3300025261 Bacteria 202716
145 Ga0209233_1000156 3300025261 Bacteria 164839
146 Ga0209676_1000096 3300025292 Bacteria 240620
147 Ga0209676_1000426 3300025292 Bacteria 73938
148 Ga0209676_1004092 3300025292 Bacteria 8341
149 Ga0209050_1000386 3300025298 Bacteria 83132
150 Ga0209051_1001898 3300025303 Bacteria 16297
151 Ga0207656_10000117 3300025321 Bacteria 30629
152 Ga0207696_1000118 3300025711 Bacteria 147902
153 Ga0207696_1000122 3300025711 Bacteria 143543
154 Ga0207696_1000136 3300025711 Bacteria 129427
155 Ga0207696_1001385 3300025711 Bacteria 13260
156 Ga0207696_1011255 3300025711 Bacteria 3235
157 Ga0207696_1017991 3300025711 Bacteria 2329
158 Ga0207696_1040953 3300025711 Bacteria 1355
159 Ga0207655_1000014 3300025728 Bacteria 607124
160 Ga0207655_1000532 3300025728 Bacteria 48217
161 Ga0207655_1000635 3300025728 Bacteria 42123
162 Ga0207655_1000715 3300025728 Bacteria 37724
163 Ga0207655_1000819 3300025728 Bacteria 33678
164 Ga0207655_1000955 3300025728 Bacteria 29926
165 Ga0207655_1004973 3300025728 Bacteria 9213
166 Ga0207655_1007592 3300025728 Bacteria 7017
167 Ga0207655_1007932 3300025728 Bacteria 6817
168 Ga0207655_1023812 3300025728 Bacteria 3022
169 Ga0207655_1026337 3300025728 Bacteria 2794
170 Ga0207655_1071975 3300025728 Bacteria 1280
171 Ga0207713_1000094 3300025735 Bacteria 146176
172 Ga0207713_1000532 3300025735 Bacteria 38234
173 Ga0207713_1002022 3300025735 Bacteria 15197
174 Ga0207713_1003566 3300025735 Bacteria 10515
175 Ga0207713_1003672 3300025735 Bacteria 10326
176 Ga0207713_1004287 3300025735 Bacteria 9300
177 Ga0207713_1004527 3300025735 Bacteria 9001
178 Ga0207713_1007352 3300025735 Bacteria 6515
179 Ga0207713_1025141 3300025735 Bacteria 2757
180 Ga0207713_1025390 3300025735 Bacteria 2737
181 Ga0207713_1185746 3300025735 Bacteria 646
182 Ga0207671_10000528 3300025914 Bacteria 51509
183 Ga0207649_10000001 3300025920 Bacteria 537851
184 Ga0207681_10000682 3300025923 Bacteria 22284
185 Ga0207650_10000073 3300025925 Bacteria 137141
186 Ga0207650_10001033 3300025925 Bacteria 20892
187 Ga0207706_10000178 3300025933 Bacteria 70787
188 Ga0207686_10001211 3300025934 Bacteria 14968
189 Ga0207709_10000022 3300025935 Bacteria 383573
190 Ga0207709_10000366 3300025935 Bacteria 45478
191 Ga0207709_10011014 3300025935 Bacteria 4985
192 Ga0207709_10024865 3300025935 Bacteria 3425
193 Ga0207709_10035472 3300025935 Bacteria 2949
194 Ga0207711_10126484 3300025941 Bacteria 2287
195 Ga0207679_10000011 3300025945 Bacteria 346112
196 Ga0207679_10255266 3300025945 Bacteria 1493
197 Ga0207668_10481003 3300025972 Bacteria 1065
198 Ga0207639_10005771 3300026041 Bacteria 8380
199 Ga0209281_1004147 3300027111 Bacteria 4433
200 Ga0209281_1018137 3300027111 Bacteria 1413
201 Ga0209389_1000020 3300027296 Bacteria 172003
202 Ga0209389_1049452 3300027296 Bacteria 2953
203 Ga0207428_10018226 3300027907 Bacteria 6000
204 Ga0207428_10067621 3300027907 Bacteria 2813
205 Ga0207428_10882436 3300027907 Bacteria 632
206 Ga0268266_10125555 3300028379 Bacteria 2289
207 Ga0307517_10189764 3300028786 Bacteria 1307
208 Ga0307511_10104484 3300030521 Bacteria 1839
209 Ga0316179_1013043 3300030734 Bacteria 2383
210 Ga0316178_1092012 3300030735 Bacteria 40323
211 Ga0307509_10078969 3300031507 Bacteria 3408
212 Ga0307408_100002800 3300031548 Bacteria 12110
213 Ga0307408_100013942 3300031548 Bacteria 5337
214 Ga0307408_100043279 3300031548 Bacteria 3203
215 Ga0307405_10002454 3300031731 Bacteria 8172
216 Ga0307405_10083267 3300031731 Bacteria 2096
217 Ga0307407_10189901 3300031903 Bacteria 1368
218 Ga0307407_10507821 3300031903 Bacteria 885
219 Ga0307412_10002051 3300031911 Bacteria 11177
220 Ga0307412_10002318 3300031911 Bacteria 10541
221 Ga0307412_10003337 3300031911 Bacteria 8918
222 Ga0307412_10014952 3300031911 Bacteria 4589
223 Ga0307412_10185767 3300031911 Bacteria 1567
224 Ga0307412_10320153 3300031911 Bacteria 1233
225 Ga0307409_100023675 3300031995 Bacteria 4263
226 Ga0307409_100543952 3300031995 Bacteria 1139
227 Ga0307416_101100635 3300032002 Bacteria 899
228 Ga0307416_101510108 3300032002 Bacteria 777
229 Ga0307414_10053565 3300032004 Bacteria 2814
230 Ga0307414_10369975 3300032004 Bacteria 1236
231 Ga0307414_11029836 3300032004 Bacteria 758
232 Ga0307411_10031873 3300032005 Bacteria 3249
233 Ga0307411_10097482 3300032005 Bacteria 2069
234 Ga0307510_10057729 3300033180 Bacteria 4025
235 Ga0237819_02162 3300038705 Bacteria 4207
236 Ga0439438_000203 3300041405 Bacteria 27158
237 Ga0439438_001370 3300041405 Bacteria 10757
238 Ga0439438_002169 3300041405 Bacteria 8462
239 Ga0439438_002516 3300041405 Bacteria 7777
240 Ga0439438_005339 3300041405 Bacteria 4749
241 Ga0439447_009787 3300041407 Bacteria 2884
242 Ga0439466_0002263 3300041411 Bacteria 7546
243 Ga0439466_0002863 3300041411 Bacteria 6746
244 Ga0439466_0025833 3300041411 Bacteria 2047
245 Ga0439466_0104033 3300041411 Bacteria 883
246 Ga0439465_0191343 3300041413 Bacteria 743
247 Ga0439445_0027967 3300042004 Bacteria 1451
248 Ga0439432_001147 3300042006 Bacteria 10025
249 Ga0439432_001967 3300042006 Bacteria 7759
250 Ga0439432_002809 3300042006 Bacteria 6490
251 Ga0439432_012819 3300042006 Bacteria 2858
252 Ga0439432_017130 3300042006 Bacteria 2434
253 Ga0439432_027321 3300042006 Bacteria 1864
254 Ga0439432_034600 3300042006 Bacteria 1621
255 Ga0439451_002584 3300042009 Bacteria 3683
256 Ga0439451_012646 3300042009 Bacteria 1703
257 Ga0439451_060667 3300042009 Bacteria 756
258 Ga0439452_000305 3300042010 Bacteria 31596
259 Ga0439452_000359 3300042010 Bacteria 27925
260 Ga0439452_002238 3300042010 Bacteria 7259
261 Ga0439456_000165 3300042013 Bacteria 19468
262 Ga0439456_001107 3300042013 Bacteria 5343
263 Ga0439456_005436 3300042013 Bacteria 2585
264 Ga0439456_013554 3300042013 Bacteria 1697
265 Ga0439456_064131 3300042013 Bacteria 809
266 Ga0439463_000063 3300042016 Bacteria 23233
267 Ga0439463_000384 3300042016 Bacteria 12207
268 Ga0439463_011188 3300042016 Bacteria 2204
269 Ga0439463_101954 3300042016 Bacteria 740
270 Ga0450911_000453 3300042115 Bacteria 13240
271 Ga0450911_002063 3300042115 Bacteria 4130
272 Ga0450922_001141 3300042124 Bacteria 2633
273 Ga0450890_000497 3300042127 Bacteria 5782
274 Ga0450900_004966 3300042136 Bacteria 1553
275 Ga0450904_008314 3300042139 Bacteria 1024
276 Ga0450906_000523 3300042145 Bacteria 8079
277 Ga0450907_010813 3300042146 Bacteria 1515
278 Ga0450910_001393 3300042147 Bacteria 3033
279 Ga0450901_000401 3300042533 Bacteria 5217
280 Ga0495617_000371 3300046452 Bacteria 24874
281 Ga0495617_005407 3300046452 Bacteria 4530
282 Ga0495617_027006 3300046452 Bacteria 1933
283 Ga0495617_071905 3300046452 Bacteria 1137
284 Ga0495617_126820 3300046452 Bacteria 820
285 Ga0495627_000037 3300046453 Bacteria 198542
286 Ga0495627_000147 3300046453 Bacteria 84285
287 Ga0495627_002627 3300046453 Bacteria 8448
288 Ga0495627_015926 3300046453 Bacteria 2586
289 Ga0495590_0004800 3300046457 Bacteria 5416
290 Ga0495590_0012316 3300046457 Bacteria 3175
291 Ga0495590_0094956 3300046457 Bacteria 1057
292 Ga0495590_0199919 3300046457 Bacteria 734
293 Ga0495591_000395 3300046458 Bacteria 36751
294 Ga0495591_000752 3300046458 Bacteria 23406
295 Ga0495591_001932 3300046458 Bacteria 12141
296 Ga0495591_003102 3300046458 Bacteria 8783
297 Ga0495591_005671 3300046458 Bacteria 5715
298 Ga0495591_008845 3300046458 Bacteria 4069
299 Ga0495591_015478 3300046458 Bacteria 2692
300 Ga0495591_043871 3300046458 Bacteria 1256
301 Ga0495591_055763 3300046458 Bacteria 1064
302 Ga0495591_069897 3300046458 Bacteria 914
303 Ga0495638_0006608 3300046460 Bacteria 8425
304 Ga0495638_0106911 3300046460 Bacteria 1666
305 Ga0495638_0109378 3300046460 Bacteria 1643
306 Ga0495638_0112314 3300046460 Bacteria 1617
307 Ga0495653_0006365 3300046463 Bacteria 9685
308 Ga0495650_0005101 3300046471 Bacteria 8684
309 Ga0495650_0007086 3300046471 Bacteria 6809
310 Ga0495650_0010295 3300046471 Bacteria 5227
311 Ga0495650_0013284 3300046471 Bacteria 4365
312 Ga0495650_0020218 3300046471 Bacteria 3252
313 Ga0495605_0000115 3300046474 Bacteria 103523
314 Ga0495605_0000140 3300046474 Bacteria 93059
315 Ga0495605_0000756 3300046474 Bacteria 23662
316 Ga0495605_0009518 3300046474 Bacteria 5456
317 Ga0495605_0011189 3300046474 Bacteria 5012
318 Ga0495605_0014410 3300046474 Bacteria 4333
319 Ga0495605_0015244 3300046474 Bacteria 4186
320 Ga0495605_0021901 3300046474 Bacteria 3380
321 Ga0495605_0027284 3300046474 Bacteria 2959
322 Ga0495605_0036633 3300046474 Bacteria 2472
323 Ga0495605_0191970 3300046474 Bacteria 893
324 Ga0495639_0012410 3300046475 Bacteria 3674
325 Ga0495584_0000991 3300046491 Bacteria 17812
326 Ga0495584_0003631 3300046491 Bacteria 8413
327 Ga0495584_0326995 3300046491 Bacteria 778
328 Ga0495585_0004748 3300046492 Bacteria 8745
329 Ga0495585_0023972 3300046492 Bacteria 3500
330 Ga0495585_0105019 3300046492 Bacteria 1507
331 Ga0495585_0196456 3300046492 Bacteria 1029
332 Ga0495594_0002192 3300046499 Bacteria 10158
333 Ga0495594_0019948 3300046499 Bacteria 3567
334 Ga0495596_0033353 3300046500 Bacteria 2048
335 Ga0495607_0000239 3300046501 Bacteria 58938
336 Ga0495607_0001088 3300046501 Bacteria 24822
337 Ga0495607_0001196 3300046501 Bacteria 23455
338 Ga0495607_0001908 3300046501 Bacteria 17672
339 Ga0495607_0001939 3300046501 Bacteria 17479
340 Ga0495607_0002056 3300046501 Bacteria 16830
341 Ga0495607_0002368 3300046501 Bacteria 15396
342 Ga0495607_0006187 3300046501 Bacteria 8458
343 Ga0495607_0011664 3300046501 Bacteria 5840
344 Ga0495607_0013798 3300046501 Bacteria 5281
345 Ga0495607_0026817 3300046501 Bacteria 3570
346 Ga0495607_0051247 3300046501 Bacteria 2398
347 Ga0495607_0091205 3300046501 Bacteria 1650
348 Ga0495607_0093696 3300046501 Bacteria 1621
349 Ga0495607_0098748 3300046501 Bacteria 1567
350 Ga0495607_0278734 3300046501 Bacteria 794
351 Ga0495607_0284837 3300046501 Bacteria 783
352 Ga0495583_0000105 3300046506 Bacteria 142444
353 Ga0495583_0001518 3300046506 Bacteria 23044
354 Ga0495583_0001766 3300046506 Bacteria 20632
355 Ga0495583_0002990 3300046506 Bacteria 13540
356 Ga0495583_0003155 3300046506 Bacteria 13000
357 Ga0495583_0004936 3300046506 Bacteria 9266
358 Ga0495583_0005139 3300046506 Bacteria 9015
359 Ga0495583_0104836 3300046506 Bacteria 1203
360 Ga0495606_0001033 3300046507 Bacteria 40343
361 Ga0495606_0002249 3300046507 Bacteria 22970
362 Ga0495606_0005721 3300046507 Bacteria 11761
363 Ga0495606_0013638 3300046507 Bacteria 6406
364 Ga0495606_0047250 3300046507 Bacteria 2838
365 Ga0495606_0053889 3300046507 Bacteria 2607
366 Ga0495606_0109229 3300046507 Bacteria 1671
367 Ga0495606_0125912 3300046507 Bacteria 1528
368 Ga0495610_0007421 3300046512 Bacteria 7301
369 Ga0495610_0013698 3300046512 Bacteria 4803
370 Ga0495610_0015634 3300046512 Bacteria 4401
371 Ga0495610_0030875 3300046512 Bacteria 2801
372 Ga0495610_0167713 3300046512 Bacteria 923
373 Ga0495616_0021590 3300046513 Bacteria 3482
374 Ga0495616_0029643 3300046513 Bacteria 2886
375 Ga0495616_0050248 3300046513 Bacteria 2086
376 Ga0495620_0000147 3300046515 Bacteria 57591
377 Ga0495620_0002677 3300046515 Bacteria 10285
378 Ga0495620_0032116 3300046515 Bacteria 2396
379 Ga0495620_0073110 3300046515 Bacteria 1398
380 Ga0495631_0002899 3300046518 Bacteria 9499
381 Ga0495631_0003130 3300046518 Bacteria 9121
382 Ga0495631_0008877 3300046518 Bacteria 5043
383 Ga0495631_0017578 3300046518 Bacteria 3379
384 Ga0495631_0249059 3300046518 Bacteria 757
385 Ga0495632_0002125 3300046519 Bacteria 15448
386 Ga0495632_0003594 3300046519 Bacteria 10912
387 Ga0495632_0003600 3300046519 Bacteria 10902
388 Ga0495632_0004833 3300046519 Bacteria 9050
389 Ga0495632_0007891 3300046519 Bacteria 6614
390 Ga0495632_0020553 3300046519 Bacteria 3571
391 Ga0495632_0039125 3300046519 Bacteria 2396
392 Ga0495632_0052993 3300046519 Bacteria 1993
393 Ga0495632_0060488 3300046519 Bacteria 1840
394 Ga0495632_0082163 3300046519 Bacteria 1535
395 Ga0495632_0110520 3300046519 Bacteria 1290
396 Ga0495637_0000706 3300046520 Bacteria 22871
397 Ga0495637_0000711 3300046520 Bacteria 22780
398 Ga0495637_0003979 3300046520 Bacteria 7724
399 Ga0495637_0011606 3300046520 Bacteria 4229
400 Ga0495637_0012271 3300046520 Bacteria 4101
401 Ga0495637_0018279 3300046520 Bacteria 3253
402 Ga0495637_0021805 3300046520 Bacteria 2931
403 Ga0495637_0024232 3300046520 Bacteria 2746
404 Ga0495637_0025308 3300046520 Bacteria 2675
405 Ga0495637_0026008 3300046520 Bacteria 2633
406 Ga0495637_0027968 3300046520 Bacteria 2520
407 Ga0495637_0126814 3300046520 Bacteria 977
408 Ga0495643_0002132 3300046522 Bacteria 16309
409 Ga0495643_0003131 3300046522 Bacteria 12342
410 Ga0495643_0005196 3300046522 Bacteria 8874
411 Ga0495643_0010463 3300046522 Bacteria 5710
412 Ga0495643_0272208 3300046522 Bacteria 782
413 Ga0495643_0291157 3300046522 Bacteria 747
414 Ga0495644_0000453 3300046523 Bacteria 17944
415 Ga0495644_0002193 3300046523 Bacteria 7847
416 Ga0495644_0007558 3300046523 Bacteria 4188
417 Ga0495644_0012150 3300046523 Bacteria 3309
418 Ga0495648_0000215 3300046524 Bacteria 66028
419 Ga0495648_0001504 3300046524 Bacteria 22818
420 Ga0495648_0007123 3300046524 Bacteria 8998
421 Ga0495648_0009782 3300046524 Bacteria 7381
422 Ga0495648_0038671 3300046524 Bacteria 3047
423 Ga0495648_0041136 3300046524 Bacteria 2922
424 Ga0495648_0051587 3300046524 Bacteria 2505
425 Ga0495648_0085992 3300046524 Bacteria 1775
426 Ga0495666_0011476 3300046526 Bacteria 4417
427 Ga0495642_0002641 3300046528 Bacteria 7223
428 Ga0495654_0000318 3300046530 Bacteria 42185
429 Ga0495654_0001144 3300046530 Bacteria 19012
430 Ga0495654_0001858 3300046530 Bacteria 14055
431 Ga0495654_0006135 3300046530 Bacteria 6880
432 Ga0495654_0008628 3300046530 Bacteria 5619
433 Ga0495654_0008752 3300046530 Bacteria 5571
434 Ga0495654_0010109 3300046530 Bacteria 5147
435 Ga0495654_0013834 3300046530 Bacteria 4307
436 Ga0495654_0068624 3300046530 Bacteria 1685
437 Ga0495609_0000151 3300046538 Bacteria 71971
438 Ga0495609_0000194 3300046538 Bacteria 60772
439 Ga0495609_0000794 3300046538 Bacteria 23640
440 Ga0495609_0001037 3300046538 Bacteria 19516
441 Ga0495609_0008548 3300046538 Bacteria 5009
442 Ga0495597_0000254 3300046542 Bacteria 48567
443 Ga0495597_0003756 3300046542 Bacteria 8655
444 Ga0495597_0008524 3300046542 Bacteria 5131
445 Ga0495597_0018804 3300046542 Bacteria 3238
446 Ga0495597_0020347 3300046542 Bacteria 3093
447 Ga0495645_0078056 3300046543 Bacteria 2380
448 Ga0495622_0002290 3300046557 Bacteria 9313
449 Ga0495622_0072171 3300046557 Bacteria 1592
450 Ga0495633_0000369 3300046558 Bacteria 48317
451 Ga0495633_0005817 3300046558 Bacteria 7439
452 Ga0495633_0155785 3300046558 Bacteria 1054
453 Ga0495656_0102618 3300046615 Bacteria 1325
454 Ga0495668_0004905 3300046616 Bacteria 9288
455 Ga0495668_0067472 3300046616 Bacteria 1968
456 Ga0495668_0088430 3300046616 Bacteria 1698
457 Ga0495611_0000765 3300046648 Bacteria 17997
458 Ga0495611_0002214 3300046648 Bacteria 9035
459 Ga0495611_0016152 3300046648 Bacteria 3191
460 Ga0495611_0109460 3300046648 Bacteria 1286
461 Ga0495625_0001921 3300046660 Bacteria 23496
462 Ga0495625_0017096 3300046660 Bacteria 5684
463 Ga0495625_0038389 3300046660 Bacteria 3506
464 Ga0495659_0001315 3300046664 Bacteria 8531
465 Ga0495661_0000289 3300046665 Bacteria 56961
466 Ga0495661_0000301 3300046665 Bacteria 56050
467 Ga0495661_0000336 3300046665 Bacteria 51167
468 Ga0495661_0001109 3300046665 Bacteria 23632
469 Ga0495661_0012454 3300046665 Bacteria 5741
470 Ga0495661_0044820 3300046665 Bacteria 2708
471 Ga0495661_0089750 3300046665 Bacteria 1751
472 Ga0495661_0102659 3300046665 Bacteria 1607
473 Ga0495670_0003704 3300046691 Bacteria 7510
474 Ga0495670_0003969 3300046691 Bacteria 7262
475 Ga0495670_0040155 3300046691 Bacteria 2334
476 Ga0495670_0193274 3300046691 Bacteria 1076
477 Ga0495671_0000738 3300046692 Bacteria 23514
478 Ga0495671_0003033 3300046692 Bacteria 10433
479 Ga0495671_0005848 3300046692 Bacteria 7161
480 Ga0495671_0010486 3300046692 Bacteria 5130
481 Ga0495671_0054046 3300046692 Bacteria 1991
482 Ga0495671_0060962 3300046692 Bacteria 1862
483 Ga0495671_0069107 3300046692 Bacteria 1736
484 Ga0495671_0093588 3300046692 Bacteria 1470
485 Ga0495671_0317323 3300046692 Bacteria 748
486 Ga0495649_0004312 3300046694 Bacteria 9323
487 Ga0495649_0005602 3300046694 Bacteria 7943
488 Ga0495649_0013664 3300046694 Bacteria 4678
489 Ga0495649_0014960 3300046694 Bacteria 4431
490 Ga0495649_0035714 3300046694 Bacteria 2733
491 Ga0495589_0000348 3300046794 Bacteria 36271
492 Ga0495589_0001214 3300046794 Bacteria 15325
493 Ga0495589_0030671 3300046794 Bacteria 2707
494 Ga0495589_0031254 3300046794 Bacteria 2680
495 Ga0495589_0184300 3300046794 Bacteria 989
496 Ga0495600_0050979 3300046809 Bacteria 2701
497 Ga0495660_0001113 3300046810 Bacteria 19197
498 Ga0495660_0001477 3300046810 Bacteria 15997
499 Ga0495660_0014581 3300046810 Bacteria 4545
500 Ga0495660_0014813 3300046810 Bacteria 4509
501 Ga0495660_0031978 3300046810 Bacteria 2956
502 Ga0495660_0043465 3300046810 Bacteria 2478
503 Ga0495660_0075564 3300046810 Bacteria 1777
504 Ga0495660_0084380 3300046810 Bacteria 1661
505 Ga0495660_0168457 3300046810 Bacteria 1068
506 Ga0495660_0275920 3300046810 Bacteria 770
507 Ga0495660_0275924 3300046810 Bacteria 770
508 Ga0495660_0282664 3300046810 Bacteria 758
509 Ga0495581_0009417 3300047315 Bacteria 5651
510 Ga0495636_0003911 3300047318 Bacteria 5814
511 Ga0495636_0229190 3300047318 Bacteria 854
512 Ga0495672_0002869 3300047320 Bacteria 15297
513 Ga0495672_0004408 3300047320 Bacteria 11544
514 Ga0495672_0004549 3300047320 Bacteria 11288
515 Ga0495672_0007911 3300047320 Bacteria 7929
516 Ga0495672_0011029 3300047320 Bacteria 6400
517 Ga0495672_0020904 3300047320 Bacteria 4279
518 Ga0495672_0030700 3300047320 Bacteria 3366
519 Ga0495672_0032970 3300047320 Bacteria 3214
520 Ga0495672_0052762 3300047320 Bacteria 2386
521 Ga0495672_0107699 3300047320 Bacteria 1500
522 Ga0495672_0135898 3300047320 Bacteria 1289
523 Ga0495676_0001016 3300047321 Bacteria 23684
524 Ga0495676_0029149 3300047321 Bacteria 4701
525 Ga0495680_0045493 3300047322 Bacteria 3465
526 Ga0495683_0000094 3300047323 Bacteria 90702
527 Ga0495683_0000195 3300047323 Bacteria 57606
528 Ga0495683_0000542 3300047323 Bacteria 28674
529 Ga0495683_0003368 3300047323 Bacteria 9339
530 Ga0495683_0007704 3300047323 Bacteria 5788
531 Ga0495683_0021717 3300047323 Bacteria 3305
532 Ga0495683_0125354 3300047323 Bacteria 1215
533 Ga0495679_000622 3300047446 Bacteria 23956
534 Ga0495679_000858 3300047446 Bacteria 19214
535 Ga0495679_000986 3300047446 Bacteria 17558
536 Ga0495679_007950 3300047446 Bacteria 4364
537 Ga0495679_017870 3300047446 Bacteria 2529
538 Ga0495673_0001099 3300047469 Bacteria 23278
539 Ga0495673_0001744 3300047469 Bacteria 16593
540 Ga0495673_0001946 3300047469 Bacteria 15324
541 Ga0495673_0002016 3300047469 Bacteria 14933
542 Ga0495673_0004820 3300047469 Bacteria 8344
543 Ga0495673_0005706 3300047469 Bacteria 7472
544 Ga0495673_0008122 3300047469 Bacteria 5940
545 Ga0495673_0019816 3300047469 Bacteria 3363
546 Ga0495673_0022183 3300047469 Bacteria 3116
547 Ga0495673_0031771 3300047469 Bacteria 2469
548 Ga0495673_0035626 3300047469 Bacteria 2290
549 Ga0495673_0148781 3300047469 Bacteria 907
550 Ga0495681_0000851 3300047470 Bacteria 23524
551 Ga0495681_0003866 3300047470 Bacteria 10351
552 Ga0495681_0006676 3300047470 Bacteria 7535
553 Ga0495681_0011201 3300047470 Bacteria 5361
554 Ga0495681_0046047 3300047470 Bacteria 2082
555 Ga0495681_0050271 3300047470 Bacteria 1965
556 Ga0495681_0085028 3300047470 Bacteria 1405
557 Ga0495681_0116073 3300047470 Bacteria 1154
558 Ga0495686_0052358 3300047472 Bacteria 2559
559 Ga0495686_0159129 3300047472 Bacteria 1321
560 Ga0495686_0257908 3300047472 Bacteria 977
561 Ga0495593_0094768 3300047673 Bacteria 1535
562 Ga0495626_0001063 3300048091 Bacteria 23488
563 Ga0495626_0007871 3300048091 Bacteria 5900
564 Ga0495626_0007939 3300048091 Bacteria 5869
565 Ga0496102_0016056 3300048905 Bacteria 6535
566 Ga0496103_0458502 3300048906 Bacteria 817
567 Ga0496105_0441176 3300048908 Bacteria 1029
568 Ga0496106_0256320 3300048909 Bacteria 1399
569 Ga0496108_0142509 3300048911 Bacteria 2065
570 Ga0496110_0039381 3300048913 Bacteria 4115
571 Ga0496110_0044791 3300048913 Bacteria 3865
572 Ga0496110_0509523 3300048913 Bacteria 1095
573 Ga0496111_0090887 3300048914 Bacteria 2237
574 Ga0496111_0111431 3300048914 Bacteria 2016
575 Ga0496114_0008174 3300048917 Bacteria 8294
576 Ga0496114_0228469 3300048917 Bacteria 1634
577 Ga0496116_0000338 3300048919 Bacteria 75100
578 Ga0496116_0005110 3300048919 Bacteria 12319
579 Ga0496116_0008796 3300048919 Bacteria 8701
580 Ga0496117_0000712 3300048920 Bacteria 52613
581 Ga0496117_0001763 3300048920 Bacteria 29782
582 Ga0496117_0004165 3300048920 Bacteria 16165
583 Ga0496117_0006151 3300048920 Bacteria 12266
584 Ga0496117_0048987 3300048920 Bacteria 3011
585 Ga0496117_0060976 3300048920 Bacteria 2595
586 Ga0496117_0129997 3300048920 Bacteria 1528
587 Ga0496117_0187860 3300048920 Bacteria 1180
588 Ga0496118_0001177 3300048921 Bacteria 40395
589 Ga0496118_0006906 3300048921 Bacteria 12288
590 Ga0496118_0027532 3300048921 Bacteria 4807
591 Ga0496118_0048085 3300048921 Bacteria 3300
592 Ga0496118_0200046 3300048921 Bacteria 1184
593 Ga0496119_0000652 3300048922 Bacteria 46693
594 Ga0496119_0032891 3300048922 Bacteria 3450
595 Ga0496119_0043665 3300048922 Bacteria 2830
596 Ga0496120_0004234 3300048923 Bacteria 12238
597 Ga0496120_0022172 3300048923 Bacteria 3998
598 Ga0496121_0000713 3300048924 Bacteria 61654
599 Ga0496121_0004199 3300048924 Bacteria 19669
600 Ga0496121_0013964 3300048924 Bacteria 8579
601 Ga0496121_0040355 3300048924 Bacteria 4096
602 Ga0496121_0142047 3300048924 Bacteria 1779
603 Ga0496122_0001163 3300048925 Bacteria 45014
604 Ga0496122_0005124 3300048925 Bacteria 15813
605 Ga0496122_0010010 3300048925 Bacteria 9868
606 Ga0496122_0010575 3300048925 Bacteria 9480
607 Ga0496122_0010852 3300048925 Bacteria 9327
608 Ga0496122_0028971 3300048925 Bacteria 4682
609 Ga0496122_0099794 3300048925 Bacteria 1945
610 Ga0496122_0140012 3300048925 Bacteria 1515
611 Ga0496122_0275547 3300048925 Bacteria 923
612 Ga0496122_0295202 3300048925 Bacteria 877
613 Ga0496123_0004034 3300048926 Bacteria 15836
614 Ga0496123_0005918 3300048926 Bacteria 12061
615 Ga0496123_0006686 3300048926 Bacteria 11109
616 Ga0496123_0008107 3300048926 Bacteria 9711
617 Ga0496123_0016581 3300048926 Bacteria 5972
618 Ga0496123_0022082 3300048926 Bacteria 4919
619 Ga0496123_0072378 3300048926 Bacteria 2145
620 Ga0496123_0266371 3300048926 Bacteria 836
621 Ga0496124_0000827 3300048927 Bacteria 50461
622 Ga0496124_0001378 3300048927 Bacteria 36419
623 Ga0496124_0005974 3300048927 Bacteria 13441
624 Ga0496124_0006224 3300048927 Bacteria 13072
625 Ga0496124_0009744 3300048927 Bacteria 9829
626 Ga0496124_0010490 3300048927 Bacteria 9375
627 Ga0496124_0020017 3300048927 Bacteria 6199
628 Ga0496124_0047150 3300048927 Bacteria 3688
629 Ga0496124_0060038 3300048927 Bacteria 3192
630 Ga0496124_0135754 3300048927 Bacteria 1948
631 Ga0496124_0186330 3300048927 Bacteria 1592
632 Ga0496124_0272038 3300048927 Bacteria 1240
633 Ga0496124_0297685 3300048927 Bacteria 1167
634 Ga0496124_0360719 3300048927 Bacteria 1024
635 Ga0496124_0457147 3300048927 Bacteria 869
636 Ga0496125_0000942 3300048928 Bacteria 45701
637 Ga0496125_0005998 3300048928 Bacteria 13299
638 Ga0496125_0010562 3300048928 Bacteria 9333
639 Ga0496125_0048153 3300048928 Bacteria 3557
640 Ga0496125_0191961 3300048928 Bacteria 1347
641 Ga0496125_0308347 3300048928 Bacteria 966
642 Ga0496125_0512374 3300048928 Bacteria 672
643 Ga0496126_0017405 3300048929 Bacteria 7160
644 Ga0496126_0038560 3300048929 Bacteria 4445
645 Ga0496126_0079807 3300048929 Bacteria 2896
646 Ga0496126_0158908 3300048929 Bacteria 1932
647 Ga0495678_000057 3300049459 Bacteria 146738
648 Ga0495678_000243 3300049459 Bacteria 61378
649 Ga0495678_004094 3300049459 Bacteria 8640
650 Ga0495678_007089 3300049459 Bacteria 5861
651 Ga0495678_009221 3300049459 Bacteria 4905
652 Ga0495678_013613 3300049459 Bacteria 3811
653 Ga0495678_025331 3300049459 Bacteria 2549
654 Ga0495682_0000662 3300049460 Bacteria 22905
655 Ga0495682_0001276 3300049460 Bacteria 14097
656 Ga0495682_0078040 3300049460 Bacteria 1191
657 Ga0501034_0000214 3300049571 Bacteria 110247
658 Ga0501222_001494 3300049662 Bacteria 3271
659 Ga0501227_012441 3300049665 Bacteria 1864
660 Ga0501269_004946 3300049766 Bacteria 1602
661 Ga0501269_006181 3300049766 Bacteria 1442
662 Ga0501226_001115 3300049853 Bacteria 3473
663 nmdc:mga00v17_182812_c1 3300050491 Bacteria 1353
664 Ga0500618_001470 3300053125 Bacteria 10442
665 Ga0500659_0001693 3300053135 Bacteria 13752
666 Ga0500573_0003938 3300053140 Bacteria 7759

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042006 Ga0439432_034600 Ga0439432_034600_821_1402 168
2 3300013100 Ga0157373_10011562 Ga0157373_100115623 171
3 3300013102 Ga0157371_10008005 Ga0157371_100080054 171
4 3300042016 Ga0439463_101954 Ga0439463_101954_22_603 172
5 3300003781 Ga0055536_1000395 Ga0055536_10003956 173
6 3300025292 Ga0209676_1000426 Ga0209676_100042662 173
7 3300042006 Ga0439432_027321 Ga0439432_027321_1064_1645 173
8 3300032005 Ga0307411_10097482 Ga0307411_100974823 175
9 3300013100 Ga0157373_10091613 Ga0157373_100916132 180
10 3300014497 Ga0182008_10409810 Ga0182008_104098101 180
11 3300015262 Ga0182007_10007413 Ga0182007_100074135 180
12 3300003781 Ga0055536_1000864 Ga0055536_10008646 183
13 3300003791 Ga0055530_10001160 Ga0055530_100011607 183
14 3300003792 Ga0055540_1000891 Ga0055540_10008916 183
15 3300025292 Ga0209676_1000096 Ga0209676_10000966 183
16 3300025298 Ga0209050_1000386 Ga0209050_100038665 183
17 3300025303 Ga0209051_1001898 Ga0209051_10018985 183
18 3300042004 Ga0439445_0027967 Ga0439445_0027967_747_1328 183
19 3300042016 Ga0439463_000063 Ga0439463_000063_19913_20494 184
20 3300041411 Ga0439466_0002863 Ga0439466_0002863_3668_4249 185
21 3300042013 Ga0439456_005436 Ga0439456_005436_1841_2422 185
22 iso_pu_bacteria 2823421272 2823422257 188
23 iso_pu_bacteria 2511231006 2511268101 189
24 iso_pu_bacteria 2511231007 2511273198 189
25 iso_pu_bacteria 2511231008 2511277896 189
26 iso_pu_bacteria 2511231010 2511292151 189
27 iso_pu_bacteria 2511231024 2511375954 189
28 iso_pu_bacteria 2512047018 2512328156 189
29 iso_pu_bacteria 2554235341 2555667681 189
30 iso_pu_bacteria 2582580891 2583790078 189
31 iso_pu_bacteria 2597489887 2597855908 189
32 iso_pu_bacteria 2597489888 2597861901 189
33 iso_pu_bacteria 2597489889 2597867633 189
34 iso_pu_bacteria 2599185155 2599327180 189
35 iso_pu_bacteria 2599185160 2599356899 189
36 iso_pu_bacteria 2599185161 2599363071 189
37 iso_pu_bacteria 2599185162 2599369977 189
38 iso_pu_bacteria 2599185163 2599376180 189
39 iso_pu_bacteria 2599185164 2599382004 189
40 iso_pu_bacteria 2599185165 2599387852 189
41 iso_pu_bacteria 2599185166 2599395622 189
42 iso_pu_bacteria 2599185167 2599402216 189
43 iso_pu_bacteria 2599185168 2599407387 189
44 iso_pu_bacteria 2599185179 2599454634 189
45 iso_pu_bacteria 2599185181 2599463732 189
46 iso_pu_bacteria 2599185182 2599468920 189
47 iso_pu_bacteria 2599185185 2599487969 189
48 iso_pu_bacteria 2599185186 2599492751 189
49 iso_pu_bacteria 2599185188 2599499879 189
50 iso_pu_bacteria 2599185189 2599506661 189
51 iso_pu_bacteria 2599185190 2599516042 189
52 iso_pu_bacteria 2599185191 2599521783 189
53 iso_pu_bacteria 2599185257 2599806941 189
54 iso_pu_bacteria 2599185288 2599882840 189
55 iso_pu_bacteria 2599185290 2599895420 189
56 iso_pu_bacteria 2599185300 2599931132 189
57 iso_pu_bacteria 2599185303 2599951018 189
58 iso_pu_bacteria 2599185307 2599974536 189
59 iso_pu_bacteria 2599185356 2600216361 189
60 iso_pu_bacteria 2600254931 2600364637 189
61 iso_pu_bacteria 2600255283 2601623459 189
62 iso_pu_bacteria 2600255296 2601692577 189
63 iso_pu_bacteria 2600255313 2601776528 189
64 iso_pu_bacteria 2619619299 2621301968 189
65 iso_pu_bacteria 2623620446 2624490023 189
66 iso_pu_bacteria 2643221571 2643872385 189
67 iso_pu_bacteria 2643221616 2644096828 189
68 iso_pu_bacteria 2643221650 2644285673 189
69 iso_pu_bacteria 2643221713 2644619925 189
70 iso_pu_bacteria 2667528171 2671099712 189
71 iso_pu_bacteria 2671180172 2671772593 189
72 iso_pu_bacteria 2675903420 2677899586 189
73 iso_pu_bacteria 2713897148 2715754130 189
74 iso_pu_bacteria 2718217725 2718632419 189
75 iso_pu_bacteria 2721755607 2723246796 189
76 iso_pu_bacteria 2738541265 2738675330 189
77 iso_pu_bacteria 2738541271 2738687159 189
78 iso_pu_bacteria 2738541282 2738753733 189
79 iso_pu_bacteria 2738541294 2738807662 189
80 iso_pu_bacteria 2738541303 2738862722 189
81 iso_pu_bacteria 2738541309 2738895022 189
82 iso_pu_bacteria 2738543016 2739262780 189
83 iso_pu_bacteria 2740892503 2743735321 189
84 iso_pu_bacteria 2765235841 2765581814 189
85 iso_pu_bacteria 2791355520 2794594268 189
86 iso_pu_bacteria 2806310737 2807410235 189
87 iso_pu_bacteria 2806310745 2807458583 189
88 iso_pu_bacteria 2808606382 2808956111 189
89 iso_pu_bacteria 2808606385 2808976440 189
90 iso_pu_bacteria 2808606388 2808992122 189
91 iso_pu_bacteria 2811994881 2812370443 189
92 iso_pu_bacteria 2816332298 2817488633 189
93 iso_pu_bacteria 2818991464 2819705472 189
94 iso_pu_bacteria 2826581358 2826583525 189
95 iso_pu_bacteria 2834028612 2834031981 189
96 iso_pu_bacteria 2842815866 2842821302 189
97 iso_pu_bacteria 2842826826 2842832319 189
98 iso_pu_bacteria 2842832357 2842834418 189
99 iso_pu_bacteria 2842837860 2842842370 189
100 iso_pu_bacteria 2842843487 2842846103 189
101 iso_pu_bacteria 2842849001 2842852744 189
102 iso_pu_bacteria 2842854478 2842859779 189
103 iso_pu_bacteria 2844665904 2844668153 189
104 iso_pu_bacteria 2852612431 2852617296 189
105 iso_pu_bacteria 2852667396 2852671715 189
106 iso_pu_bacteria 2860867994 2860868652 189
107 iso_pu_bacteria 2908446538 2908447270 189
108 iso_pu_bacteria 2912963787 2912964416 189
109 iso_pu_bacteria 2917070673 2917071434 189
110 iso_pu_bacteria 2919155634 2919158715 189
111 iso_pu_bacteria 2919385768 2919389511 189
112 iso_pu_bacteria 2919456309 2919460250 189
113 iso_pu_bacteria 2919487758 2919493116 189
114 iso_pu_bacteria 2919697872 2919703873 189
115 iso_pu_bacteria 2923153595 2923154319 189
116 iso_pu_bacteria 2923519811 2923524534 189
117 iso_pu_bacteria 2929189879 2929190525 189
118 iso_pu_bacteria 2931390751 2931391619 189
119 iso_pu_bacteria 2935353572 2935359260 189
120 iso_pu_bacteria 2939651529 2939656541 189
121 iso_pu_bacteria 2945928738 2945929929 189
122 iso_pu_bacteria 2945961074 2945967843 189
123 iso_pu_bacteria 2946006987 2946012254 189
124 iso_pu_bacteria 2946027586 2946028875 189
125 iso_pu_bacteria 2947233263 2947235412 189
126 iso_pu_bacteria 2974289157 2974293089 189
127 iso_pu_bacteria 2984286254 2984291731 189
128 iso_pu_bacteria 2998139840 2998140727 189
129 iso_pu_bacteria 3007395558 3007399873 189
130 iso_pu_bacteria 3007419365 3007420247 189
131 iso_pu_bacteria 3007718800 3007723539 189
132 iso_pu_bacteria 3007803356 3007806577 189
133 iso_pu_bacteria 3007855910 3007859950 189
134 iso_pu_bacteria 3007861166 3007864068 189
135 iso_pu_bacteria 3007866637 3007867265 189
136 iso_pu_bacteria 637000220 637318072 189
137 iso_pu_bacteria 8015687852 8015688578 189
138 iso_pu_bacteria 8019775933 8019782140 189
139 iso_pu_bacteria 8029995093 8030000015 189
140 iso_pu_bacteria 8052494512 8052499356 189
141 iso_pu_bacteria 8054285046 8054288307 189
142 iso_pu_bacteria 8054347763 8054349897 189
143 iso_pu_bacteria 8054503363 8054504208 189
144 iso_pu_bacteria 8054929484 8054930282 189
145 iso_pu_bacteria 8055770955 8055771676 189
146 iso_pu_bacteria 8055817908 8055818639 189
147 iso_pu_bacteria 8056120720 8056121499 189
148 iso_pu_bacteria 8056131705 8056132549 189
149 iso_pu_bacteria 8056137416 8056142331 189
150 iso_pu_bacteria 8056143049 8056144017 189
151 iso_pu_bacteria 8056148874 8056152713 189
152 iso_pu_bacteria 8056161164 8056161595 189
153 iso_pu_bacteria 8056166840 8056170321 189
154 iso_pu_bacteria 8057798959 8057802956 189
155 3300015265 Ga0182005_1039739 Ga0182005_10397392 192
156 3300046522 Ga0495643_0003131 Ga0495643_0003131_11515_12123 192
157 2124908027 MRS2a_Contig_527 MRS2a_00407110 193
158 2162886007 SwRhRL2b_contig_299650 SwRhRL2b_0322.00003850 193
159 3300002737 JGI25162J39368_1000195 JGI25162J39368_100019556 193
160 3300002738 JGI25154J39366_1003084 JGI25154J39366_10030843 193
161 3300002771 JGI25163J39215_1000418 JGI25163J39215_10004186 193
162 3300002771 JGI25163J39215_1000826 JGI25163J39215_10008263 193
163 3300002772 JGI25164J39214_1000258 JGI25164J39214_10002585 193
164 3300002772 JGI25164J39214_1000484 JGI25164J39214_10004847 193
165 3300003214 JGI25165J46597_1000222 JGI25165J46597_10002226 193
166 3300003214 JGI25165J46597_1000291 JGI25165J46597_100029156 193
167 3300003751 Ga0055538_1000267 Ga0055538_10002677 193
168 3300003752 Ga0055539_1000295 Ga0055539_10002957 193
169 3300003756 Ga0055533_1000065 Ga0055533_10000657 193
170 3300003758 Ga0055532_1000322 Ga0055532_10003227 193
171 3300003759 Ga0055525_1000083 Ga0055525_1000083131 193
172 3300003761 Ga0055535_1005578 Ga0055535_10055783 193
173 3300003841 Ga0055541_1000040 Ga0055541_10000407 193
174 3300005289 Ga0065704_10073486 Ga0065704_100734863 193
175 3300005289 Ga0065704_10119875 Ga0065704_101198752 193
176 3300005290 Ga0065712_10068989 Ga0065712_100689895 193
177 3300005290 Ga0065712_10074699 Ga0065712_100746993 193
178 3300005331 Ga0070670_100001525 Ga0070670_1000015255 193
179 3300005331 Ga0070670_100228414 Ga0070670_1002284142 193
180 3300005344 Ga0070661_100000207 Ga0070661_10000020737 193
181 3300005344 Ga0070661_100271885 Ga0070661_1002718852 193
182 3300005353 Ga0070669_100000375 Ga0070669_10000037528 193
183 3300005457 Ga0070662_100000137 Ga0070662_10000013736 193
184 3300005539 Ga0068853_100008175 Ga0068853_1000081757 193
185 3300005548 Ga0070665_100045655 Ga0070665_1000456554 193
186 3300005564 Ga0070664_100000135 Ga0070664_10000013538 193
187 3300005564 Ga0070664_100091601 Ga0070664_1000916012 193
188 3300005578 Ga0068854_100005640 Ga0068854_1000056403 193
189 3300005834 Ga0068851_10000004 Ga0068851_100000046 193
190 3300006051 Ga0075364_10064984 Ga0075364_100649842 193
191 3300006051 Ga0075364_10549978 Ga0075364_105499782 193
192 3300006058 Ga0075432_10001582 Ga0075432_100015823 193
193 3300006058 Ga0075432_10006749 Ga0075432_100067493 193
194 3300006914 Ga0075436_100113795 Ga0075436_1001137952 193
195 3300006914 Ga0075436_100243202 Ga0075436_1002432021 193
196 3300006944 Ga0099823_1000076 Ga0099823_100007637 193
197 3300006944 Ga0099823_1044080 Ga0099823_10440802 193
198 3300006946 Ga0079104_1028786 Ga0079104_10287862 193
199 3300009011 Ga0105251_10000131 Ga0105251_100001316 193
200 3300009011 Ga0105251_10000400 Ga0105251_1000040037 193
201 3300009011 Ga0105251_10002201 Ga0105251_100022015 193
202 3300009011 Ga0105251_10002405 Ga0105251_100024059 193
203 3300009011 Ga0105251_10004775 Ga0105251_100047754 193
204 3300009011 Ga0105251_10005811 Ga0105251_100058112 193
205 3300009011 Ga0105251_10011415 Ga0105251_100114153 193
206 3300009011 Ga0105251_10048596 Ga0105251_100485963 193
207 3300009011 Ga0105251_10073975 Ga0105251_100739753 193
208 3300009011 Ga0105251_10078248 Ga0105251_100782482 193
209 3300009011 Ga0105251_10215463 Ga0105251_102154632 193
210 3300009036 Ga0105244_10000154 Ga0105244_1000015468 193
211 3300009036 Ga0105244_10000571 Ga0105244_100005715 193
212 3300009036 Ga0105244_10003031 Ga0105244_100030316 193
213 3300009036 Ga0105244_10003274 Ga0105244_100032747 193
214 3300009036 Ga0105244_10006565 Ga0105244_100065656 193
215 3300009036 Ga0105244_10011667 Ga0105244_100116674 193
216 3300009036 Ga0105244_10017112 Ga0105244_100171124 193
217 3300009036 Ga0105244_10017980 Ga0105244_100179804 193
218 3300009036 Ga0105244_10036609 Ga0105244_100366093 193
219 3300009036 Ga0105244_10057286 Ga0105244_100572862 193
220 3300009036 Ga0105244_10208327 Ga0105244_102083272 193
221 3300009036 Ga0105244_10237172 Ga0105244_102371722 193
222 3300009092 Ga0105250_10000142 Ga0105250_1000014255 193
223 3300009092 Ga0105250_10000163 Ga0105250_100001636 193
224 3300009092 Ga0105250_10005933 Ga0105250_100059334 193
225 3300009092 Ga0105250_10057589 Ga0105250_100575892 193
226 3300009092 Ga0105250_10171541 Ga0105250_101715411 193
227 3300009092 Ga0105250_10202353 Ga0105250_102023532 193
228 3300009092 Ga0105250_10252257 Ga0105250_102522571 193
229 3300009148 Ga0105243_10000225 Ga0105243_100002257 193
230 3300009148 Ga0105243_10004738 Ga0105243_100047386 193
231 3300009148 Ga0105243_10026659 Ga0105243_100266593 193
232 3300009148 Ga0105243_10030281 Ga0105243_100302816 193
233 3300009148 Ga0105243_10047509 Ga0105243_100475093 193
234 3300009148 Ga0105243_10912923 Ga0105243_109129231 193
235 3300009148 Ga0105243_11316135 Ga0105243_113161351 193
236 3300009176 Ga0105242_10008316 Ga0105242_100083163 193
237 3300009545 Ga0105237_10000613 Ga0105237_1000061338 193
238 3300011119 Ga0105246_10000422 Ga0105246_100004226 193
239 3300011119 Ga0105246_10001667 Ga0105246_1000166711 193
240 3300011119 Ga0105246_10012923 Ga0105246_100129234 193
241 3300011119 Ga0105246_10099770 Ga0105246_100997702 193
242 3300013100 Ga0157373_10008874 Ga0157373_100088744 193
243 3300013100 Ga0157373_10032977 Ga0157373_100329774 193
244 3300013102 Ga0157371_10000648 Ga0157371_1000064835 193
245 3300013102 Ga0157371_10005241 Ga0157371_100052414 193
246 3300013102 Ga0157371_10032367 Ga0157371_100323673 193
247 3300013104 Ga0157370_10020532 Ga0157370_100205326 193
248 3300013104 Ga0157370_10343980 Ga0157370_103439802 193
249 3300013105 Ga0157369_10008487 Ga0157369_100084872 193
250 3300013105 Ga0157369_10014101 Ga0157369_100141015 193
251 3300013105 Ga0157369_10105524 Ga0157369_101055242 193
252 3300013306 Ga0163162_10250905 Ga0163162_102509051 193
253 3300013306 Ga0163162_10878263 Ga0163162_108782631 193
254 3300013307 Ga0157372_10029092 Ga0157372_100290921 193
255 3300013307 Ga0157372_10160310 Ga0157372_101603102 193
256 3300013308 Ga0157375_10019953 Ga0157375_100199532 193
257 3300013308 Ga0157375_10232635 Ga0157375_102326352 193
258 3300014497 Ga0182008_10001048 Ga0182008_1000104812 193
259 3300014497 Ga0182008_10041131 Ga0182008_100411312 193
260 3300014497 Ga0182008_10053410 Ga0182008_100534103 193
261 3300015261 Ga0182006_1002067 Ga0182006_10020675 193
262 3300015261 Ga0182006_1003200 Ga0182006_10032002 193
263 3300015261 Ga0182006_1104444 Ga0182006_11044442 193
264 3300015262 Ga0182007_10000375 Ga0182007_1000037523 193
265 3300015265 Ga0182005_1000897 Ga0182005_100089711 193
266 3300015265 Ga0182005_1000957 Ga0182005_10009577 193
267 3300015265 Ga0182005_1025955 Ga0182005_10259552 193
268 3300015265 Ga0182005_1033185 Ga0182005_10331852 193
269 3300017792 Ga0163161_10126158 Ga0163161_101261582 193
270 3300017792 Ga0163161_10226304 Ga0163161_102263041 193
271 3300017792 Ga0163161_10284316 Ga0163161_102843162 193
272 3300017792 Ga0163161_10917291 Ga0163161_109172912 193
273 3300025206 Ga0209435_100395 Ga0209435_1003953 193
274 3300025207 Ga0209760_100296 Ga0209760_10029612 193
275 3300025207 Ga0209760_100435 Ga0209760_1004354 193
276 3300025224 Ga0209784_100028 Ga0209784_100028294 193
277 3300025225 Ga0209566_100028 Ga0209566_100028294 193
278 3300025226 Ga0209674_100047 Ga0209674_100047294 193
279 3300025229 Ga0209147_100031 Ga0209147_100031294 193
280 3300025230 Ga0209563_100050 Ga0209563_100050294 193
281 3300025231 Ga0207427_100063 Ga0207427_1000635 193
282 3300025231 Ga0207427_100067 Ga0207427_100067153 193
283 3300025233 Ga0209437_100016 Ga0209437_1000166 193
284 3300025233 Ga0209437_100133 Ga0209437_100133179 193
285 3300025242 Ga0209258_100170 Ga0209258_100170118 193
286 3300025245 Ga0207425_1040909 Ga0207425_10409091 193
287 3300025246 Ga0209646_1000444 Ga0209646_100044416 193
288 3300025253 Ga0209677_100029 Ga0209677_100029294 193
289 3300025256 Ga0209759_1003775 Ga0209759_10037752 193
290 3300025261 Ga0209233_1000133 Ga0209233_1000133207 193
291 3300025261 Ga0209233_1000156 Ga0209233_1000156153 193
292 3300025292 Ga0209676_1004092 Ga0209676_10040924 193
293 3300025321 Ga0207656_10000117 Ga0207656_100001176 193
294 3300025711 Ga0207696_1000118 Ga0207696_1000118145 193
295 3300025711 Ga0207696_1000122 Ga0207696_10001227 193
296 3300025711 Ga0207696_1000136 Ga0207696_10001366 193
297 3300025711 Ga0207696_1001385 Ga0207696_10013859 193
298 3300025711 Ga0207696_1011255 Ga0207696_10112552 193
299 3300025711 Ga0207696_1017991 Ga0207696_10179912 193
300 3300025711 Ga0207696_1040953 Ga0207696_10409531 193
301 3300025728 Ga0207655_1000014 Ga0207655_10000145 193
302 3300025728 Ga0207655_1000532 Ga0207655_10005325 193
303 3300025728 Ga0207655_1000635 Ga0207655_10006356 193
304 3300025728 Ga0207655_1000715 Ga0207655_10007156 193
305 3300025728 Ga0207655_1000819 Ga0207655_100081925 193
306 3300025728 Ga0207655_1000955 Ga0207655_10009555 193
307 3300025728 Ga0207655_1004973 Ga0207655_10049735 193
308 3300025728 Ga0207655_1007592 Ga0207655_10075921 193
309 3300025728 Ga0207655_1007932 Ga0207655_10079322 193
310 3300025728 Ga0207655_1023812 Ga0207655_10238122 193
311 3300025728 Ga0207655_1026337 Ga0207655_10263373 193
312 3300025728 Ga0207655_1071975 Ga0207655_10719752 193
313 3300025735 Ga0207713_1000094 Ga0207713_1000094133 193
314 3300025735 Ga0207713_1000532 Ga0207713_100053230 193
315 3300025735 Ga0207713_1002022 Ga0207713_10020226 193
316 3300025735 Ga0207713_1003566 Ga0207713_10035664 193
317 3300025735 Ga0207713_1003672 Ga0207713_10036725 193
318 3300025735 Ga0207713_1004287 Ga0207713_10042876 193
319 3300025735 Ga0207713_1004527 Ga0207713_10045275 193
320 3300025735 Ga0207713_1007352 Ga0207713_10073525 193
321 3300025735 Ga0207713_1025141 Ga0207713_10251413 193
322 3300025735 Ga0207713_1025390 Ga0207713_10253902 193
323 3300025735 Ga0207713_1185746 Ga0207713_11857461 193
324 3300025914 Ga0207671_10000528 Ga0207671_100005286 193
325 3300025920 Ga0207649_10000001 Ga0207649_100000016 193
326 3300025923 Ga0207681_10000682 Ga0207681_1000068217 193
327 3300025925 Ga0207650_10000073 Ga0207650_100000735 193
328 3300025925 Ga0207650_10001033 Ga0207650_100010336 193
329 3300025933 Ga0207706_10000178 Ga0207706_1000017858 193
330 3300025934 Ga0207686_10001211 Ga0207686_100012113 193
331 3300025935 Ga0207709_10000022 Ga0207709_100000226 193
332 3300025935 Ga0207709_10000366 Ga0207709_100003667 193
333 3300025935 Ga0207709_10011014 Ga0207709_100110143 193
334 3300025935 Ga0207709_10024865 Ga0207709_100248653 193
335 3300025935 Ga0207709_10035472 Ga0207709_100354722 193
336 3300025941 Ga0207711_10126484 Ga0207711_101264842 193
337 3300025945 Ga0207679_10000011 Ga0207679_100000116 193
338 3300025945 Ga0207679_10255266 Ga0207679_102552662 193
339 3300025972 Ga0207668_10481003 Ga0207668_104810032 193
340 3300026041 Ga0207639_10005771 Ga0207639_100057716 193
341 3300027111 Ga0209281_1004147 Ga0209281_10041473 193
342 3300027111 Ga0209281_1018137 Ga0209281_10181371 193
343 3300027296 Ga0209389_1000020 Ga0209389_1000020170 193
344 3300027296 Ga0209389_1049452 Ga0209389_10494522 193
345 3300027907 Ga0207428_10018226 Ga0207428_100182265 193
346 3300027907 Ga0207428_10067621 Ga0207428_100676212 193
347 3300027907 Ga0207428_10882436 Ga0207428_108824361 193
348 3300028379 Ga0268266_10125555 Ga0268266_101255552 193
349 3300028786 Ga0307517_10189764 Ga0307517_101897642 193
350 3300030521 Ga0307511_10104484 Ga0307511_101044842 193
351 3300030734 Ga0316179_1013043 Ga0316179_10130433 193
352 3300030735 Ga0316178_1092012 Ga0316178_10920126 193
353 3300031507 Ga0307509_10078969 Ga0307509_100789693 193
354 3300031548 Ga0307408_100002800 Ga0307408_1000028005 193
355 3300031548 Ga0307408_100013942 Ga0307408_1000139424 193
356 3300031548 Ga0307408_100043279 Ga0307408_1000432792 193
357 3300031731 Ga0307405_10002454 Ga0307405_100024543 193
358 3300031731 Ga0307405_10083267 Ga0307405_100832672 193
359 3300031903 Ga0307407_10189901 Ga0307407_101899012 193
360 3300031903 Ga0307407_10507821 Ga0307407_105078212 193
361 3300031911 Ga0307412_10002051 Ga0307412_100020517 193
362 3300031911 Ga0307412_10002318 Ga0307412_100023182 193
363 3300031911 Ga0307412_10003337 Ga0307412_100033374 193
364 3300031911 Ga0307412_10014952 Ga0307412_100149522 193
365 3300031911 Ga0307412_10185767 Ga0307412_101857672 193
366 3300031911 Ga0307412_10320153 Ga0307412_103201532 193
367 3300031995 Ga0307409_100023675 Ga0307409_1000236752 193
368 3300031995 Ga0307409_100543952 Ga0307409_1005439522 193
369 3300032002 Ga0307416_101100635 Ga0307416_1011006351 193
370 3300032002 Ga0307416_101510108 Ga0307416_1015101081 193
371 3300032004 Ga0307414_10053565 Ga0307414_100535653 193
372 3300032004 Ga0307414_10369975 Ga0307414_103699751 193
373 3300032004 Ga0307414_11029836 Ga0307414_110298362 193
374 3300032005 Ga0307411_10031873 Ga0307411_100318733 193
375 3300033180 Ga0307510_10057729 Ga0307510_100577292 193
376 3300038705 Ga0237819_02162 Ga0237819_02162_2233_2814 193
377 3300041405 Ga0439438_000203 Ga0439438_000203_383_970 193
378 3300041405 Ga0439438_001370 Ga0439438_001370_5326_5907 193
379 3300041405 Ga0439438_002169 Ga0439438_002169_7281_7862 193
380 3300041405 Ga0439438_002516 Ga0439438_002516_3525_4106 193
381 3300041405 Ga0439438_005339 Ga0439438_005339_777_1358 193
382 3300041407 Ga0439447_009787 Ga0439447_009787_1867_2448 193
383 3300041411 Ga0439466_0002263 Ga0439466_0002263_1861_2442 193
384 3300041411 Ga0439466_0025833 Ga0439466_0025833_1321_1902 193
385 3300041411 Ga0439466_0104033 Ga0439466_0104033_121_702 193
386 3300041413 Ga0439465_0191343 Ga0439465_0191343_99_680 193
387 3300042006 Ga0439432_001147 Ga0439432_001147_3103_3684 193
388 3300042006 Ga0439432_001967 Ga0439432_001967_4345_4926 193
389 3300042006 Ga0439432_002809 Ga0439432_002809_1435_2019 193
390 3300042006 Ga0439432_012819 Ga0439432_012819_1076_1657 193
391 3300042006 Ga0439432_017130 Ga0439432_017130_93_674 193
392 3300042009 Ga0439451_002584 Ga0439451_002584_2435_3016 193
393 3300042009 Ga0439451_012646 Ga0439451_012646_922_1503 193
394 3300042009 Ga0439451_060667 Ga0439451_060667_45_626 193
395 3300042010 Ga0439452_000305 Ga0439452_000305_24418_24999 193
396 3300042010 Ga0439452_000359 Ga0439452_000359_5244_5825 193
397 3300042010 Ga0439452_002238 Ga0439452_002238_1645_2226 193
398 3300042013 Ga0439456_000165 Ga0439456_000165_7622_8206 193
399 3300042013 Ga0439456_001107 Ga0439456_001107_3702_4283 193
400 3300042013 Ga0439456_013554 Ga0439456_013554_753_1334 193
401 3300042013 Ga0439456_064131 Ga0439456_064131_215_796 193
402 3300042016 Ga0439463_000384 Ga0439463_000384_6657_7250 193
403 3300042016 Ga0439463_011188 Ga0439463_011188_1300_1881 193
404 3300042115 Ga0450911_000453 Ga0450911_000453_5222_5803 193
405 3300042115 Ga0450911_002063 Ga0450911_002063_306_887 193
406 3300042124 Ga0450922_001141 Ga0450922_001141_206_787 193
407 3300042127 Ga0450890_000497 Ga0450890_000497_3045_3626 193
408 3300042136 Ga0450900_004966 Ga0450900_004966_300_884 193
409 3300042139 Ga0450904_008314 Ga0450904_008314_347_928 193
410 3300042145 Ga0450906_000523 Ga0450906_000523_1381_1962 193
411 3300042146 Ga0450907_010813 Ga0450907_010813_856_1437 193
412 3300042147 Ga0450910_001393 Ga0450910_001393_917_1498 193
413 3300042533 Ga0450901_000401 Ga0450901_000401_244_825 193
414 3300046452 Ga0495617_000371 Ga0495617_000371_2400_2981 193
415 3300046452 Ga0495617_005407 Ga0495617_005407_2773_3354 193
416 3300046452 Ga0495617_027006 Ga0495617_027006_21_614 193
417 3300046452 Ga0495617_071905 Ga0495617_071905_282_863 193
418 3300046452 Ga0495617_126820 Ga0495617_126820_172_765 193
419 3300046453 Ga0495627_000037 Ga0495627_000037_191470_192060 193
420 3300046453 Ga0495627_000147 Ga0495627_000147_77324_77908 193
421 3300046453 Ga0495627_002627 Ga0495627_002627_5343_5936 193
422 3300046453 Ga0495627_015926 Ga0495627_015926_330_911 193
423 3300046457 Ga0495590_0004800 Ga0495590_0004800_4553_5134 193
424 3300046457 Ga0495590_0012316 Ga0495590_0012316_2509_3090 193
425 3300046457 Ga0495590_0094956 Ga0495590_0094956_324_917 193
426 3300046457 Ga0495590_0199919 Ga0495590_0199919_80_661 193
427 3300046458 Ga0495591_000395 Ga0495591_000395_29638_30228 193
428 3300046458 Ga0495591_000752 Ga0495591_000752_6975_7568 193
429 3300046458 Ga0495591_001932 Ga0495591_001932_10012_10605 193
430 3300046458 Ga0495591_003102 Ga0495591_003102_7374_7967 193
431 3300046458 Ga0495591_005671 Ga0495591_005671_4043_4636 193
432 3300046458 Ga0495591_008845 Ga0495591_008845_330_911 193
433 3300046458 Ga0495591_015478 Ga0495591_015478_1972_2553 193
434 3300046458 Ga0495591_043871 Ga0495591_043871_591_1172 193
435 3300046458 Ga0495591_055763 Ga0495591_055763_393_983 193
436 3300046458 Ga0495591_069897 Ga0495591_069897_97_678 193
437 3300046460 Ga0495638_0006608 Ga0495638_0006608_2148_2729 193
438 3300046460 Ga0495638_0106911 Ga0495638_0106911_524_1105 193
439 3300046460 Ga0495638_0109378 Ga0495638_0109378_730_1311 193
440 3300046460 Ga0495638_0112314 Ga0495638_0112314_195_782 193
441 3300046463 Ga0495653_0006365 Ga0495653_0006365_7681_8265 193
442 3300046471 Ga0495650_0005101 Ga0495650_0005101_5093_5689 193
443 3300046471 Ga0495650_0007086 Ga0495650_0007086_5937_6530 193
444 3300046471 Ga0495650_0010295 Ga0495650_0010295_3923_4516 193
445 3300046471 Ga0495650_0013284 Ga0495650_0013284_2564_3145 193
446 3300046471 Ga0495650_0020218 Ga0495650_0020218_2373_2957 193
447 3300046474 Ga0495605_0000115 Ga0495605_0000115_6424_7017 193
448 3300046474 Ga0495605_0000140 Ga0495605_0000140_87252_87845 193
449 3300046474 Ga0495605_0000756 Ga0495605_0000756_6669_7262 193
450 3300046474 Ga0495605_0009518 Ga0495605_0009518_389_979 193
451 3300046474 Ga0495605_0011189 Ga0495605_0011189_3258_3851 193
452 3300046474 Ga0495605_0014410 Ga0495605_0014410_177_806 193
453 3300046474 Ga0495605_0015244 Ga0495605_0015244_1069_1650 193
454 3300046474 Ga0495605_0021901 Ga0495605_0021901_1921_2511 193
455 3300046474 Ga0495605_0027284 Ga0495605_0027284_143_724 193
456 3300046474 Ga0495605_0036633 Ga0495605_0036633_1848_2429 193
457 3300046474 Ga0495605_0191970 Ga0495605_0191970_217_801 193
458 3300046475 Ga0495639_0012410 Ga0495639_0012410_721_1302 193
459 3300046491 Ga0495584_0000991 Ga0495584_0000991_2326_2907 193
460 3300046491 Ga0495584_0003631 Ga0495584_0003631_3569_4150 193
461 3300046491 Ga0495584_0326995 Ga0495584_0326995_151_732 193
462 3300046492 Ga0495585_0004748 Ga0495585_0004748_5105_5689 193
463 3300046492 Ga0495585_0023972 Ga0495585_0023972_2601_3182 193
464 3300046492 Ga0495585_0105019 Ga0495585_0105019_482_1066 193
465 3300046492 Ga0495585_0196456 Ga0495585_0196456_308_889 193
466 3300046499 Ga0495594_0002192 Ga0495594_0002192_5918_6511 193
467 3300046499 Ga0495594_0019948 Ga0495594_0019948_987_1568 193
468 3300046500 Ga0495596_0033353 Ga0495596_0033353_1390_1983 193
469 3300046501 Ga0495607_0000239 Ga0495607_0000239_6526_7116 193
470 3300046501 Ga0495607_0001088 Ga0495607_0001088_2433_3014 193
471 3300046501 Ga0495607_0001196 Ga0495607_0001196_6582_7175 193
472 3300046501 Ga0495607_0001908 Ga0495607_0001908_16097_16687 193
473 3300046501 Ga0495607_0001939 Ga0495607_0001939_10229_10816 193
474 3300046501 Ga0495607_0002056 Ga0495607_0002056_9582_10184 193
475 3300046501 Ga0495607_0002368 Ga0495607_0002368_6545_7174 193
476 3300046501 Ga0495607_0006187 Ga0495607_0006187_7651_8235 193
477 3300046501 Ga0495607_0011664 Ga0495607_0011664_1003_1584 193
478 3300046501 Ga0495607_0013798 Ga0495607_0013798_1619_2200 193
479 3300046501 Ga0495607_0026817 Ga0495607_0026817_810_1403 193
480 3300046501 Ga0495607_0051247 Ga0495607_0051247_1557_2150 193
481 3300046501 Ga0495607_0091205 Ga0495607_0091205_959_1552 193
482 3300046501 Ga0495607_0093696 Ga0495607_0093696_443_1036 193
483 3300046501 Ga0495607_0098748 Ga0495607_0098748_701_1282 193
484 3300046501 Ga0495607_0278734 Ga0495607_0278734_111_704 193
485 3300046501 Ga0495607_0284837 Ga0495607_0284837_43_636 193
486 3300046506 Ga0495583_0000105 Ga0495583_0000105_135433_136026 193
487 3300046506 Ga0495583_0001518 Ga0495583_0001518_6697_7293 193
488 3300046506 Ga0495583_0001766 Ga0495583_0001766_4511_5104 193
489 3300046506 Ga0495583_0002990 Ga0495583_0002990_7403_7996 193
490 3300046506 Ga0495583_0003155 Ga0495583_0003155_7316_7909 193
491 3300046506 Ga0495583_0004936 Ga0495583_0004936_4288_4878 193
492 3300046506 Ga0495583_0005139 Ga0495583_0005139_3823_4404 193
493 3300046506 Ga0495583_0104836 Ga0495583_0104836_63_644 193
494 3300046507 Ga0495606_0001033 Ga0495606_0001033_34372_34956 193
495 3300046507 Ga0495606_0002249 Ga0495606_0002249_15732_16325 193
496 3300046507 Ga0495606_0005721 Ga0495606_0005721_4579_5172 193
497 3300046507 Ga0495606_0013638 Ga0495606_0013638_3908_4489 193
498 3300046507 Ga0495606_0047250 Ga0495606_0047250_2108_2689 193
499 3300046507 Ga0495606_0053889 Ga0495606_0053889_1825_2406 193
500 3300046507 Ga0495606_0109229 Ga0495606_0109229_606_1199 193
501 3300046507 Ga0495606_0125912 Ga0495606_0125912_806_1390 193
502 3300046512 Ga0495610_0007421 Ga0495610_0007421_584_1177 193
503 3300046512 Ga0495610_0013698 Ga0495610_0013698_2086_2679 193
504 3300046512 Ga0495610_0015634 Ga0495610_0015634_134_715 193
505 3300046512 Ga0495610_0030875 Ga0495610_0030875_19_600 193
506 3300046512 Ga0495610_0167713 Ga0495610_0167713_88_678 193
507 3300046513 Ga0495616_0021590 Ga0495616_0021590_2819_3400 193
508 3300046513 Ga0495616_0029643 Ga0495616_0029643_487_1068 193
509 3300046513 Ga0495616_0050248 Ga0495616_0050248_325_906 193
510 3300046515 Ga0495620_0000147 Ga0495620_0000147_7043_7636 193
511 3300046515 Ga0495620_0002677 Ga0495620_0002677_3390_3983 193
512 3300046515 Ga0495620_0032116 Ga0495620_0032116_1789_2370 193
513 3300046515 Ga0495620_0073110 Ga0495620_0073110_538_1119 193
514 3300046518 Ga0495631_0002899 Ga0495631_0002899_6641_7222 193
515 3300046518 Ga0495631_0003130 Ga0495631_0003130_6678_7268 193
516 3300046518 Ga0495631_0008877 Ga0495631_0008877_2381_2974 193
517 3300046518 Ga0495631_0017578 Ga0495631_0017578_2353_2937 193
518 3300046518 Ga0495631_0249059 Ga0495631_0249059_63_644 193
519 3300046519 Ga0495632_0002125 Ga0495632_0002125_6474_7070 193
520 3300046519 Ga0495632_0003594 Ga0495632_0003594_2368_2949 193
521 3300046519 Ga0495632_0003600 Ga0495632_0003600_6575_7165 193
522 3300046519 Ga0495632_0004833 Ga0495632_0004833_5525_6118 193
523 3300046519 Ga0495632_0007891 Ga0495632_0007891_5792_6373 193
524 3300046519 Ga0495632_0020553 Ga0495632_0020553_2968_3549 193
525 3300046519 Ga0495632_0039125 Ga0495632_0039125_1639_2220 193
526 3300046519 Ga0495632_0052993 Ga0495632_0052993_1027_1608 193
527 3300046519 Ga0495632_0060488 Ga0495632_0060488_460_1044 193
528 3300046519 Ga0495632_0082163 Ga0495632_0082163_922_1506 193
529 3300046519 Ga0495632_0110520 Ga0495632_0110520_527_1111 193
530 3300046520 Ga0495637_0000706 Ga0495637_0000706_6548_7138 193
531 3300046520 Ga0495637_0000711 Ga0495637_0000711_6652_7245 193
532 3300046520 Ga0495637_0003979 Ga0495637_0003979_1814_2404 193
533 3300046520 Ga0495637_0011606 Ga0495637_0011606_3350_3934 193
534 3300046520 Ga0495637_0012271 Ga0495637_0012271_3385_3966 193
535 3300046520 Ga0495637_0018279 Ga0495637_0018279_2109_2690 193
536 3300046520 Ga0495637_0021805 Ga0495637_0021805_524_1105 193
537 3300046520 Ga0495637_0024232 Ga0495637_0024232_825_1409 193
538 3300046520 Ga0495637_0025308 Ga0495637_0025308_1111_1695 193
539 3300046520 Ga0495637_0026008 Ga0495637_0026008_1866_2462 193
540 3300046520 Ga0495637_0027968 Ga0495637_0027968_1637_2230 193
541 3300046520 Ga0495637_0126814 Ga0495637_0126814_310_891 193
542 3300046522 Ga0495643_0002132 Ga0495643_0002132_5065_5649 193
543 3300046522 Ga0495643_0005196 Ga0495643_0005196_1202_1783 193
544 3300046522 Ga0495643_0010463 Ga0495643_0010463_2247_2837 193
545 3300046522 Ga0495643_0272208 Ga0495643_0272208_181_762 193
546 3300046522 Ga0495643_0291157 Ga0495643_0291157_120_701 193
547 3300046523 Ga0495644_0000453 Ga0495644_0000453_10634_11227 193
548 3300046523 Ga0495644_0002193 Ga0495644_0002193_167_748 193
549 3300046523 Ga0495644_0007558 Ga0495644_0007558_3216_3797 193
550 3300046523 Ga0495644_0012150 Ga0495644_0012150_62_643 193
551 3300046524 Ga0495648_0000215 Ga0495648_0000215_2304_2885 193
552 3300046524 Ga0495648_0001504 Ga0495648_0001504_15650_16240 193
553 3300046524 Ga0495648_0007123 Ga0495648_0007123_2636_3229 193
554 3300046524 Ga0495648_0009782 Ga0495648_0009782_6389_6970 193
555 3300046524 Ga0495648_0038671 Ga0495648_0038671_202_783 193
556 3300046524 Ga0495648_0041136 Ga0495648_0041136_2004_2585 193
557 3300046524 Ga0495648_0051587 Ga0495648_0051587_1634_2227 193
558 3300046524 Ga0495648_0085992 Ga0495648_0085992_571_1164 193
559 3300046526 Ga0495666_0011476 Ga0495666_0011476_2710_3291 193
560 3300046528 Ga0495642_0002641 Ga0495642_0002641_4314_4895 193
561 3300046530 Ga0495654_0000318 Ga0495654_0000318_41186_41770 193
562 3300046530 Ga0495654_0001144 Ga0495654_0001144_13810_14391 193
563 3300046530 Ga0495654_0001858 Ga0495654_0001858_7048_7641 193
564 3300046530 Ga0495654_0006135 Ga0495654_0006135_66_647 193
565 3300046530 Ga0495654_0008628 Ga0495654_0008628_2842_3423 193
566 3300046530 Ga0495654_0008752 Ga0495654_0008752_3957_4547 193
567 3300046530 Ga0495654_0010109 Ga0495654_0010109_1342_1923 193
568 3300046530 Ga0495654_0013834 Ga0495654_0013834_1953_2546 193
569 3300046530 Ga0495654_0068624 Ga0495654_0068624_33_614 193
570 3300046538 Ga0495609_0000151 Ga0495609_0000151_6420_7013 193
571 3300046538 Ga0495609_0000194 Ga0495609_0000194_53458_54051 193
572 3300046538 Ga0495609_0000794 Ga0495609_0000794_6733_7326 193
573 3300046538 Ga0495609_0001037 Ga0495609_0001037_2468_3049 193
574 3300046538 Ga0495609_0008548 Ga0495609_0008548_1708_2295 193
575 3300046542 Ga0495597_0000254 Ga0495597_0000254_6523_7113 193
576 3300046542 Ga0495597_0003756 Ga0495597_0003756_7684_8277 193
577 3300046542 Ga0495597_0008524 Ga0495597_0008524_2732_3313 193
578 3300046542 Ga0495597_0018804 Ga0495597_0018804_707_1288 193
579 3300046542 Ga0495597_0020347 Ga0495597_0020347_899_1483 193
580 3300046543 Ga0495645_0078056 Ga0495645_0078056_1580_2173 193
581 3300046557 Ga0495622_0002290 Ga0495622_0002290_4377_4970 193
582 3300046557 Ga0495622_0072171 Ga0495622_0072171_751_1332 193
583 3300046558 Ga0495633_0000369 Ga0495633_0000369_41150_41743 193
584 3300046558 Ga0495633_0005817 Ga0495633_0005817_372_953 193
585 3300046558 Ga0495633_0155785 Ga0495633_0155785_26_607 193
586 3300046615 Ga0495656_0102618 Ga0495656_0102618_82_663 193
587 3300046616 Ga0495668_0004905 Ga0495668_0004905_4500_5090 193
588 3300046616 Ga0495668_0067472 Ga0495668_0067472_785_1378 193
589 3300046616 Ga0495668_0088430 Ga0495668_0088430_927_1508 193
590 3300046648 Ga0495611_0000765 Ga0495611_0000765_6438_7031 193
591 3300046648 Ga0495611_0002214 Ga0495611_0002214_5952_6545 193
592 3300046648 Ga0495611_0016152 Ga0495611_0016152_561_1142 193
593 3300046648 Ga0495611_0109460 Ga0495611_0109460_521_1102 193
594 3300046660 Ga0495625_0001921 Ga0495625_0001921_16314_16907 193
595 3300046660 Ga0495625_0017096 Ga0495625_0017096_2082_2663 193
596 3300046660 Ga0495625_0038389 Ga0495625_0038389_2193_2774 193
597 3300046664 Ga0495659_0001315 Ga0495659_0001315_5231_5812 193
598 3300046665 Ga0495661_0000289 Ga0495661_0000289_6480_7073 193
599 3300046665 Ga0495661_0000301 Ga0495661_0000301_48876_49460 193
600 3300046665 Ga0495661_0000336 Ga0495661_0000336_6770_7366 193
601 3300046665 Ga0495661_0001109 Ga0495661_0001109_6715_7308 193
602 3300046665 Ga0495661_0012454 Ga0495661_0012454_4838_5419 193
603 3300046665 Ga0495661_0044820 Ga0495661_0044820_455_1036 193
604 3300046665 Ga0495661_0089750 Ga0495661_0089750_630_1220 193
605 3300046665 Ga0495661_0102659 Ga0495661_0102659_780_1364 193
606 3300046691 Ga0495670_0003704 Ga0495670_0003704_6308_6901 193
607 3300046691 Ga0495670_0003969 Ga0495670_0003969_4569_5150 193
608 3300046691 Ga0495670_0040155 Ga0495670_0040155_968_1549 193
609 3300046691 Ga0495670_0193274 Ga0495670_0193274_359_940 193
610 3300046692 Ga0495671_0000738 Ga0495671_0000738_7229_7819 193
611 3300046692 Ga0495671_0003033 Ga0495671_0003033_4787_5368 193
612 3300046692 Ga0495671_0005848 Ga0495671_0005848_6328_6912 193
613 3300046692 Ga0495671_0010486 Ga0495671_0010486_1772_2353 193
614 3300046692 Ga0495671_0054046 Ga0495671_0054046_250_843 193
615 3300046692 Ga0495671_0060962 Ga0495671_0060962_920_1504 193
616 3300046692 Ga0495671_0069107 Ga0495671_0069107_284_865 193
617 3300046692 Ga0495671_0093588 Ga0495671_0093588_793_1386 193
618 3300046692 Ga0495671_0317323 Ga0495671_0317323_40_621 193
619 3300046694 Ga0495649_0004312 Ga0495649_0004312_6574_7158 193
620 3300046694 Ga0495649_0005602 Ga0495649_0005602_2628_3209 193
621 3300046694 Ga0495649_0013664 Ga0495649_0013664_3111_3704 193
622 3300046694 Ga0495649_0014960 Ga0495649_0014960_2563_3144 193
623 3300046694 Ga0495649_0035714 Ga0495649_0035714_116_697 193
624 3300046794 Ga0495589_0000348 Ga0495589_0000348_5112_5693 193
625 3300046794 Ga0495589_0001214 Ga0495589_0001214_4011_4604 193
626 3300046794 Ga0495589_0030671 Ga0495589_0030671_225_806 193
627 3300046794 Ga0495589_0031254 Ga0495589_0031254_401_982 193
628 3300046794 Ga0495589_0184300 Ga0495589_0184300_273_854 193
629 3300046809 Ga0495600_0050979 Ga0495600_0050979_1691_2272 193
630 3300046810 Ga0495660_0001113 Ga0495660_0001113_12203_12796 193
631 3300046810 Ga0495660_0001477 Ga0495660_0001477_8576_9160 193
632 3300046810 Ga0495660_0014581 Ga0495660_0014581_511_1098 193
633 3300046810 Ga0495660_0014813 Ga0495660_0014813_515_1096 193
634 3300046810 Ga0495660_0031978 Ga0495660_0031978_187_777 193
635 3300046810 Ga0495660_0043465 Ga0495660_0043465_187_777 193
636 3300046810 Ga0495660_0075564 Ga0495660_0075564_454_1035 193
637 3300046810 Ga0495660_0084380 Ga0495660_0084380_1065_1646 193
638 3300046810 Ga0495660_0168457 Ga0495660_0168457_243_824 193
639 3300046810 Ga0495660_0275920 Ga0495660_0275920_124_717 193
640 3300046810 Ga0495660_0275924 Ga0495660_0275924_54_647 193
641 3300046810 Ga0495660_0282664 Ga0495660_0282664_86_667 193
642 3300047315 Ga0495581_0009417 Ga0495581_0009417_2912_3493 193
643 3300047318 Ga0495636_0003911 Ga0495636_0003911_2891_3472 193
644 3300047318 Ga0495636_0229190 Ga0495636_0229190_237_818 193
645 3300047320 Ga0495672_0002869 Ga0495672_0002869_4407_4988 193
646 3300047320 Ga0495672_0004408 Ga0495672_0004408_5619_6200 193
647 3300047320 Ga0495672_0004549 Ga0495672_0004549_2995_3576 193
648 3300047320 Ga0495672_0007911 Ga0495672_0007911_1118_1711 193
649 3300047320 Ga0495672_0011029 Ga0495672_0011029_2647_3240 193
650 3300047320 Ga0495672_0020904 Ga0495672_0020904_3100_3690 193
651 3300047320 Ga0495672_0030700 Ga0495672_0030700_836_1426 193
652 3300047320 Ga0495672_0032970 Ga0495672_0032970_487_1068 193
653 3300047320 Ga0495672_0052762 Ga0495672_0052762_51_632 193
654 3300047320 Ga0495672_0107699 Ga0495672_0107699_51_632 193
655 3300047320 Ga0495672_0135898 Ga0495672_0135898_576_1205 193
656 3300047321 Ga0495676_0001016 Ga0495676_0001016_16312_16905 193
657 3300047321 Ga0495676_0029149 Ga0495676_0029149_4105_4689 193
658 3300047322 Ga0495680_0045493 Ga0495680_0045493_2472_3053 193
659 3300047323 Ga0495683_0000094 Ga0495683_0000094_83641_84225 193
660 3300047323 Ga0495683_0000195 Ga0495683_0000195_50212_50805 193
661 3300047323 Ga0495683_0000542 Ga0495683_0000542_24770_25351 193
662 3300047323 Ga0495683_0003368 Ga0495683_0003368_7613_8194 193
663 3300047323 Ga0495683_0007704 Ga0495683_0007704_4929_5522 193
664 3300047323 Ga0495683_0021717 Ga0495683_0021717_1222_1803 193
665 3300047323 Ga0495683_0125354 Ga0495683_0125354_169_750 193
666 3300047446 Ga0495679_000622 Ga0495679_000622_6733_7326 193
667 3300047446 Ga0495679_000858 Ga0495679_000858_12147_12728 193
668 3300047446 Ga0495679_000986 Ga0495679_000986_10600_11193 193
669 3300047446 Ga0495679_007950 Ga0495679_007950_73_654 193
670 3300047446 Ga0495679_017870 Ga0495679_017870_1809_2390 193
671 3300047469 Ga0495673_0001099 Ga0495673_0001099_15803_16396 193
672 3300047469 Ga0495673_0001744 Ga0495673_0001744_15664_16257 193
673 3300047469 Ga0495673_0001946 Ga0495673_0001946_8160_8750 193
674 3300047469 Ga0495673_0002016 Ga0495673_0002016_9267_9848 193
675 3300047469 Ga0495673_0004820 Ga0495673_0004820_7209_7802 193
676 3300047469 Ga0495673_0005706 Ga0495673_0005706_442_1035 193
677 3300047469 Ga0495673_0008122 Ga0495673_0008122_3462_4043 193
678 3300047469 Ga0495673_0019816 Ga0495673_0019816_2190_2771 193
679 3300047469 Ga0495673_0022183 Ga0495673_0022183_747_1337 193
680 3300047469 Ga0495673_0031771 Ga0495673_0031771_296_877 193
681 3300047469 Ga0495673_0035626 Ga0495673_0035626_803_1396 193
682 3300047469 Ga0495673_0148781 Ga0495673_0148781_205_789 193
683 3300047470 Ga0495681_0000851 Ga0495681_0000851_6720_7313 193
684 3300047470 Ga0495681_0003866 Ga0495681_0003866_640_1221 193
685 3300047470 Ga0495681_0006676 Ga0495681_0006676_1741_2334 193
686 3300047470 Ga0495681_0011201 Ga0495681_0011201_3577_4158 193
687 3300047470 Ga0495681_0046047 Ga0495681_0046047_1293_1874 193
688 3300047470 Ga0495681_0050271 Ga0495681_0050271_95_676 193
689 3300047470 Ga0495681_0085028 Ga0495681_0085028_763_1344 193
690 3300047470 Ga0495681_0116073 Ga0495681_0116073_202_792 193
691 3300047472 Ga0495686_0052358 Ga0495686_0052358_945_1538 193
692 3300047472 Ga0495686_0159129 Ga0495686_0159129_726_1307 193
693 3300047472 Ga0495686_0257908 Ga0495686_0257908_50_640 193
694 3300047673 Ga0495593_0094768 Ga0495593_0094768_487_1068 193
695 3300048091 Ga0495626_0001063 Ga0495626_0001063_16310_16903 193
696 3300048091 Ga0495626_0007871 Ga0495626_0007871_2999_3580 193
697 3300048091 Ga0495626_0007939 Ga0495626_0007939_2337_2918 193
698 3300048905 Ga0496102_0016056 Ga0496102_0016056_364_957 193
699 3300048906 Ga0496103_0458502 Ga0496103_0458502_198_791 193
700 3300048908 Ga0496105_0441176 Ga0496105_0441176_375_956 193
701 3300048909 Ga0496106_0256320 Ga0496106_0256320_292_873 193
702 3300048911 Ga0496108_0142509 Ga0496108_0142509_421_1005 193
703 3300048913 Ga0496110_0039381 Ga0496110_0039381_3506_4090 193
704 3300048913 Ga0496110_0044791 Ga0496110_0044791_2423_3007 193
705 3300048913 Ga0496110_0509523 Ga0496110_0509523_337_918 193
706 3300048914 Ga0496111_0090887 Ga0496111_0090887_742_1326 193
707 3300048914 Ga0496111_0111431 Ga0496111_0111431_1351_1944 193
708 3300048917 Ga0496114_0008174 Ga0496114_0008174_3291_3875 193
709 3300048917 Ga0496114_0228469 Ga0496114_0228469_610_1194 193
710 3300048919 Ga0496116_0000338 Ga0496116_0000338_68054_68635 193
711 3300048919 Ga0496116_0005110 Ga0496116_0005110_6533_7114 193
712 3300048919 Ga0496116_0008796 Ga0496116_0008796_4241_4822 193
713 3300048920 Ga0496117_0000712 Ga0496117_0000712_45650_46231 193
714 3300048920 Ga0496117_0001763 Ga0496117_0001763_6466_7047 193
715 3300048920 Ga0496117_0004165 Ga0496117_0004165_4946_5530 193
716 3300048920 Ga0496117_0006151 Ga0496117_0006151_6565_7146 193
717 3300048920 Ga0496117_0048987 Ga0496117_0048987_1482_2075 193
718 3300048920 Ga0496117_0060976 Ga0496117_0060976_1254_1838 193
719 3300048920 Ga0496117_0129997 Ga0496117_0129997_45_626 193
720 3300048920 Ga0496117_0187860 Ga0496117_0187860_528_1109 193
721 3300048921 Ga0496118_0001177 Ga0496118_0001177_34899_35483 193
722 3300048921 Ga0496118_0006906 Ga0496118_0006906_6589_7170 193
723 3300048921 Ga0496118_0027532 Ga0496118_0027532_1429_2013 193
724 3300048921 Ga0496118_0048085 Ga0496118_0048085_2040_2621 193
725 3300048921 Ga0496118_0200046 Ga0496118_0200046_346_927 193
726 3300048922 Ga0496119_0000652 Ga0496119_0000652_5048_5632 193
727 3300048922 Ga0496119_0032891 Ga0496119_0032891_1947_2531 193
728 3300048922 Ga0496119_0043665 Ga0496119_0043665_2024_2605 193
729 3300048923 Ga0496120_0004234 Ga0496120_0004234_6727_7311 193
730 3300048923 Ga0496120_0022172 Ga0496120_0022172_2134_2715 193
731 3300048924 Ga0496121_0000713 Ga0496121_0000713_6561_7142 193
732 3300048924 Ga0496121_0004199 Ga0496121_0004199_3312_3905 193
733 3300048924 Ga0496121_0013964 Ga0496121_0013964_5160_5753 193
734 3300048924 Ga0496121_0040355 Ga0496121_0040355_1221_1802 193
735 3300048924 Ga0496121_0142047 Ga0496121_0142047_42_623 193
736 3300048925 Ga0496122_0001163 Ga0496122_0001163_5272_5856 193
737 3300048925 Ga0496122_0005124 Ga0496122_0005124_10127_10720 193
738 3300048925 Ga0496122_0010010 Ga0496122_0010010_6403_6984 193
739 3300048925 Ga0496122_0010575 Ga0496122_0010575_6518_7111 193
740 3300048925 Ga0496122_0010852 Ga0496122_0010852_45_638 193
741 3300048925 Ga0496122_0028971 Ga0496122_0028971_1277_1858 193
742 3300048925 Ga0496122_0099794 Ga0496122_0099794_110_691 193
743 3300048925 Ga0496122_0140012 Ga0496122_0140012_165_749 193
744 3300048925 Ga0496122_0275547 Ga0496122_0275547_156_740 193
745 3300048925 Ga0496122_0295202 Ga0496122_0295202_155_739 193
746 3300048926 Ga0496123_0004034 Ga0496123_0004034_10150_10743 193
747 3300048926 Ga0496123_0005918 Ga0496123_0005918_5063_5644 193
748 3300048926 Ga0496123_0006686 Ga0496123_0006686_6885_7466 193
749 3300048926 Ga0496123_0008107 Ga0496123_0008107_4951_5535 193
750 3300048926 Ga0496123_0016581 Ga0496123_0016581_526_1119 193
751 3300048926 Ga0496123_0022082 Ga0496123_0022082_4079_4672 193
752 3300048926 Ga0496123_0072378 Ga0496123_0072378_496_1077 193
753 3300048926 Ga0496123_0266371 Ga0496123_0266371_141_725 193
754 3300048927 Ga0496124_0000827 Ga0496124_0000827_6605_7192 193
755 3300048927 Ga0496124_0001378 Ga0496124_0001378_31862_32446 193
756 3300048927 Ga0496124_0005974 Ga0496124_0005974_666_1259 193
757 3300048927 Ga0496124_0006224 Ga0496124_0006224_7553_8134 193
758 3300048927 Ga0496124_0009744 Ga0496124_0009744_4805_5389 193
759 3300048927 Ga0496124_0010490 Ga0496124_0010490_2410_2991 193
760 3300048927 Ga0496124_0020017 Ga0496124_0020017_3645_4226 193
761 3300048927 Ga0496124_0047150 Ga0496124_0047150_2792_3373 193
762 3300048927 Ga0496124_0060038 Ga0496124_0060038_138_719 193
763 3300048927 Ga0496124_0135754 Ga0496124_0135754_1052_1636 193
764 3300048927 Ga0496124_0186330 Ga0496124_0186330_666_1259 193
765 3300048927 Ga0496124_0272038 Ga0496124_0272038_515_1096 193
766 3300048927 Ga0496124_0297685 Ga0496124_0297685_102_695 193
767 3300048927 Ga0496124_0360719 Ga0496124_0360719_81_662 193
768 3300048927 Ga0496124_0457147 Ga0496124_0457147_188_769 193
769 3300048928 Ga0496125_0000942 Ga0496125_0000942_5012_5596 193
770 3300048928 Ga0496125_0005998 Ga0496125_0005998_8373_8957 193
771 3300048928 Ga0496125_0010562 Ga0496125_0010562_2040_2621 193
772 3300048928 Ga0496125_0048153 Ga0496125_0048153_2594_3175 193
773 3300048928 Ga0496125_0191961 Ga0496125_0191961_513_1094 193
774 3300048928 Ga0496125_0308347 Ga0496125_0308347_312_893 193
775 3300048928 Ga0496125_0512374 Ga0496125_0512374_45_626 193
776 3300048929 Ga0496126_0017405 Ga0496126_0017405_2460_3044 193
777 3300048929 Ga0496126_0038560 Ga0496126_0038560_890_1474 193
778 3300048929 Ga0496126_0079807 Ga0496126_0079807_366_947 193
779 3300048929 Ga0496126_0158908 Ga0496126_0158908_1211_1792 193
780 3300049459 Ga0495678_000057 Ga0495678_000057_6474_7067 193
781 3300049459 Ga0495678_000243 Ga0495678_000243_54213_54803 193
782 3300049459 Ga0495678_004094 Ga0495678_004094_7487_8077 193
783 3300049459 Ga0495678_007089 Ga0495678_007089_2615_3196 193
784 3300049459 Ga0495678_009221 Ga0495678_009221_4166_4747 193
785 3300049459 Ga0495678_013613 Ga0495678_013613_2720_3313 193
786 3300049459 Ga0495678_025331 Ga0495678_025331_1803_2387 193
787 3300049460 Ga0495682_0000662 Ga0495682_0000662_6583_7176 193
788 3300049460 Ga0495682_0001276 Ga0495682_0001276_5083_5664 193
789 3300049460 Ga0495682_0078040 Ga0495682_0078040_74_655 193
790 3300049571 Ga0501034_0000214 Ga0501034_0000214_5272_5856 193
791 3300049662 Ga0501222_001494 Ga0501222_001494_332_922 193
792 3300049665 Ga0501227_012441 Ga0501227_012441_984_1574 193
793 3300049766 Ga0501269_004946 Ga0501269_004946_895_1485 193
794 3300049766 Ga0501269_006181 Ga0501269_006181_839_1420 193
795 3300049853 Ga0501226_001115 Ga0501226_001115_1300_1890 193
796 3300050491 nmdc:mga00v17_182812_c1 nmdc:mga00v17_182812_c1_727_1308 193
797 3300053125 Ga0500618_001470 Ga0500618_001470_1005_1589 193
798 3300053135 Ga0500659_0001693 Ga0500659_0001693_10438_11022 193
799 3300053140 Ga0500573_0003938 Ga0500573_0003938_5975_6565 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09186

DUF1949

Domain of unknown function (DUF1949)

131

186

0.98

PF01205

UPF0029

Uncharacterized protein family UPF0029

13

115

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3grz-assembly1.cif.gz_B crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.907 135 170
3grz-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.9047 135 170
2cve-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein tt1547 from thermus thermophilus hb8 0.8526 3 192
4w2e-assembly1.cif.gz_y crystal structure of elongation factor 4 (ef4/lepa) bound to the thermus thermophilus 70s ribosome 0.8512 126 191
2cve-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein tt1547 from thermus thermophilus hb8 0.8444 3 192
ID Description Score Start End Superfamily
af_Q6ZJC5_65_187_3.30.230.30 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Impact, N-terminal domain 0.9989 3 124 3.30.230.30
af_Q6ZJC5_65_187_3.30.230.30 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Impact, N-terminal domain 0.9828 3 124 3.30.230.30
1vi7A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9721 127 192 3.30.70.240
af_Q2G059_1_130_3.30.230.30 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Impact, N-terminal domain 0.9467 1 122 3.30.230.30
af_P27862_1_132_3.30.230.30 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Impact, N-terminal domain 0.9343 1 123 3.30.230.30
ID Description Score Start End GO Terms
AF-A0A7C2NIJ7-F1-model_v4 YigZ family protein 0.9774 2 122 GO:0005737
GO:0006446
AF-A0A7Y5FDZ8-F1-model_v4 deleted 0.9763 4 117
AF-A0A7C6L6S6-F1-model_v4 YigZ family protein 0.9752 2 122 GO:0005737
GO:0006446
AF-A0A497I1F6-F1-model_v4 YigZ family protein 0.9745 1 111 GO:0005737
GO:0006446
AF-A0A354WMG7-F1-model_v4 YigZ family protein 0.973 2 122 GO:0005737
GO:0006446

Feature Viewer

pLDDT pTM Quality
96.2 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map