F481365
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 800 | 271 | 800 | 210 |
Family's Representative Sequence
| Representative Sequence | 3300005328|Ga0070676_10028963|Ga0070676_100289633 |
| Length | 242 |
| Sequence | MRDERAPMNDPDPAMYKAADASSSAGRTEEPRSSAATHAQSRVAIPHPLTPEDRGRADFYALLARLYAGAPDWPLLQAIARAPALEGGGPIAASWQRLTAASGAMDTAAAEQEYTDLFIGVGKSEVNLHGSHWIAGAMMERPLAELRAELATLGLGRRAGVTMLEDHLSALFESMRLLIAGSDGRAPASVATQRAFFERHIGPWAFACCAAIRETTIANYYACVAEFTEQFMALDRDALAME |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 196 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 198 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 199 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 201 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 202 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 203 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 204 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 217 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 220 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 223 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 224 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 227 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 228 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 229 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 230 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 231 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 232 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 233 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 234 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 253 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 254 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 255 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 256 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 257 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 260 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 261 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 262 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 263 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.38 |
| Metatranscriptomes | 0.62 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4 |
| Rhizosphere | 96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10015763 | 3300001991 | Unclassified | 1404 |
| 2 | JGI24744J21845_10035547 | 3300002077 | Bacteria | 942 |
| 3 | Ga0065715_10156372 | 3300005293 | Bacteria | 1646 |
| 4 | Ga0070658_10013205 | 3300005327 | Bacteria | 6626 |
| 5 | Ga0070658_10089647 | 3300005327 | Bacteria | 2532 |
| 6 | Ga0070658_10180487 | 3300005327 | Bacteria | 1776 |
| 7 | Ga0070676_10028963 | 3300005328 | Bacteria | 3147 |
| 8 | Ga0070676_10038410 | 3300005328 | Bacteria | 2766 |
| 9 | Ga0070676_10111177 | 3300005328 | Bacteria | 1706 |
| 10 | Ga0070676_10119398 | 3300005328 | Bacteria | 1653 |
| 11 | Ga0070683_100008229 | 3300005329 | Bacteria | 8861 |
| 12 | Ga0070683_100044968 | 3300005329 | Bacteria | 4074 |
| 13 | Ga0070683_100990781 | 3300005329 | Unclassified | 807 |
| 14 | Ga0070690_100003757 | 3300005330 | Bacteria | 8366 |
| 15 | Ga0070690_100153467 | 3300005330 | Bacteria | 1573 |
| 16 | Ga0070690_100179646 | 3300005330 | Bacteria | 1462 |
| 17 | Ga0070670_100000721 | 3300005331 | Bacteria | 25663 |
| 18 | Ga0070670_100022535 | 3300005331 | Bacteria | 5420 |
| 19 | Ga0070670_100056338 | 3300005331 | Bacteria | 3373 |
| 20 | Ga0070670_100091558 | 3300005331 | Bacteria | 2614 |
| 21 | Ga0070670_100250911 | 3300005331 | Bacteria | 1542 |
| 22 | Ga0070670_100625053 | 3300005331 | Unclassified | 965 |
| 23 | Ga0070677_10015084 | 3300005333 | Bacteria | 2732 |
| 24 | Ga0068869_100000106 | 3300005334 | Bacteria | 39499 |
| 25 | Ga0068869_100075246 | 3300005334 | Bacteria | 2508 |
| 26 | Ga0068869_100195024 | 3300005334 | Bacteria | 1594 |
| 27 | Ga0070666_10107395 | 3300005335 | Bacteria | 1928 |
| 28 | Ga0070666_10109013 | 3300005335 | Bacteria | 1913 |
| 29 | Ga0070666_10188680 | 3300005335 | Bacteria | 1448 |
| 30 | Ga0070680_100128278 | 3300005336 | Bacteria | 2120 |
| 31 | Ga0070680_100160171 | 3300005336 | Bacteria | 1891 |
| 32 | Ga0070680_100324563 | 3300005336 | Unclassified | 1307 |
| 33 | Ga0070682_100120646 | 3300005337 | Bacteria | 1760 |
| 34 | Ga0070682_100226244 | 3300005337 | Bacteria | 1335 |
| 35 | Ga0068868_100007615 | 3300005338 | Bacteria | 7722 |
| 36 | Ga0068868_100126450 | 3300005338 | Bacteria | 2089 |
| 37 | Ga0068868_100197033 | 3300005338 | Bacteria | 1677 |
| 38 | Ga0068868_100199362 | 3300005338 | Bacteria | 1668 |
| 39 | Ga0068868_100282292 | 3300005338 | Archaea | 1406 |
| 40 | Ga0070660_100010199 | 3300005339 | Bacteria | 6633 |
| 41 | Ga0070660_100010721 | 3300005339 | Bacteria | 6486 |
| 42 | Ga0070660_100100862 | 3300005339 | Bacteria | 2287 |
| 43 | Ga0070660_100135573 | 3300005339 | Bacteria | 1972 |
| 44 | Ga0070660_100249794 | 3300005339 | Bacteria | 1446 |
| 45 | Ga0070660_100269510 | 3300005339 | Bacteria | 1391 |
| 46 | Ga0070660_100300079 | 3300005339 | Bacteria | 1317 |
| 47 | Ga0070660_100538854 | 3300005339 | Unclassified | 973 |
| 48 | Ga0070689_100007744 | 3300005340 | Bacteria | 7526 |
| 49 | Ga0070689_100133536 | 3300005340 | Bacteria | 1992 |
| 50 | Ga0070689_100232418 | 3300005340 | Bacteria | 1516 |
| 51 | Ga0070687_100146301 | 3300005343 | Unclassified | 1382 |
| 52 | Ga0070687_100147184 | 3300005343 | Bacteria | 1378 |
| 53 | Ga0070661_100006442 | 3300005344 | Bacteria | 8092 |
| 54 | Ga0070661_100006563 | 3300005344 | Bacteria | 8022 |
| 55 | Ga0070661_100016522 | 3300005344 | Bacteria | 5220 |
| 56 | Ga0070661_100018753 | 3300005344 | Bacteria | 4923 |
| 57 | Ga0070661_100061746 | 3300005344 | Bacteria | 2751 |
| 58 | Ga0070661_100251773 | 3300005344 | Bacteria | 1363 |
| 59 | Ga0070661_100298929 | 3300005344 | Bacteria | 1252 |
| 60 | Ga0070661_100444475 | 3300005344 | Unclassified | 1031 |
| 61 | Ga0070661_100625834 | 3300005344 | Bacteria | 872 |
| 62 | Ga0070661_101048418 | 3300005344 | Bacteria | 678 |
| 63 | Ga0070692_10058776 | 3300005345 | Bacteria | 2020 |
| 64 | Ga0070668_100044975 | 3300005347 | Bacteria | 3388 |
| 65 | Ga0070668_100081162 | 3300005347 | Bacteria | 2542 |
| 66 | Ga0070668_100124059 | 3300005347 | Bacteria | 2067 |
| 67 | Ga0070668_100142810 | 3300005347 | Unclassified | 1930 |
| 68 | Ga0070668_100225323 | 3300005347 | Unclassified | 1548 |
| 69 | Ga0070668_100482902 | 3300005347 | Unclassified | 1070 |
| 70 | Ga0070668_100901838 | 3300005347 | Bacteria | 790 |
| 71 | Ga0070669_100002610 | 3300005353 | Bacteria | 13031 |
| 72 | Ga0070669_100022397 | 3300005353 | Bacteria | 4516 |
| 73 | Ga0070669_100109983 | 3300005353 | Bacteria | 2090 |
| 74 | Ga0070669_100147828 | 3300005353 | Bacteria | 1816 |
| 75 | Ga0070669_100269711 | 3300005353 | Bacteria | 1360 |
| 76 | Ga0070675_100031296 | 3300005354 | Bacteria | 4300 |
| 77 | Ga0070675_100103016 | 3300005354 | Bacteria | 2406 |
| 78 | Ga0070675_100163157 | 3300005354 | Bacteria | 1918 |
| 79 | Ga0070671_100006650 | 3300005355 | Bacteria | 9243 |
| 80 | Ga0070671_100023700 | 3300005355 | Bacteria | 5025 |
| 81 | Ga0070674_100002332 | 3300005356 | Bacteria | 10476 |
| 82 | Ga0070674_100037406 | 3300005356 | Bacteria | 3264 |
| 83 | Ga0070674_100060793 | 3300005356 | Bacteria | 2634 |
| 84 | Ga0070674_100153053 | 3300005356 | Bacteria | 1742 |
| 85 | Ga0070673_100006942 | 3300005364 | Bacteria | 7411 |
| 86 | Ga0070673_100011016 | 3300005364 | Bacteria | 6157 |
| 87 | Ga0070673_100216133 | 3300005364 | Unclassified | 1657 |
| 88 | Ga0070688_100024370 | 3300005365 | Bacteria | 3570 |
| 89 | Ga0070688_100027403 | 3300005365 | Bacteria | 3394 |
| 90 | Ga0070659_100002261 | 3300005366 | Bacteria | 13722 |
| 91 | Ga0070659_100016936 | 3300005366 | Bacteria | 5478 |
| 92 | Ga0070659_100085769 | 3300005366 | Bacteria | 2519 |
| 93 | Ga0070659_100100848 | 3300005366 | Bacteria | 2323 |
| 94 | Ga0070659_100233312 | 3300005366 | Bacteria | 1521 |
| 95 | Ga0070659_100314745 | 3300005366 | Bacteria | 1307 |
| 96 | Ga0070659_100809114 | 3300005366 | Bacteria | 815 |
| 97 | Ga0070667_100036439 | 3300005367 | Bacteria | 4124 |
| 98 | Ga0070667_100063921 | 3300005367 | Bacteria | 3121 |
| 99 | Ga0070667_100125623 | 3300005367 | Bacteria | 2235 |
| 100 | Ga0070667_100218959 | 3300005367 | Unclassified | 1694 |
| 101 | Ga0070667_100413749 | 3300005367 | Bacteria | 1229 |
| 102 | Ga0070667_100651277 | 3300005367 | Bacteria | 973 |
| 103 | Ga0070703_10012071 | 3300005406 | Bacteria | 2446 |
| 104 | Ga0070709_10159627 | 3300005434 | Bacteria | 1566 |
| 105 | Ga0070709_10181163 | 3300005434 | Bacteria | 1479 |
| 106 | Ga0070709_10302988 | 3300005434 | Unclassified | 1168 |
| 107 | Ga0070709_10341155 | 3300005434 | Bacteria | 1104 |
| 108 | Ga0070714_100036247 | 3300005435 | Bacteria | 4136 |
| 109 | Ga0070714_100038580 | 3300005435 | Bacteria | 4016 |
| 110 | Ga0070714_100042440 | 3300005435 | Bacteria | 3843 |
| 111 | Ga0070714_100274414 | 3300005435 | Bacteria | 1564 |
| 112 | Ga0070714_100420922 | 3300005435 | Bacteria | 1265 |
| 113 | Ga0070714_100513022 | 3300005435 | Bacteria | 1144 |
| 114 | Ga0070713_100000694 | 3300005436 | Bacteria | 21627 |
| 115 | Ga0070713_100004630 | 3300005436 | Bacteria | 9275 |
| 116 | Ga0070713_100005864 | 3300005436 | Bacteria | 8442 |
| 117 | Ga0070713_100238578 | 3300005436 | Bacteria | 1655 |
| 118 | Ga0070710_10015135 | 3300005437 | Bacteria | 3898 |
| 119 | Ga0070701_10161958 | 3300005438 | Bacteria | 1297 |
| 120 | Ga0070711_100157388 | 3300005439 | Bacteria | 1719 |
| 121 | Ga0070711_100328120 | 3300005439 | Unclassified | 1224 |
| 122 | Ga0070705_100024577 | 3300005440 | Bacteria | 3254 |
| 123 | Ga0070694_100007279 | 3300005444 | Bacteria | 6741 |
| 124 | Ga0070694_100096907 | 3300005444 | Bacteria | 2080 |
| 125 | Ga0070708_100337852 | 3300005445 | Bacteria | 1419 |
| 126 | Ga0070663_100017134 | 3300005455 | Bacteria | 4721 |
| 127 | Ga0070663_100032818 | 3300005455 | Bacteria | 3583 |
| 128 | Ga0070663_100038441 | 3300005455 | Bacteria | 3338 |
| 129 | Ga0070663_100063082 | 3300005455 | Bacteria | 2674 |
| 130 | Ga0070663_100064607 | 3300005455 | Bacteria | 2646 |
| 131 | Ga0070663_100106015 | 3300005455 | Bacteria | 2105 |
| 132 | Ga0070663_100259927 | 3300005455 | Bacteria | 1377 |
| 133 | Ga0070678_100145800 | 3300005456 | Bacteria | 1900 |
| 134 | Ga0070678_100308015 | 3300005456 | Bacteria | 1348 |
| 135 | Ga0070662_100000291 | 3300005457 | Bacteria | 29613 |
| 136 | Ga0070662_100029543 | 3300005457 | Bacteria | 3827 |
| 137 | Ga0070662_100140183 | 3300005457 | Bacteria | 1873 |
| 138 | Ga0070662_100190195 | 3300005457 | Bacteria | 1623 |
| 139 | Ga0070662_100334690 | 3300005457 | Bacteria | 1237 |
| 140 | Ga0070662_100456116 | 3300005457 | Bacteria | 1062 |
| 141 | Ga0070681_10070048 | 3300005458 | Bacteria | 3472 |
| 142 | Ga0070681_10089384 | 3300005458 | Bacteria | 3032 |
| 143 | Ga0070681_10093306 | 3300005458 | Bacteria | 2959 |
| 144 | Ga0070681_10103222 | 3300005458 | Bacteria | 2795 |
| 145 | Ga0070681_10270297 | 3300005458 | Unclassified | 1611 |
| 146 | Ga0068867_100018182 | 3300005459 | Bacteria | 4995 |
| 147 | Ga0068867_100027952 | 3300005459 | Bacteria | 4058 |
| 148 | Ga0068867_100076456 | 3300005459 | Bacteria | 2514 |
| 149 | Ga0068867_101313796 | 3300005459 | Unclassified | 668 |
| 150 | Ga0070685_10012861 | 3300005466 | Bacteria | 4405 |
| 151 | Ga0070685_10013985 | 3300005466 | Bacteria | 4246 |
| 152 | Ga0070706_100035231 | 3300005467 | Bacteria | 4622 |
| 153 | Ga0070706_100307250 | 3300005467 | Bacteria | 1479 |
| 154 | Ga0070707_100026925 | 3300005468 | Bacteria | 5465 |
| 155 | Ga0070707_100107667 | 3300005468 | Bacteria | 2704 |
| 156 | Ga0070707_100284166 | 3300005468 | Bacteria | 1608 |
| 157 | Ga0070707_100451729 | 3300005468 | Bacteria | 1246 |
| 158 | Ga0070707_100843900 | 3300005468 | Unclassified | 880 |
| 159 | Ga0070698_100081710 | 3300005471 | Bacteria | 3225 |
| 160 | Ga0070698_100109838 | 3300005471 | Bacteria | 2724 |
| 161 | Ga0070698_100172125 | 3300005471 | Bacteria | 2106 |
| 162 | Ga0070698_100379330 | 3300005471 | Bacteria | 1346 |
| 163 | Ga0070699_100166196 | 3300005518 | Bacteria | 1954 |
| 164 | Ga0070699_100237861 | 3300005518 | Unclassified | 1624 |
| 165 | Ga0070699_101153140 | 3300005518 | Bacteria | 711 |
| 166 | Ga0070679_100029448 | 3300005530 | Bacteria | 5418 |
| 167 | Ga0070679_100266925 | 3300005530 | Bacteria | 1666 |
| 168 | Ga0070679_100274878 | 3300005530 | Bacteria | 1638 |
| 169 | Ga0070679_100704831 | 3300005530 | Bacteria | 952 |
| 170 | Ga0070684_100265888 | 3300005535 | Unclassified | 1569 |
| 171 | Ga0070684_100397383 | 3300005535 | Bacteria | 1270 |
| 172 | Ga0070697_100039754 | 3300005536 | Bacteria | 3804 |
| 173 | Ga0070697_100238760 | 3300005536 | Unclassified | 1551 |
| 174 | Ga0070697_100321614 | 3300005536 | Bacteria | 1332 |
| 175 | Ga0068853_100039736 | 3300005539 | Bacteria | 4013 |
| 176 | Ga0068853_100098828 | 3300005539 | Bacteria | 2577 |
| 177 | Ga0068853_100120769 | 3300005539 | Bacteria | 2337 |
| 178 | Ga0068853_100143537 | 3300005539 | Bacteria | 2144 |
| 179 | Ga0068853_100143749 | 3300005539 | Bacteria | 2142 |
| 180 | Ga0068853_100196459 | 3300005539 | Bacteria | 1835 |
| 181 | Ga0068853_100305663 | 3300005539 | Bacteria | 1471 |
| 182 | Ga0070672_100004581 | 3300005543 | Bacteria | 9050 |
| 183 | Ga0070672_100027206 | 3300005543 | Bacteria | 4264 |
| 184 | Ga0070672_100107021 | 3300005543 | Bacteria | 2275 |
| 185 | Ga0070672_100138559 | 3300005543 | Bacteria | 2005 |
| 186 | Ga0070672_100156011 | 3300005543 | Bacteria | 1891 |
| 187 | Ga0070672_100255236 | 3300005543 | Unclassified | 1477 |
| 188 | Ga0070686_100631479 | 3300005544 | Bacteria | 847 |
| 189 | Ga0070696_100020735 | 3300005546 | Bacteria | 4453 |
| 190 | Ga0070696_100086353 | 3300005546 | Bacteria | 2228 |
| 191 | Ga0070696_100673693 | 3300005546 | Bacteria | 841 |
| 192 | Ga0070693_100011957 | 3300005547 | Bacteria | 4381 |
| 193 | Ga0070693_100069188 | 3300005547 | Bacteria | 2074 |
| 194 | Ga0070665_100004289 | 3300005548 | Bacteria | 14987 |
| 195 | Ga0070665_100030174 | 3300005548 | Bacteria | 5456 |
| 196 | Ga0070665_100070962 | 3300005548 | Bacteria | 3490 |
| 197 | Ga0070665_100402103 | 3300005548 | Bacteria | 1378 |
| 198 | Ga0070704_100008028 | 3300005549 | Bacteria | 6305 |
| 199 | Ga0068855_100009716 | 3300005563 | Bacteria | 11611 |
| 200 | Ga0068855_100159811 | 3300005563 | Bacteria | 2558 |
| 201 | Ga0068855_100214885 | 3300005563 | Bacteria | 2159 |
| 202 | Ga0068855_100260078 | 3300005563 | Bacteria | 1934 |
| 203 | Ga0068855_100261208 | 3300005563 | Bacteria | 1929 |
| 204 | Ga0068855_100354442 | 3300005563 | Bacteria | 1616 |
| 205 | Ga0068855_100394050 | 3300005563 | Bacteria | 1518 |
| 206 | Ga0068855_100408162 | 3300005563 | Unclassified | 1488 |
| 207 | Ga0070664_100003055 | 3300005564 | Bacteria | 13534 |
| 208 | Ga0070664_100004791 | 3300005564 | Bacteria | 10841 |
| 209 | Ga0070664_100041319 | 3300005564 | Bacteria | 3891 |
| 210 | Ga0070664_100118871 | 3300005564 | Bacteria | 2312 |
| 211 | Ga0070664_100211473 | 3300005564 | Bacteria | 1733 |
| 212 | Ga0068857_100035955 | 3300005577 | Bacteria | 4388 |
| 213 | Ga0068857_100063368 | 3300005577 | Bacteria | 3286 |
| 214 | Ga0068857_100288230 | 3300005577 | Bacteria | 1511 |
| 215 | Ga0068857_100356147 | 3300005577 | Bacteria | 1356 |
| 216 | Ga0068857_100363595 | 3300005577 | Bacteria | 1341 |
| 217 | Ga0068857_100619277 | 3300005577 | Bacteria | 1024 |
| 218 | Ga0068857_100834323 | 3300005577 | Unclassified | 881 |
| 219 | Ga0068857_101111221 | 3300005577 | Bacteria | 763 |
| 220 | Ga0068854_100004902 | 3300005578 | Bacteria | 8444 |
| 221 | Ga0068854_100021479 | 3300005578 | Bacteria | 4381 |
| 222 | Ga0068854_100142553 | 3300005578 | Bacteria | 1840 |
| 223 | Ga0068854_100153553 | 3300005578 | Unclassified | 1777 |
| 224 | Ga0068854_100169431 | 3300005578 | Bacteria | 1698 |
| 225 | Ga0068854_100214187 | 3300005578 | Bacteria | 1521 |
| 226 | Ga0068854_100379019 | 3300005578 | Bacteria | 1165 |
| 227 | Ga0068856_100063534 | 3300005614 | Bacteria | 3647 |
| 228 | Ga0068856_100183433 | 3300005614 | Bacteria | 2106 |
| 229 | Ga0068856_100466097 | 3300005614 | Bacteria | 1284 |
| 230 | Ga0068856_100626177 | 3300005614 | Bacteria | 1097 |
| 231 | Ga0068856_100815706 | 3300005614 | Bacteria | 952 |
| 232 | Ga0070702_100378400 | 3300005615 | Unclassified | 1006 |
| 233 | Ga0068852_100007301 | 3300005616 | Bacteria | 8058 |
| 234 | Ga0068852_100056542 | 3300005616 | Bacteria | 3391 |
| 235 | Ga0068852_100069869 | 3300005616 | Bacteria | 3079 |
| 236 | Ga0068852_100238509 | 3300005616 | Bacteria | 1736 |
| 237 | Ga0068852_100278705 | 3300005616 | Bacteria | 1611 |
| 238 | Ga0068852_100300722 | 3300005616 | Bacteria | 1553 |
| 239 | Ga0068852_100376707 | 3300005616 | Bacteria | 1391 |
| 240 | Ga0068859_100000273 | 3300005617 | Bacteria | 51339 |
| 241 | Ga0068859_100023653 | 3300005617 | Bacteria | 6167 |
| 242 | Ga0068859_100044151 | 3300005617 | Bacteria | 4479 |
| 243 | Ga0068859_100057638 | 3300005617 | Bacteria | 3912 |
| 244 | Ga0068859_100915510 | 3300005617 | Bacteria | 961 |
| 245 | Ga0068859_101183725 | 3300005617 | Bacteria | 842 |
| 246 | Ga0068864_100002063 | 3300005618 | Bacteria | 16600 |
| 247 | Ga0068864_100011007 | 3300005618 | Bacteria | 7480 |
| 248 | Ga0068864_100505258 | 3300005618 | Bacteria | 1164 |
| 249 | Ga0068866_10003742 | 3300005718 | Bacteria | 6237 |
| 250 | Ga0068866_10017938 | 3300005718 | Bacteria | 3193 |
| 251 | Ga0068866_10161142 | 3300005718 | Bacteria | 1308 |
| 252 | Ga0068861_100000427 | 3300005719 | Bacteria | 24490 |
| 253 | Ga0068861_100088968 | 3300005719 | Bacteria | 2433 |
| 254 | Ga0068851_10002925 | 3300005834 | Bacteria | 7542 |
| 255 | Ga0068851_10018629 | 3300005834 | Bacteria | 3347 |
| 256 | Ga0068851_10031522 | 3300005834 | Bacteria | 2634 |
| 257 | Ga0068851_10056114 | 3300005834 | Bacteria | 2008 |
| 258 | Ga0068851_10472213 | 3300005834 | Bacteria | 748 |
| 259 | Ga0068870_10037705 | 3300005840 | Bacteria | 2492 |
| 260 | Ga0068870_10098989 | 3300005840 | Bacteria | 1644 |
| 261 | Ga0068863_100000481 | 3300005841 | Bacteria | 40838 |
| 262 | Ga0068863_100026802 | 3300005841 | Bacteria | 5496 |
| 263 | Ga0068863_100329342 | 3300005841 | Bacteria | 1485 |
| 264 | Ga0068863_100347140 | 3300005841 | Bacteria | 1444 |
| 265 | Ga0068863_100501089 | 3300005841 | Bacteria | 1196 |
| 266 | Ga0068858_100002596 | 3300005842 | Bacteria | 18194 |
| 267 | Ga0068858_100005514 | 3300005842 | Bacteria | 12386 |
| 268 | Ga0068858_100094370 | 3300005842 | Bacteria | 2787 |
| 269 | Ga0068858_100243810 | 3300005842 | Bacteria | 1706 |
| 270 | Ga0068860_100014374 | 3300005843 | Bacteria | 7757 |
| 271 | Ga0068860_100037955 | 3300005843 | Bacteria | 4610 |
| 272 | Ga0068860_100043526 | 3300005843 | Bacteria | 4283 |
| 273 | Ga0068860_100079865 | 3300005843 | Bacteria | 3110 |
| 274 | Ga0068860_100483898 | 3300005843 | Bacteria | 1234 |
| 275 | Ga0068860_100484525 | 3300005843 | Bacteria | 1233 |
| 276 | Ga0068860_100701949 | 3300005843 | Bacteria | 1021 |
| 277 | Ga0068862_100008312 | 3300005844 | Bacteria | 8589 |
| 278 | Ga0068862_100065184 | 3300005844 | Bacteria | 3137 |
| 279 | Ga0068862_100242031 | 3300005844 | Bacteria | 1641 |
| 280 | Ga0068862_100328915 | 3300005844 | Bacteria | 1413 |
| 281 | Ga0068862_100569816 | 3300005844 | Bacteria | 1083 |
| 282 | Ga0070717_10177507 | 3300006028 | Bacteria | 1855 |
| 283 | Ga0070715_10011259 | 3300006163 | Bacteria | 3217 |
| 284 | Ga0070716_100006729 | 3300006173 | Bacteria | 5630 |
| 285 | Ga0070712_100013314 | 3300006175 | Bacteria | 5253 |
| 286 | Ga0070712_100193196 | 3300006175 | Unclassified | 1594 |
| 287 | Ga0070712_100267124 | 3300006175 | Unclassified | 1373 |
| 288 | Ga0070712_100419041 | 3300006175 | Unclassified | 1109 |
| 289 | Ga0097621_100012286 | 3300006237 | Bacteria | 6338 |
| 290 | Ga0097621_100806054 | 3300006237 | Unclassified | 870 |
| 291 | Ga0068871_100006677 | 3300006358 | Bacteria | 8185 |
| 292 | Ga0068871_100008285 | 3300006358 | Bacteria | 7470 |
| 293 | Ga0068871_100924834 | 3300006358 | Unclassified | 809 |
| 294 | Ga0075433_10064467 | 3300006852 | Bacteria | 3212 |
| 295 | Ga0075433_10105986 | 3300006852 | Bacteria | 2491 |
| 296 | Ga0075433_10354133 | 3300006852 | Bacteria | 1297 |
| 297 | Ga0075434_100062744 | 3300006871 | Bacteria | 3700 |
| 298 | Ga0075434_100175093 | 3300006871 | Bacteria | 2165 |
| 299 | Ga0075434_100348140 | 3300006871 | Bacteria | 1503 |
| 300 | Ga0075434_100402593 | 3300006871 | Unclassified | 1390 |
| 301 | Ga0075434_100447365 | 3300006871 | Bacteria | 1313 |
| 302 | Ga0075434_100629710 | 3300006871 | Unclassified | 1091 |
| 303 | Ga0068865_100004079 | 3300006881 | Bacteria | 8777 |
| 304 | Ga0068865_100013818 | 3300006881 | Bacteria | 5118 |
| 305 | Ga0075436_100003385 | 3300006914 | Bacteria | 10924 |
| 306 | Ga0075436_100042101 | 3300006914 | Bacteria | 3149 |
| 307 | Ga0075436_100193319 | 3300006914 | Bacteria | 1440 |
| 308 | Ga0075436_100419186 | 3300006914 | Bacteria | 972 |
| 309 | Ga0097620_100000273 | 3300006931 | Bacteria | 51339 |
| 310 | Ga0097620_100023652 | 3300006931 | Bacteria | 6167 |
| 311 | Ga0097620_100044145 | 3300006931 | Bacteria | 4479 |
| 312 | Ga0097620_100057637 | 3300006931 | Bacteria | 3912 |
| 313 | Ga0097620_100915453 | 3300006931 | Bacteria | 961 |
| 314 | Ga0097620_101183761 | 3300006931 | Bacteria | 842 |
| 315 | Ga0075435_100027482 | 3300007076 | Bacteria | 4451 |
| 316 | Ga0075435_100730710 | 3300007076 | Unclassified | 861 |
| 317 | Ga0105240_10004546 | 3300009093 | Bacteria | 21059 |
| 318 | Ga0105240_10035547 | 3300009093 | Bacteria | 6419 |
| 319 | Ga0105240_10472153 | 3300009093 | Unclassified | 1400 |
| 320 | Ga0111539_10019735 | 3300009094 | Bacteria | 8313 |
| 321 | Ga0105245_10344633 | 3300009098 | Bacteria | 1474 |
| 322 | Ga0105245_10676501 | 3300009098 | Bacteria | 1064 |
| 323 | Ga0105245_11057344 | 3300009098 | Unclassified | 857 |
| 324 | Ga0105247_10035538 | 3300009101 | Bacteria | 3037 |
| 325 | Ga0105247_10041229 | 3300009101 | Bacteria | 2824 |
| 326 | Ga0114129_10197732 | 3300009147 | Bacteria | 2725 |
| 327 | Ga0114129_10299137 | 3300009147 | Bacteria | 2145 |
| 328 | Ga0105241_10019509 | 3300009174 | Bacteria | 5000 |
| 329 | Ga0105241_10033854 | 3300009174 | Bacteria | 3837 |
| 330 | Ga0105241_10401568 | 3300009174 | Bacteria | 1202 |
| 331 | Ga0105242_10434608 | 3300009176 | Bacteria | 1233 |
| 332 | Ga0105248_10005397 | 3300009177 | Bacteria | 14051 |
| 333 | Ga0105248_10013080 | 3300009177 | Bacteria | 9139 |
| 334 | Ga0105248_10094760 | 3300009177 | Bacteria | 3361 |
| 335 | Ga0105248_10229942 | 3300009177 | Unclassified | 2087 |
| 336 | Ga0105248_10321498 | 3300009177 | Bacteria | 1743 |
| 337 | Ga0105237_10065558 | 3300009545 | Bacteria | 3628 |
| 338 | Ga0105237_10107615 | 3300009545 | Bacteria | 2780 |
| 339 | Ga0105237_10223560 | 3300009545 | Bacteria | 1883 |
| 340 | Ga0105237_10282803 | 3300009545 | Bacteria | 1661 |
| 341 | Ga0105237_10712692 | 3300009545 | Bacteria | 1010 |
| 342 | Ga0105238_10000366 | 3300009551 | Bacteria | 48570 |
| 343 | Ga0105238_10007544 | 3300009551 | Bacteria | 10892 |
| 344 | Ga0105238_10080825 | 3300009551 | Bacteria | 3240 |
| 345 | Ga0105238_10126932 | 3300009551 | Bacteria | 2529 |
| 346 | Ga0105238_10688403 | 3300009551 | Bacteria | 1034 |
| 347 | Ga0105249_10766885 | 3300009553 | Bacteria | 1027 |
| 348 | Ga0105239_10227037 | 3300010375 | Bacteria | 2095 |
| 349 | Ga0105246_10032937 | 3300011119 | Bacteria | 3440 |
| 350 | Ga0157373_10004340 | 3300013100 | Bacteria | 10675 |
| 351 | Ga0157373_10012276 | 3300013100 | Bacteria | 6296 |
| 352 | Ga0157373_10032604 | 3300013100 | Bacteria | 3749 |
| 353 | Ga0157373_10175464 | 3300013100 | Bacteria | 1508 |
| 354 | Ga0157371_10034883 | 3300013102 | Bacteria | 3607 |
| 355 | Ga0157371_10110534 | 3300013102 | Bacteria | 1951 |
| 356 | Ga0157371_10142644 | 3300013102 | Bacteria | 1706 |
| 357 | Ga0157370_10003127 | 3300013104 | Bacteria | 19607 |
| 358 | Ga0157370_10013807 | 3300013104 | Bacteria | 8297 |
| 359 | Ga0157370_10033430 | 3300013104 | Bacteria | 5015 |
| 360 | Ga0157370_10041487 | 3300013104 | Bacteria | 4439 |
| 361 | Ga0157370_10098960 | 3300013104 | Bacteria | 2734 |
| 362 | Ga0157370_10171335 | 3300013104 | Bacteria | 2018 |
| 363 | Ga0157370_10217187 | 3300013104 | Bacteria | 1772 |
| 364 | Ga0157370_10507892 | 3300013104 | Unclassified | 1107 |
| 365 | Ga0157369_10032348 | 3300013105 | Bacteria | 5753 |
| 366 | Ga0157369_10064787 | 3300013105 | Bacteria | 3935 |
| 367 | Ga0157369_10099058 | 3300013105 | Bacteria | 3108 |
| 368 | Ga0157369_10188808 | 3300013105 | Bacteria | 2166 |
| 369 | Ga0157369_10259769 | 3300013105 | Unclassified | 1811 |
| 370 | Ga0157369_10339039 | 3300013105 | Bacteria | 1562 |
| 371 | Ga0157369_10764490 | 3300013105 | Unclassified | 994 |
| 372 | Ga0157374_10036955 | 3300013296 | Bacteria | 4477 |
| 373 | Ga0157374_10186233 | 3300013296 | Bacteria | 2029 |
| 374 | Ga0157374_10263710 | 3300013296 | Bacteria | 1697 |
| 375 | Ga0157374_10278895 | 3300013296 | Bacteria | 1650 |
| 376 | Ga0157374_10585417 | 3300013296 | Bacteria | 1125 |
| 377 | Ga0157374_10667659 | 3300013296 | Bacteria | 1052 |
| 378 | Ga0157378_10053063 | 3300013297 | Bacteria | 3609 |
| 379 | Ga0157378_10096476 | 3300013297 | Bacteria | 2694 |
| 380 | Ga0157378_10622181 | 3300013297 | Bacteria | 1093 |
| 381 | Ga0163162_10286972 | 3300013306 | Bacteria | 1778 |
| 382 | Ga0163162_10739146 | 3300013306 | Bacteria | 1104 |
| 383 | Ga0157372_10002136 | 3300013307 | Bacteria | 21495 |
| 384 | Ga0157372_10033833 | 3300013307 | Bacteria | 5616 |
| 385 | Ga0157372_10042932 | 3300013307 | Bacteria | 5005 |
| 386 | Ga0157372_10075855 | 3300013307 | Bacteria | 3795 |
| 387 | Ga0157372_10138345 | 3300013307 | Bacteria | 2805 |
| 388 | Ga0157372_10159751 | 3300013307 | Bacteria | 2604 |
| 389 | Ga0157372_10181144 | 3300013307 | Bacteria | 2439 |
| 390 | Ga0157372_10188391 | 3300013307 | Bacteria | 2389 |
| 391 | Ga0157372_10209419 | 3300013307 | Bacteria | 2259 |
| 392 | Ga0157372_10533019 | 3300013307 | Bacteria | 1369 |
| 393 | Ga0157372_10554083 | 3300013307 | Bacteria | 1340 |
| 394 | Ga0157375_10108143 | 3300013308 | Bacteria | 2875 |
| 395 | Ga0157375_10116202 | 3300013308 | Bacteria | 2779 |
| 396 | Ga0157375_10159989 | 3300013308 | Bacteria | 2393 |
| 397 | Ga0157375_10298253 | 3300013308 | Bacteria | 1775 |
| 398 | Ga0163163_10022645 | 3300014325 | Bacteria | 5954 |
| 399 | Ga0157380_10186443 | 3300014326 | Bacteria | 1828 |
| 400 | Ga0182008_10065327 | 3300014497 | Bacteria | 1790 |
| 401 | Ga0157379_10000447 | 3300014968 | Bacteria | 33364 |
| 402 | Ga0157379_10001351 | 3300014968 | Bacteria | 20063 |
| 403 | Ga0157379_10006715 | 3300014968 | Bacteria | 9939 |
| 404 | Ga0157379_10838393 | 3300014968 | Bacteria | 869 |
| 405 | Ga0157376_10085376 | 3300014969 | Bacteria | 2720 |
| 406 | Ga0157376_10088072 | 3300014969 | Bacteria | 2680 |
| 407 | Ga0157376_10215356 | 3300014969 | Bacteria | 1776 |
| 408 | Ga0197907_11411880 | 3300020069 | Bacteria | 1642 |
| 409 | Ga0206356_10237737 | 3300020070 | Bacteria | 2430 |
| 410 | Ga0206356_10729429 | 3300020070 | Unclassified | 1355 |
| 411 | Ga0206354_10681834 | 3300020081 | Bacteria | 2231 |
| 412 | Ga0206353_10243398 | 3300020082 | Bacteria | 1237 |
| 413 | Ga0207697_10040245 | 3300025315 | Bacteria | 1919 |
| 414 | Ga0207656_10040229 | 3300025321 | Bacteria | 1981 |
| 415 | Ga0207656_10181182 | 3300025321 | Bacteria | 1011 |
| 416 | Ga0207653_10031643 | 3300025885 | Bacteria | 1710 |
| 417 | Ga0207653_10067173 | 3300025885 | Unclassified | 1219 |
| 418 | Ga0207682_10000678 | 3300025893 | Bacteria | 15854 |
| 419 | Ga0207692_10022875 | 3300025898 | Bacteria | 2883 |
| 420 | Ga0207692_10196063 | 3300025898 | Bacteria | 1185 |
| 421 | Ga0207692_10340410 | 3300025898 | Unclassified | 922 |
| 422 | Ga0207642_10118033 | 3300025899 | Unclassified | 1363 |
| 423 | Ga0207680_10004359 | 3300025903 | Bacteria | 6705 |
| 424 | Ga0207685_10007026 | 3300025905 | Bacteria | 3109 |
| 425 | Ga0207699_10018111 | 3300025906 | Bacteria | 3726 |
| 426 | Ga0207699_10428371 | 3300025906 | Unclassified | 946 |
| 427 | Ga0207699_10474167 | 3300025906 | Bacteria | 900 |
| 428 | Ga0207645_10005694 | 3300025907 | Bacteria | 9001 |
| 429 | Ga0207645_10025886 | 3300025907 | Bacteria | 3795 |
| 430 | Ga0207645_10143111 | 3300025907 | Unclassified | 1558 |
| 431 | Ga0207643_10007633 | 3300025908 | Bacteria | 5813 |
| 432 | Ga0207643_10042283 | 3300025908 | Bacteria | 2569 |
| 433 | Ga0207643_10110152 | 3300025908 | Bacteria | 1622 |
| 434 | Ga0207705_10008051 | 3300025909 | Bacteria | 7725 |
| 435 | Ga0207705_10222123 | 3300025909 | Bacteria | 1435 |
| 436 | Ga0207705_10266799 | 3300025909 | Bacteria | 1308 |
| 437 | Ga0207684_10113616 | 3300025910 | Bacteria | 2318 |
| 438 | Ga0207684_10694403 | 3300025910 | Unclassified | 865 |
| 439 | Ga0207654_10134788 | 3300025911 | Bacteria | 1567 |
| 440 | Ga0207654_10373640 | 3300025911 | Bacteria | 986 |
| 441 | Ga0207707_10094432 | 3300025912 | Bacteria | 2613 |
| 442 | Ga0207707_10110570 | 3300025912 | Bacteria | 2402 |
| 443 | Ga0207707_10191193 | 3300025912 | Bacteria | 1786 |
| 444 | Ga0207707_10323003 | 3300025912 | Bacteria | 1332 |
| 445 | Ga0207695_10093320 | 3300025913 | Bacteria | 3019 |
| 446 | Ga0207695_10111047 | 3300025913 | Unclassified | 2721 |
| 447 | Ga0207695_10138898 | 3300025913 | Bacteria | 2381 |
| 448 | Ga0207671_10095507 | 3300025914 | Bacteria | 2245 |
| 449 | Ga0207671_10310075 | 3300025914 | Bacteria | 1247 |
| 450 | Ga0207693_10007409 | 3300025915 | Bacteria | 9025 |
| 451 | Ga0207693_10030159 | 3300025915 | Bacteria | 4283 |
| 452 | Ga0207693_10263211 | 3300025915 | Unclassified | 1352 |
| 453 | Ga0207663_10070741 | 3300025916 | Bacteria | 2249 |
| 454 | Ga0207663_10141943 | 3300025916 | Unclassified | 1674 |
| 455 | Ga0207660_10020199 | 3300025917 | Bacteria | 4467 |
| 456 | Ga0207662_10108774 | 3300025918 | Bacteria | 1726 |
| 457 | Ga0207662_10172713 | 3300025918 | Unclassified | 1387 |
| 458 | Ga0207657_10000936 | 3300025919 | Bacteria | 30891 |
| 459 | Ga0207657_10003829 | 3300025919 | Bacteria | 15981 |
| 460 | Ga0207657_10015486 | 3300025919 | Bacteria | 7387 |
| 461 | Ga0207657_10019055 | 3300025919 | Bacteria | 6528 |
| 462 | Ga0207657_10086159 | 3300025919 | Bacteria | 2630 |
| 463 | Ga0207657_10203092 | 3300025919 | Bacteria | 1593 |
| 464 | Ga0207657_10370813 | 3300025919 | Bacteria | 1128 |
| 465 | Ga0207657_10448307 | 3300025919 | Bacteria | 1013 |
| 466 | Ga0207649_10003799 | 3300025920 | Bacteria | 8238 |
| 467 | Ga0207649_10017105 | 3300025920 | Bacteria | 4105 |
| 468 | Ga0207649_10018323 | 3300025920 | Bacteria | 3979 |
| 469 | Ga0207649_10129611 | 3300025920 | Bacteria | 1711 |
| 470 | Ga0207649_10165244 | 3300025920 | Bacteria | 1537 |
| 471 | Ga0207649_10190454 | 3300025920 | Bacteria | 1442 |
| 472 | Ga0207649_10219581 | 3300025920 | Bacteria | 1353 |
| 473 | Ga0207649_10341736 | 3300025920 | Unclassified | 1105 |
| 474 | Ga0207649_10464713 | 3300025920 | Bacteria | 957 |
| 475 | Ga0207652_10120621 | 3300025921 | Bacteria | 2333 |
| 476 | Ga0207652_10197279 | 3300025921 | Bacteria | 1811 |
| 477 | Ga0207652_10215071 | 3300025921 | Bacteria | 1731 |
| 478 | Ga0207646_10062608 | 3300025922 | Bacteria | 3321 |
| 479 | Ga0207681_10088689 | 3300025923 | Bacteria | 2203 |
| 480 | Ga0207681_10122450 | 3300025923 | Bacteria | 1909 |
| 481 | Ga0207681_10182450 | 3300025923 | Bacteria | 1600 |
| 482 | Ga0207681_10186141 | 3300025923 | Bacteria | 1585 |
| 483 | Ga0207681_10762598 | 3300025923 | Bacteria | 807 |
| 484 | Ga0207694_10020190 | 3300025924 | Bacteria | 5039 |
| 485 | Ga0207694_10031628 | 3300025924 | Bacteria | 4044 |
| 486 | Ga0207694_10249329 | 3300025924 | Bacteria | 1453 |
| 487 | Ga0207694_10355323 | 3300025924 | Bacteria | 1213 |
| 488 | Ga0207650_10003516 | 3300025925 | Bacteria | 10760 |
| 489 | Ga0207650_10044122 | 3300025925 | Bacteria | 3275 |
| 490 | Ga0207650_10056231 | 3300025925 | Bacteria | 2923 |
| 491 | Ga0207650_10075764 | 3300025925 | Bacteria | 2540 |
| 492 | Ga0207650_10149981 | 3300025925 | Bacteria | 1839 |
| 493 | Ga0207650_10225275 | 3300025925 | Unclassified | 1510 |
| 494 | Ga0207650_10439489 | 3300025925 | Bacteria | 1084 |
| 495 | Ga0207650_10458147 | 3300025925 | Unclassified | 1062 |
| 496 | Ga0207659_10003975 | 3300025926 | Bacteria | 8924 |
| 497 | Ga0207659_10033033 | 3300025926 | Bacteria | 3557 |
| 498 | Ga0207659_10044532 | 3300025926 | Bacteria | 3123 |
| 499 | Ga0207659_10228063 | 3300025926 | Bacteria | 1501 |
| 500 | Ga0207659_10811841 | 3300025926 | Bacteria | 804 |
| 501 | Ga0207687_10204156 | 3300025927 | Bacteria | 1547 |
| 502 | Ga0207687_10510614 | 3300025927 | Unclassified | 1004 |
| 503 | Ga0207687_10541915 | 3300025927 | Unclassified | 975 |
| 504 | Ga0207687_10569304 | 3300025927 | Bacteria | 952 |
| 505 | Ga0207700_10030406 | 3300025928 | Bacteria | 3825 |
| 506 | Ga0207700_10072598 | 3300025928 | Bacteria | 2654 |
| 507 | Ga0207700_10094366 | 3300025928 | Bacteria | 2370 |
| 508 | Ga0207664_10005177 | 3300025929 | Bacteria | 8888 |
| 509 | Ga0207664_10011946 | 3300025929 | Bacteria | 6200 |
| 510 | Ga0207664_10028492 | 3300025929 | Bacteria | 4245 |
| 511 | Ga0207644_10002621 | 3300025931 | Bacteria | 11583 |
| 512 | Ga0207644_10010064 | 3300025931 | Bacteria | 6227 |
| 513 | Ga0207644_10030486 | 3300025931 | Bacteria | 3751 |
| 514 | Ga0207644_10086997 | 3300025931 | Bacteria | 2321 |
| 515 | Ga0207644_10114105 | 3300025931 | Bacteria | 2047 |
| 516 | Ga0207690_10001284 | 3300025932 | Bacteria | 15861 |
| 517 | Ga0207690_10103728 | 3300025932 | Bacteria | 2036 |
| 518 | Ga0207690_10117011 | 3300025932 | Bacteria | 1929 |
| 519 | Ga0207690_10327964 | 3300025932 | Bacteria | 1205 |
| 520 | Ga0207690_10356493 | 3300025932 | Bacteria | 1158 |
| 521 | Ga0207706_10000631 | 3300025933 | Bacteria | 37435 |
| 522 | Ga0207706_10026906 | 3300025933 | Bacteria | 5148 |
| 523 | Ga0207706_10046644 | 3300025933 | Bacteria | 3836 |
| 524 | Ga0207706_10072106 | 3300025933 | Bacteria | 3038 |
| 525 | Ga0207686_10001387 | 3300025934 | Bacteria | 13761 |
| 526 | Ga0207670_10213664 | 3300025936 | Unclassified | 1472 |
| 527 | Ga0207669_10006081 | 3300025937 | Bacteria | 5478 |
| 528 | Ga0207669_10082156 | 3300025937 | Bacteria | 2067 |
| 529 | Ga0207669_10123850 | 3300025937 | Bacteria | 1761 |
| 530 | Ga0207669_10351330 | 3300025937 | Unclassified | 1139 |
| 531 | Ga0207704_10016882 | 3300025938 | Bacteria | 3766 |
| 532 | Ga0207704_10116039 | 3300025938 | Bacteria | 1821 |
| 533 | Ga0207665_10047915 | 3300025939 | Unclassified | 2866 |
| 534 | Ga0207665_10304473 | 3300025939 | Bacteria | 1192 |
| 535 | Ga0207691_10009632 | 3300025940 | Bacteria | 9268 |
| 536 | Ga0207691_10040781 | 3300025940 | Bacteria | 4289 |
| 537 | Ga0207691_10043656 | 3300025940 | Bacteria | 4130 |
| 538 | Ga0207691_10084591 | 3300025940 | Bacteria | 2848 |
| 539 | Ga0207691_10144224 | 3300025940 | Bacteria | 2097 |
| 540 | Ga0207691_10264265 | 3300025940 | Bacteria | 1483 |
| 541 | Ga0207691_10903139 | 3300025940 | Bacteria | 739 |
| 542 | Ga0207711_10000761 | 3300025941 | Bacteria | 31642 |
| 543 | Ga0207711_10030429 | 3300025941 | Bacteria | 4553 |
| 544 | Ga0207711_10280568 | 3300025941 | Bacteria | 1534 |
| 545 | Ga0207711_10801297 | 3300025941 | Unclassified | 877 |
| 546 | Ga0207689_10000118 | 3300025942 | Bacteria | 65374 |
| 547 | Ga0207689_10004444 | 3300025942 | Bacteria | 12717 |
| 548 | Ga0207689_10121627 | 3300025942 | Bacteria | 2147 |
| 549 | Ga0207661_10017909 | 3300025944 | Bacteria | 5253 |
| 550 | Ga0207661_10061918 | 3300025944 | Bacteria | 3025 |
| 551 | Ga0207661_10270186 | 3300025944 | Bacteria | 1517 |
| 552 | Ga0207661_10347916 | 3300025944 | Bacteria | 1337 |
| 553 | Ga0207679_10005896 | 3300025945 | Bacteria | 7705 |
| 554 | Ga0207679_10012718 | 3300025945 | Bacteria | 5496 |
| 555 | Ga0207679_10023423 | 3300025945 | Bacteria | 4222 |
| 556 | Ga0207679_10023519 | 3300025945 | Bacteria | 4215 |
| 557 | Ga0207679_10269612 | 3300025945 | Bacteria | 1455 |
| 558 | Ga0207667_10002636 | 3300025949 | Bacteria | 22187 |
| 559 | Ga0207667_10007850 | 3300025949 | Bacteria | 12743 |
| 560 | Ga0207667_10015971 | 3300025949 | Bacteria | 8503 |
| 561 | Ga0207667_10017566 | 3300025949 | Bacteria | 8046 |
| 562 | Ga0207667_10053078 | 3300025949 | Bacteria | 4266 |
| 563 | Ga0207667_10063646 | 3300025949 | Bacteria | 3854 |
| 564 | Ga0207667_10089037 | 3300025949 | Bacteria | 3191 |
| 565 | Ga0207667_10229981 | 3300025949 | Bacteria | 1899 |
| 566 | Ga0207667_10337349 | 3300025949 | Bacteria | 1539 |
| 567 | Ga0207667_10647975 | 3300025949 | Unclassified | 1062 |
| 568 | Ga0207651_10001194 | 3300025960 | Bacteria | 11632 |
| 569 | Ga0207651_10162246 | 3300025960 | Unclassified | 1753 |
| 570 | Ga0207651_10197525 | 3300025960 | Bacteria | 1609 |
| 571 | Ga0207712_10584177 | 3300025961 | Bacteria | 964 |
| 572 | Ga0207668_10016878 | 3300025972 | Bacteria | 4567 |
| 573 | Ga0207668_10022436 | 3300025972 | Bacteria | 4041 |
| 574 | Ga0207668_10106285 | 3300025972 | Bacteria | 2096 |
| 575 | Ga0207668_10149176 | 3300025972 | Unclassified | 1808 |
| 576 | Ga0207668_10159306 | 3300025972 | Bacteria | 1757 |
| 577 | Ga0207668_10191820 | 3300025972 | Bacteria | 1620 |
| 578 | Ga0207668_10271559 | 3300025972 | Bacteria | 1386 |
| 579 | Ga0207640_10005875 | 3300025981 | Bacteria | 6698 |
| 580 | Ga0207640_10044877 | 3300025981 | Bacteria | 2835 |
| 581 | Ga0207640_10070378 | 3300025981 | Bacteria | 2353 |
| 582 | Ga0207640_10089367 | 3300025981 | Bacteria | 2129 |
| 583 | Ga0207640_10100037 | 3300025981 | Bacteria | 2031 |
| 584 | Ga0207640_10276855 | 3300025981 | Bacteria | 1316 |
| 585 | Ga0207640_10290678 | 3300025981 | Bacteria | 1288 |
| 586 | Ga0207640_10292732 | 3300025981 | Bacteria | 1284 |
| 587 | Ga0207640_10346532 | 3300025981 | Bacteria | 1192 |
| 588 | Ga0207658_10076068 | 3300025986 | Bacteria | 2556 |
| 589 | Ga0207658_10187734 | 3300025986 | Bacteria | 1715 |
| 590 | Ga0207658_10251517 | 3300025986 | Unclassified | 1502 |
| 591 | Ga0207658_10456090 | 3300025986 | Bacteria | 1132 |
| 592 | Ga0207677_10085813 | 3300026023 | Bacteria | 2273 |
| 593 | Ga0207677_10117043 | 3300026023 | Bacteria | 1997 |
| 594 | Ga0207703_10002366 | 3300026035 | Bacteria | 16408 |
| 595 | Ga0207703_10006533 | 3300026035 | Bacteria | 9303 |
| 596 | Ga0207703_10007748 | 3300026035 | Bacteria | 8499 |
| 597 | Ga0207703_10063538 | 3300026035 | Bacteria | 3027 |
| 598 | Ga0207703_10104661 | 3300026035 | Bacteria | 2405 |
| 599 | Ga0207639_10007035 | 3300026041 | Bacteria | 7671 |
| 600 | Ga0207639_10039471 | 3300026041 | Bacteria | 3518 |
| 601 | Ga0207639_10173609 | 3300026041 | Bacteria | 1828 |
| 602 | Ga0207639_10239574 | 3300026041 | Bacteria | 1576 |
| 603 | Ga0207639_10364329 | 3300026041 | Bacteria | 1294 |
| 604 | Ga0207678_10009246 | 3300026067 | Bacteria | 8673 |
| 605 | Ga0207678_10041499 | 3300026067 | Bacteria | 3990 |
| 606 | Ga0207678_10058758 | 3300026067 | Bacteria | 3309 |
| 607 | Ga0207678_10129104 | 3300026067 | Bacteria | 2156 |
| 608 | Ga0207678_10495969 | 3300026067 | Bacteria | 1064 |
| 609 | Ga0207678_11130028 | 3300026067 | Bacteria | 694 |
| 610 | Ga0207708_10122611 | 3300026075 | Bacteria | 2026 |
| 611 | Ga0207702_10004317 | 3300026078 | Bacteria | 12678 |
| 612 | Ga0207702_10015054 | 3300026078 | Bacteria | 6414 |
| 613 | Ga0207702_10020526 | 3300026078 | Bacteria | 5469 |
| 614 | Ga0207702_10327659 | 3300026078 | Bacteria | 1460 |
| 615 | Ga0207702_10338784 | 3300026078 | Bacteria | 1436 |
| 616 | Ga0207641_10019723 | 3300026088 | Bacteria | 5535 |
| 617 | Ga0207641_10032700 | 3300026088 | Bacteria | 4320 |
| 618 | Ga0207641_10038818 | 3300026088 | Bacteria | 3981 |
| 619 | Ga0207641_10129266 | 3300026088 | Bacteria | 2266 |
| 620 | Ga0207641_10183034 | 3300026088 | Bacteria | 1920 |
| 621 | Ga0207641_10528450 | 3300026088 | Bacteria | 1148 |
| 622 | Ga0207641_10593263 | 3300026088 | Bacteria | 1084 |
| 623 | Ga0207648_10005165 | 3300026089 | Bacteria | 13220 |
| 624 | Ga0207648_10005815 | 3300026089 | Bacteria | 12352 |
| 625 | Ga0207648_10020302 | 3300026089 | Bacteria | 5985 |
| 626 | Ga0207648_10154414 | 3300026089 | Bacteria | 2026 |
| 627 | Ga0207648_10165789 | 3300026089 | Bacteria | 1952 |
| 628 | Ga0207648_10244475 | 3300026089 | Bacteria | 1599 |
| 629 | Ga0207676_10002905 | 3300026095 | Bacteria | 12218 |
| 630 | Ga0207676_10013603 | 3300026095 | Bacteria | 5840 |
| 631 | Ga0207676_10015379 | 3300026095 | Bacteria | 5518 |
| 632 | Ga0207676_10505470 | 3300026095 | Bacteria | 1148 |
| 633 | Ga0207674_10000489 | 3300026116 | Bacteria | 52346 |
| 634 | Ga0207674_10004126 | 3300026116 | Bacteria | 17572 |
| 635 | Ga0207674_10005149 | 3300026116 | Bacteria | 15593 |
| 636 | Ga0207674_10014375 | 3300026116 | Bacteria | 8745 |
| 637 | Ga0207674_10345887 | 3300026116 | Unclassified | 1438 |
| 638 | Ga0207674_10347395 | 3300026116 | Bacteria | 1434 |
| 639 | Ga0207674_10931237 | 3300026116 | Unclassified | 837 |
| 640 | Ga0207675_100002411 | 3300026118 | Bacteria | 18514 |
| 641 | Ga0207675_100007599 | 3300026118 | Bacteria | 10239 |
| 642 | Ga0207675_100011191 | 3300026118 | Bacteria | 8401 |
| 643 | Ga0207675_100322117 | 3300026118 | Bacteria | 1509 |
| 644 | Ga0207683_10002808 | 3300026121 | Bacteria | 15210 |
| 645 | Ga0207683_10009155 | 3300026121 | Bacteria | 8436 |
| 646 | Ga0207683_10357476 | 3300026121 | Bacteria | 1341 |
| 647 | Ga0207698_10006331 | 3300026142 | Bacteria | 7374 |
| 648 | Ga0207698_10020629 | 3300026142 | Bacteria | 4540 |
| 649 | Ga0207698_10070511 | 3300026142 | Bacteria | 2769 |
| 650 | Ga0207698_10167094 | 3300026142 | Unclassified | 1932 |
| 651 | Ga0207698_10205018 | 3300026142 | Bacteria | 1769 |
| 652 | Ga0210002_1022977 | 3300027617 | Bacteria | 1013 |
| 653 | Ga0209983_1001874 | 3300027665 | Bacteria | 4673 |
| 654 | Ga0209983_1053220 | 3300027665 | Bacteria | 888 |
| 655 | Ga0209971_1003927 | 3300027682 | Bacteria | 3516 |
| 656 | Ga0209966_1005525 | 3300027695 | Bacteria | 2171 |
| 657 | Ga0209998_10008467 | 3300027717 | Bacteria | 2132 |
| 658 | Ga0209974_10003765 | 3300027876 | Bacteria | 5432 |
| 659 | Ga0209974_10003960 | 3300027876 | Bacteria | 5304 |
| 660 | Ga0207428_10147869 | 3300027907 | Bacteria | 1790 |
| 661 | Ga0268266_10049822 | 3300028379 | Bacteria | 3592 |
| 662 | Ga0268266_10170038 | 3300028379 | Bacteria | 1978 |
| 663 | Ga0268266_10390671 | 3300028379 | Bacteria | 1314 |
| 664 | Ga0268266_10609125 | 3300028379 | Unclassified | 1049 |
| 665 | Ga0268266_10709822 | 3300028379 | Bacteria | 969 |
| 666 | Ga0268265_10019642 | 3300028380 | Bacteria | 4702 |
| 667 | Ga0268265_10138282 | 3300028380 | Bacteria | 2035 |
| 668 | Ga0268265_10201559 | 3300028380 | Bacteria | 1727 |
| 669 | Ga0268265_10206617 | 3300028380 | Bacteria | 1708 |
| 670 | Ga0268265_10669535 | 3300028380 | Bacteria | 999 |
| 671 | Ga0268264_10000740 | 3300028381 | Bacteria | 37012 |
| 672 | Ga0268264_10002985 | 3300028381 | Bacteria | 14683 |
| 673 | Ga0268264_10095954 | 3300028381 | Bacteria | 2567 |
| 674 | Ga0268264_10247488 | 3300028381 | Bacteria | 1654 |
| 675 | Ga0268264_10284806 | 3300028381 | Unclassified | 1549 |
| 676 | Ga0265330_10026990 | 3300031235 | Bacteria | 2595 |
| 677 | Ga0265332_10000583 | 3300031238 | Bacteria | 24150 |
| 678 | Ga0265325_10050407 | 3300031241 | Bacteria | 2144 |
| 679 | Ga0265329_10010967 | 3300031242 | Bacteria | 3310 |
| 680 | Ga0265327_10010271 | 3300031251 | Bacteria | 6601 |
| 681 | Ga0307408_100016857 | 3300031548 | Bacteria | 4883 |
| 682 | Ga0265342_10055387 | 3300031712 | Bacteria | 2354 |
| 683 | Ga0307413_10002055 | 3300031824 | Bacteria | 8033 |
| 684 | Ga0307410_10022837 | 3300031852 | Bacteria | 3875 |
| 685 | Ga0307406_10010725 | 3300031901 | Bacteria | 5177 |
| 686 | Ga0307407_10034457 | 3300031903 | Bacteria | 2772 |
| 687 | Ga0307412_10006583 | 3300031911 | Bacteria | 6578 |
| 688 | Ga0307409_100000779 | 3300031995 | Bacteria | 14446 |
| 689 | Ga0307416_100003235 | 3300032002 | Bacteria | 9546 |
| 690 | Ga0307414_10024958 | 3300032004 | Bacteria | 3820 |
| 691 | Ga0307411_10001712 | 3300032005 | Bacteria | 9209 |
| 692 | Ga0307411_10332976 | 3300032005 | Bacteria | 1231 |
| 693 | Ga0373934_0010816 | 3300035086 | Bacteria | 3428 |
| 694 | Ga0373949_0031964 | 3300035090 | Bacteria | 1258 |
| 695 | Ga0373936_0170182 | 3300035113 | Bacteria | 952 |
| 696 | Ga0373945_0030990 | 3300035116 | Unclassified | 1887 |
| 697 | Ga0373953_0034149 | 3300035117 | Bacteria | 1993 |
| 698 | Ga0373953_0186345 | 3300035117 | Unclassified | 896 |
| 699 | Ga0373954_0008221 | 3300035118 | Bacteria | 4575 |
| 700 | Ga0373956_0015876 | 3300035119 | Bacteria | 3158 |
| 701 | Ga0373956_0047822 | 3300035119 | Bacteria | 1914 |
| 702 | Ga0373957_0026166 | 3300035120 | Bacteria | 2108 |
| 703 | Ga0373957_0113226 | 3300035120 | Bacteria | 1094 |
| 704 | Ga0373943_0397608 | 3300035170 | Bacteria | 795 |
| 705 | Ga0373955_0108939 | 3300035172 | Bacteria | 1600 |
| 706 | Ga0373924_0083403 | 3300035410 | Bacteria | 1361 |
| 707 | Ga0373931_0057502 | 3300035691 | Bacteria | 2086 |
| 708 | Ga0373935_0006155 | 3300035692 | Bacteria | 7141 |
| 709 | Ga0373935_0076961 | 3300035692 | Bacteria | 2161 |
| 710 | Ga0373927_0019308 | 3300035695 | Bacteria | 4470 |
| 711 | Ga0373927_0026016 | 3300035695 | Bacteria | 3825 |
| 712 | Ga0373947_0095620 | 3300035725 | Bacteria | 1859 |
| 713 | Ga0373947_0531173 | 3300035725 | Bacteria | 800 |
| 714 | Ga0373937_0042806 | 3300036401 | Bacteria | 4132 |
| 715 | Ga0373937_0106411 | 3300036401 | Bacteria | 2607 |
| 716 | Ga0373937_0523653 | 3300036401 | Bacteria | 1126 |
| 717 | Ga0373925_0002104 | 3300037068 | Bacteria | 16332 |
| 718 | Ga0373925_0022539 | 3300037068 | Bacteria | 4594 |
| 719 | Ga0373925_0530569 | 3300037068 | Bacteria | 967 |
| 720 | Ga0395899_0041201 | 3300037312 | Bacteria | 3451 |
| 721 | Ga0395898_0230920 | 3300037466 | Bacteria | 1765 |
| 722 | Ga0395905_0212888 | 3300037471 | Bacteria | 1810 |
| 723 | Ga0395905_0486015 | 3300037471 | Bacteria | 1134 |
| 724 | Ga0395901_0380716 | 3300038443 | Bacteria | 1452 |
| 725 | Ga0451807_0417438 | 3300041486 | Bacteria | 784 |
| 726 | Ga0453684_0208454 | 3300044712 | Bacteria | 2274 |
| 727 | Ga0451576_0743739 | 3300045051 | Bacteria | 1030 |
| 728 | Ga0466967_0147462 | 3300045976 | Bacteria | 2196 |
| 729 | Ga0495592_0181112 | 3300046454 | Bacteria | 1435 |
| 730 | Ga0495629_0095709 | 3300046459 | Bacteria | 2071 |
| 731 | Ga0495580_0268013 | 3300046472 | Unclassified | 1167 |
| 732 | Ga0495580_0479424 | 3300046472 | Bacteria | 832 |
| 733 | Ga0495662_0037461 | 3300046476 | Bacteria | 2342 |
| 734 | Ga0495664_0027690 | 3300046477 | Bacteria | 3306 |
| 735 | Ga0495630_0185920 | 3300046517 | Unclassified | 1585 |
| 736 | Ga0495586_0062671 | 3300046535 | Bacteria | 2025 |
| 737 | Ga0495621_0088336 | 3300046539 | Bacteria | 1165 |
| 738 | Ga0495588_0050614 | 3300046674 | Bacteria | 2138 |
| 739 | Ga0495658_0076024 | 3300046683 | Bacteria | 1961 |
| 740 | Ga0495613_0253117 | 3300046689 | Bacteria | 1229 |
| 741 | Ga0495613_0435176 | 3300046689 | Bacteria | 890 |
| 742 | Ga0495600_0093226 | 3300046809 | Bacteria | 1964 |
| 743 | Ga0495581_0048540 | 3300047315 | Bacteria | 2451 |
| 744 | Ga0495680_0025209 | 3300047322 | Bacteria | 4925 |
| 745 | Ga0495684_0015154 | 3300047471 | Bacteria | 5935 |
| 746 | Ga0495614_0046301 | 3300048089 | Unclassified | 1865 |
| 747 | Ga0496100_0026062 | 3300048903 | Bacteria | 3581 |
| 748 | Ga0496101_0021534 | 3300048904 | Bacteria | 4430 |
| 749 | Ga0496101_0530394 | 3300048904 | Bacteria | 931 |
| 750 | Ga0496102_0002362 | 3300048905 | Bacteria | 16110 |
| 751 | Ga0496102_0106971 | 3300048905 | Bacteria | 2604 |
| 752 | Ga0496102_0142952 | 3300048905 | Bacteria | 2244 |
| 753 | Ga0496102_0606694 | 3300048905 | Bacteria | 1017 |
| 754 | Ga0496104_0030328 | 3300048907 | Bacteria | 5024 |
| 755 | Ga0496105_0130250 | 3300048908 | Bacteria | 2074 |
| 756 | Ga0496106_0000427 | 3300048909 | Bacteria | 29931 |
| 757 | Ga0496106_0005263 | 3300048909 | Bacteria | 9584 |
| 758 | Ga0496106_0124912 | 3300048909 | Bacteria | 2014 |
| 759 | Ga0496106_0159792 | 3300048909 | Bacteria | 1782 |
| 760 | Ga0496107_0001256 | 3300048910 | Bacteria | 15518 |
| 761 | Ga0496108_0018678 | 3300048911 | Bacteria | 5681 |
| 762 | Ga0496108_0115398 | 3300048911 | Bacteria | 2300 |
| 763 | Ga0496108_0124473 | 3300048911 | Bacteria | 2213 |
| 764 | Ga0496108_0266824 | 3300048911 | Bacteria | 1490 |
| 765 | Ga0496108_0431952 | 3300048911 | Bacteria | 1150 |
| 766 | Ga0496109_0008131 | 3300048912 | Bacteria | 8893 |
| 767 | Ga0496109_0068191 | 3300048912 | Bacteria | 3261 |
| 768 | Ga0496109_0069039 | 3300048912 | Bacteria | 3240 |
| 769 | Ga0496109_0207817 | 3300048912 | Bacteria | 1841 |
| 770 | Ga0496109_0342604 | 3300048912 | Bacteria | 1412 |
| 771 | Ga0496110_0013091 | 3300048913 | Bacteria | 6848 |
| 772 | Ga0496110_0095542 | 3300048913 | Bacteria | 2662 |
| 773 | Ga0496112_0003395 | 3300048915 | Bacteria | 13151 |
| 774 | Ga0496112_0049976 | 3300048915 | Bacteria | 4099 |
| 775 | Ga0496112_0570656 | 3300048915 | Bacteria | 1064 |
| 776 | Ga0496113_0128722 | 3300048916 | Bacteria | 1985 |
| 777 | Ga0496114_0031348 | 3300048917 | Bacteria | 4375 |
| 778 | nmdc:mga05p37_164745_c1 | 3300050507 | Bacteria | 2706 |
| 779 | nmdc:mga08y16_259982_c1 | 3300050511 | Bacteria | 1793 |
| 780 | nmdc:mga0n895_1019626_c1 | 3300050512 | Unclassified | 808 |
| 781 | nmdc:mga0n895_133787_c1 | 3300050512 | Bacteria | 2505 |
| 782 | nmdc:mga0n895_178201_c1 | 3300050512 | Unclassified | 2156 |
| 783 | nmdc:mga0n895_182487_c1 | 3300050512 | Bacteria | 2130 |
| 784 | nmdc:mga0n895_220605_c1 | 3300050512 | Bacteria | 1925 |
| 785 | nmdc:mga0n895_360842_c1 | 3300050512 | Bacteria | 1471 |
| 786 | nmdc:mga0n895_58586_c1 | 3300050512 | Bacteria | 3797 |
| 787 | nmdc:mga0rr50_104297_c1 | 3300050513 | Bacteria | 2233 |
| 788 | nmdc:mga0rr50_159260_c1 | 3300050513 | Bacteria | 1831 |
| 789 | nmdc:mga0rr50_20741_c1 | 3300050513 | Bacteria | 4469 |
| 790 | nmdc:mga08x19_105945_c1 | 3300050514 | Bacteria | 1870 |
| 791 | nmdc:mga08x19_158119_c1 | 3300050514 | Bacteria | 1538 |
| 792 | nmdc:mga08x19_477115_c1 | 3300050514 | Unclassified | 879 |
| 793 | nmdc:mga08x19_7468_c1 | 3300050514 | Bacteria | 6493 |
| 794 | nmdc:mga0a205_12257_c1 | 3300050515 | Bacteria | 7929 |
| 795 | nmdc:mga0a205_50317_c1 | 3300050515 | Bacteria | 4022 |
| 796 | Ga0495601_0114441 | 3300053077 | Bacteria | 1749 |
| 797 | Ga0495595_0200083 | 3300053084 | Bacteria | 994 |
| 798 | Ga0495619_0005085 | 3300053085 | Bacteria | 8351 |
| 799 | Ga0495619_0075443 | 3300053085 | Bacteria | 2263 |
| 800 | Ga0495619_0498145 | 3300053085 | Unclassified | 838 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005347 | Ga0070668_100901838 | Ga0070668_1009018381 | 181 |
| 2 | 3300005353 | Ga0070669_100269711 | Ga0070669_1002697111 | 181 |
| 3 | 3300005444 | Ga0070694_100096907 | Ga0070694_1000969072 | 181 |
| 4 | 3300005543 | Ga0070672_100004581 | Ga0070672_1000045818 | 181 |
| 5 | 3300025940 | Ga0207691_10043656 | Ga0207691_100436563 | 181 |
| 6 | 3300026075 | Ga0207708_10122611 | Ga0207708_101226113 | 181 |
| 7 | 3300005617 | Ga0068859_100057638 | Ga0068859_1000576382 | 183 |
| 8 | 3300006931 | Ga0097620_100057637 | Ga0097620_1000576373 | 183 |
| 9 | 3300013308 | Ga0157375_10108143 | Ga0157375_101081432 | 183 |
| 10 | 3300026067 | Ga0207678_11130028 | Ga0207678_111300281 | 188 |
| 11 | 3300006852 | Ga0075433_10105986 | Ga0075433_101059863 | 190 |
| 12 | 3300007076 | Ga0075435_100027482 | Ga0075435_1000274823 | 190 |
| 13 | 3300009147 | Ga0114129_10299137 | Ga0114129_102991373 | 190 |
| 14 | 3300025939 | Ga0207665_10047915 | Ga0207665_100479153 | 190 |
| 15 | 3300050512 | nmdc:mga0n895_58586_c1 | nmdc:mga0n895_58586_c1_681_1322 | 190 |
| 16 | 3300050513 | nmdc:mga0rr50_20741_c1 | nmdc:mga0rr50_20741_c1_2655_3296 | 190 |
| 17 | 3300050515 | nmdc:mga0a205_12257_c1 | nmdc:mga0a205_12257_c1_5751_6392 | 190 |
| 18 | 3300006914 | Ga0075436_100042101 | Ga0075436_1000421012 | 191 |
| 19 | 3300050514 | nmdc:mga08x19_105945_c1 | nmdc:mga08x19_105945_c1_1154_1795 | 191 |
| 20 | 3300053085 | Ga0495619_0075443 | Ga0495619_0075443_466_1107 | 191 |
| 21 | 3300005467 | Ga0070706_100035231 | Ga0070706_1000352312 | 192 |
| 22 | 3300005468 | Ga0070707_100284166 | Ga0070707_1002841662 | 192 |
| 23 | 3300005536 | Ga0070697_100238760 | Ga0070697_1002387602 | 192 |
| 24 | 3300027617 | Ga0210002_1022977 | Ga0210002_10229772 | 192 |
| 25 | 3300025923 | Ga0207681_10762598 | Ga0207681_107625981 | 193 |
| 26 | 3300014326 | Ga0157380_10186443 | Ga0157380_101864432 | 194 |
| 27 | 3300005445 | Ga0070708_100337852 | Ga0070708_1003378521 | 196 |
| 28 | 3300005467 | Ga0070706_100307250 | Ga0070706_1003072502 | 196 |
| 29 | 3300005471 | Ga0070698_100379330 | Ga0070698_1003793302 | 196 |
| 30 | 3300025910 | Ga0207684_10694403 | Ga0207684_106944031 | 196 |
| 31 | 3300005331 | Ga0070670_100625053 | Ga0070670_1006250532 | 197 |
| 32 | 3300005340 | Ga0070689_100232418 | Ga0070689_1002324183 | 197 |
| 33 | 3300005354 | Ga0070675_100031296 | Ga0070675_1000312962 | 197 |
| 34 | 3300005364 | Ga0070673_100006942 | Ga0070673_1000069423 | 197 |
| 35 | 3300005434 | Ga0070709_10181163 | Ga0070709_101811631 | 197 |
| 36 | 3300005518 | Ga0070699_100237861 | Ga0070699_1002378612 | 197 |
| 37 | 3300025925 | Ga0207650_10458147 | Ga0207650_104581472 | 197 |
| 38 | 3300025926 | Ga0207659_10044532 | Ga0207659_100445322 | 197 |
| 39 | 3300025960 | Ga0207651_10162246 | Ga0207651_101622461 | 197 |
| 40 | 3300005468 | Ga0070707_100107667 | Ga0070707_1001076672 | 198 |
| 41 | 3300025920 | Ga0207649_10464713 | Ga0207649_104647131 | 198 |
| 42 | 3300025922 | Ga0207646_10062608 | Ga0207646_100626082 | 198 |
| 43 | 3300025926 | Ga0207659_10811841 | Ga0207659_108118411 | 198 |
| 44 | 3300025972 | Ga0207668_10106285 | Ga0207668_101062853 | 198 |
| 45 | 3300035691 | Ga0373931_0057502 | Ga0373931_0057502_1285_1881 | 198 |
| 46 | 3300014968 | Ga0157379_10838393 | Ga0157379_108383932 | 199 |
| 47 | 3300005468 | Ga0070707_100843900 | Ga0070707_1008439002 | 200 |
| 48 | 3300005471 | Ga0070698_100081710 | Ga0070698_1000817103 | 200 |
| 49 | 3300006175 | Ga0070712_100419041 | Ga0070712_1004190411 | 200 |
| 50 | 3300041486 | Ga0451807_0417438 | Ga0451807_0417438_68_670 | 200 |
| 51 | 3300046689 | Ga0495613_0253117 | Ga0495613_0253117_416_1018 | 200 |
| 52 | 3300005336 | Ga0070680_100160171 | Ga0070680_1001601712 | 201 |
| 53 | 3300005339 | Ga0070660_100100862 | Ga0070660_1001008622 | 201 |
| 54 | 3300005344 | Ga0070661_100006442 | Ga0070661_1000064424 | 201 |
| 55 | 3300005366 | Ga0070659_100085769 | Ga0070659_1000857693 | 201 |
| 56 | 3300005367 | Ga0070667_100218959 | Ga0070667_1002189592 | 201 |
| 57 | 3300005435 | Ga0070714_100042440 | Ga0070714_1000424402 | 201 |
| 58 | 3300005436 | Ga0070713_100238578 | Ga0070713_1002385783 | 201 |
| 59 | 3300005458 | Ga0070681_10070048 | Ga0070681_100700483 | 201 |
| 60 | 3300005563 | Ga0068855_100159811 | Ga0068855_1001598112 | 201 |
| 61 | 3300005564 | Ga0070664_100003055 | Ga0070664_1000030553 | 201 |
| 62 | 3300005577 | Ga0068857_100035955 | Ga0068857_1000359553 | 201 |
| 63 | 3300005578 | Ga0068854_100004902 | Ga0068854_1000049027 | 201 |
| 64 | 3300005616 | Ga0068852_100007301 | Ga0068852_1000073013 | 201 |
| 65 | 3300005843 | Ga0068860_100484525 | Ga0068860_1004845252 | 201 |
| 66 | 3300009093 | Ga0105240_10004546 | Ga0105240_1000454614 | 201 |
| 67 | 3300009545 | Ga0105237_10282803 | Ga0105237_102828033 | 201 |
| 68 | 3300009551 | Ga0105238_10000366 | Ga0105238_100003664 | 201 |
| 69 | 3300013100 | Ga0157373_10032604 | Ga0157373_100326043 | 201 |
| 70 | 3300013102 | Ga0157371_10142644 | Ga0157371_101426443 | 201 |
| 71 | 3300013104 | Ga0157370_10217187 | Ga0157370_102171873 | 201 |
| 72 | 3300013105 | Ga0157369_10032348 | Ga0157369_100323482 | 201 |
| 73 | 3300013296 | Ga0157374_10263710 | Ga0157374_102637101 | 201 |
| 74 | 3300013307 | Ga0157372_10033833 | Ga0157372_100338335 | 201 |
| 75 | 3300025912 | Ga0207707_10191193 | Ga0207707_101911932 | 201 |
| 76 | 3300025913 | Ga0207695_10111047 | Ga0207695_101110472 | 201 |
| 77 | 3300025914 | Ga0207671_10310075 | Ga0207671_103100752 | 201 |
| 78 | 3300025919 | Ga0207657_10086159 | Ga0207657_100861593 | 201 |
| 79 | 3300025920 | Ga0207649_10017105 | Ga0207649_100171054 | 201 |
| 80 | 3300025921 | Ga0207652_10120621 | Ga0207652_101206213 | 201 |
| 81 | 3300025924 | Ga0207694_10020190 | Ga0207694_100201902 | 201 |
| 82 | 3300025929 | Ga0207664_10028492 | Ga0207664_100284923 | 201 |
| 83 | 3300025944 | Ga0207661_10017909 | Ga0207661_100179092 | 201 |
| 84 | 3300025949 | Ga0207667_10007850 | Ga0207667_100078503 | 201 |
| 85 | 3300025981 | Ga0207640_10044877 | Ga0207640_100448772 | 201 |
| 86 | 3300025986 | Ga0207658_10251517 | Ga0207658_102515173 | 201 |
| 87 | 3300026116 | Ga0207674_10000489 | Ga0207674_1000048943 | 201 |
| 88 | 3300026142 | Ga0207698_10006331 | Ga0207698_100063313 | 201 |
| 89 | 3300048911 | Ga0496108_0266824 | Ga0496108_0266824_68_679 | 201 |
| 90 | 3300053085 | Ga0495619_0498145 | Ga0495619_0498145_128_739 | 201 |
| 91 | 3300005347 | Ga0070668_100482902 | Ga0070668_1004829022 | 202 |
| 92 | 3300005577 | Ga0068857_100834323 | Ga0068857_1008343231 | 202 |
| 93 | 3300005842 | Ga0068858_100094370 | Ga0068858_1000943703 | 202 |
| 94 | 3300005843 | Ga0068860_100079865 | Ga0068860_1000798652 | 202 |
| 95 | 3300006871 | Ga0075434_100629710 | Ga0075434_1006297102 | 202 |
| 96 | 3300009098 | Ga0105245_11057344 | Ga0105245_110573442 | 202 |
| 97 | 3300025927 | Ga0207687_10541915 | Ga0207687_105419152 | 202 |
| 98 | 3300025972 | Ga0207668_10159306 | Ga0207668_101593062 | 202 |
| 99 | 3300026035 | Ga0207703_10104661 | Ga0207703_101046613 | 202 |
| 100 | 3300026088 | Ga0207641_10129266 | Ga0207641_101292662 | 202 |
| 101 | 3300026095 | Ga0207676_10505470 | Ga0207676_105054702 | 202 |
| 102 | 3300026116 | Ga0207674_10931237 | Ga0207674_109312371 | 202 |
| 103 | 3300026118 | Ga0207675_100011191 | Ga0207675_1000111916 | 202 |
| 104 | 3300028381 | Ga0268264_10284806 | Ga0268264_102848061 | 202 |
| 105 | 3300048911 | Ga0496108_0431952 | Ga0496108_0431952_119_733 | 202 |
| 106 | 3300048912 | Ga0496109_0207817 | Ga0496109_0207817_1120_1734 | 202 |
| 107 | 3300048915 | Ga0496112_0003395 | Ga0496112_0003395_8346_8960 | 202 |
| 108 | 3300048916 | Ga0496113_0128722 | Ga0496113_0128722_1250_1864 | 202 |
| 109 | 3300005327 | Ga0070658_10013205 | Ga0070658_100132056 | 203 |
| 110 | 3300005327 | Ga0070658_10180487 | Ga0070658_101804873 | 203 |
| 111 | 3300005328 | Ga0070676_10119398 | Ga0070676_101193981 | 203 |
| 112 | 3300005329 | Ga0070683_100008229 | Ga0070683_1000082298 | 203 |
| 113 | 3300005329 | Ga0070683_100044968 | Ga0070683_1000449682 | 203 |
| 114 | 3300005334 | Ga0068869_100075246 | Ga0068869_1000752461 | 203 |
| 115 | 3300005334 | Ga0068869_100195024 | Ga0068869_1001950242 | 203 |
| 116 | 3300005337 | Ga0070682_100120646 | Ga0070682_1001206462 | 203 |
| 117 | 3300005337 | Ga0070682_100226244 | Ga0070682_1002262442 | 203 |
| 118 | 3300005338 | Ga0068868_100197033 | Ga0068868_1001970333 | 203 |
| 119 | 3300005339 | Ga0070660_100269510 | Ga0070660_1002695102 | 203 |
| 120 | 3300005340 | Ga0070689_100133536 | Ga0070689_1001335363 | 203 |
| 121 | 3300005344 | Ga0070661_100018753 | Ga0070661_1000187533 | 203 |
| 122 | 3300005344 | Ga0070661_100625834 | Ga0070661_1006258342 | 203 |
| 123 | 3300005345 | Ga0070692_10058776 | Ga0070692_100587762 | 203 |
| 124 | 3300005347 | Ga0070668_100124059 | Ga0070668_1001240593 | 203 |
| 125 | 3300005354 | Ga0070675_100163157 | Ga0070675_1001631573 | 203 |
| 126 | 3300005356 | Ga0070674_100002332 | Ga0070674_1000023326 | 203 |
| 127 | 3300005365 | Ga0070688_100024370 | Ga0070688_1000243703 | 203 |
| 128 | 3300005366 | Ga0070659_100016936 | Ga0070659_1000169363 | 203 |
| 129 | 3300005366 | Ga0070659_100100848 | Ga0070659_1001008483 | 203 |
| 130 | 3300005367 | Ga0070667_100651277 | Ga0070667_1006512772 | 203 |
| 131 | 3300005434 | Ga0070709_10159627 | Ga0070709_101596272 | 203 |
| 132 | 3300005434 | Ga0070709_10302988 | Ga0070709_103029881 | 203 |
| 133 | 3300005435 | Ga0070714_100036247 | Ga0070714_1000362473 | 203 |
| 134 | 3300005435 | Ga0070714_100038580 | Ga0070714_1000385803 | 203 |
| 135 | 3300005435 | Ga0070714_100513022 | Ga0070714_1005130221 | 203 |
| 136 | 3300005436 | Ga0070713_100000694 | Ga0070713_10000069416 | 203 |
| 137 | 3300005436 | Ga0070713_100005864 | Ga0070713_1000058649 | 203 |
| 138 | 3300005438 | Ga0070701_10161958 | Ga0070701_101619582 | 203 |
| 139 | 3300005439 | Ga0070711_100328120 | Ga0070711_1003281202 | 203 |
| 140 | 3300005440 | Ga0070705_100024577 | Ga0070705_1000245772 | 203 |
| 141 | 3300005444 | Ga0070694_100007279 | Ga0070694_1000072791 | 203 |
| 142 | 3300005455 | Ga0070663_100017134 | Ga0070663_1000171344 | 203 |
| 143 | 3300005455 | Ga0070663_100064607 | Ga0070663_1000646073 | 203 |
| 144 | 3300005455 | Ga0070663_100106015 | Ga0070663_1001060152 | 203 |
| 145 | 3300005457 | Ga0070662_100029543 | Ga0070662_1000295433 | 203 |
| 146 | 3300005458 | Ga0070681_10270297 | Ga0070681_102702972 | 203 |
| 147 | 3300005466 | Ga0070685_10013985 | Ga0070685_100139853 | 203 |
| 148 | 3300005468 | Ga0070707_100026925 | Ga0070707_1000269253 | 203 |
| 149 | 3300005468 | Ga0070707_100451729 | Ga0070707_1004517292 | 203 |
| 150 | 3300005471 | Ga0070698_100109838 | Ga0070698_1001098382 | 203 |
| 151 | 3300005518 | Ga0070699_100166196 | Ga0070699_1001661962 | 203 |
| 152 | 3300005530 | Ga0070679_100266925 | Ga0070679_1002669253 | 203 |
| 153 | 3300005535 | Ga0070684_100265888 | Ga0070684_1002658882 | 203 |
| 154 | 3300005535 | Ga0070684_100397383 | Ga0070684_1003973831 | 203 |
| 155 | 3300005536 | Ga0070697_100039754 | Ga0070697_1000397543 | 203 |
| 156 | 3300005539 | Ga0068853_100098828 | Ga0068853_1000988283 | 203 |
| 157 | 3300005539 | Ga0068853_100143537 | Ga0068853_1001435373 | 203 |
| 158 | 3300005539 | Ga0068853_100143749 | Ga0068853_1001437492 | 203 |
| 159 | 3300005543 | Ga0070672_100107021 | Ga0070672_1001070213 | 203 |
| 160 | 3300005546 | Ga0070696_100086353 | Ga0070696_1000863532 | 203 |
| 161 | 3300005547 | Ga0070693_100011957 | Ga0070693_1000119572 | 203 |
| 162 | 3300005548 | Ga0070665_100004289 | Ga0070665_10000428913 | 203 |
| 163 | 3300005548 | Ga0070665_100402103 | Ga0070665_1004021031 | 203 |
| 164 | 3300005549 | Ga0070704_100008028 | Ga0070704_1000080285 | 203 |
| 165 | 3300005563 | Ga0068855_100261208 | Ga0068855_1002612081 | 203 |
| 166 | 3300005564 | Ga0070664_100118871 | Ga0070664_1001188712 | 203 |
| 167 | 3300005577 | Ga0068857_100063368 | Ga0068857_1000633682 | 203 |
| 168 | 3300005577 | Ga0068857_101111221 | Ga0068857_1011112211 | 203 |
| 169 | 3300005578 | Ga0068854_100021479 | Ga0068854_1000214792 | 203 |
| 170 | 3300005578 | Ga0068854_100142553 | Ga0068854_1001425533 | 203 |
| 171 | 3300005614 | Ga0068856_100815706 | Ga0068856_1008157062 | 203 |
| 172 | 3300005616 | Ga0068852_100069869 | Ga0068852_1000698693 | 203 |
| 173 | 3300005616 | Ga0068852_100238509 | Ga0068852_1002385092 | 203 |
| 174 | 3300005616 | Ga0068852_100376707 | Ga0068852_1003767072 | 203 |
| 175 | 3300005617 | Ga0068859_100023653 | Ga0068859_1000236536 | 203 |
| 176 | 3300005718 | Ga0068866_10017938 | Ga0068866_100179382 | 203 |
| 177 | 3300005834 | Ga0068851_10002925 | Ga0068851_100029253 | 203 |
| 178 | 3300005834 | Ga0068851_10031522 | Ga0068851_100315223 | 203 |
| 179 | 3300005841 | Ga0068863_100329342 | Ga0068863_1003293422 | 203 |
| 180 | 3300005842 | Ga0068858_100002596 | Ga0068858_1000025965 | 203 |
| 181 | 3300005843 | Ga0068860_100483898 | Ga0068860_1004838982 | 203 |
| 182 | 3300005844 | Ga0068862_100569816 | Ga0068862_1005698162 | 203 |
| 183 | 3300006028 | Ga0070717_10177507 | Ga0070717_101775072 | 203 |
| 184 | 3300006163 | Ga0070715_10011259 | Ga0070715_100112592 | 203 |
| 185 | 3300006173 | Ga0070716_100006729 | Ga0070716_1000067294 | 203 |
| 186 | 3300006175 | Ga0070712_100013314 | Ga0070712_1000133144 | 203 |
| 187 | 3300006358 | Ga0068871_100924834 | Ga0068871_1009248342 | 203 |
| 188 | 3300006871 | Ga0075434_100175093 | Ga0075434_1001750933 | 203 |
| 189 | 3300006881 | Ga0068865_100013818 | Ga0068865_1000138183 | 203 |
| 190 | 3300006914 | Ga0075436_100193319 | Ga0075436_1001933192 | 203 |
| 191 | 3300006931 | Ga0097620_100023652 | Ga0097620_1000236522 | 203 |
| 192 | 3300007076 | Ga0075435_100730710 | Ga0075435_1007307102 | 203 |
| 193 | 3300009093 | Ga0105240_10035547 | Ga0105240_100355472 | 203 |
| 194 | 3300009098 | Ga0105245_10344633 | Ga0105245_103446333 | 203 |
| 195 | 3300009101 | Ga0105247_10035538 | Ga0105247_100355383 | 203 |
| 196 | 3300009174 | Ga0105241_10033854 | Ga0105241_100338542 | 203 |
| 197 | 3300009177 | Ga0105248_10229942 | Ga0105248_102299422 | 203 |
| 198 | 3300009545 | Ga0105237_10065558 | Ga0105237_100655583 | 203 |
| 199 | 3300009551 | Ga0105238_10080825 | Ga0105238_100808252 | 203 |
| 200 | 3300009553 | Ga0105249_10766885 | Ga0105249_107668852 | 203 |
| 201 | 3300010375 | Ga0105239_10227037 | Ga0105239_102270372 | 203 |
| 202 | 3300011119 | Ga0105246_10032937 | Ga0105246_100329372 | 203 |
| 203 | 3300013100 | Ga0157373_10175464 | Ga0157373_101754642 | 203 |
| 204 | 3300013104 | Ga0157370_10171335 | Ga0157370_101713353 | 203 |
| 205 | 3300013105 | Ga0157369_10064787 | Ga0157369_100647873 | 203 |
| 206 | 3300013296 | Ga0157374_10278895 | Ga0157374_102788953 | 203 |
| 207 | 3300013296 | Ga0157374_10585417 | Ga0157374_105854172 | 203 |
| 208 | 3300013297 | Ga0157378_10096476 | Ga0157378_100964762 | 203 |
| 209 | 3300013297 | Ga0157378_10622181 | Ga0157378_106221812 | 203 |
| 210 | 3300014968 | Ga0157379_10001351 | Ga0157379_1000135113 | 203 |
| 211 | 3300014969 | Ga0157376_10085376 | Ga0157376_100853763 | 203 |
| 212 | 3300020069 | Ga0197907_11411880 | Ga0197907_114118803 | 203 |
| 213 | 3300020070 | Ga0206356_10237737 | Ga0206356_102377372 | 203 |
| 214 | 3300020070 | Ga0206356_10729429 | Ga0206356_107294292 | 203 |
| 215 | 3300020081 | Ga0206354_10681834 | Ga0206354_106818343 | 203 |
| 216 | 3300025321 | Ga0207656_10181182 | Ga0207656_101811821 | 203 |
| 217 | 3300025885 | Ga0207653_10067173 | Ga0207653_100671732 | 203 |
| 218 | 3300025898 | Ga0207692_10196063 | Ga0207692_101960632 | 203 |
| 219 | 3300025898 | Ga0207692_10340410 | Ga0207692_103404101 | 203 |
| 220 | 3300025903 | Ga0207680_10004359 | Ga0207680_100043595 | 203 |
| 221 | 3300025905 | Ga0207685_10007026 | Ga0207685_100070262 | 203 |
| 222 | 3300025906 | Ga0207699_10018111 | Ga0207699_100181112 | 203 |
| 223 | 3300025906 | Ga0207699_10428371 | Ga0207699_104283711 | 203 |
| 224 | 3300025907 | Ga0207645_10025886 | Ga0207645_100258862 | 203 |
| 225 | 3300025909 | Ga0207705_10222123 | Ga0207705_102221232 | 203 |
| 226 | 3300025910 | Ga0207684_10113616 | Ga0207684_101136162 | 203 |
| 227 | 3300025912 | Ga0207707_10110570 | Ga0207707_101105702 | 203 |
| 228 | 3300025912 | Ga0207707_10323003 | Ga0207707_103230032 | 203 |
| 229 | 3300025913 | Ga0207695_10138898 | Ga0207695_101388983 | 203 |
| 230 | 3300025914 | Ga0207671_10095507 | Ga0207671_100955073 | 203 |
| 231 | 3300025915 | Ga0207693_10007409 | Ga0207693_100074098 | 203 |
| 232 | 3300025915 | Ga0207693_10263211 | Ga0207693_102632111 | 203 |
| 233 | 3300025916 | Ga0207663_10070741 | Ga0207663_100707413 | 203 |
| 234 | 3300025917 | Ga0207660_10020199 | Ga0207660_100201993 | 203 |
| 235 | 3300025918 | Ga0207662_10108774 | Ga0207662_101087741 | 203 |
| 236 | 3300025919 | Ga0207657_10003829 | Ga0207657_1000382914 | 203 |
| 237 | 3300025919 | Ga0207657_10015486 | Ga0207657_100154863 | 203 |
| 238 | 3300025920 | Ga0207649_10129611 | Ga0207649_101296112 | 203 |
| 239 | 3300025920 | Ga0207649_10190454 | Ga0207649_101904543 | 203 |
| 240 | 3300025921 | Ga0207652_10197279 | Ga0207652_101972792 | 203 |
| 241 | 3300025921 | Ga0207652_10215071 | Ga0207652_102150712 | 203 |
| 242 | 3300025924 | Ga0207694_10031628 | Ga0207694_100316282 | 203 |
| 243 | 3300025924 | Ga0207694_10249329 | Ga0207694_102493292 | 203 |
| 244 | 3300025925 | Ga0207650_10225275 | Ga0207650_102252753 | 203 |
| 245 | 3300025925 | Ga0207650_10439489 | Ga0207650_104394892 | 203 |
| 246 | 3300025926 | Ga0207659_10228063 | Ga0207659_102280633 | 203 |
| 247 | 3300025927 | Ga0207687_10204156 | Ga0207687_102041561 | 203 |
| 248 | 3300025928 | Ga0207700_10030406 | Ga0207700_100304062 | 203 |
| 249 | 3300025928 | Ga0207700_10072598 | Ga0207700_100725983 | 203 |
| 250 | 3300025929 | Ga0207664_10005177 | Ga0207664_100051778 | 203 |
| 251 | 3300025931 | Ga0207644_10030486 | Ga0207644_100304862 | 203 |
| 252 | 3300025931 | Ga0207644_10086997 | Ga0207644_100869973 | 203 |
| 253 | 3300025931 | Ga0207644_10114105 | Ga0207644_101141053 | 203 |
| 254 | 3300025933 | Ga0207706_10026906 | Ga0207706_100269062 | 203 |
| 255 | 3300025934 | Ga0207686_10001387 | Ga0207686_1000138714 | 203 |
| 256 | 3300025937 | Ga0207669_10006081 | Ga0207669_100060816 | 203 |
| 257 | 3300025938 | Ga0207704_10016882 | Ga0207704_100168822 | 203 |
| 258 | 3300025939 | Ga0207665_10304473 | Ga0207665_103044732 | 203 |
| 259 | 3300025940 | Ga0207691_10264265 | Ga0207691_102642651 | 203 |
| 260 | 3300025941 | Ga0207711_10000761 | Ga0207711_100007615 | 203 |
| 261 | 3300025941 | Ga0207711_10801297 | Ga0207711_108012971 | 203 |
| 262 | 3300025942 | Ga0207689_10004444 | Ga0207689_1000444413 | 203 |
| 263 | 3300025944 | Ga0207661_10061918 | Ga0207661_100619182 | 203 |
| 264 | 3300025944 | Ga0207661_10270186 | Ga0207661_102701862 | 203 |
| 265 | 3300025945 | Ga0207679_10023423 | Ga0207679_100234233 | 203 |
| 266 | 3300025945 | Ga0207679_10269612 | Ga0207679_102696123 | 203 |
| 267 | 3300025949 | Ga0207667_10015971 | Ga0207667_100159718 | 203 |
| 268 | 3300025949 | Ga0207667_10017566 | Ga0207667_100175663 | 203 |
| 269 | 3300025960 | Ga0207651_10001194 | Ga0207651_1000119410 | 203 |
| 270 | 3300025961 | Ga0207712_10584177 | Ga0207712_105841772 | 203 |
| 271 | 3300025981 | Ga0207640_10005875 | Ga0207640_100058752 | 203 |
| 272 | 3300025981 | Ga0207640_10290678 | Ga0207640_102906782 | 203 |
| 273 | 3300025986 | Ga0207658_10456090 | Ga0207658_104560902 | 203 |
| 274 | 3300026035 | Ga0207703_10006533 | Ga0207703_100065334 | 203 |
| 275 | 3300026041 | Ga0207639_10039471 | Ga0207639_100394712 | 203 |
| 276 | 3300026041 | Ga0207639_10173609 | Ga0207639_101736092 | 203 |
| 277 | 3300026041 | Ga0207639_10364329 | Ga0207639_103643293 | 203 |
| 278 | 3300026067 | Ga0207678_10009246 | Ga0207678_100092463 | 203 |
| 279 | 3300026067 | Ga0207678_10058758 | Ga0207678_100587582 | 203 |
| 280 | 3300026067 | Ga0207678_10495969 | Ga0207678_104959691 | 203 |
| 281 | 3300026078 | Ga0207702_10015054 | Ga0207702_100150542 | 203 |
| 282 | 3300026078 | Ga0207702_10327659 | Ga0207702_103276592 | 203 |
| 283 | 3300026078 | Ga0207702_10338784 | Ga0207702_103387842 | 203 |
| 284 | 3300026089 | Ga0207648_10020302 | Ga0207648_100203024 | 203 |
| 285 | 3300026089 | Ga0207648_10165789 | Ga0207648_101657892 | 203 |
| 286 | 3300026095 | Ga0207676_10002905 | Ga0207676_100029055 | 203 |
| 287 | 3300026116 | Ga0207674_10004126 | Ga0207674_1000412614 | 203 |
| 288 | 3300026116 | Ga0207674_10014375 | Ga0207674_100143753 | 203 |
| 289 | 3300026121 | Ga0207683_10002808 | Ga0207683_1000280815 | 203 |
| 290 | 3300026121 | Ga0207683_10357476 | Ga0207683_103574763 | 203 |
| 291 | 3300026142 | Ga0207698_10167094 | Ga0207698_101670942 | 203 |
| 292 | 3300026142 | Ga0207698_10205018 | Ga0207698_102050182 | 203 |
| 293 | 3300028379 | Ga0268266_10390671 | Ga0268266_103906713 | 203 |
| 294 | 3300028379 | Ga0268266_10709822 | Ga0268266_107098222 | 203 |
| 295 | 3300035086 | Ga0373934_0010816 | Ga0373934_0010816_2198_2830 | 203 |
| 296 | 3300035113 | Ga0373936_0170182 | Ga0373936_0170182_275_907 | 203 |
| 297 | 3300035116 | Ga0373945_0030990 | Ga0373945_0030990_304_936 | 203 |
| 298 | 3300035117 | Ga0373953_0186345 | Ga0373953_0186345_166_798 | 203 |
| 299 | 3300035118 | Ga0373954_0008221 | Ga0373954_0008221_2306_2938 | 203 |
| 300 | 3300035119 | Ga0373956_0015876 | Ga0373956_0015876_90_722 | 203 |
| 301 | 3300035119 | Ga0373956_0047822 | Ga0373956_0047822_19_651 | 203 |
| 302 | 3300035120 | Ga0373957_0026166 | Ga0373957_0026166_1236_1868 | 203 |
| 303 | 3300035120 | Ga0373957_0113226 | Ga0373957_0113226_449_1081 | 203 |
| 304 | 3300035170 | Ga0373943_0397608 | Ga0373943_0397608_70_702 | 203 |
| 305 | 3300035172 | Ga0373955_0108939 | Ga0373955_0108939_120_752 | 203 |
| 306 | 3300035410 | Ga0373924_0083403 | Ga0373924_0083403_674_1306 | 203 |
| 307 | 3300035692 | Ga0373935_0006155 | Ga0373935_0006155_5100_5732 | 203 |
| 308 | 3300035692 | Ga0373935_0076961 | Ga0373935_0076961_1393_2025 | 203 |
| 309 | 3300035695 | Ga0373927_0019308 | Ga0373927_0019308_3228_3860 | 203 |
| 310 | 3300035695 | Ga0373927_0026016 | Ga0373927_0026016_419_1051 | 203 |
| 311 | 3300035725 | Ga0373947_0531173 | Ga0373947_0531173_13_645 | 203 |
| 312 | 3300036401 | Ga0373937_0042806 | Ga0373937_0042806_206_838 | 203 |
| 313 | 3300036401 | Ga0373937_0523653 | Ga0373937_0523653_246_878 | 203 |
| 314 | 3300037068 | Ga0373925_0002104 | Ga0373925_0002104_12137_12769 | 203 |
| 315 | 3300037068 | Ga0373925_0022539 | Ga0373925_0022539_3136_3768 | 203 |
| 316 | 3300037471 | Ga0395905_0212888 | Ga0395905_0212888_856_1467 | 203 |
| 317 | 3300046454 | Ga0495592_0181112 | Ga0495592_0181112_33_665 | 203 |
| 318 | 3300046459 | Ga0495629_0095709 | Ga0495629_0095709_1026_1658 | 203 |
| 319 | 3300046472 | Ga0495580_0479424 | Ga0495580_0479424_188_820 | 203 |
| 320 | 3300046476 | Ga0495662_0037461 | Ga0495662_0037461_1073_1705 | 203 |
| 321 | 3300046477 | Ga0495664_0027690 | Ga0495664_0027690_1276_1908 | 203 |
| 322 | 3300046517 | Ga0495630_0185920 | Ga0495630_0185920_804_1436 | 203 |
| 323 | 3300046535 | Ga0495586_0062671 | Ga0495586_0062671_934_1566 | 203 |
| 324 | 3300046674 | Ga0495588_0050614 | Ga0495588_0050614_285_917 | 203 |
| 325 | 3300046683 | Ga0495658_0076024 | Ga0495658_0076024_541_1173 | 203 |
| 326 | 3300046689 | Ga0495613_0435176 | Ga0495613_0435176_247_879 | 203 |
| 327 | 3300046809 | Ga0495600_0093226 | Ga0495600_0093226_1057_1689 | 203 |
| 328 | 3300047315 | Ga0495581_0048540 | Ga0495581_0048540_1492_2124 | 203 |
| 329 | 3300047322 | Ga0495680_0025209 | Ga0495680_0025209_4064_4696 | 203 |
| 330 | 3300047471 | Ga0495684_0015154 | Ga0495684_0015154_3632_4264 | 203 |
| 331 | 3300048089 | Ga0495614_0046301 | Ga0495614_0046301_1167_1799 | 203 |
| 332 | 3300048904 | Ga0496101_0530394 | Ga0496101_0530394_103_735 | 203 |
| 333 | 3300048905 | Ga0496102_0606694 | Ga0496102_0606694_100_732 | 203 |
| 334 | 3300048907 | Ga0496104_0030328 | Ga0496104_0030328_4362_4994 | 203 |
| 335 | 3300048912 | Ga0496109_0069039 | Ga0496109_0069039_2356_2988 | 203 |
| 336 | 3300048915 | Ga0496112_0049976 | Ga0496112_0049976_2661_3293 | 203 |
| 337 | 3300048915 | Ga0496112_0570656 | Ga0496112_0570656_248_880 | 203 |
| 338 | 3300050512 | nmdc:mga0n895_133787_c1 | nmdc:mga0n895_133787_c1_290_922 | 203 |
| 339 | 3300050512 | nmdc:mga0n895_178201_c1 | nmdc:mga0n895_178201_c1_796_1434 | 203 |
| 340 | 3300050514 | nmdc:mga08x19_158119_c1 | nmdc:mga08x19_158119_c1_353_964 | 203 |
| 341 | 3300053077 | Ga0495601_0114441 | Ga0495601_0114441_137_769 | 203 |
| 342 | 3300053084 | Ga0495595_0200083 | Ga0495595_0200083_209_841 | 203 |
| 343 | 3300053085 | Ga0495619_0005085 | Ga0495619_0005085_1576_2208 | 203 |
| 344 | 3300005329 | Ga0070683_100990781 | Ga0070683_1009907811 | 204 |
| 345 | 3300005331 | Ga0070670_100091558 | Ga0070670_1000915583 | 204 |
| 346 | 3300005353 | Ga0070669_100147828 | Ga0070669_1001478283 | 204 |
| 347 | 3300005459 | Ga0068867_101313796 | Ga0068867_1013137961 | 204 |
| 348 | 3300005536 | Ga0070697_100321614 | Ga0070697_1003216142 | 204 |
| 349 | 3300005841 | Ga0068863_100501089 | Ga0068863_1005010891 | 204 |
| 350 | 3300005843 | Ga0068860_100701949 | Ga0068860_1007019492 | 204 |
| 351 | 3300005844 | Ga0068862_100065184 | Ga0068862_1000651842 | 204 |
| 352 | 3300009147 | Ga0114129_10197732 | Ga0114129_101977322 | 204 |
| 353 | 3300009551 | Ga0105238_10126932 | Ga0105238_101269322 | 204 |
| 354 | 3300013104 | Ga0157370_10003127 | Ga0157370_100031273 | 204 |
| 355 | 3300025909 | Ga0207705_10008051 | Ga0207705_100080513 | 204 |
| 356 | 3300025923 | Ga0207681_10182450 | Ga0207681_101824501 | 204 |
| 357 | 3300025924 | Ga0207694_10355323 | Ga0207694_103553232 | 204 |
| 358 | 3300025925 | Ga0207650_10149981 | Ga0207650_101499813 | 204 |
| 359 | 3300025940 | Ga0207691_10903139 | Ga0207691_109031391 | 204 |
| 360 | 3300025944 | Ga0207661_10347916 | Ga0207661_103479162 | 204 |
| 361 | 3300025972 | Ga0207668_10271559 | Ga0207668_102715592 | 204 |
| 362 | 3300026088 | Ga0207641_10032700 | Ga0207641_100327003 | 204 |
| 363 | 3300026088 | Ga0207641_10183034 | Ga0207641_101830343 | 204 |
| 364 | 3300026118 | Ga0207675_100322117 | Ga0207675_1003221173 | 204 |
| 365 | 3300028380 | Ga0268265_10019642 | Ga0268265_100196423 | 204 |
| 366 | 3300028381 | Ga0268264_10095954 | Ga0268264_100959542 | 204 |
| 367 | 3300050507 | nmdc:mga05p37_164745_c1 | nmdc:mga05p37_164745_c1_218_859 | 204 |
| 368 | 3300005293 | Ga0065715_10156372 | Ga0065715_101563722 | 205 |
| 369 | 3300005328 | Ga0070676_10111177 | Ga0070676_101111772 | 205 |
| 370 | 3300005330 | Ga0070690_100153467 | Ga0070690_1001534673 | 205 |
| 371 | 3300005331 | Ga0070670_100000721 | Ga0070670_1000007213 | 205 |
| 372 | 3300005331 | Ga0070670_100250911 | Ga0070670_1002509113 | 205 |
| 373 | 3300005334 | Ga0068869_100000106 | Ga0068869_1000001065 | 205 |
| 374 | 3300005336 | Ga0070680_100128278 | Ga0070680_1001282783 | 205 |
| 375 | 3300005338 | Ga0068868_100126450 | Ga0068868_1001264502 | 205 |
| 376 | 3300005338 | Ga0068868_100199362 | Ga0068868_1001993622 | 205 |
| 377 | 3300005339 | Ga0070660_100010721 | Ga0070660_1000107213 | 205 |
| 378 | 3300005339 | Ga0070660_100249794 | Ga0070660_1002497942 | 205 |
| 379 | 3300005343 | Ga0070687_100147184 | Ga0070687_1001471843 | 205 |
| 380 | 3300005344 | Ga0070661_100251773 | Ga0070661_1002517732 | 205 |
| 381 | 3300005344 | Ga0070661_100444475 | Ga0070661_1004444752 | 205 |
| 382 | 3300005347 | Ga0070668_100044975 | Ga0070668_1000449752 | 205 |
| 383 | 3300005353 | Ga0070669_100002610 | Ga0070669_1000026103 | 205 |
| 384 | 3300005366 | Ga0070659_100233312 | Ga0070659_1002333123 | 205 |
| 385 | 3300005366 | Ga0070659_100809114 | Ga0070659_1008091141 | 205 |
| 386 | 3300005367 | Ga0070667_100036439 | Ga0070667_1000364392 | 205 |
| 387 | 3300005367 | Ga0070667_100413749 | Ga0070667_1004137492 | 205 |
| 388 | 3300005406 | Ga0070703_10012071 | Ga0070703_100120712 | 205 |
| 389 | 3300005457 | Ga0070662_100334690 | Ga0070662_1003346902 | 205 |
| 390 | 3300005458 | Ga0070681_10103222 | Ga0070681_101032223 | 205 |
| 391 | 3300005459 | Ga0068867_100027952 | Ga0068867_1000279522 | 205 |
| 392 | 3300005471 | Ga0070698_100172125 | Ga0070698_1001721251 | 205 |
| 393 | 3300005518 | Ga0070699_101153140 | Ga0070699_1011531401 | 205 |
| 394 | 3300005530 | Ga0070679_100704831 | Ga0070679_1007048311 | 205 |
| 395 | 3300005539 | Ga0068853_100305663 | Ga0068853_1003056632 | 205 |
| 396 | 3300005543 | Ga0070672_100138559 | Ga0070672_1001385592 | 205 |
| 397 | 3300005546 | Ga0070696_100673693 | Ga0070696_1006736931 | 205 |
| 398 | 3300005563 | Ga0068855_100214885 | Ga0068855_1002148852 | 205 |
| 399 | 3300005563 | Ga0068855_100354442 | Ga0068855_1003544422 | 205 |
| 400 | 3300005563 | Ga0068855_100394050 | Ga0068855_1003940502 | 205 |
| 401 | 3300005577 | Ga0068857_100288230 | Ga0068857_1002882303 | 205 |
| 402 | 3300005578 | Ga0068854_100153553 | Ga0068854_1001535532 | 205 |
| 403 | 3300005614 | Ga0068856_100626177 | Ga0068856_1006261772 | 205 |
| 404 | 3300005617 | Ga0068859_100000273 | Ga0068859_10000027332 | 205 |
| 405 | 3300005618 | Ga0068864_100002063 | Ga0068864_1000020634 | 205 |
| 406 | 3300005618 | Ga0068864_100505258 | Ga0068864_1005052582 | 205 |
| 407 | 3300005718 | Ga0068866_10161142 | Ga0068866_101611422 | 205 |
| 408 | 3300005719 | Ga0068861_100000427 | Ga0068861_10000042716 | 205 |
| 409 | 3300005834 | Ga0068851_10472213 | Ga0068851_104722131 | 205 |
| 410 | 3300005840 | Ga0068870_10098989 | Ga0068870_100989892 | 205 |
| 411 | 3300005841 | Ga0068863_100000481 | Ga0068863_10000048124 | 205 |
| 412 | 3300005841 | Ga0068863_100347140 | Ga0068863_1003471403 | 205 |
| 413 | 3300005842 | Ga0068858_100005514 | Ga0068858_10000551410 | 205 |
| 414 | 3300005843 | Ga0068860_100014374 | Ga0068860_1000143744 | 205 |
| 415 | 3300005844 | Ga0068862_100008312 | Ga0068862_1000083123 | 205 |
| 416 | 3300006175 | Ga0070712_100267124 | Ga0070712_1002671241 | 205 |
| 417 | 3300006852 | Ga0075433_10064467 | Ga0075433_100644672 | 205 |
| 418 | 3300006852 | Ga0075433_10354133 | Ga0075433_103541333 | 205 |
| 419 | 3300006871 | Ga0075434_100062744 | Ga0075434_1000627443 | 205 |
| 420 | 3300006871 | Ga0075434_100402593 | Ga0075434_1004025932 | 205 |
| 421 | 3300006931 | Ga0097620_100000273 | Ga0097620_10000027320 | 205 |
| 422 | 3300009098 | Ga0105245_10676501 | Ga0105245_106765012 | 205 |
| 423 | 3300009101 | Ga0105247_10041229 | Ga0105247_100412292 | 205 |
| 424 | 3300009174 | Ga0105241_10019509 | Ga0105241_100195095 | 205 |
| 425 | 3300009177 | Ga0105248_10005397 | Ga0105248_100053973 | 205 |
| 426 | 3300009177 | Ga0105248_10013080 | Ga0105248_100130803 | 205 |
| 427 | 3300009545 | Ga0105237_10223560 | Ga0105237_102235603 | 205 |
| 428 | 3300009545 | Ga0105237_10712692 | Ga0105237_107126922 | 205 |
| 429 | 3300009551 | Ga0105238_10007544 | Ga0105238_100075443 | 205 |
| 430 | 3300013100 | Ga0157373_10004340 | Ga0157373_1000434012 | 205 |
| 431 | 3300013104 | Ga0157370_10033430 | Ga0157370_100334304 | 205 |
| 432 | 3300013104 | Ga0157370_10041487 | Ga0157370_100414873 | 205 |
| 433 | 3300013104 | Ga0157370_10507892 | Ga0157370_105078922 | 205 |
| 434 | 3300013105 | Ga0157369_10764490 | Ga0157369_107644902 | 205 |
| 435 | 3300013296 | Ga0157374_10667659 | Ga0157374_106676592 | 205 |
| 436 | 3300013297 | Ga0157378_10053063 | Ga0157378_100530633 | 205 |
| 437 | 3300013307 | Ga0157372_10138345 | Ga0157372_101383452 | 205 |
| 438 | 3300013307 | Ga0157372_10209419 | Ga0157372_102094192 | 205 |
| 439 | 3300013308 | Ga0157375_10116202 | Ga0157375_101162023 | 205 |
| 440 | 3300013308 | Ga0157375_10298253 | Ga0157375_102982532 | 205 |
| 441 | 3300014325 | Ga0163163_10022645 | Ga0163163_100226453 | 205 |
| 442 | 3300014497 | Ga0182008_10065327 | Ga0182008_100653272 | 205 |
| 443 | 3300014968 | Ga0157379_10000447 | Ga0157379_1000044721 | 205 |
| 444 | 3300025885 | Ga0207653_10031643 | Ga0207653_100316433 | 205 |
| 445 | 3300025908 | Ga0207643_10007633 | Ga0207643_100076336 | 205 |
| 446 | 3300025919 | Ga0207657_10019055 | Ga0207657_100190553 | 205 |
| 447 | 3300025919 | Ga0207657_10203092 | Ga0207657_102030922 | 205 |
| 448 | 3300025920 | Ga0207649_10165244 | Ga0207649_101652442 | 205 |
| 449 | 3300025920 | Ga0207649_10341736 | Ga0207649_103417363 | 205 |
| 450 | 3300025923 | Ga0207681_10088689 | Ga0207681_100886893 | 205 |
| 451 | 3300025925 | Ga0207650_10044122 | Ga0207650_100441223 | 205 |
| 452 | 3300025927 | Ga0207687_10569304 | Ga0207687_105693042 | 205 |
| 453 | 3300025932 | Ga0207690_10103728 | Ga0207690_101037283 | 205 |
| 454 | 3300025940 | Ga0207691_10144224 | Ga0207691_101442242 | 205 |
| 455 | 3300025941 | Ga0207711_10030429 | Ga0207711_100304294 | 205 |
| 456 | 3300025942 | Ga0207689_10000118 | Ga0207689_1000011831 | 205 |
| 457 | 3300025949 | Ga0207667_10063646 | Ga0207667_100636462 | 205 |
| 458 | 3300025949 | Ga0207667_10229981 | Ga0207667_102299812 | 205 |
| 459 | 3300025949 | Ga0207667_10337349 | Ga0207667_103373492 | 205 |
| 460 | 3300025972 | Ga0207668_10016878 | Ga0207668_100168782 | 205 |
| 461 | 3300025981 | Ga0207640_10100037 | Ga0207640_101000372 | 205 |
| 462 | 3300025981 | Ga0207640_10276855 | Ga0207640_102768552 | 205 |
| 463 | 3300025986 | Ga0207658_10076068 | Ga0207658_100760682 | 205 |
| 464 | 3300026023 | Ga0207677_10117043 | Ga0207677_101170432 | 205 |
| 465 | 3300026035 | Ga0207703_10002366 | Ga0207703_100023665 | 205 |
| 466 | 3300026041 | Ga0207639_10239574 | Ga0207639_102395742 | 205 |
| 467 | 3300026088 | Ga0207641_10019723 | Ga0207641_100197232 | 205 |
| 468 | 3300026088 | Ga0207641_10528450 | Ga0207641_105284502 | 205 |
| 469 | 3300026089 | Ga0207648_10005815 | Ga0207648_100058155 | 205 |
| 470 | 3300026095 | Ga0207676_10015379 | Ga0207676_100153792 | 205 |
| 471 | 3300026116 | Ga0207674_10005149 | Ga0207674_1000514912 | 205 |
| 472 | 3300026118 | Ga0207675_100002411 | Ga0207675_1000024113 | 205 |
| 473 | 3300028380 | Ga0268265_10138282 | Ga0268265_101382822 | 205 |
| 474 | 3300028380 | Ga0268265_10669535 | Ga0268265_106695352 | 205 |
| 475 | 3300028381 | Ga0268264_10000740 | Ga0268264_1000074026 | 205 |
| 476 | 3300028381 | Ga0268264_10247488 | Ga0268264_102474882 | 205 |
| 477 | 3300031235 | Ga0265330_10026990 | Ga0265330_100269902 | 205 |
| 478 | 3300031238 | Ga0265332_10000583 | Ga0265332_1000058316 | 205 |
| 479 | 3300031241 | Ga0265325_10050407 | Ga0265325_100504072 | 205 |
| 480 | 3300031242 | Ga0265329_10010967 | Ga0265329_100109673 | 205 |
| 481 | 3300031251 | Ga0265327_10010271 | Ga0265327_100102718 | 205 |
| 482 | 3300031712 | Ga0265342_10055387 | Ga0265342_100553872 | 205 |
| 483 | 3300035090 | Ga0373949_0031964 | Ga0373949_0031964_133_801 | 205 |
| 484 | 3300037312 | Ga0395899_0041201 | Ga0395899_0041201_555_1172 | 205 |
| 485 | 3300037466 | Ga0395898_0230920 | Ga0395898_0230920_651_1268 | 205 |
| 486 | 3300037471 | Ga0395905_0486015 | Ga0395905_0486015_470_1087 | 205 |
| 487 | 3300038443 | Ga0395901_0380716 | Ga0395901_0380716_195_812 | 205 |
| 488 | 3300045051 | Ga0451576_0743739 | Ga0451576_0743739_191_817 | 205 |
| 489 | 3300048905 | Ga0496102_0106971 | Ga0496102_0106971_758_1381 | 205 |
| 490 | 3300048909 | Ga0496106_0124912 | Ga0496106_0124912_388_1011 | 205 |
| 491 | 3300048911 | Ga0496108_0115398 | Ga0496108_0115398_93_716 | 205 |
| 492 | 3300048912 | Ga0496109_0342604 | Ga0496109_0342604_475_1098 | 205 |
| 493 | 3300048913 | Ga0496110_0095542 | Ga0496110_0095542_816_1439 | 205 |
| 494 | 3300050512 | nmdc:mga0n895_182487_c1 | nmdc:mga0n895_182487_c1_602_1228 | 205 |
| 495 | 3300050513 | nmdc:mga0rr50_104297_c1 | nmdc:mga0rr50_104297_c1_962_1585 | 205 |
| 496 | 3300050515 | nmdc:mga0a205_50317_c1 | nmdc:mga0a205_50317_c1_2971_3597 | 205 |
| 497 | 3300005336 | Ga0070680_100324563 | Ga0070680_1003245632 | 206 |
| 498 | 3300005366 | Ga0070659_100314745 | Ga0070659_1003147453 | 206 |
| 499 | 3300005434 | Ga0070709_10341155 | Ga0070709_103411552 | 206 |
| 500 | 3300005435 | Ga0070714_100420922 | Ga0070714_1004209222 | 206 |
| 501 | 3300005436 | Ga0070713_100004630 | Ga0070713_10000463010 | 206 |
| 502 | 3300005437 | Ga0070710_10015135 | Ga0070710_100151352 | 206 |
| 503 | 3300005439 | Ga0070711_100157388 | Ga0070711_1001573881 | 206 |
| 504 | 3300005458 | Ga0070681_10089384 | Ga0070681_100893843 | 206 |
| 505 | 3300005530 | Ga0070679_100029448 | Ga0070679_1000294483 | 206 |
| 506 | 3300005539 | Ga0068853_100196459 | Ga0068853_1001964592 | 206 |
| 507 | 3300005546 | Ga0070696_100020735 | Ga0070696_1000207353 | 206 |
| 508 | 3300005563 | Ga0068855_100260078 | Ga0068855_1002600783 | 206 |
| 509 | 3300005577 | Ga0068857_100619277 | Ga0068857_1006192772 | 206 |
| 510 | 3300005578 | Ga0068854_100379019 | Ga0068854_1003790192 | 206 |
| 511 | 3300005614 | Ga0068856_100063534 | Ga0068856_1000635343 | 206 |
| 512 | 3300005616 | Ga0068852_100278705 | Ga0068852_1002787052 | 206 |
| 513 | 3300006871 | Ga0075434_100348140 | Ga0075434_1003481402 | 206 |
| 514 | 3300006914 | Ga0075436_100003385 | Ga0075436_1000033859 | 206 |
| 515 | 3300013104 | Ga0157370_10098960 | Ga0157370_100989602 | 206 |
| 516 | 3300013105 | Ga0157369_10099058 | Ga0157369_100990582 | 206 |
| 517 | 3300013105 | Ga0157369_10339039 | Ga0157369_103390393 | 206 |
| 518 | 3300013307 | Ga0157372_10075855 | Ga0157372_100758554 | 206 |
| 519 | 3300013307 | Ga0157372_10159751 | Ga0157372_101597513 | 206 |
| 520 | 3300020082 | Ga0206353_10243398 | Ga0206353_102433982 | 206 |
| 521 | 3300025898 | Ga0207692_10022875 | Ga0207692_100228752 | 206 |
| 522 | 3300025911 | Ga0207654_10134788 | Ga0207654_101347883 | 206 |
| 523 | 3300025912 | Ga0207707_10094432 | Ga0207707_100944322 | 206 |
| 524 | 3300025916 | Ga0207663_10141943 | Ga0207663_101419432 | 206 |
| 525 | 3300025928 | Ga0207700_10094366 | Ga0207700_100943662 | 206 |
| 526 | 3300025929 | Ga0207664_10011946 | Ga0207664_100119462 | 206 |
| 527 | 3300025932 | Ga0207690_10117011 | Ga0207690_101170112 | 206 |
| 528 | 3300025949 | Ga0207667_10089037 | Ga0207667_100890373 | 206 |
| 529 | 3300025981 | Ga0207640_10346532 | Ga0207640_103465322 | 206 |
| 530 | 3300026078 | Ga0207702_10020526 | Ga0207702_100205265 | 206 |
| 531 | 3300035725 | Ga0373947_0095620 | Ga0373947_0095620_383_1042 | 206 |
| 532 | 3300037068 | Ga0373925_0530569 | Ga0373925_0530569_270_929 | 206 |
| 533 | 3300045976 | Ga0466967_0147462 | Ga0466967_0147462_1242_1865 | 206 |
| 534 | 3300046539 | Ga0495621_0088336 | Ga0495621_0088336_317_976 | 206 |
| 535 | 3300048909 | Ga0496106_0159792 | Ga0496106_0159792_837_1460 | 206 |
| 536 | 3300048911 | Ga0496108_0124473 | Ga0496108_0124473_797_1456 | 206 |
| 537 | 3300050512 | nmdc:mga0n895_220605_c1 | nmdc:mga0n895_220605_c1_310_939 | 206 |
| 538 | 3300050513 | nmdc:mga0rr50_159260_c1 | nmdc:mga0rr50_159260_c1_15_644 | 206 |
| 539 | 3300050514 | nmdc:mga08x19_7468_c1 | nmdc:mga08x19_7468_c1_4585_5214 | 206 |
| 540 | 3300005327 | Ga0070658_10089647 | Ga0070658_100896472 | 207 |
| 541 | 3300005328 | Ga0070676_10038410 | Ga0070676_100384103 | 207 |
| 542 | 3300005330 | Ga0070690_100179646 | Ga0070690_1001796462 | 207 |
| 543 | 3300005331 | Ga0070670_100022535 | Ga0070670_1000225352 | 207 |
| 544 | 3300005335 | Ga0070666_10109013 | Ga0070666_101090133 | 207 |
| 545 | 3300005339 | Ga0070660_100538854 | Ga0070660_1005388542 | 207 |
| 546 | 3300005340 | Ga0070689_100007744 | Ga0070689_1000077442 | 207 |
| 547 | 3300005344 | Ga0070661_100061746 | Ga0070661_1000617462 | 207 |
| 548 | 3300005344 | Ga0070661_100298929 | Ga0070661_1002989292 | 207 |
| 549 | 3300005347 | Ga0070668_100142810 | Ga0070668_1001428102 | 207 |
| 550 | 3300005356 | Ga0070674_100060793 | Ga0070674_1000607932 | 207 |
| 551 | 3300005364 | Ga0070673_100216133 | Ga0070673_1002161333 | 207 |
| 552 | 3300005435 | Ga0070714_100274414 | Ga0070714_1002744142 | 207 |
| 553 | 3300005455 | Ga0070663_100032818 | Ga0070663_1000328182 | 207 |
| 554 | 3300005457 | Ga0070662_100456116 | Ga0070662_1004561162 | 207 |
| 555 | 3300005459 | Ga0068867_100076456 | Ga0068867_1000764562 | 207 |
| 556 | 3300005547 | Ga0070693_100069188 | Ga0070693_1000691882 | 207 |
| 557 | 3300005548 | Ga0070665_100070962 | Ga0070665_1000709623 | 207 |
| 558 | 3300005563 | Ga0068855_100408162 | Ga0068855_1004081622 | 207 |
| 559 | 3300005564 | Ga0070664_100211473 | Ga0070664_1002114733 | 207 |
| 560 | 3300005577 | Ga0068857_100356147 | Ga0068857_1003561472 | 207 |
| 561 | 3300005577 | Ga0068857_100363595 | Ga0068857_1003635952 | 207 |
| 562 | 3300005615 | Ga0070702_100378400 | Ga0070702_1003784002 | 207 |
| 563 | 3300005617 | Ga0068859_101183725 | Ga0068859_1011837252 | 207 |
| 564 | 3300005834 | Ga0068851_10018629 | Ga0068851_100186293 | 207 |
| 565 | 3300006358 | Ga0068871_100008285 | Ga0068871_1000082852 | 207 |
| 566 | 3300006881 | Ga0068865_100004079 | Ga0068865_1000040796 | 207 |
| 567 | 3300006931 | Ga0097620_101183761 | Ga0097620_1011837612 | 207 |
| 568 | 3300009093 | Ga0105240_10472153 | Ga0105240_104721532 | 207 |
| 569 | 3300009174 | Ga0105241_10401568 | Ga0105241_104015682 | 207 |
| 570 | 3300009177 | Ga0105248_10321498 | Ga0105248_103214983 | 207 |
| 571 | 3300009551 | Ga0105238_10688403 | Ga0105238_106884031 | 207 |
| 572 | 3300013102 | Ga0157371_10110534 | Ga0157371_101105343 | 207 |
| 573 | 3300013104 | Ga0157370_10013807 | Ga0157370_100138072 | 207 |
| 574 | 3300013105 | Ga0157369_10259769 | Ga0157369_102597692 | 207 |
| 575 | 3300013296 | Ga0157374_10186233 | Ga0157374_101862332 | 207 |
| 576 | 3300013307 | Ga0157372_10042932 | Ga0157372_100429325 | 207 |
| 577 | 3300013307 | Ga0157372_10188391 | Ga0157372_101883912 | 207 |
| 578 | 3300013307 | Ga0157372_10554083 | Ga0157372_105540832 | 207 |
| 579 | 3300014969 | Ga0157376_10215356 | Ga0157376_102153562 | 207 |
| 580 | 3300025315 | Ga0207697_10040245 | Ga0207697_100402453 | 207 |
| 581 | 3300025906 | Ga0207699_10474167 | Ga0207699_104741671 | 207 |
| 582 | 3300025908 | Ga0207643_10110152 | Ga0207643_101101522 | 207 |
| 583 | 3300025909 | Ga0207705_10266799 | Ga0207705_102667991 | 207 |
| 584 | 3300025911 | Ga0207654_10373640 | Ga0207654_103736402 | 207 |
| 585 | 3300025913 | Ga0207695_10093320 | Ga0207695_100933202 | 207 |
| 586 | 3300025920 | Ga0207649_10219581 | Ga0207649_102195812 | 207 |
| 587 | 3300025925 | Ga0207650_10056231 | Ga0207650_100562312 | 207 |
| 588 | 3300025925 | Ga0207650_10075764 | Ga0207650_100757642 | 207 |
| 589 | 3300025927 | Ga0207687_10510614 | Ga0207687_105106142 | 207 |
| 590 | 3300025932 | Ga0207690_10356493 | Ga0207690_103564932 | 207 |
| 591 | 3300025937 | Ga0207669_10082156 | Ga0207669_100821562 | 207 |
| 592 | 3300025938 | Ga0207704_10116039 | Ga0207704_101160393 | 207 |
| 593 | 3300025942 | Ga0207689_10121627 | Ga0207689_101216273 | 207 |
| 594 | 3300025945 | Ga0207679_10023519 | Ga0207679_100235192 | 207 |
| 595 | 3300025949 | Ga0207667_10647975 | Ga0207667_106479752 | 207 |
| 596 | 3300025972 | Ga0207668_10149176 | Ga0207668_101491762 | 207 |
| 597 | 3300025981 | Ga0207640_10292732 | Ga0207640_102927321 | 207 |
| 598 | 3300026067 | Ga0207678_10129104 | Ga0207678_101291042 | 207 |
| 599 | 3300026089 | Ga0207648_10154414 | Ga0207648_101544142 | 207 |
| 600 | 3300028379 | Ga0268266_10170038 | Ga0268266_101700382 | 207 |
| 601 | 3300028379 | Ga0268266_10609125 | Ga0268266_106091251 | 207 |
| 602 | 3300028380 | Ga0268265_10206617 | Ga0268265_102066173 | 207 |
| 603 | 3300032005 | Ga0307411_10332976 | Ga0307411_103329762 | 207 |
| 604 | 3300050512 | nmdc:mga0n895_1019626_c1 | nmdc:mga0n895_1019626_c1_148_774 | 207 |
| 605 | 3300001991 | JGI24743J22301_10015763 | JGI24743J22301_100157633 | 208 |
| 606 | 3300002077 | JGI24744J21845_10035547 | JGI24744J21845_100355472 | 208 |
| 607 | 3300005328 | Ga0070676_10028963 | Ga0070676_100289633 | 208 |
| 608 | 3300005330 | Ga0070690_100003757 | Ga0070690_1000037572 | 208 |
| 609 | 3300005331 | Ga0070670_100056338 | Ga0070670_1000563382 | 208 |
| 610 | 3300005333 | Ga0070677_10015084 | Ga0070677_100150843 | 208 |
| 611 | 3300005335 | Ga0070666_10107395 | Ga0070666_101073953 | 208 |
| 612 | 3300005335 | Ga0070666_10188680 | Ga0070666_101886802 | 208 |
| 613 | 3300005338 | Ga0068868_100007615 | Ga0068868_1000076152 | 208 |
| 614 | 3300005338 | Ga0068868_100282292 | Ga0068868_1002822921 | 208 |
| 615 | 3300005339 | Ga0070660_100010199 | Ga0070660_1000101994 | 208 |
| 616 | 3300005339 | Ga0070660_100135573 | Ga0070660_1001355733 | 208 |
| 617 | 3300005339 | Ga0070660_100300079 | Ga0070660_1003000792 | 208 |
| 618 | 3300005343 | Ga0070687_100146301 | Ga0070687_1001463012 | 208 |
| 619 | 3300005344 | Ga0070661_100006563 | Ga0070661_1000065635 | 208 |
| 620 | 3300005344 | Ga0070661_100016522 | Ga0070661_1000165223 | 208 |
| 621 | 3300005344 | Ga0070661_101048418 | Ga0070661_1010484181 | 208 |
| 622 | 3300005347 | Ga0070668_100081162 | Ga0070668_1000811623 | 208 |
| 623 | 3300005347 | Ga0070668_100225323 | Ga0070668_1002253232 | 208 |
| 624 | 3300005353 | Ga0070669_100022397 | Ga0070669_1000223974 | 208 |
| 625 | 3300005353 | Ga0070669_100109983 | Ga0070669_1001099832 | 208 |
| 626 | 3300005354 | Ga0070675_100103016 | Ga0070675_1001030163 | 208 |
| 627 | 3300005355 | Ga0070671_100006650 | Ga0070671_1000066502 | 208 |
| 628 | 3300005355 | Ga0070671_100023700 | Ga0070671_1000237002 | 208 |
| 629 | 3300005356 | Ga0070674_100037406 | Ga0070674_1000374062 | 208 |
| 630 | 3300005356 | Ga0070674_100153053 | Ga0070674_1001530533 | 208 |
| 631 | 3300005364 | Ga0070673_100011016 | Ga0070673_1000110163 | 208 |
| 632 | 3300005365 | Ga0070688_100027403 | Ga0070688_1000274033 | 208 |
| 633 | 3300005366 | Ga0070659_100002261 | Ga0070659_1000022613 | 208 |
| 634 | 3300005367 | Ga0070667_100063921 | Ga0070667_1000639212 | 208 |
| 635 | 3300005367 | Ga0070667_100125623 | Ga0070667_1001256233 | 208 |
| 636 | 3300005455 | Ga0070663_100038441 | Ga0070663_1000384412 | 208 |
| 637 | 3300005455 | Ga0070663_100063082 | Ga0070663_1000630822 | 208 |
| 638 | 3300005455 | Ga0070663_100259927 | Ga0070663_1002599272 | 208 |
| 639 | 3300005456 | Ga0070678_100145800 | Ga0070678_1001458002 | 208 |
| 640 | 3300005456 | Ga0070678_100308015 | Ga0070678_1003080152 | 208 |
| 641 | 3300005457 | Ga0070662_100000291 | Ga0070662_1000002919 | 208 |
| 642 | 3300005457 | Ga0070662_100140183 | Ga0070662_1001401833 | 208 |
| 643 | 3300005457 | Ga0070662_100190195 | Ga0070662_1001901953 | 208 |
| 644 | 3300005458 | Ga0070681_10093306 | Ga0070681_100933062 | 208 |
| 645 | 3300005459 | Ga0068867_100018182 | Ga0068867_1000181821 | 208 |
| 646 | 3300005466 | Ga0070685_10012861 | Ga0070685_100128613 | 208 |
| 647 | 3300005530 | Ga0070679_100274878 | Ga0070679_1002748781 | 208 |
| 648 | 3300005539 | Ga0068853_100039736 | Ga0068853_1000397363 | 208 |
| 649 | 3300005539 | Ga0068853_100120769 | Ga0068853_1001207692 | 208 |
| 650 | 3300005543 | Ga0070672_100027206 | Ga0070672_1000272062 | 208 |
| 651 | 3300005543 | Ga0070672_100156011 | Ga0070672_1001560113 | 208 |
| 652 | 3300005543 | Ga0070672_100255236 | Ga0070672_1002552362 | 208 |
| 653 | 3300005544 | Ga0070686_100631479 | Ga0070686_1006314791 | 208 |
| 654 | 3300005548 | Ga0070665_100030174 | Ga0070665_1000301743 | 208 |
| 655 | 3300005563 | Ga0068855_100009716 | Ga0068855_1000097163 | 208 |
| 656 | 3300005564 | Ga0070664_100004791 | Ga0070664_1000047913 | 208 |
| 657 | 3300005564 | Ga0070664_100041319 | Ga0070664_1000413193 | 208 |
| 658 | 3300005578 | Ga0068854_100169431 | Ga0068854_1001694312 | 208 |
| 659 | 3300005578 | Ga0068854_100214187 | Ga0068854_1002141872 | 208 |
| 660 | 3300005614 | Ga0068856_100183433 | Ga0068856_1001834333 | 208 |
| 661 | 3300005614 | Ga0068856_100466097 | Ga0068856_1004660972 | 208 |
| 662 | 3300005616 | Ga0068852_100056542 | Ga0068852_1000565422 | 208 |
| 663 | 3300005616 | Ga0068852_100300722 | Ga0068852_1003007222 | 208 |
| 664 | 3300005617 | Ga0068859_100044151 | Ga0068859_1000441513 | 208 |
| 665 | 3300005617 | Ga0068859_100915510 | Ga0068859_1009155102 | 208 |
| 666 | 3300005618 | Ga0068864_100011007 | Ga0068864_1000110072 | 208 |
| 667 | 3300005718 | Ga0068866_10003742 | Ga0068866_100037427 | 208 |
| 668 | 3300005719 | Ga0068861_100088968 | Ga0068861_1000889682 | 208 |
| 669 | 3300005834 | Ga0068851_10056114 | Ga0068851_100561143 | 208 |
| 670 | 3300005840 | Ga0068870_10037705 | Ga0068870_100377052 | 208 |
| 671 | 3300005841 | Ga0068863_100026802 | Ga0068863_1000268026 | 208 |
| 672 | 3300005842 | Ga0068858_100243810 | Ga0068858_1002438102 | 208 |
| 673 | 3300005843 | Ga0068860_100037955 | Ga0068860_1000379553 | 208 |
| 674 | 3300005843 | Ga0068860_100043526 | Ga0068860_1000435263 | 208 |
| 675 | 3300005844 | Ga0068862_100242031 | Ga0068862_1002420312 | 208 |
| 676 | 3300005844 | Ga0068862_100328915 | Ga0068862_1003289152 | 208 |
| 677 | 3300006175 | Ga0070712_100193196 | Ga0070712_1001931962 | 208 |
| 678 | 3300006237 | Ga0097621_100012286 | Ga0097621_1000122862 | 208 |
| 679 | 3300006237 | Ga0097621_100806054 | Ga0097621_1008060542 | 208 |
| 680 | 3300006358 | Ga0068871_100006677 | Ga0068871_1000066779 | 208 |
| 681 | 3300006871 | Ga0075434_100447365 | Ga0075434_1004473652 | 208 |
| 682 | 3300006914 | Ga0075436_100419186 | Ga0075436_1004191862 | 208 |
| 683 | 3300006931 | Ga0097620_100044145 | Ga0097620_1000441452 | 208 |
| 684 | 3300006931 | Ga0097620_100915453 | Ga0097620_1009154532 | 208 |
| 685 | 3300009094 | Ga0111539_10019735 | Ga0111539_100197353 | 208 |
| 686 | 3300009176 | Ga0105242_10434608 | Ga0105242_104346082 | 208 |
| 687 | 3300009177 | Ga0105248_10094760 | Ga0105248_100947602 | 208 |
| 688 | 3300009545 | Ga0105237_10107615 | Ga0105237_101076152 | 208 |
| 689 | 3300013100 | Ga0157373_10012276 | Ga0157373_100122762 | 208 |
| 690 | 3300013102 | Ga0157371_10034883 | Ga0157371_100348833 | 208 |
| 691 | 3300013105 | Ga0157369_10188808 | Ga0157369_101888083 | 208 |
| 692 | 3300013296 | Ga0157374_10036955 | Ga0157374_100369552 | 208 |
| 693 | 3300013306 | Ga0163162_10286972 | Ga0163162_102869722 | 208 |
| 694 | 3300013306 | Ga0163162_10739146 | Ga0163162_107391461 | 208 |
| 695 | 3300013307 | Ga0157372_10002136 | Ga0157372_1000213620 | 208 |
| 696 | 3300013307 | Ga0157372_10181144 | Ga0157372_101811443 | 208 |
| 697 | 3300013307 | Ga0157372_10533019 | Ga0157372_105330192 | 208 |
| 698 | 3300013308 | Ga0157375_10159989 | Ga0157375_101599891 | 208 |
| 699 | 3300014968 | Ga0157379_10006715 | Ga0157379_100067158 | 208 |
| 700 | 3300014969 | Ga0157376_10088072 | Ga0157376_100880722 | 208 |
| 701 | 3300025321 | Ga0207656_10040229 | Ga0207656_100402291 | 208 |
| 702 | 3300025893 | Ga0207682_10000678 | Ga0207682_1000067815 | 208 |
| 703 | 3300025899 | Ga0207642_10118033 | Ga0207642_101180332 | 208 |
| 704 | 3300025907 | Ga0207645_10005694 | Ga0207645_100056948 | 208 |
| 705 | 3300025907 | Ga0207645_10143111 | Ga0207645_101431113 | 208 |
| 706 | 3300025908 | Ga0207643_10042283 | Ga0207643_100422833 | 208 |
| 707 | 3300025915 | Ga0207693_10030159 | Ga0207693_100301593 | 208 |
| 708 | 3300025918 | Ga0207662_10172713 | Ga0207662_101727132 | 208 |
| 709 | 3300025919 | Ga0207657_10000936 | Ga0207657_100009367 | 208 |
| 710 | 3300025919 | Ga0207657_10370813 | Ga0207657_103708132 | 208 |
| 711 | 3300025919 | Ga0207657_10448307 | Ga0207657_104483072 | 208 |
| 712 | 3300025920 | Ga0207649_10003799 | Ga0207649_100037992 | 208 |
| 713 | 3300025920 | Ga0207649_10018323 | Ga0207649_100183233 | 208 |
| 714 | 3300025923 | Ga0207681_10122450 | Ga0207681_101224503 | 208 |
| 715 | 3300025923 | Ga0207681_10186141 | Ga0207681_101861413 | 208 |
| 716 | 3300025925 | Ga0207650_10003516 | Ga0207650_1000351611 | 208 |
| 717 | 3300025926 | Ga0207659_10003975 | Ga0207659_100039752 | 208 |
| 718 | 3300025926 | Ga0207659_10033033 | Ga0207659_100330333 | 208 |
| 719 | 3300025931 | Ga0207644_10002621 | Ga0207644_100026218 | 208 |
| 720 | 3300025931 | Ga0207644_10010064 | Ga0207644_100100646 | 208 |
| 721 | 3300025932 | Ga0207690_10001284 | Ga0207690_100012843 | 208 |
| 722 | 3300025932 | Ga0207690_10327964 | Ga0207690_103279642 | 208 |
| 723 | 3300025933 | Ga0207706_10000631 | Ga0207706_1000063114 | 208 |
| 724 | 3300025933 | Ga0207706_10046644 | Ga0207706_100466443 | 208 |
| 725 | 3300025933 | Ga0207706_10072106 | Ga0207706_100721062 | 208 |
| 726 | 3300025936 | Ga0207670_10213664 | Ga0207670_102136642 | 208 |
| 727 | 3300025937 | Ga0207669_10123850 | Ga0207669_101238502 | 208 |
| 728 | 3300025937 | Ga0207669_10351330 | Ga0207669_103513301 | 208 |
| 729 | 3300025940 | Ga0207691_10009632 | Ga0207691_100096329 | 208 |
| 730 | 3300025940 | Ga0207691_10040781 | Ga0207691_100407813 | 208 |
| 731 | 3300025940 | Ga0207691_10084591 | Ga0207691_100845912 | 208 |
| 732 | 3300025941 | Ga0207711_10280568 | Ga0207711_102805682 | 208 |
| 733 | 3300025945 | Ga0207679_10005896 | Ga0207679_100058963 | 208 |
| 734 | 3300025945 | Ga0207679_10012718 | Ga0207679_100127185 | 208 |
| 735 | 3300025949 | Ga0207667_10002636 | Ga0207667_1000263618 | 208 |
| 736 | 3300025949 | Ga0207667_10053078 | Ga0207667_100530782 | 208 |
| 737 | 3300025960 | Ga0207651_10197525 | Ga0207651_101975252 | 208 |
| 738 | 3300025972 | Ga0207668_10022436 | Ga0207668_100224363 | 208 |
| 739 | 3300025972 | Ga0207668_10191820 | Ga0207668_101918203 | 208 |
| 740 | 3300025981 | Ga0207640_10070378 | Ga0207640_100703783 | 208 |
| 741 | 3300025981 | Ga0207640_10089367 | Ga0207640_100893672 | 208 |
| 742 | 3300025986 | Ga0207658_10187734 | Ga0207658_101877341 | 208 |
| 743 | 3300026023 | Ga0207677_10085813 | Ga0207677_100858132 | 208 |
| 744 | 3300026035 | Ga0207703_10007748 | Ga0207703_100077482 | 208 |
| 745 | 3300026035 | Ga0207703_10063538 | Ga0207703_100635382 | 208 |
| 746 | 3300026041 | Ga0207639_10007035 | Ga0207639_100070355 | 208 |
| 747 | 3300026067 | Ga0207678_10041499 | Ga0207678_100414993 | 208 |
| 748 | 3300026078 | Ga0207702_10004317 | Ga0207702_100043173 | 208 |
| 749 | 3300026088 | Ga0207641_10038818 | Ga0207641_100388183 | 208 |
| 750 | 3300026088 | Ga0207641_10593263 | Ga0207641_105932632 | 208 |
| 751 | 3300026089 | Ga0207648_10005165 | Ga0207648_100051656 | 208 |
| 752 | 3300026089 | Ga0207648_10244475 | Ga0207648_102444752 | 208 |
| 753 | 3300026095 | Ga0207676_10013603 | Ga0207676_100136032 | 208 |
| 754 | 3300026116 | Ga0207674_10345887 | Ga0207674_103458873 | 208 |
| 755 | 3300026116 | Ga0207674_10347395 | Ga0207674_103473952 | 208 |
| 756 | 3300026118 | Ga0207675_100007599 | Ga0207675_1000075993 | 208 |
| 757 | 3300026121 | Ga0207683_10009155 | Ga0207683_1000915510 | 208 |
| 758 | 3300026142 | Ga0207698_10020629 | Ga0207698_100206292 | 208 |
| 759 | 3300026142 | Ga0207698_10070511 | Ga0207698_100705112 | 208 |
| 760 | 3300027665 | Ga0209983_1001874 | Ga0209983_10018743 | 208 |
| 761 | 3300027665 | Ga0209983_1053220 | Ga0209983_10532202 | 208 |
| 762 | 3300027682 | Ga0209971_1003927 | Ga0209971_10039273 | 208 |
| 763 | 3300027695 | Ga0209966_1005525 | Ga0209966_10055252 | 208 |
| 764 | 3300027717 | Ga0209998_10008467 | Ga0209998_100084672 | 208 |
| 765 | 3300027876 | Ga0209974_10003765 | Ga0209974_100037652 | 208 |
| 766 | 3300027876 | Ga0209974_10003960 | Ga0209974_100039602 | 208 |
| 767 | 3300027907 | Ga0207428_10147869 | Ga0207428_101478692 | 208 |
| 768 | 3300028379 | Ga0268266_10049822 | Ga0268266_100498222 | 208 |
| 769 | 3300028380 | Ga0268265_10201559 | Ga0268265_102015592 | 208 |
| 770 | 3300028381 | Ga0268264_10002985 | Ga0268264_100029853 | 208 |
| 771 | 3300031548 | Ga0307408_100016857 | Ga0307408_1000168573 | 208 |
| 772 | 3300031824 | Ga0307413_10002055 | Ga0307413_100020552 | 208 |
| 773 | 3300031852 | Ga0307410_10022837 | Ga0307410_100228372 | 208 |
| 774 | 3300031901 | Ga0307406_10010725 | Ga0307406_100107253 | 208 |
| 775 | 3300031903 | Ga0307407_10034457 | Ga0307407_100344572 | 208 |
| 776 | 3300031911 | Ga0307412_10006583 | Ga0307412_100065836 | 208 |
| 777 | 3300031995 | Ga0307409_100000779 | Ga0307409_1000007798 | 208 |
| 778 | 3300032002 | Ga0307416_100003235 | Ga0307416_1000032356 | 208 |
| 779 | 3300032004 | Ga0307414_10024958 | Ga0307414_100249584 | 208 |
| 780 | 3300032005 | Ga0307411_10001712 | Ga0307411_100017125 | 208 |
| 781 | 3300035117 | Ga0373953_0034149 | Ga0373953_0034149_1226_1852 | 208 |
| 782 | 3300036401 | Ga0373937_0106411 | Ga0373937_0106411_1451_2077 | 208 |
| 783 | 3300044712 | Ga0453684_0208454 | Ga0453684_0208454_1114_1779 | 208 |
| 784 | 3300046472 | Ga0495580_0268013 | Ga0495580_0268013_367_993 | 208 |
| 785 | 3300048903 | Ga0496100_0026062 | Ga0496100_0026062_2005_2631 | 208 |
| 786 | 3300048904 | Ga0496101_0021534 | Ga0496101_0021534_2568_3194 | 208 |
| 787 | 3300048905 | Ga0496102_0002362 | Ga0496102_0002362_1191_1898 | 208 |
| 788 | 3300048905 | Ga0496102_0142952 | Ga0496102_0142952_1287_1913 | 208 |
| 789 | 3300048908 | Ga0496105_0130250 | Ga0496105_0130250_639_1265 | 208 |
| 790 | 3300048909 | Ga0496106_0000427 | Ga0496106_0000427_26494_27201 | 208 |
| 791 | 3300048909 | Ga0496106_0005263 | Ga0496106_0005263_7596_8222 | 208 |
| 792 | 3300048910 | Ga0496107_0001256 | Ga0496107_0001256_3632_4339 | 208 |
| 793 | 3300048911 | Ga0496108_0018678 | Ga0496108_0018678_1052_1678 | 208 |
| 794 | 3300048912 | Ga0496109_0008131 | Ga0496109_0008131_3549_4175 | 208 |
| 795 | 3300048912 | Ga0496109_0068191 | Ga0496109_0068191_1183_1809 | 208 |
| 796 | 3300048913 | Ga0496110_0013091 | Ga0496110_0013091_4706_5332 | 208 |
| 797 | 3300048917 | Ga0496114_0031348 | Ga0496114_0031348_1359_1985 | 208 |
| 798 | 3300050511 | nmdc:mga08y16_259982_c1 | nmdc:mga08y16_259982_c1_908_1534 | 208 |
| 799 | 3300050512 | nmdc:mga0n895_360842_c1 | nmdc:mga0n895_360842_c1_479_1144 | 208 |
| 800 | 3300050514 | nmdc:mga08x19_477115_c1 | nmdc:mga08x19_477115_c1_49_714 | 208 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s9u-assembly1.cif.gz_A | atomic structure of a putative anaerobic dehydrogenase component | 0.7864 | 18 | 205 |
| 3efp-assembly1.cif.gz_A | crystal structure of the escherichia coli twin arginine leader peptide binding protein dmsd in a monomeric form | 0.7575 | 21 | 205 |
| 1s9u-assembly1.cif.gz_A | atomic structure of a putative anaerobic dehydrogenase component | 0.715 | 18 | 205 |
| 2o9x-assembly1.cif.gz_A | crystal structure of a putative redox enzyme maturation protein from archaeoglobus fulgidus | 0.7148 | 12 | 199 |
| 2o9x-assembly1.cif.gz_A | crystal structure of a putative redox enzyme maturation protein from archaeoglobus fulgidus | 0.6949 | 12 | 199 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1n1cB02 | Mainly Alpha;Up-down Bundle;Monooxygenase;HscB, C-terminal domain | 0.8049 | 154 | 205 | 1.20.1280.20 |
| af_P75915_1_182_1.10.3480.10 | Mainly Alpha;Orthogonal Bundle;TorD-like;TorD-like | 0.8041 | 22 | 207 | 1.10.3480.10 |
| af_P75915_1_182_1.10.3480.10 | Mainly Alpha;Orthogonal Bundle;TorD-like;TorD-like | 0.7796 | 22 | 207 | 1.10.3480.10 |
| af_P9WJQ1_274_409_1.10.3480.10 | Mainly Alpha;Orthogonal Bundle;TorD-like;TorD-like | 0.716 | 53 | 199 | 1.10.3480.10 |
| af_P19317_7_161_1.10.3480.10 | Mainly Alpha;Orthogonal Bundle;TorD-like;TorD-like | 0.6711 | 56 | 199 | 1.10.3480.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1P8FQT0-F1-model_v4 | Molecular chaperone | 0.9599 | 13 | 208 |
|
| AF-A0A536T5H3-F1-model_v4 | Uncharacterized protein | 0.9527 | 109 | 208 |
|
| AF-A0A3B0QZY6-F1-model_v4 | Formate dehydrogenase-specific chaperone | 0.9504 | 13 | 208 |
|
| AF-A0A142LJT8-F1-model_v4 | Cytochrome C oxidase subunit II | 0.9478 | 12 | 208 |
|
| AF-A0A318A2P6-F1-model_v4 | Molecular chaperone | 0.9459 | 19 | 205 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar