F481379
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 800 | 300 | 798 | 210 |
Family's Representative Sequence
| Representative Sequence | 3300025913|Ga0207695_10022225|Ga0207695_100222253 |
| Length | 245 |
| Sequence | MDPKDPKGHQDPTDRRALMDSGAVISADASPLDTGTLTDRRTTLKWVLAAAAAMTAPLGSYAYAGAHAPARKGYGTDPDLSKVYKPGDLWPLTLTGPQRETSKSLCDLIIPADASSPSASEVGVVDFIDEWISAPYEQHRLDRIVILEGLVWLDAEAASRYGLGSSFAALSQQQQTAICDDICLADKATPNFAKAAKFFARYRDLTAGGFYTTPQGRQDLRYVGNVPSTHFDGPSPEVLKKVGLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 3 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 4 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 103 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 165 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 166 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 167 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 168 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 171 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 172 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 173 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 174 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 175 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 176 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 178 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 180 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 182 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 183 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 184 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 185 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 186 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 189 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 190 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 191 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 194 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 196 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 198 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 199 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 200 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 204 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 207 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 208 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 209 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 210 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 211 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 212 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 213 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 214 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 215 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 216 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 217 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 241 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 242 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 243 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 244 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 246 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 247 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 248 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 249 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 250 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 251 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 252 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 253 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 254 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 255 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 256 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 257 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 258 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 291 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 292 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 293 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 294 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 295 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 296 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 297 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 298 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.62 |
| Metatranscriptomes | 0 |
| Isolates | 0.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.88 |
| Nodule | 0.12 |
| Rhizoplane | 2.62 |
| Rhizosphere | 87.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_2609391 | 2162886006 | Unclassified | 1199 |
| 2 | SwRhRL3b_contig_4185416 | 2162886006 | Unclassified | 1048 |
| 3 | rootH1_10008880 | 3300003316 | Unclassified | 1745 |
| 4 | rootH1_10008880 | 3300003323 | Bacteria | 4627 |
| 5 | rootH2_10003802 | 3300003320 | Bacteria | 24313 |
| 6 | rootL2_10095019 | 3300003322 | Bacteria | 3199 |
| 7 | rootL2_10123247 | 3300003322 | Bacteria | 1101 |
| 8 | rootH1_10000797 | 3300003323 | Bacteria | 7755 |
| 9 | rootH1_10244250 | 3300003323 | Bacteria | 2402 |
| 10 | Ga0055525_1000013 | 3300003759 | Bacteria | 440870 |
| 11 | Ga0055526_1007082 | 3300003771 | Bacteria | 5924 |
| 12 | Ga0055531_10000154 | 3300003794 | Bacteria | 79686 |
| 13 | Ga0065707_10085706 | 3300005295 | Bacteria | 5948 |
| 14 | Ga0070658_10067994 | 3300005327 | Bacteria | 2912 |
| 15 | Ga0070658_10332657 | 3300005327 | Bacteria | 1298 |
| 16 | Ga0070658_10449313 | 3300005327 | Bacteria | 1110 |
| 17 | Ga0070676_10009973 | 3300005328 | Bacteria | 5141 |
| 18 | Ga0070676_10132958 | 3300005328 | Bacteria | 1575 |
| 19 | Ga0070683_100803399 | 3300005329 | Unclassified | 902 |
| 20 | Ga0070690_100272380 | 3300005330 | Bacteria | 1205 |
| 21 | Ga0070670_100078422 | 3300005331 | Bacteria | 2837 |
| 22 | Ga0070670_100227308 | 3300005331 | Bacteria | 1624 |
| 23 | Ga0070670_100311155 | 3300005331 | Bacteria | 1379 |
| 24 | Ga0070670_100637608 | 3300005331 | Bacteria | 955 |
| 25 | Ga0070677_10063017 | 3300005333 | Bacteria | 1535 |
| 26 | Ga0068869_100110730 | 3300005334 | Bacteria | 2089 |
| 27 | Ga0068869_100149280 | 3300005334 | Bacteria | 1811 |
| 28 | Ga0068869_100155783 | 3300005334 | Unclassified | 1775 |
| 29 | Ga0068869_100263353 | 3300005334 | Bacteria | 1381 |
| 30 | Ga0068869_100495993 | 3300005334 | Unclassified | 1019 |
| 31 | Ga0070666_10000239 | 3300005335 | Bacteria | 37286 |
| 32 | Ga0070666_10003569 | 3300005335 | Bacteria | 9433 |
| 33 | Ga0070666_10061313 | 3300005335 | Bacteria | 2547 |
| 34 | Ga0070666_10321439 | 3300005335 | Bacteria | 1104 |
| 35 | Ga0070682_100002961 | 3300005337 | Bacteria | 9427 |
| 36 | Ga0070682_100047495 | 3300005337 | Bacteria | 2669 |
| 37 | Ga0070682_100115377 | 3300005337 | Bacteria | 1796 |
| 38 | Ga0070682_100137504 | 3300005337 | Bacteria | 1661 |
| 39 | Ga0070682_100230852 | 3300005337 | Unclassified | 1323 |
| 40 | Ga0070682_100702491 | 3300005337 | Bacteria | 811 |
| 41 | Ga0068868_100059920 | 3300005338 | Bacteria | 3012 |
| 42 | Ga0068868_100094578 | 3300005338 | Bacteria | 2411 |
| 43 | Ga0068868_100720808 | 3300005338 | Bacteria | 894 |
| 44 | Ga0070689_100010836 | 3300005340 | Bacteria | 6516 |
| 45 | Ga0070689_100150054 | 3300005340 | Unclassified | 1879 |
| 46 | Ga0070689_100239616 | 3300005340 | Bacteria | 1493 |
| 47 | Ga0070689_100308589 | 3300005340 | Bacteria | 1319 |
| 48 | Ga0070689_100500300 | 3300005340 | Bacteria | 1041 |
| 49 | Ga0070689_100530814 | 3300005340 | Bacteria | 1012 |
| 50 | Ga0070689_100641570 | 3300005340 | Bacteria | 923 |
| 51 | Ga0070691_10494791 | 3300005341 | Unclassified | 706 |
| 52 | Ga0070687_100651501 | 3300005343 | Bacteria | 730 |
| 53 | Ga0070661_100051593 | 3300005344 | Bacteria | 3011 |
| 54 | Ga0070661_100064639 | 3300005344 | Bacteria | 2689 |
| 55 | Ga0070661_100168221 | 3300005344 | Bacteria | 1664 |
| 56 | Ga0070661_100916433 | 3300005344 | Unclassified | 724 |
| 57 | Ga0070668_100024849 | 3300005347 | Bacteria | 4541 |
| 58 | Ga0070668_100203751 | 3300005347 | Bacteria | 1625 |
| 59 | Ga0070668_100289790 | 3300005347 | Bacteria | 1370 |
| 60 | Ga0070668_100501690 | 3300005347 | Bacteria | 1051 |
| 61 | Ga0070668_100921229 | 3300005347 | Bacteria | 782 |
| 62 | Ga0070669_100134161 | 3300005353 | Bacteria | 1903 |
| 63 | Ga0070669_100616081 | 3300005353 | Bacteria | 910 |
| 64 | Ga0070675_100037736 | 3300005354 | Bacteria | 3937 |
| 65 | Ga0070675_100058746 | 3300005354 | Bacteria | 3172 |
| 66 | Ga0070675_100091367 | 3300005354 | Bacteria | 2550 |
| 67 | Ga0070675_100139446 | 3300005354 | Bacteria | 2072 |
| 68 | Ga0070675_100291673 | 3300005354 | Bacteria | 1436 |
| 69 | Ga0070675_100998002 | 3300005354 | Bacteria | 769 |
| 70 | Ga0070671_100000727 | 3300005355 | Bacteria | 23552 |
| 71 | Ga0070671_100062046 | 3300005355 | Bacteria | 3113 |
| 72 | Ga0070671_100184556 | 3300005355 | Bacteria | 1767 |
| 73 | Ga0070673_100103082 | 3300005364 | Bacteria | 2353 |
| 74 | Ga0070673_100257380 | 3300005364 | Bacteria | 1523 |
| 75 | Ga0070673_100321176 | 3300005364 | Bacteria | 1367 |
| 76 | Ga0070673_100443395 | 3300005364 | Bacteria | 1167 |
| 77 | Ga0070673_100726957 | 3300005364 | Bacteria | 913 |
| 78 | Ga0070688_100152351 | 3300005365 | Unclassified | 1581 |
| 79 | Ga0070688_100232118 | 3300005365 | Bacteria | 1306 |
| 80 | Ga0070688_100241554 | 3300005365 | Bacteria | 1282 |
| 81 | Ga0070688_100358850 | 3300005365 | Bacteria | 1069 |
| 82 | Ga0070688_100624940 | 3300005365 | Unclassified | 827 |
| 83 | Ga0070667_100029948 | 3300005367 | Bacteria | 4539 |
| 84 | Ga0070667_100071416 | 3300005367 | Bacteria | 2956 |
| 85 | Ga0070667_100100676 | 3300005367 | Bacteria | 2496 |
| 86 | Ga0070667_100143690 | 3300005367 | Bacteria | 2091 |
| 87 | Ga0070667_100192445 | 3300005367 | Bacteria | 1807 |
| 88 | Ga0070667_100437590 | 3300005367 | Unclassified | 1194 |
| 89 | Ga0070667_100591404 | 3300005367 | Bacteria | 1022 |
| 90 | Ga0070709_10268313 | 3300005434 | Bacteria | 1236 |
| 91 | Ga0070713_100022634 | 3300005436 | Bacteria | 4859 |
| 92 | Ga0070710_10156140 | 3300005437 | Bacteria | 1411 |
| 93 | Ga0070701_10017426 | 3300005438 | Bacteria | 3356 |
| 94 | Ga0070701_10172989 | 3300005438 | Bacteria | 1259 |
| 95 | Ga0070711_100132225 | 3300005439 | Bacteria | 1860 |
| 96 | Ga0070711_100258179 | 3300005439 | Bacteria | 1370 |
| 97 | Ga0070711_100622853 | 3300005439 | Bacteria | 902 |
| 98 | Ga0070700_100013808 | 3300005441 | Bacteria | 4544 |
| 99 | Ga0070700_100022106 | 3300005441 | Bacteria | 3705 |
| 100 | Ga0070694_100256003 | 3300005444 | Bacteria | 1326 |
| 101 | Ga0070694_100793912 | 3300005444 | Unclassified | 776 |
| 102 | Ga0070663_100005805 | 3300005455 | Bacteria | 7373 |
| 103 | Ga0070663_100027649 | 3300005455 | Bacteria | 3853 |
| 104 | Ga0070663_100173728 | 3300005455 | Bacteria | 1667 |
| 105 | Ga0070663_100322822 | 3300005455 | Unclassified | 1242 |
| 106 | Ga0070663_100437979 | 3300005455 | Bacteria | 1075 |
| 107 | Ga0070678_100025465 | 3300005456 | Bacteria | 3980 |
| 108 | Ga0070678_100041542 | 3300005456 | Bacteria | 3261 |
| 109 | Ga0070678_100064409 | 3300005456 | Bacteria | 2717 |
| 110 | Ga0070678_100120737 | 3300005456 | Bacteria | 2066 |
| 111 | Ga0070678_100132854 | 3300005456 | Bacteria | 1980 |
| 112 | Ga0070662_100008323 | 3300005457 | Bacteria | 6759 |
| 113 | Ga0070662_100022542 | 3300005457 | Bacteria | 4313 |
| 114 | Ga0070662_100118024 | 3300005457 | Bacteria | 2030 |
| 115 | Ga0068867_100022629 | 3300005459 | Bacteria | 4494 |
| 116 | Ga0068867_100025240 | 3300005459 | Bacteria | 4263 |
| 117 | Ga0068867_100090222 | 3300005459 | Bacteria | 2325 |
| 118 | Ga0068867_100130729 | 3300005459 | Bacteria | 1951 |
| 119 | Ga0068867_100334027 | 3300005459 | Bacteria | 1260 |
| 120 | Ga0068867_100338004 | 3300005459 | Bacteria | 1253 |
| 121 | Ga0070685_10061807 | 3300005466 | Bacteria | 2194 |
| 122 | Ga0070685_10183743 | 3300005466 | Bacteria | 1348 |
| 123 | Ga0070685_10363955 | 3300005466 | Unclassified | 992 |
| 124 | Ga0070679_100053216 | 3300005530 | Bacteria | 4030 |
| 125 | Ga0070679_100062616 | 3300005530 | Bacteria | 3709 |
| 126 | Ga0070684_100340026 | 3300005535 | Bacteria | 1380 |
| 127 | Ga0068853_100240992 | 3300005539 | Bacteria | 1657 |
| 128 | Ga0068853_100360339 | 3300005539 | Bacteria | 1354 |
| 129 | Ga0070672_100010396 | 3300005543 | Bacteria | 6455 |
| 130 | Ga0070672_100016046 | 3300005543 | Bacteria | 5354 |
| 131 | Ga0070672_100026815 | 3300005543 | Bacteria | 4293 |
| 132 | Ga0070672_100048540 | 3300005543 | Bacteria | 3299 |
| 133 | Ga0070672_100219683 | 3300005543 | Bacteria | 1594 |
| 134 | Ga0070672_100304032 | 3300005543 | Bacteria | 1353 |
| 135 | Ga0070686_100015956 | 3300005544 | Bacteria | 4362 |
| 136 | Ga0070686_100095023 | 3300005544 | Bacteria | 2002 |
| 137 | Ga0070686_100258195 | 3300005544 | Bacteria | 1276 |
| 138 | Ga0070665_100000283 | 3300005548 | Bacteria | 82138 |
| 139 | Ga0070665_100008331 | 3300005548 | Bacteria | 10484 |
| 140 | Ga0070665_100011239 | 3300005548 | Bacteria | 9052 |
| 141 | Ga0070665_100025117 | 3300005548 | Bacteria | 6003 |
| 142 | Ga0070665_100044691 | 3300005548 | Bacteria | 4448 |
| 143 | Ga0070665_100073673 | 3300005548 | Bacteria | 3420 |
| 144 | Ga0070665_100163954 | 3300005548 | Bacteria | 2225 |
| 145 | Ga0070665_100229410 | 3300005548 | Bacteria | 1857 |
| 146 | Ga0070665_100363777 | 3300005548 | Bacteria | 1453 |
| 147 | Ga0070665_100437813 | 3300005548 | Bacteria | 1316 |
| 148 | Ga0070665_100453655 | 3300005548 | Bacteria | 1292 |
| 149 | Ga0068855_100035915 | 3300005563 | Bacteria | 5902 |
| 150 | Ga0068855_100175572 | 3300005563 | Bacteria | 2424 |
| 151 | Ga0068855_100436725 | 3300005563 | Bacteria | 1430 |
| 152 | Ga0070664_100014517 | 3300005564 | Bacteria | 6424 |
| 153 | Ga0070664_100318947 | 3300005564 | Bacteria | 1408 |
| 154 | Ga0070664_100611496 | 3300005564 | Unclassified | 1011 |
| 155 | Ga0068857_100042281 | 3300005577 | Bacteria | 4042 |
| 156 | Ga0068857_100174834 | 3300005577 | Bacteria | 1953 |
| 157 | Ga0068857_100855020 | 3300005577 | Bacteria | 871 |
| 158 | Ga0068857_101322220 | 3300005577 | Bacteria | 700 |
| 159 | Ga0068854_100001633 | 3300005578 | Bacteria | 13647 |
| 160 | Ga0068854_100009334 | 3300005578 | Bacteria | 6333 |
| 161 | Ga0068854_100057180 | 3300005578 | Bacteria | 2813 |
| 162 | Ga0068854_100229976 | 3300005578 | Bacteria | 1471 |
| 163 | Ga0068854_100766937 | 3300005578 | Bacteria | 838 |
| 164 | Ga0068856_100050403 | 3300005614 | Bacteria | 4104 |
| 165 | Ga0068856_100215261 | 3300005614 | Unclassified | 1936 |
| 166 | Ga0068856_100608688 | 3300005614 | Bacteria | 1113 |
| 167 | Ga0068856_100797058 | 3300005614 | Bacteria | 964 |
| 168 | Ga0070702_100011956 | 3300005615 | Bacteria | 4333 |
| 169 | Ga0070702_100374767 | 3300005615 | Bacteria | 1010 |
| 170 | Ga0070702_100392047 | 3300005615 | Bacteria | 991 |
| 171 | Ga0068852_100026314 | 3300005616 | Bacteria | 4727 |
| 172 | Ga0068852_100147859 | 3300005616 | Bacteria | 2181 |
| 173 | Ga0068852_100443087 | 3300005616 | Bacteria | 1284 |
| 174 | Ga0068852_101016960 | 3300005616 | Unclassified | 848 |
| 175 | Ga0068859_100015604 | 3300005617 | Bacteria | 7633 |
| 176 | Ga0068859_100160391 | 3300005617 | Bacteria | 2328 |
| 177 | Ga0068859_100284369 | 3300005617 | Bacteria | 1747 |
| 178 | Ga0068859_100305773 | 3300005617 | Bacteria | 1683 |
| 179 | Ga0068859_100366986 | 3300005617 | Bacteria | 1535 |
| 180 | Ga0068859_101174319 | 3300005617 | Bacteria | 845 |
| 181 | Ga0068864_100102696 | 3300005618 | Bacteria | 2537 |
| 182 | Ga0068864_100185145 | 3300005618 | Bacteria | 1906 |
| 183 | Ga0068864_100247640 | 3300005618 | Unclassified | 1653 |
| 184 | Ga0068864_100265858 | 3300005618 | Unclassified | 1597 |
| 185 | Ga0068866_10207352 | 3300005718 | Bacteria | 1174 |
| 186 | Ga0068866_10222703 | 3300005718 | Bacteria | 1139 |
| 187 | Ga0068866_10352125 | 3300005718 | Bacteria | 936 |
| 188 | Ga0068861_100006072 | 3300005719 | Bacteria | 8214 |
| 189 | Ga0068861_100007372 | 3300005719 | Bacteria | 7537 |
| 190 | Ga0068861_100134761 | 3300005719 | Bacteria | 2008 |
| 191 | Ga0068861_100164035 | 3300005719 | Bacteria | 1835 |
| 192 | Ga0068861_100198619 | 3300005719 | Bacteria | 1682 |
| 193 | Ga0068861_100463860 | 3300005719 | Bacteria | 1138 |
| 194 | Ga0068851_10001629 | 3300005834 | Bacteria | 9843 |
| 195 | Ga0068851_10001806 | 3300005834 | Bacteria | 9368 |
| 196 | Ga0068851_10098068 | 3300005834 | Bacteria | 1551 |
| 197 | Ga0068870_10001457 | 3300005840 | Bacteria | 9574 |
| 198 | Ga0068870_10191787 | 3300005840 | Bacteria | 1233 |
| 199 | Ga0068863_100001082 | 3300005841 | Bacteria | 27269 |
| 200 | Ga0068863_100004356 | 3300005841 | Bacteria | 13950 |
| 201 | Ga0068863_100110088 | 3300005841 | Bacteria | 2623 |
| 202 | Ga0068863_100128289 | 3300005841 | Bacteria | 2420 |
| 203 | Ga0068863_100146756 | 3300005841 | Bacteria | 2256 |
| 204 | Ga0068863_100197202 | 3300005841 | Bacteria | 1935 |
| 205 | Ga0068863_100234424 | 3300005841 | Bacteria | 1771 |
| 206 | Ga0068863_100284907 | 3300005841 | Bacteria | 1601 |
| 207 | Ga0068863_100434000 | 3300005841 | Unclassified | 1288 |
| 208 | Ga0068863_100563052 | 3300005841 | Viruses | 1126 |
| 209 | Ga0068858_100000101 | 3300005842 | Bacteria | 89093 |
| 210 | Ga0068858_100000991 | 3300005842 | Bacteria | 29310 |
| 211 | Ga0068858_100003283 | 3300005842 | Bacteria | 16113 |
| 212 | Ga0068858_100016218 | 3300005842 | Bacteria | 6999 |
| 213 | Ga0068858_100030767 | 3300005842 | Bacteria | 4985 |
| 214 | Ga0068858_100046651 | 3300005842 | Bacteria | 4016 |
| 215 | Ga0068860_100000878 | 3300005843 | Bacteria | 33413 |
| 216 | Ga0068860_100018738 | 3300005843 | Bacteria | 6726 |
| 217 | Ga0068860_100021252 | 3300005843 | Bacteria | 6286 |
| 218 | Ga0068860_100201894 | 3300005843 | Unclassified | 1927 |
| 219 | Ga0068860_100323812 | 3300005843 | Unclassified | 1513 |
| 220 | Ga0068860_100580491 | 3300005843 | Bacteria | 1125 |
| 221 | Ga0068862_100028773 | 3300005844 | Unclassified | 4680 |
| 222 | Ga0068862_100057971 | 3300005844 | Bacteria | 3322 |
| 223 | Ga0068862_100168931 | 3300005844 | Bacteria | 1957 |
| 224 | Ga0068862_100456597 | 3300005844 | Unclassified | 1205 |
| 225 | Ga0068862_100482419 | 3300005844 | Bacteria | 1174 |
| 226 | Ga0068862_100503374 | 3300005844 | Bacteria | 1150 |
| 227 | Ga0081455_10005653 | 3300005937 | Bacteria | 13650 |
| 228 | Ga0070717_10000038 | 3300006028 | Bacteria | 119189 |
| 229 | Ga0070717_10049927 | 3300006028 | Bacteria | 3436 |
| 230 | Ga0070715_10507707 | 3300006163 | Bacteria | 691 |
| 231 | Ga0097621_100056808 | 3300006237 | Bacteria | 3198 |
| 232 | Ga0097621_100071442 | 3300006237 | Bacteria | 2868 |
| 233 | Ga0097621_100156877 | 3300006237 | Bacteria | 1954 |
| 234 | Ga0097621_100203097 | 3300006237 | Bacteria | 1721 |
| 235 | Ga0097621_100214882 | 3300006237 | Bacteria | 1674 |
| 236 | Ga0097621_100235552 | 3300006237 | Bacteria | 1599 |
| 237 | Ga0097621_100366002 | 3300006237 | Bacteria | 1285 |
| 238 | Ga0068871_100069852 | 3300006358 | Bacteria | 2885 |
| 239 | Ga0068871_100082681 | 3300006358 | Bacteria | 2663 |
| 240 | Ga0068871_100103159 | 3300006358 | Unclassified | 2391 |
| 241 | Ga0068871_100119081 | 3300006358 | Bacteria | 2228 |
| 242 | Ga0068871_100132092 | 3300006358 | Bacteria | 2117 |
| 243 | Ga0068871_100149280 | 3300006358 | Bacteria | 1992 |
| 244 | Ga0068871_100332048 | 3300006358 | Bacteria | 1341 |
| 245 | Ga0068871_100468342 | 3300006358 | Bacteria | 1132 |
| 246 | Ga0075428_100017573 | 3300006844 | Bacteria | 7900 |
| 247 | Ga0075431_100000257 | 3300006847 | Bacteria | 40664 |
| 248 | Ga0075429_100001404 | 3300006880 | Bacteria | 19710 |
| 249 | Ga0075429_100886461 | 3300006880 | Bacteria | 781 |
| 250 | Ga0068865_100004141 | 3300006881 | Bacteria | 8718 |
| 251 | Ga0068865_100010271 | 3300006881 | Bacteria | 5823 |
| 252 | Ga0068865_100013736 | 3300006881 | Bacteria | 5129 |
| 253 | Ga0068865_100056466 | 3300006881 | Bacteria | 2735 |
| 254 | Ga0068865_100133055 | 3300006881 | Bacteria | 1865 |
| 255 | Ga0068865_100298502 | 3300006881 | Bacteria | 1288 |
| 256 | Ga0068865_100341125 | 3300006881 | Bacteria | 1211 |
| 257 | Ga0068865_100932667 | 3300006881 | Bacteria | 757 |
| 258 | Ga0097620_100015605 | 3300006931 | Bacteria | 7633 |
| 259 | Ga0097620_100160396 | 3300006931 | Bacteria | 2328 |
| 260 | Ga0097620_100284371 | 3300006931 | Bacteria | 1747 |
| 261 | Ga0097620_100305777 | 3300006931 | Bacteria | 1683 |
| 262 | Ga0097620_100366991 | 3300006931 | Bacteria | 1535 |
| 263 | Ga0097620_100688829 | 3300006931 | Bacteria | 1113 |
| 264 | Ga0097620_101174762 | 3300006931 | Bacteria | 845 |
| 265 | Ga0105240_10000243 | 3300009093 | Bacteria | 107903 |
| 266 | Ga0105240_10018068 | 3300009093 | Bacteria | 9481 |
| 267 | Ga0105240_10057832 | 3300009093 | Bacteria | 4842 |
| 268 | Ga0105240_10103314 | 3300009093 | Bacteria | 3463 |
| 269 | Ga0105240_10223878 | 3300009093 | Bacteria | 2190 |
| 270 | Ga0105240_10423493 | 3300009093 | Bacteria | 1495 |
| 271 | Ga0105240_11211215 | 3300009093 | Bacteria | 799 |
| 272 | Ga0111539_10016527 | 3300009094 | Bacteria | 9146 |
| 273 | Ga0111539_10088809 | 3300009094 | Bacteria | 3631 |
| 274 | Ga0111539_10209204 | 3300009094 | Bacteria | 2273 |
| 275 | Ga0111539_10295919 | 3300009094 | Unclassified | 1884 |
| 276 | Ga0105245_11187890 | 3300009098 | Bacteria | 811 |
| 277 | Ga0105247_10000743 | 3300009101 | Bacteria | 25155 |
| 278 | Ga0105247_10097127 | 3300009101 | Bacteria | 1879 |
| 279 | Ga0114129_10002305 | 3300009147 | Bacteria | 26465 |
| 280 | Ga0105243_10374074 | 3300009148 | Bacteria | 1315 |
| 281 | Ga0105243_10382283 | 3300009148 | Bacteria | 1303 |
| 282 | Ga0105241_10010519 | 3300009174 | Bacteria | 6788 |
| 283 | Ga0105241_10048725 | 3300009174 | Bacteria | 3225 |
| 284 | Ga0105241_10079670 | 3300009174 | Bacteria | 2562 |
| 285 | Ga0105241_10613843 | 3300009174 | Bacteria | 984 |
| 286 | Ga0105242_10000796 | 3300009176 | Bacteria | 24434 |
| 287 | Ga0105242_10222059 | 3300009176 | Unclassified | 1689 |
| 288 | Ga0105242_10246527 | 3300009176 | Bacteria | 1608 |
| 289 | Ga0105242_10309207 | 3300009176 | Unclassified | 1445 |
| 290 | Ga0105248_10021102 | 3300009177 | Bacteria | 7217 |
| 291 | Ga0105248_10161297 | 3300009177 | Bacteria | 2529 |
| 292 | Ga0105248_10170358 | 3300009177 | Bacteria | 2454 |
| 293 | Ga0105248_10224910 | 3300009177 | Bacteria | 2112 |
| 294 | Ga0105248_10492867 | 3300009177 | Bacteria | 1381 |
| 295 | Ga0105237_10028008 | 3300009545 | Bacteria | 5741 |
| 296 | Ga0105237_10105815 | 3300009545 | Bacteria | 2805 |
| 297 | Ga0105237_10281952 | 3300009545 | Bacteria | 1664 |
| 298 | Ga0105237_10755455 | 3300009545 | Unclassified | 979 |
| 299 | Ga0105238_10002571 | 3300009551 | Bacteria | 18109 |
| 300 | Ga0105238_10024347 | 3300009551 | Bacteria | 6171 |
| 301 | Ga0105238_10037280 | 3300009551 | Bacteria | 4943 |
| 302 | Ga0105238_10074486 | 3300009551 | Bacteria | 3388 |
| 303 | Ga0105238_10330985 | 3300009551 | Bacteria | 1510 |
| 304 | Ga0105238_10331969 | 3300009551 | Bacteria | 1508 |
| 305 | Ga0105238_10484683 | 3300009551 | Bacteria | 1236 |
| 306 | Ga0105249_10002100 | 3300009553 | Bacteria | 17282 |
| 307 | Ga0105249_10104444 | 3300009553 | Bacteria | 2670 |
| 308 | Ga0105249_10119239 | 3300009553 | Bacteria | 2505 |
| 309 | Ga0105249_10152735 | 3300009553 | Bacteria | 2224 |
| 310 | Ga0105249_10293143 | 3300009553 | Bacteria | 1629 |
| 311 | Ga0105249_10429312 | 3300009553 | Bacteria | 1357 |
| 312 | Ga0105249_10566131 | 3300009553 | Bacteria | 1188 |
| 313 | Ga0105239_10006656 | 3300010375 | Bacteria | 13367 |
| 314 | Ga0105239_10230454 | 3300010375 | Bacteria | 2078 |
| 315 | Ga0105239_10412875 | 3300010375 | Bacteria | 1529 |
| 316 | Ga0105239_10994680 | 3300010375 | Bacteria | 964 |
| 317 | Ga0157369_10000001 | 3300013105 | Bacteria | 554908 |
| 318 | Ga0157369_10046965 | 3300013105 | Bacteria | 4690 |
| 319 | Ga0157374_10087355 | 3300013296 | Bacteria | 2968 |
| 320 | Ga0157374_10110385 | 3300013296 | Bacteria | 2645 |
| 321 | Ga0157374_10186692 | 3300013296 | Bacteria | 2027 |
| 322 | Ga0157374_10250319 | 3300013296 | Bacteria | 1743 |
| 323 | Ga0157374_10660485 | 3300013296 | Bacteria | 1057 |
| 324 | Ga0163162_10019083 | 3300013306 | Bacteria | 6724 |
| 325 | Ga0163162_10030020 | 3300013306 | Bacteria | 5383 |
| 326 | Ga0163162_10089462 | 3300013306 | Bacteria | 3159 |
| 327 | Ga0163162_10169995 | 3300013306 | Bacteria | 2304 |
| 328 | Ga0163162_10205445 | 3300013306 | Bacteria | 2099 |
| 329 | Ga0163162_10770703 | 3300013306 | Unclassified | 1080 |
| 330 | Ga0163162_11396262 | 3300013306 | Bacteria | 797 |
| 331 | Ga0157372_10134437 | 3300013307 | Bacteria | 2847 |
| 332 | Ga0157372_10294252 | 3300013307 | Bacteria | 1888 |
| 333 | Ga0157375_10000342 | 3300013308 | Bacteria | 42091 |
| 334 | Ga0157375_10004701 | 3300013308 | Bacteria | 11887 |
| 335 | Ga0157375_10018865 | 3300013308 | Bacteria | 6262 |
| 336 | Ga0157375_10413367 | 3300013308 | Bacteria | 1515 |
| 337 | Ga0157375_10680513 | 3300013308 | Unclassified | 1183 |
| 338 | Ga0157375_11035011 | 3300013308 | Bacteria | 959 |
| 339 | Ga0163163_10043577 | 3300014325 | Bacteria | 4400 |
| 340 | Ga0163163_10738004 | 3300014325 | Unclassified | 1048 |
| 341 | Ga0157380_10004887 | 3300014326 | Bacteria | 9338 |
| 342 | Ga0157380_10127130 | 3300014326 | Bacteria | 2168 |
| 343 | Ga0157380_10133286 | 3300014326 | Bacteria | 2123 |
| 344 | Ga0157380_10166658 | 3300014326 | Bacteria | 1921 |
| 345 | Ga0157380_10237221 | 3300014326 | Bacteria | 1642 |
| 346 | Ga0157379_10071283 | 3300014968 | Bacteria | 3109 |
| 347 | Ga0157379_10162183 | 3300014968 | Bacteria | 2018 |
| 348 | Ga0157379_10706706 | 3300014968 | Bacteria | 946 |
| 349 | Ga0157376_10002154 | 3300014969 | Bacteria | 13258 |
| 350 | Ga0157376_10038493 | 3300014969 | Bacteria | 3891 |
| 351 | Ga0157376_10057121 | 3300014969 | Bacteria | 3263 |
| 352 | Ga0157376_10074912 | 3300014969 | Bacteria | 2887 |
| 353 | Ga0157376_10195729 | 3300014969 | Bacteria | 1857 |
| 354 | Ga0157376_10233686 | 3300014969 | Bacteria | 1709 |
| 355 | Ga0157376_10426574 | 3300014969 | Bacteria | 1288 |
| 356 | Ga0157376_10498435 | 3300014969 | Bacteria | 1196 |
| 357 | Ga0163161_10524622 | 3300017792 | Bacteria | 968 |
| 358 | Ga0213872_10000085 | 3300021361 | Bacteria | 85496 |
| 359 | Ga0209674_112304 | 3300025226 | Bacteria | 839 |
| 360 | Ga0209563_100025 | 3300025230 | Bacteria | 596456 |
| 361 | Ga0209233_1007840 | 3300025261 | Bacteria | 3350 |
| 362 | Ga0209673_1017194 | 3300025273 | Bacteria | 2672 |
| 363 | Ga0209564_1000097 | 3300025295 | Bacteria | 231436 |
| 364 | Ga0209050_1002369 | 3300025298 | Bacteria | 16384 |
| 365 | Ga0209051_1003041 | 3300025303 | Bacteria | 11345 |
| 366 | Ga0209257_1000016 | 3300025304 | Bacteria | 908015 |
| 367 | Ga0209257_1021170 | 3300025304 | Bacteria | 2373 |
| 368 | Ga0207656_10000407 | 3300025321 | Bacteria | 14423 |
| 369 | Ga0207656_10007696 | 3300025321 | Bacteria | 3938 |
| 370 | Ga0207656_10140059 | 3300025321 | Bacteria | 1140 |
| 371 | Ga0207682_10005406 | 3300025893 | Bacteria | 5201 |
| 372 | Ga0207692_10080365 | 3300025898 | Bacteria | 1742 |
| 373 | Ga0207710_10000510 | 3300025900 | Bacteria | 24240 |
| 374 | Ga0207710_10166097 | 3300025900 | Unclassified | 1077 |
| 375 | Ga0207680_10002251 | 3300025903 | Bacteria | 9006 |
| 376 | Ga0207680_10039871 | 3300025903 | Bacteria | 2728 |
| 377 | Ga0207680_10181017 | 3300025903 | Bacteria | 1425 |
| 378 | Ga0207647_10000075 | 3300025904 | Bacteria | 76289 |
| 379 | Ga0207647_10005480 | 3300025904 | Bacteria | 9289 |
| 380 | Ga0207685_10114313 | 3300025905 | Unclassified | 1175 |
| 381 | Ga0207685_10415554 | 3300025905 | Bacteria | 692 |
| 382 | Ga0207699_10085166 | 3300025906 | Bacteria | 1970 |
| 383 | Ga0207645_10026936 | 3300025907 | Bacteria | 3715 |
| 384 | Ga0207643_10012952 | 3300025908 | Bacteria | 4510 |
| 385 | Ga0207643_10054590 | 3300025908 | Bacteria | 2271 |
| 386 | Ga0207705_10016092 | 3300025909 | Bacteria | 5368 |
| 387 | Ga0207654_10042683 | 3300025911 | Bacteria | 2568 |
| 388 | Ga0207654_10173108 | 3300025911 | Bacteria | 1403 |
| 389 | Ga0207654_10319681 | 3300025911 | Bacteria | 1061 |
| 390 | Ga0207695_10007103 | 3300025913 | Bacteria | 14345 |
| 391 | Ga0207695_10022225 | 3300025913 | Bacteria | 7212 |
| 392 | Ga0207695_10022274 | 3300025913 | Bacteria | 7201 |
| 393 | Ga0207695_10087629 | 3300025913 | Bacteria | 3136 |
| 394 | Ga0207695_10111236 | 3300025913 | Unclassified | 2718 |
| 395 | Ga0207695_10123568 | 3300025913 | Bacteria | 2554 |
| 396 | Ga0207695_10806897 | 3300025913 | Unclassified | 818 |
| 397 | Ga0207671_10002096 | 3300025914 | Bacteria | 21815 |
| 398 | Ga0207671_10002882 | 3300025914 | Bacteria | 17809 |
| 399 | Ga0207671_10015791 | 3300025914 | Bacteria | 5894 |
| 400 | Ga0207671_10033854 | 3300025914 | Bacteria | 3799 |
| 401 | Ga0207671_10038094 | 3300025914 | Bacteria | 3564 |
| 402 | Ga0207671_10062103 | 3300025914 | Bacteria | 2774 |
| 403 | Ga0207671_10261972 | 3300025914 | Bacteria | 1361 |
| 404 | Ga0207649_10041909 | 3300025920 | Bacteria | 2790 |
| 405 | Ga0207649_10114042 | 3300025920 | Bacteria | 1811 |
| 406 | Ga0207649_10569437 | 3300025920 | Unclassified | 869 |
| 407 | Ga0207652_10039167 | 3300025921 | Bacteria | 4022 |
| 408 | Ga0207652_10046335 | 3300025921 | Bacteria | 3710 |
| 409 | Ga0207681_10018449 | 3300025923 | Bacteria | 4396 |
| 410 | Ga0207694_10000784 | 3300025924 | Bacteria | 28556 |
| 411 | Ga0207694_10003412 | 3300025924 | Bacteria | 12649 |
| 412 | Ga0207694_10003581 | 3300025924 | Bacteria | 12319 |
| 413 | Ga0207694_10005868 | 3300025924 | Bacteria | 9412 |
| 414 | Ga0207694_10218158 | 3300025924 | Bacteria | 1555 |
| 415 | Ga0207694_10486284 | 3300025924 | Unclassified | 1033 |
| 416 | Ga0207650_10037643 | 3300025925 | Bacteria | 3527 |
| 417 | Ga0207650_10068382 | 3300025925 | Bacteria | 2667 |
| 418 | Ga0207650_10156575 | 3300025925 | Bacteria | 1802 |
| 419 | Ga0207650_10186750 | 3300025925 | Bacteria | 1654 |
| 420 | Ga0207659_10045020 | 3300025926 | Bacteria | 3108 |
| 421 | Ga0207659_10115488 | 3300025926 | Bacteria | 2048 |
| 422 | Ga0207659_10117147 | 3300025926 | Bacteria | 2035 |
| 423 | Ga0207644_10000910 | 3300025931 | Bacteria | 18751 |
| 424 | Ga0207644_10179204 | 3300025931 | Bacteria | 1660 |
| 425 | Ga0207644_10552545 | 3300025931 | Bacteria | 953 |
| 426 | Ga0207706_10004965 | 3300025933 | Bacteria | 12434 |
| 427 | Ga0207706_10018566 | 3300025933 | Bacteria | 6258 |
| 428 | Ga0207706_10032026 | 3300025933 | Bacteria | 4684 |
| 429 | Ga0207706_10053512 | 3300025933 | Bacteria | 3563 |
| 430 | Ga0207706_10068854 | 3300025933 | Bacteria | 3113 |
| 431 | Ga0207706_10125507 | 3300025933 | Bacteria | 2257 |
| 432 | Ga0207706_10381431 | 3300025933 | Bacteria | 1223 |
| 433 | Ga0207686_10074082 | 3300025934 | Bacteria | 2199 |
| 434 | Ga0207686_10287598 | 3300025934 | Bacteria | 1216 |
| 435 | Ga0207709_10145941 | 3300025935 | Bacteria | 1632 |
| 436 | Ga0207670_10007470 | 3300025936 | Bacteria | 6098 |
| 437 | Ga0207670_10071145 | 3300025936 | Unclassified | 2405 |
| 438 | Ga0207670_10197307 | 3300025936 | Bacteria | 1527 |
| 439 | Ga0207670_10434456 | 3300025936 | Bacteria | 1056 |
| 440 | Ga0207669_10216422 | 3300025937 | Bacteria | 1402 |
| 441 | Ga0207704_10022303 | 3300025938 | Bacteria | 3390 |
| 442 | Ga0207704_10032099 | 3300025938 | Bacteria | 2967 |
| 443 | Ga0207704_10080080 | 3300025938 | Bacteria | 2107 |
| 444 | Ga0207704_10260073 | 3300025938 | Bacteria | 1308 |
| 445 | Ga0207704_10281455 | 3300025938 | Bacteria | 1264 |
| 446 | Ga0207691_10008149 | 3300025940 | Bacteria | 10057 |
| 447 | Ga0207691_10043483 | 3300025940 | Bacteria | 4140 |
| 448 | Ga0207691_10073960 | 3300025940 | Bacteria | 3074 |
| 449 | Ga0207691_10157723 | 3300025940 | Bacteria | 1992 |
| 450 | Ga0207691_10297280 | 3300025940 | Bacteria | 1387 |
| 451 | Ga0207691_10432076 | 3300025940 | Bacteria | 1121 |
| 452 | Ga0207711_10059660 | 3300025941 | Bacteria | 3285 |
| 453 | Ga0207711_10156947 | 3300025941 | Bacteria | 2057 |
| 454 | Ga0207711_10514909 | 3300025941 | Bacteria | 1115 |
| 455 | Ga0207689_10029034 | 3300025942 | Bacteria | 4623 |
| 456 | Ga0207689_10110436 | 3300025942 | Bacteria | 2260 |
| 457 | Ga0207689_10132202 | 3300025942 | Unclassified | 2054 |
| 458 | Ga0207689_10227515 | 3300025942 | Unclassified | 1542 |
| 459 | Ga0207689_10248253 | 3300025942 | Bacteria | 1472 |
| 460 | Ga0207689_10487671 | 3300025942 | Bacteria | 1032 |
| 461 | Ga0207689_10655053 | 3300025942 | Unclassified | 885 |
| 462 | Ga0207679_10374664 | 3300025945 | Bacteria | 1246 |
| 463 | Ga0207679_10658934 | 3300025945 | Unclassified | 947 |
| 464 | Ga0207667_10249497 | 3300025949 | Bacteria | 1816 |
| 465 | Ga0207667_10641997 | 3300025949 | Bacteria | 1068 |
| 466 | Ga0207667_10718450 | 3300025949 | Bacteria | 1000 |
| 467 | Ga0207667_11294703 | 3300025949 | Unclassified | 705 |
| 468 | Ga0207651_10136050 | 3300025960 | Bacteria | 1890 |
| 469 | Ga0207651_10169581 | 3300025960 | Bacteria | 1720 |
| 470 | Ga0207651_10176609 | 3300025960 | Bacteria | 1690 |
| 471 | Ga0207712_10000211 | 3300025961 | Bacteria | 58110 |
| 472 | Ga0207712_10003217 | 3300025961 | Bacteria | 10379 |
| 473 | Ga0207712_10027904 | 3300025961 | Bacteria | 3772 |
| 474 | Ga0207712_10061496 | 3300025961 | Bacteria | 2665 |
| 475 | Ga0207712_10095613 | 3300025961 | Bacteria | 2197 |
| 476 | Ga0207712_10173600 | 3300025961 | Bacteria | 1687 |
| 477 | Ga0207668_10184956 | 3300025972 | Bacteria | 1646 |
| 478 | Ga0207668_10207424 | 3300025972 | Bacteria | 1565 |
| 479 | Ga0207668_10227397 | 3300025972 | Bacteria | 1502 |
| 480 | Ga0207668_10356008 | 3300025972 | Bacteria | 1225 |
| 481 | Ga0207640_10013953 | 3300025981 | Bacteria | 4614 |
| 482 | Ga0207640_10020481 | 3300025981 | Bacteria | 3928 |
| 483 | Ga0207640_10189819 | 3300025981 | Bacteria | 1548 |
| 484 | Ga0207640_10722151 | 3300025981 | Bacteria | 856 |
| 485 | Ga0207658_10018494 | 3300025986 | Bacteria | 4812 |
| 486 | Ga0207658_10019618 | 3300025986 | Bacteria | 4677 |
| 487 | Ga0207658_10044849 | 3300025986 | Bacteria | 3220 |
| 488 | Ga0207658_10052688 | 3300025986 | Bacteria | 3003 |
| 489 | Ga0207658_10202547 | 3300025986 | Bacteria | 1658 |
| 490 | Ga0207658_10241078 | 3300025986 | Unclassified | 1532 |
| 491 | Ga0207658_10362843 | 3300025986 | Bacteria | 1264 |
| 492 | Ga0207658_10957605 | 3300025986 | Bacteria | 780 |
| 493 | Ga0207658_11029370 | 3300025986 | Unclassified | 751 |
| 494 | Ga0207677_10128239 | 3300026023 | Bacteria | 1921 |
| 495 | Ga0207703_10000180 | 3300026035 | Bacteria | 73584 |
| 496 | Ga0207703_10001490 | 3300026035 | Bacteria | 21362 |
| 497 | Ga0207703_10001805 | 3300026035 | Bacteria | 19093 |
| 498 | Ga0207703_10001858 | 3300026035 | Bacteria | 18776 |
| 499 | Ga0207703_10004699 | 3300026035 | Bacteria | 11153 |
| 500 | Ga0207703_10075965 | 3300026035 | Bacteria | 2786 |
| 501 | Ga0207639_10000209 | 3300026041 | Bacteria | 44317 |
| 502 | Ga0207639_10000602 | 3300026041 | Bacteria | 24789 |
| 503 | Ga0207639_10000836 | 3300026041 | Bacteria | 20877 |
| 504 | Ga0207639_10040192 | 3300026041 | Bacteria | 3489 |
| 505 | Ga0207639_10228512 | 3300026041 | Unclassified | 1611 |
| 506 | Ga0207639_10480427 | 3300026041 | Bacteria | 1132 |
| 507 | Ga0207678_10003270 | 3300026067 | Bacteria | 14620 |
| 508 | Ga0207678_10020169 | 3300026067 | Bacteria | 5853 |
| 509 | Ga0207678_10048413 | 3300026067 | Bacteria | 3674 |
| 510 | Ga0207678_10059818 | 3300026067 | Bacteria | 3278 |
| 511 | Ga0207678_10069374 | 3300026067 | Bacteria | 3022 |
| 512 | Ga0207678_10205120 | 3300026067 | Bacteria | 1686 |
| 513 | Ga0207708_10014631 | 3300026075 | Bacteria | 5871 |
| 514 | Ga0207708_10199468 | 3300026075 | Bacteria | 1596 |
| 515 | Ga0207702_10062232 | 3300026078 | Bacteria | 3186 |
| 516 | Ga0207702_10179396 | 3300026078 | Bacteria | 1949 |
| 517 | Ga0207702_10184420 | 3300026078 | Bacteria | 1924 |
| 518 | Ga0207702_10225507 | 3300026078 | Bacteria | 1748 |
| 519 | Ga0207702_10729830 | 3300026078 | Unclassified | 977 |
| 520 | Ga0207641_10000217 | 3300026088 | Bacteria | 74684 |
| 521 | Ga0207641_10003378 | 3300026088 | Bacteria | 14170 |
| 522 | Ga0207641_10065529 | 3300026088 | Bacteria | 3108 |
| 523 | Ga0207641_10081047 | 3300026088 | Bacteria | 2817 |
| 524 | Ga0207641_10155506 | 3300026088 | Bacteria | 2074 |
| 525 | Ga0207641_10278870 | 3300026088 | Bacteria | 1571 |
| 526 | Ga0207641_10283124 | 3300026088 | Bacteria | 1560 |
| 527 | Ga0207641_10427604 | 3300026088 | Bacteria | 1276 |
| 528 | Ga0207641_10429903 | 3300026088 | Unclassified | 1273 |
| 529 | Ga0207641_10546460 | 3300026088 | Unclassified | 1129 |
| 530 | Ga0207641_10696100 | 3300026088 | Bacteria | 1000 |
| 531 | Ga0207641_10966810 | 3300026088 | Unclassified | 847 |
| 532 | Ga0207648_10057943 | 3300026089 | Bacteria | 3379 |
| 533 | Ga0207648_10065816 | 3300026089 | Bacteria | 3160 |
| 534 | Ga0207648_10068616 | 3300026089 | Bacteria | 3089 |
| 535 | Ga0207648_10102235 | 3300026089 | Bacteria | 2512 |
| 536 | Ga0207648_10158301 | 3300026089 | Bacteria | 2000 |
| 537 | Ga0207648_10241657 | 3300026089 | Bacteria | 1608 |
| 538 | Ga0207648_10443515 | 3300026089 | Unclassified | 1181 |
| 539 | Ga0207648_10932586 | 3300026089 | Bacteria | 812 |
| 540 | Ga0207676_10065516 | 3300026095 | Bacteria | 2893 |
| 541 | Ga0207676_10446970 | 3300026095 | Unclassified | 1218 |
| 542 | Ga0207674_10054980 | 3300026116 | Bacteria | 4050 |
| 543 | Ga0207674_10111725 | 3300026116 | Bacteria | 2707 |
| 544 | Ga0207674_10150158 | 3300026116 | Bacteria | 2287 |
| 545 | Ga0207674_10211943 | 3300026116 | Bacteria | 1886 |
| 546 | Ga0207674_10234977 | 3300026116 | Bacteria | 1781 |
| 547 | Ga0207675_100002110 | 3300026118 | Bacteria | 19700 |
| 548 | Ga0207675_100002779 | 3300026118 | Bacteria | 17193 |
| 549 | Ga0207675_100091678 | 3300026118 | Bacteria | 2857 |
| 550 | Ga0207675_100186531 | 3300026118 | Bacteria | 1988 |
| 551 | Ga0207675_100198662 | 3300026118 | Bacteria | 1926 |
| 552 | Ga0207675_100501076 | 3300026118 | Bacteria | 1209 |
| 553 | Ga0207675_100673102 | 3300026118 | Bacteria | 1042 |
| 554 | Ga0207675_100737526 | 3300026118 | Bacteria | 996 |
| 555 | Ga0207675_101076773 | 3300026118 | Bacteria | 823 |
| 556 | Ga0207683_10007087 | 3300026121 | Bacteria | 9610 |
| 557 | Ga0207683_10014004 | 3300026121 | Bacteria | 6838 |
| 558 | Ga0207683_10016610 | 3300026121 | Bacteria | 6265 |
| 559 | Ga0207683_10048570 | 3300026121 | Bacteria | 3716 |
| 560 | Ga0207683_10242531 | 3300026121 | Bacteria | 1644 |
| 561 | Ga0207698_10066641 | 3300026142 | Bacteria | 2835 |
| 562 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 563 | Ga0268266_10000008 | 3300028379 | Bacteria | 1161875 |
| 564 | Ga0268266_10008971 | 3300028379 | Bacteria | 8850 |
| 565 | Ga0268266_10022170 | 3300028379 | Bacteria | 5412 |
| 566 | Ga0268266_10098279 | 3300028379 | Bacteria | 2575 |
| 567 | Ga0268266_10118317 | 3300028379 | Bacteria | 2355 |
| 568 | Ga0268266_10222782 | 3300028379 | Bacteria | 1735 |
| 569 | Ga0268266_10305193 | 3300028379 | Bacteria | 1486 |
| 570 | Ga0268265_10089988 | 3300028380 | Unclassified | 2450 |
| 571 | Ga0268265_10438294 | 3300028380 | Bacteria | 1217 |
| 572 | Ga0268265_10453107 | 3300028380 | Bacteria | 1199 |
| 573 | Ga0268265_10555792 | 3300028380 | Unclassified | 1090 |
| 574 | Ga0268265_10912788 | 3300028380 | Bacteria | 863 |
| 575 | Ga0268264_10000058 | 3300028381 | Bacteria | 308956 |
| 576 | Ga0268264_10000060 | 3300028381 | Bacteria | 305056 |
| 577 | Ga0268264_10058922 | 3300028381 | Bacteria | 3217 |
| 578 | Ga0268264_10061028 | 3300028381 | Bacteria | 3162 |
| 579 | Ga0268264_10417631 | 3300028381 | Bacteria | 1293 |
| 580 | Ga0265319_1000777 | 3300028563 | Bacteria | 20762 |
| 581 | Ga0265319_1026809 | 3300028563 | Bacteria | 2049 |
| 582 | Ga0265318_10004691 | 3300028577 | Bacteria | 6560 |
| 583 | Ga0307517_10176140 | 3300028786 | Bacteria | 1392 |
| 584 | Ga0307515_10000037 | 3300028794 | Bacteria | 331970 |
| 585 | Ga0307515_10012918 | 3300028794 | Bacteria | 15662 |
| 586 | Ga0307515_10047411 | 3300028794 | Bacteria | 6532 |
| 587 | Ga0307515_10146047 | 3300028794 | Unclassified | 2504 |
| 588 | Ga0265338_10011548 | 3300028800 | Bacteria | 10185 |
| 589 | Ga0265324_10036760 | 3300029957 | Unclassified | 1702 |
| 590 | Ga0307511_10012417 | 3300030521 | Bacteria | 8355 |
| 591 | Ga0265320_10025262 | 3300031240 | Bacteria | 3125 |
| 592 | Ga0265331_10000857 | 3300031250 | Bacteria | 24739 |
| 593 | Ga0265327_10001107 | 3300031251 | Bacteria | 37348 |
| 594 | Ga0265327_10003286 | 3300031251 | Bacteria | 15659 |
| 595 | Ga0265327_10103771 | 3300031251 | Bacteria | 1368 |
| 596 | Ga0307513_10006084 | 3300031456 | Bacteria | 15833 |
| 597 | Ga0307513_10013647 | 3300031456 | Bacteria | 9964 |
| 598 | Ga0307513_10019540 | 3300031456 | Bacteria | 8065 |
| 599 | Ga0307513_10023596 | 3300031456 | Bacteria | 7183 |
| 600 | Ga0307513_10026034 | 3300031456 | Bacteria | 6755 |
| 601 | Ga0307513_10143864 | 3300031456 | Bacteria | 2306 |
| 602 | Ga0307513_10163836 | 3300031456 | Bacteria | 2111 |
| 603 | Ga0307513_10255915 | 3300031456 | Bacteria | 1544 |
| 604 | Ga0307509_10000004 | 3300031507 | Bacteria | 535507 |
| 605 | Ga0307509_10313299 | 3300031507 | Bacteria | 1310 |
| 606 | Ga0265313_10003091 | 3300031595 | Bacteria | 13807 |
| 607 | Ga0307514_10023305 | 3300031649 | Bacteria | 5022 |
| 608 | Ga0265314_10018622 | 3300031711 | Bacteria | 5408 |
| 609 | Ga0265314_10040677 | 3300031711 | Bacteria | 3334 |
| 610 | Ga0307516_10000973 | 3300031730 | Bacteria | 39600 |
| 611 | Ga0307516_10315374 | 3300031730 | Bacteria | 1236 |
| 612 | Ga0307405_10219469 | 3300031731 | Bacteria | 1394 |
| 613 | Ga0307405_10826351 | 3300031731 | Unclassified | 778 |
| 614 | Ga0307413_10052491 | 3300031824 | Bacteria | 2462 |
| 615 | Ga0307518_10304507 | 3300031838 | Unclassified | 966 |
| 616 | Ga0307410_10028299 | 3300031852 | Bacteria | 3553 |
| 617 | Ga0307410_10210176 | 3300031852 | Bacteria | 1490 |
| 618 | Ga0307406_10340611 | 3300031901 | Bacteria | 1168 |
| 619 | Ga0307407_10057003 | 3300031903 | Bacteria | 2265 |
| 620 | Ga0307407_10282334 | 3300031903 | Bacteria | 1150 |
| 621 | Ga0307409_100144330 | 3300031995 | Bacteria | 2056 |
| 622 | Ga0307409_100553631 | 3300031995 | Bacteria | 1129 |
| 623 | Ga0307416_100113217 | 3300032002 | Bacteria | 2397 |
| 624 | Ga0307416_100226911 | 3300032002 | Bacteria | 1797 |
| 625 | Ga0307416_100269170 | 3300032002 | Bacteria | 1671 |
| 626 | Ga0307411_10000884 | 3300032005 | Bacteria | 11352 |
| 627 | Ga0307411_10131559 | 3300032005 | Bacteria | 1829 |
| 628 | Ga0307415_100036883 | 3300032126 | Bacteria | 3208 |
| 629 | Ga0307415_100133460 | 3300032126 | Bacteria | 1884 |
| 630 | Ga0307415_100160960 | 3300032126 | Unclassified | 1740 |
| 631 | Ga0307415_100510607 | 3300032126 | Unclassified | 1053 |
| 632 | Ga0307415_100816937 | 3300032126 | Unclassified | 852 |
| 633 | Ga0307510_10000006 | 3300033180 | Bacteria | 566474 |
| 634 | Ga0307510_10112942 | 3300033180 | Bacteria | 2452 |
| 635 | Ga0307510_10364002 | 3300033180 | Bacteria | 894 |
| 636 | Ga0373956_0115860 | 3300035119 | Bacteria | 1250 |
| 637 | Ga0373955_0315635 | 3300035172 | Bacteria | 944 |
| 638 | Ga0373924_0044956 | 3300035410 | Bacteria | 1816 |
| 639 | Ga0373935_0844717 | 3300035692 | Unclassified | 677 |
| 640 | Ga0373933_0259616 | 3300035724 | Bacteria | 1120 |
| 641 | Ga0373937_0143168 | 3300036401 | Bacteria | 2237 |
| 642 | Ga0373937_0213003 | 3300036401 | Bacteria | 1818 |
| 643 | Ga0395905_0010252 | 3300037471 | Bacteria | 9127 |
| 644 | Ga0395905_0036179 | 3300037471 | Bacteria | 4636 |
| 645 | Ga0436365_0208206 | 3300039437 | Bacteria | 1387 |
| 646 | Ga0436365_1218812 | 3300039437 | Bacteria | 2107 |
| 647 | Ga0436361_0019641 | 3300039447 | Bacteria | 127735 |
| 648 | Ga0436361_1131838 | 3300039447 | Unclassified | 1085 |
| 649 | Ga0451791_0728188 | 3300041451 | Bacteria | 1272 |
| 650 | Ga0451791_1748093 | 3300041451 | Bacteria | 1195 |
| 651 | Ga0451797_0171226 | 3300041453 | Unclassified | 1068 |
| 652 | Ga0451800_0010766 | 3300041459 | Bacteria | 1017 |
| 653 | Ga0451802_0111061 | 3300041460 | Bacteria | 2653 |
| 654 | Ga0451804_1183977 | 3300041463 | Bacteria | 1471 |
| 655 | Ga0451807_1688973 | 3300041486 | Bacteria | 4227 |
| 656 | Ga0451837_0957394 | 3300041494 | Bacteria | 3478 |
| 657 | Ga0451839_0591939 | 3300041496 | Bacteria | 695 |
| 658 | Ga0451853_2579635 | 3300041512 | Unclassified | 1313 |
| 659 | Ga0439446_0047201 | 3300042156 | Bacteria | 1281 |
| 660 | Ga0451577_0162885 | 3300042876 | Bacteria | 2009 |
| 661 | Ga0453683_0000584 | 3300044673 | Bacteria | 40423 |
| 662 | Ga0453683_0028338 | 3300044673 | Bacteria | 3547 |
| 663 | Ga0466966_0222209 | 3300044684 | Bacteria | 1140 |
| 664 | Ga0466961_0097843 | 3300044693 | Bacteria | 1850 |
| 665 | Ga0453684_0331508 | 3300044712 | Unclassified | 1721 |
| 666 | Ga0466970_0201573 | 3300044765 | Unclassified | 1107 |
| 667 | Ga0451576_0000708 | 3300045051 | Bacteria | 67318 |
| 668 | Ga0451576_0003454 | 3300045051 | Bacteria | 21672 |
| 669 | Ga0451576_0142245 | 3300045051 | Unclassified | 2501 |
| 670 | Ga0451576_0280510 | 3300045051 | Bacteria | 1742 |
| 671 | Ga0495590_0001029 | 3300046457 | Bacteria | 12278 |
| 672 | Ga0495590_0046972 | 3300046457 | Unclassified | 1506 |
| 673 | Ga0495638_0006869 | 3300046460 | Bacteria | 8215 |
| 674 | Ga0495580_0224617 | 3300046472 | Unclassified | 1290 |
| 675 | Ga0495664_0330946 | 3300046477 | Bacteria | 918 |
| 676 | Ga0495594_0489014 | 3300046499 | Unclassified | 699 |
| 677 | Ga0495616_0000837 | 3300046513 | Bacteria | 22426 |
| 678 | Ga0495630_0566472 | 3300046517 | Unclassified | 871 |
| 679 | Ga0495632_0034293 | 3300046519 | Bacteria | 2599 |
| 680 | Ga0495632_0053285 | 3300046519 | Bacteria | 1987 |
| 681 | Ga0495643_0000214 | 3300046522 | Bacteria | 88979 |
| 682 | Ga0495648_0070833 | 3300046524 | Bacteria | 2024 |
| 683 | Ga0495665_0184210 | 3300046531 | Bacteria | 1084 |
| 684 | Ga0495587_0050166 | 3300046536 | Unclassified | 2469 |
| 685 | Ga0495645_0403780 | 3300046543 | Bacteria | 870 |
| 686 | Ga0495625_0010605 | 3300046660 | Bacteria | 7603 |
| 687 | Ga0495625_0041369 | 3300046660 | Bacteria | 3355 |
| 688 | Ga0495625_0175026 | 3300046660 | Bacteria | 1430 |
| 689 | Ga0495599_0014613 | 3300046678 | Bacteria | 4863 |
| 690 | Ga0495647_0026008 | 3300046681 | Bacteria | 2142 |
| 691 | Ga0495658_0005817 | 3300046683 | Bacteria | 6053 |
| 692 | Ga0495649_0018603 | 3300046694 | Bacteria | 3906 |
| 693 | Ga0495672_0277719 | 3300047320 | Unclassified | 802 |
| 694 | Ga0495684_0193000 | 3300047471 | Bacteria | 1505 |
| 695 | Ga0495686_0002983 | 3300047472 | Bacteria | 15069 |
| 696 | Ga0495686_0246460 | 3300047472 | Unclassified | 1005 |
| 697 | Ga0496100_0083187 | 3300048903 | Unclassified | 2166 |
| 698 | Ga0496102_0184614 | 3300048905 | Bacteria | 1965 |
| 699 | Ga0496103_0042528 | 3300048906 | Bacteria | 2797 |
| 700 | Ga0496103_0090499 | 3300048906 | Bacteria | 1931 |
| 701 | Ga0496104_0000017 | 3300048907 | Bacteria | 325877 |
| 702 | Ga0496104_0004579 | 3300048907 | Bacteria | 12046 |
| 703 | Ga0496104_0135615 | 3300048907 | Bacteria | 2365 |
| 704 | Ga0496105_0000009 | 3300048908 | Bacteria | 325734 |
| 705 | Ga0496105_0000256 | 3300048908 | Bacteria | 35835 |
| 706 | Ga0496107_0204424 | 3300048910 | Bacteria | 1468 |
| 707 | Ga0496107_0221381 | 3300048910 | Bacteria | 1408 |
| 708 | Ga0496108_0597922 | 3300048911 | Bacteria | 961 |
| 709 | Ga0496114_0002670 | 3300048917 | Bacteria | 13618 |
| 710 | Ga0496115_0081437 | 3300048918 | Bacteria | 2637 |
| 711 | Ga0496116_0066326 | 3300048919 | Bacteria | 2310 |
| 712 | Ga0496117_0000523 | 3300048920 | Bacteria | 63335 |
| 713 | Ga0496118_0000180 | 3300048921 | Bacteria | 112199 |
| 714 | Ga0496118_0008446 | 3300048921 | Bacteria | 10643 |
| 715 | Ga0496118_0164018 | 3300048921 | Bacteria | 1369 |
| 716 | Ga0496119_0000998 | 3300048922 | Bacteria | 36271 |
| 717 | Ga0496119_0004217 | 3300048922 | Bacteria | 14432 |
| 718 | Ga0496119_0124758 | 3300048922 | Bacteria | 1410 |
| 719 | Ga0496120_0000814 | 3300048923 | Bacteria | 44686 |
| 720 | Ga0496120_0019980 | 3300048923 | Bacteria | 4270 |
| 721 | Ga0496120_0234583 | 3300048923 | Unclassified | 869 |
| 722 | Ga0496121_0003660 | 3300048924 | Bacteria | 21605 |
| 723 | Ga0496121_0035773 | 3300048924 | Bacteria | 4441 |
| 724 | Ga0496121_0066352 | 3300048924 | Bacteria | 2931 |
| 725 | Ga0496122_0000725 | 3300048925 | Bacteria | 64489 |
| 726 | Ga0496123_0001443 | 3300048926 | Bacteria | 33137 |
| 727 | Ga0496124_0014972 | 3300048927 | Bacteria | 7466 |
| 728 | Ga0496125_0002234 | 3300048928 | Bacteria | 25765 |
| 729 | Ga0496125_0006868 | 3300048928 | Bacteria | 12194 |
| 730 | Ga0496125_0013999 | 3300048928 | Bacteria | 7844 |
| 731 | Ga0496126_0478054 | 3300048929 | Unclassified | 999 |
| 732 | Ga0495678_022739 | 3300049459 | Bacteria | 2737 |
| 733 | Ga0501031_0012034 | 3300049568 | Bacteria | 5641 |
| 734 | Ga0501032_0001081 | 3300049569 | Bacteria | 21777 |
| 735 | Ga0501032_0140155 | 3300049569 | Bacteria | 1593 |
| 736 | Ga0501033_0013136 | 3300049570 | Bacteria | 6308 |
| 737 | Ga0501034_0089507 | 3300049571 | Bacteria | 3076 |
| 738 | Ga0501034_0169034 | 3300049571 | Bacteria | 2154 |
| 739 | Ga0501034_0722985 | 3300049571 | Bacteria | 893 |
| 740 | Ga0501036_0009221 | 3300049572 | Bacteria | 8111 |
| 741 | Ga0501037_0005804 | 3300049573 | Bacteria | 9010 |
| 742 | Ga0501037_0496918 | 3300049573 | Bacteria | 828 |
| 743 | Ga0501038_0116972 | 3300049574 | Unclassified | 2202 |
| 744 | Ga0501039_0501632 | 3300049575 | Bacteria | 953 |
| 745 | Ga0501042_0003972 | 3300049578 | Bacteria | 9364 |
| 746 | Ga0501043_0036679 | 3300049579 | Unclassified | 3857 |
| 747 | Ga0501046_0006085 | 3300049580 | Bacteria | 10731 |
| 748 | Ga0501047_0017668 | 3300049581 | Bacteria | 6835 |
| 749 | Ga0501047_0092769 | 3300049581 | Bacteria | 2898 |
| 750 | Ga0501047_0334227 | 3300049581 | Bacteria | 1353 |
| 751 | Ga0501047_0428649 | 3300049581 | Bacteria | 1153 |
| 752 | Ga0501067_0008524 | 3300049583 | Bacteria | 5685 |
| 753 | Ga0501068_0005963 | 3300049584 | Bacteria | 6687 |
| 754 | Ga0501070_0051592 | 3300049586 | Bacteria | 3414 |
| 755 | Ga0501070_0583593 | 3300049586 | Bacteria | 892 |
| 756 | Ga0501070_0630914 | 3300049586 | Bacteria | 852 |
| 757 | Ga0501071_0006847 | 3300049587 | Bacteria | 7428 |
| 758 | Ga0501073_0010359 | 3300049589 | Bacteria | 6839 |
| 759 | Ga0501073_0012576 | 3300049589 | Bacteria | 6175 |
| 760 | Ga0501074_0000405 | 3300049590 | Bacteria | 25788 |
| 761 | Ga0501076_0007170 | 3300049592 | Bacteria | 8104 |
| 762 | Ga0501077_0008833 | 3300049593 | Bacteria | 6253 |
| 763 | Ga0501079_0004012 | 3300049741 | Bacteria | 10889 |
| 764 | Ga0501080_0003407 | 3300049742 | Bacteria | 14011 |
| 765 | Ga0501080_0089285 | 3300049742 | Unclassified | 2863 |
| 766 | Ga0501080_0098327 | 3300049742 | Bacteria | 2716 |
| 767 | Ga0501080_0555625 | 3300049742 | Bacteria | 1022 |
| 768 | Ga0501080_0805748 | 3300049742 | Bacteria | 823 |
| 769 | Ga0501081_0027625 | 3300049743 | Bacteria | 3827 |
| 770 | Ga0501083_0016483 | 3300049744 | Bacteria | 5171 |
| 771 | Ga0501083_0046539 | 3300049744 | Unclassified | 2933 |
| 772 | Ga0501035_0019178 | 3300049822 | Bacteria | 6296 |
| 773 | Ga0501035_0334631 | 3300049822 | Bacteria | 1270 |
| 774 | Ga0501044_0028790 | 3300049823 | Bacteria | 5859 |
| 775 | nmdc:mga05p37_5926_c1 | 3300050507 | Bacteria | 14383 |
| 776 | nmdc:mga09592_934_c2 | 3300050508 | Bacteria | 22024 |
| 777 | nmdc:mga06r32_518_c1 | 3300050510 | Bacteria | 33229 |
| 778 | nmdc:mga08y16_218280_c1 | 3300050511 | Unclassified | 1974 |
| 779 | nmdc:mga08y16_571_c2 | 3300050511 | Bacteria | 30328 |
| 780 | nmdc:mga08y16_65792_c1 | 3300050511 | Bacteria | 3783 |
| 781 | nmdc:mga08y16_859553_c1 | 3300050511 | Bacteria | 896 |
| 782 | Ga0495601_0120166 | 3300053077 | Bacteria | 1706 |
| 783 | Ga0500643_000396 | 3300053087 | Bacteria | 33542 |
| 784 | Ga0500583_0023539 | 3300053092 | Bacteria | 2597 |
| 785 | Ga0500558_108491 | 3300053106 | Unclassified | 1092 |
| 786 | Ga0500597_015612 | 3300053120 | Bacteria | 2876 |
| 787 | Ga0500590_150634 | 3300053148 | Bacteria | 1050 |
| 788 | Ga0500616_0032412 | 3300053153 | Bacteria | 2857 |
| 789 | Ga0500622_0002571 | 3300053156 | Bacteria | 13005 |
| 790 | Ga0500622_0017409 | 3300053156 | Bacteria | 3823 |
| 791 | Ga0500622_0047814 | 3300053156 | Bacteria | 2208 |
| 792 | Ga0500622_0209908 | 3300053156 | Bacteria | 880 |
| 793 | Ga0500611_005124 | 3300053727 | Bacteria | 1821 |
| 794 | Ga0501084_0012026 | 3300054114 | Bacteria | 7165 |
| 795 | Ga0501084_0093245 | 3300054114 | Bacteria | 2528 |
| 796 | Ga0501082_0000075 | 3300060353 | Bacteria | 73206 |
| 797 | Ga0501082_0011806 | 3300060353 | Bacteria | 7509 |
| 798 | Ga0530510_0077153 | 3300061734 | Bacteria | 2422 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005530 | Ga0070679_100053216 | Ga0070679_1000532162 | 175 |
| 2 | 3300025921 | Ga0207652_10039167 | Ga0207652_100391673 | 175 |
| 3 | 3300044693 | Ga0466961_0097843 | Ga0466961_0097843_1297_1836 | 176 |
| 4 | 3300037471 | Ga0395905_0036179 | Ga0395905_0036179_3249_3830 | 180 |
| 5 | 3300046499 | Ga0495594_0489014 | Ga0495594_0489014_25_567 | 180 |
| 6 | 3300013296 | Ga0157374_10660485 | Ga0157374_106604852 | 184 |
| 7 | 3300005327 | Ga0070658_10332657 | Ga0070658_103326572 | 190 |
| 8 | 3300053156 | Ga0500622_0017409 | Ga0500622_0017409_225_884 | 190 |
| 9 | 3300039447 | Ga0436361_1131838 | Ga0436361_1131838_364_978 | 191 |
| 10 | 3300005436 | Ga0070713_100022634 | Ga0070713_1000226342 | 192 |
| 11 | 3300053156 | Ga0500622_0002571 | Ga0500622_0002571_148_801 | 194 |
| 12 | 3300028794 | Ga0307515_10000037 | Ga0307515_10000037140 | 195 |
| 13 | 3300005544 | Ga0070686_100095023 | Ga0070686_1000950232 | 196 |
| 14 | 3300009553 | Ga0105249_10119239 | Ga0105249_101192392 | 196 |
| 15 | 3300010375 | Ga0105239_10006656 | Ga0105239_100066565 | 196 |
| 16 | 3300025961 | Ga0207712_10027904 | Ga0207712_100279042 | 196 |
| 17 | iso_pu_bacteria | 2643221646 | 2644255569 | 196 |
| 18 | 3300035692 | Ga0373935_0844717 | Ga0373935_0844717_70_663 | 197 |
| 19 | 3300047472 | Ga0495686_0002983 | Ga0495686_0002983_6427_7023 | 197 |
| 20 | 3300048925 | Ga0496122_0000725 | Ga0496122_0000725_24662_25258 | 197 |
| 21 | 3300048926 | Ga0496123_0001443 | Ga0496123_0001443_17888_18484 | 197 |
| 22 | 3300003759 | Ga0055525_1000013 | Ga0055525_1000013414 | 198 |
| 23 | 3300021361 | Ga0213872_10000085 | Ga0213872_1000008580 | 198 |
| 24 | 3300025226 | Ga0209674_112304 | Ga0209674_1123041 | 198 |
| 25 | 3300025230 | Ga0209563_100025 | Ga0209563_100025173 | 198 |
| 26 | 3300033180 | Ga0307510_10112942 | Ga0307510_101129422 | 198 |
| 27 | 3300039447 | Ga0436361_0019641 | Ga0436361_0019641_23760_24368 | 198 |
| 28 | 3300005340 | Ga0070689_100308589 | Ga0070689_1003085892 | 199 |
| 29 | 3300005564 | Ga0070664_100318947 | Ga0070664_1003189472 | 199 |
| 30 | 3300005841 | Ga0068863_100234424 | Ga0068863_1002344242 | 199 |
| 31 | 3300006844 | Ga0075428_100017573 | Ga0075428_10001757310 | 199 |
| 32 | 3300006847 | Ga0075431_100000257 | Ga0075431_10000025727 | 199 |
| 33 | 3300006880 | Ga0075429_100001404 | Ga0075429_10000140410 | 199 |
| 34 | 3300009094 | Ga0111539_10016527 | Ga0111539_100165273 | 199 |
| 35 | 3300009147 | Ga0114129_10002305 | Ga0114129_100023058 | 199 |
| 36 | 3300025936 | Ga0207670_10197307 | Ga0207670_101973072 | 199 |
| 37 | 3300025945 | Ga0207679_10374664 | Ga0207679_103746642 | 199 |
| 38 | 3300026088 | Ga0207641_10966810 | Ga0207641_109668102 | 199 |
| 39 | 3300031250 | Ga0265331_10000857 | Ga0265331_1000085711 | 199 |
| 40 | 3300031251 | Ga0265327_10001107 | Ga0265327_1000110711 | 199 |
| 41 | 3300031649 | Ga0307514_10023305 | Ga0307514_100233053 | 199 |
| 42 | 3300033180 | Ga0307510_10364002 | Ga0307510_103640022 | 199 |
| 43 | 3300044765 | Ga0466970_0201573 | Ga0466970_0201573_149_781 | 199 |
| 44 | 3300046524 | Ga0495648_0070833 | Ga0495648_0070833_586_1185 | 199 |
| 45 | 3300050507 | nmdc:mga05p37_5926_c1 | nmdc:mga05p37_5926_c1_3036_3662 | 199 |
| 46 | 3300050508 | nmdc:mga09592_934_c2 | nmdc:mga09592_934_c2_13509_14135 | 199 |
| 47 | 3300050510 | nmdc:mga06r32_518_c1 | nmdc:mga06r32_518_c1_5841_6467 | 199 |
| 48 | 3300050511 | nmdc:mga08y16_571_c2 | nmdc:mga08y16_571_c2_1102_1728 | 199 |
| 49 | iso_pu_bacteria | 2738541337 | 2739054029 | 199 |
| 50 | 3300003322 | rootL2_10123247 | rootL2_101232472 | 200 |
| 51 | 3300003323 | rootH1_10000797 | rootH1_100007974 | 200 |
| 52 | 3300003794 | Ga0055531_10000154 | Ga0055531_1000015467 | 200 |
| 53 | 3300005337 | Ga0070682_100047495 | Ga0070682_1000474952 | 200 |
| 54 | 3300005340 | Ga0070689_100150054 | Ga0070689_1001500542 | 200 |
| 55 | 3300005340 | Ga0070689_100239616 | Ga0070689_1002396162 | 200 |
| 56 | 3300005365 | Ga0070688_100152351 | Ga0070688_1001523513 | 200 |
| 57 | 3300005444 | Ga0070694_100793912 | Ga0070694_1007939121 | 200 |
| 58 | 3300005548 | Ga0070665_100044691 | Ga0070665_1000446913 | 200 |
| 59 | 3300005577 | Ga0068857_100174834 | Ga0068857_1001748342 | 200 |
| 60 | 3300009094 | Ga0111539_10295919 | Ga0111539_102959192 | 200 |
| 61 | 3300025298 | Ga0209050_1002369 | Ga0209050_10023694 | 200 |
| 62 | 3300025303 | Ga0209051_1003041 | Ga0209051_10030412 | 200 |
| 63 | 3300025304 | Ga0209257_1000016 | Ga0209257_1000016872 | 200 |
| 64 | 3300025920 | Ga0207649_10569437 | Ga0207649_105694372 | 200 |
| 65 | 3300025936 | Ga0207670_10071145 | Ga0207670_100711452 | 200 |
| 66 | 3300026088 | Ga0207641_10283124 | Ga0207641_102831242 | 200 |
| 67 | 3300026116 | Ga0207674_10111725 | Ga0207674_101117252 | 200 |
| 68 | 3300028379 | Ga0268266_10022170 | Ga0268266_100221704 | 200 |
| 69 | 3300031456 | Ga0307513_10163836 | Ga0307513_101638363 | 200 |
| 70 | 3300037471 | Ga0395905_0010252 | Ga0395905_0010252_1983_2600 | 200 |
| 71 | 3300041451 | Ga0451791_0728188 | Ga0451791_0728188_363_1001 | 200 |
| 72 | 3300050511 | nmdc:mga08y16_218280_c1 | nmdc:mga08y16_218280_c1_209_835 | 200 |
| 73 | iso_pu_bacteria | 2831864461 | 2831866885 | 200 |
| 74 | 3300005331 | Ga0070670_100227308 | Ga0070670_1002273082 | 201 |
| 75 | 3300005439 | Ga0070711_100132225 | Ga0070711_1001322252 | 201 |
| 76 | 3300005459 | Ga0068867_100334027 | Ga0068867_1003340272 | 201 |
| 77 | 3300005539 | Ga0068853_100240992 | Ga0068853_1002409922 | 201 |
| 78 | 3300005548 | Ga0070665_100011239 | Ga0070665_1000112396 | 201 |
| 79 | 3300006237 | Ga0097621_100235552 | Ga0097621_1002355521 | 201 |
| 80 | 3300009174 | Ga0105241_10010519 | Ga0105241_100105193 | 201 |
| 81 | 3300009176 | Ga0105242_10246527 | Ga0105242_102465272 | 201 |
| 82 | 3300009177 | Ga0105248_10492867 | Ga0105248_104928672 | 201 |
| 83 | 3300009545 | Ga0105237_10281952 | Ga0105237_102819522 | 201 |
| 84 | 3300009551 | Ga0105238_10002571 | Ga0105238_1000257118 | 201 |
| 85 | 3300013105 | Ga0157369_10046965 | Ga0157369_100469654 | 201 |
| 86 | 3300013296 | Ga0157374_10087355 | Ga0157374_100873552 | 201 |
| 87 | 3300013307 | Ga0157372_10134437 | Ga0157372_101344372 | 201 |
| 88 | 3300014968 | Ga0157379_10162183 | Ga0157379_101621832 | 201 |
| 89 | 3300025304 | Ga0209257_1021170 | Ga0209257_10211702 | 201 |
| 90 | 3300025914 | Ga0207671_10062103 | Ga0207671_100621032 | 201 |
| 91 | 3300025914 | Ga0207671_10261972 | Ga0207671_102619722 | 201 |
| 92 | 3300025924 | Ga0207694_10218158 | Ga0207694_102181581 | 201 |
| 93 | 3300025925 | Ga0207650_10186750 | Ga0207650_101867502 | 201 |
| 94 | 3300026067 | Ga0207678_10048413 | Ga0207678_100484132 | 201 |
| 95 | 3300026089 | Ga0207648_10241657 | Ga0207648_102416572 | 201 |
| 96 | 3300028786 | Ga0307517_10176140 | Ga0307517_101761402 | 201 |
| 97 | 3300028794 | Ga0307515_10012918 | Ga0307515_100129184 | 201 |
| 98 | 3300028794 | Ga0307515_10047411 | Ga0307515_100474118 | 201 |
| 99 | 3300028794 | Ga0307515_10146047 | Ga0307515_101460473 | 201 |
| 100 | 3300031456 | Ga0307513_10006084 | Ga0307513_1000608410 | 201 |
| 101 | 3300031456 | Ga0307513_10019540 | Ga0307513_100195402 | 201 |
| 102 | 3300031730 | Ga0307516_10000973 | Ga0307516_1000097315 | 201 |
| 103 | 3300035172 | Ga0373955_0315635 | Ga0373955_0315635_186_800 | 201 |
| 104 | 3300046519 | Ga0495632_0034293 | Ga0495632_0034293_1660_2265 | 201 |
| 105 | 3300049580 | Ga0501046_0006085 | Ga0501046_0006085_3552_4214 | 201 |
| 106 | 3300049581 | Ga0501047_0092769 | Ga0501047_0092769_411_1073 | 201 |
| 107 | 3300049822 | Ga0501035_0334631 | Ga0501035_0334631_609_1223 | 201 |
| 108 | 3300053092 | Ga0500583_0023539 | Ga0500583_0023539_1626_2231 | 201 |
| 109 | 3300003316 | rootH1_10008880 | rootH1_100088802 | 202 |
| 110 | 3300003771 | Ga0055526_1007082 | Ga0055526_10070822 | 202 |
| 111 | 3300005614 | Ga0068856_100050403 | Ga0068856_1000504032 | 202 |
| 112 | 3300009093 | Ga0105240_11211215 | Ga0105240_112112151 | 202 |
| 113 | 3300025273 | Ga0209673_1017194 | Ga0209673_10171942 | 202 |
| 114 | 3300025295 | Ga0209564_1000097 | Ga0209564_1000097157 | 202 |
| 115 | 3300026078 | Ga0207702_10179396 | Ga0207702_101793961 | 202 |
| 116 | 3300031456 | Ga0307513_10255915 | Ga0307513_102559152 | 202 |
| 117 | 3300033180 | Ga0307510_10000006 | Ga0307510_1000000628 | 202 |
| 118 | 3300039437 | Ga0436365_1218812 | Ga0436365_1218812_407_1021 | 202 |
| 119 | 3300044684 | Ga0466966_0222209 | Ga0466966_0222209_217_825 | 202 |
| 120 | 3300048906 | Ga0496103_0090499 | Ga0496103_0090499_1069_1680 | 202 |
| 121 | 3300048918 | Ga0496115_0081437 | Ga0496115_0081437_319_930 | 202 |
| 122 | 3300048919 | Ga0496116_0066326 | Ga0496116_0066326_1011_1622 | 202 |
| 123 | 3300048920 | Ga0496117_0000523 | Ga0496117_0000523_2513_3124 | 202 |
| 124 | 3300048921 | Ga0496118_0000180 | Ga0496118_0000180_61665_62276 | 202 |
| 125 | 3300048922 | Ga0496119_0000998 | Ga0496119_0000998_21392_22000 | 202 |
| 126 | 3300048922 | Ga0496119_0004217 | Ga0496119_0004217_9455_10063 | 202 |
| 127 | 3300048922 | Ga0496119_0124758 | Ga0496119_0124758_202_813 | 202 |
| 128 | 3300048923 | Ga0496120_0000814 | Ga0496120_0000814_24157_24765 | 202 |
| 129 | 3300048923 | Ga0496120_0019980 | Ga0496120_0019980_2534_3145 | 202 |
| 130 | 3300048923 | Ga0496120_0234583 | Ga0496120_0234583_103_711 | 202 |
| 131 | 3300048924 | Ga0496121_0035773 | Ga0496121_0035773_3733_4344 | 202 |
| 132 | 3300048927 | Ga0496124_0014972 | Ga0496124_0014972_4925_5536 | 202 |
| 133 | 3300048928 | Ga0496125_0006868 | Ga0496125_0006868_730_1338 | 202 |
| 134 | 3300049581 | Ga0501047_0017668 | Ga0501047_0017668_2006_2626 | 202 |
| 135 | 3300053156 | Ga0500622_0209908 | Ga0500622_0209908_96_704 | 202 |
| 136 | 3300005577 | Ga0068857_100042281 | Ga0068857_1000422814 | 203 |
| 137 | 3300006028 | Ga0070717_10000038 | Ga0070717_1000003820 | 203 |
| 138 | 3300006028 | Ga0070717_10049927 | Ga0070717_100499275 | 203 |
| 139 | 3300026116 | Ga0207674_10054980 | Ga0207674_100549804 | 203 |
| 140 | 3300031595 | Ga0265313_10003091 | Ga0265313_100030913 | 203 |
| 141 | 3300031711 | Ga0265314_10018622 | Ga0265314_100186223 | 203 |
| 142 | 3300031711 | Ga0265314_10040677 | Ga0265314_100406772 | 203 |
| 143 | 3300046472 | Ga0495580_0224617 | Ga0495580_0224617_315_947 | 203 |
| 144 | 3300046543 | Ga0495645_0403780 | Ga0495645_0403780_126_755 | 203 |
| 145 | 3300046678 | Ga0495599_0014613 | Ga0495599_0014613_3592_4218 | 203 |
| 146 | 3300048903 | Ga0496100_0083187 | Ga0496100_0083187_395_1015 | 203 |
| 147 | 3300048907 | Ga0496104_0004579 | Ga0496104_0004579_6362_6982 | 203 |
| 148 | 3300048908 | Ga0496105_0000256 | Ga0496105_0000256_23319_23939 | 203 |
| 149 | 3300048910 | Ga0496107_0204424 | Ga0496107_0204424_150_770 | 203 |
| 150 | 3300048917 | Ga0496114_0002670 | Ga0496114_0002670_8448_9068 | 203 |
| 151 | 3300053077 | Ga0495601_0120166 | Ga0495601_0120166_625_1254 | 203 |
| 152 | 3300005331 | Ga0070670_100078422 | Ga0070670_1000784222 | 204 |
| 153 | 3300005335 | Ga0070666_10003569 | Ga0070666_100035695 | 204 |
| 154 | 3300005455 | Ga0070663_100005805 | Ga0070663_1000058053 | 204 |
| 155 | 3300005457 | Ga0070662_100008323 | Ga0070662_1000083234 | 204 |
| 156 | 3300005459 | Ga0068867_100338004 | Ga0068867_1003380041 | 204 |
| 157 | 3300005548 | Ga0070665_100025117 | Ga0070665_1000251174 | 204 |
| 158 | 3300005563 | Ga0068855_100175572 | Ga0068855_1001755722 | 204 |
| 159 | 3300005564 | Ga0070664_100611496 | Ga0070664_1006114962 | 204 |
| 160 | 3300005578 | Ga0068854_100009334 | Ga0068854_1000093342 | 204 |
| 161 | 3300005616 | Ga0068852_100147859 | Ga0068852_1001478592 | 204 |
| 162 | 3300005834 | Ga0068851_10098068 | Ga0068851_100980682 | 204 |
| 163 | 3300005841 | Ga0068863_100434000 | Ga0068863_1004340002 | 204 |
| 164 | 3300005842 | Ga0068858_100000101 | Ga0068858_1000001015 | 204 |
| 165 | 3300006358 | Ga0068871_100082681 | Ga0068871_1000826812 | 204 |
| 166 | 3300009551 | Ga0105238_10330985 | Ga0105238_103309852 | 204 |
| 167 | 3300009553 | Ga0105249_10002100 | Ga0105249_100021003 | 204 |
| 168 | 3300013296 | Ga0157374_10250319 | Ga0157374_102503192 | 204 |
| 169 | 3300014969 | Ga0157376_10195729 | Ga0157376_101957293 | 204 |
| 170 | 3300025321 | Ga0207656_10000407 | Ga0207656_1000040710 | 204 |
| 171 | 3300025903 | Ga0207680_10002251 | Ga0207680_100022512 | 204 |
| 172 | 3300025904 | Ga0207647_10000075 | Ga0207647_1000007546 | 204 |
| 173 | 3300025911 | Ga0207654_10319681 | Ga0207654_103196812 | 204 |
| 174 | 3300025913 | Ga0207695_10087629 | Ga0207695_100876293 | 204 |
| 175 | 3300025914 | Ga0207671_10038094 | Ga0207671_100380942 | 204 |
| 176 | 3300025925 | Ga0207650_10068382 | Ga0207650_100683822 | 204 |
| 177 | 3300025933 | Ga0207706_10018566 | Ga0207706_100185664 | 204 |
| 178 | 3300025945 | Ga0207679_10658934 | Ga0207679_106589342 | 204 |
| 179 | 3300025961 | Ga0207712_10000211 | Ga0207712_1000021155 | 204 |
| 180 | 3300025986 | Ga0207658_10044849 | Ga0207658_100448492 | 204 |
| 181 | 3300025986 | Ga0207658_10957605 | Ga0207658_109576052 | 204 |
| 182 | 3300025986 | Ga0207658_11029370 | Ga0207658_110293701 | 204 |
| 183 | 3300026035 | Ga0207703_10000180 | Ga0207703_1000018056 | 204 |
| 184 | 3300026041 | Ga0207639_10000209 | Ga0207639_100002094 | 204 |
| 185 | 3300026067 | Ga0207678_10020169 | Ga0207678_100201693 | 204 |
| 186 | 3300026078 | Ga0207702_10062232 | Ga0207702_100622322 | 204 |
| 187 | 3300026088 | Ga0207641_10546460 | Ga0207641_105464602 | 204 |
| 188 | 3300026089 | Ga0207648_10158301 | Ga0207648_101583012 | 204 |
| 189 | 3300026116 | Ga0207674_10150158 | Ga0207674_101501582 | 204 |
| 190 | 3300028379 | Ga0268266_10000008 | Ga0268266_10000008433 | 204 |
| 191 | 3300045051 | Ga0451576_0000708 | Ga0451576_0000708_44235_44882 | 204 |
| 192 | 3300045051 | Ga0451576_0003454 | Ga0451576_0003454_17575_18222 | 204 |
| 193 | 3300005331 | Ga0070670_100637608 | Ga0070670_1006376082 | 205 |
| 194 | 3300005367 | Ga0070667_100029948 | Ga0070667_1000299483 | 205 |
| 195 | 3300005548 | Ga0070665_100000283 | Ga0070665_10000028372 | 205 |
| 196 | 3300005614 | Ga0068856_100215261 | Ga0068856_1002152612 | 205 |
| 197 | 3300005843 | Ga0068860_100580491 | Ga0068860_1005804912 | 205 |
| 198 | 3300006880 | Ga0075429_100886461 | Ga0075429_1008864612 | 205 |
| 199 | 3300009093 | Ga0105240_10423493 | Ga0105240_104234932 | 205 |
| 200 | 3300025913 | Ga0207695_10806897 | Ga0207695_108068971 | 205 |
| 201 | 3300025925 | Ga0207650_10037643 | Ga0207650_100376434 | 205 |
| 202 | 3300026078 | Ga0207702_10729830 | Ga0207702_107298302 | 205 |
| 203 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000012333 | 205 |
| 204 | 3300028381 | Ga0268264_10417631 | Ga0268264_104176312 | 205 |
| 205 | 3300031730 | Ga0307516_10315374 | Ga0307516_103153742 | 205 |
| 206 | 3300049569 | Ga0501032_0140155 | Ga0501032_0140155_789_1406 | 205 |
| 207 | 3300053156 | Ga0500622_0047814 | Ga0500622_0047814_745_1371 | 205 |
| 208 | 3300005335 | Ga0070666_10061313 | Ga0070666_100613132 | 206 |
| 209 | 3300005338 | Ga0068868_100059920 | Ga0068868_1000599202 | 206 |
| 210 | 3300005344 | Ga0070661_100168221 | Ga0070661_1001682212 | 206 |
| 211 | 3300005344 | Ga0070661_100916433 | Ga0070661_1009164331 | 206 |
| 212 | 3300005355 | Ga0070671_100062046 | Ga0070671_1000620462 | 206 |
| 213 | 3300005367 | Ga0070667_100192445 | Ga0070667_1001924452 | 206 |
| 214 | 3300005455 | Ga0070663_100027649 | Ga0070663_1000276493 | 206 |
| 215 | 3300005459 | Ga0068867_100130729 | Ga0068867_1001307292 | 206 |
| 216 | 3300005543 | Ga0070672_100304032 | Ga0070672_1003040322 | 206 |
| 217 | 3300005578 | Ga0068854_100057180 | Ga0068854_1000571802 | 206 |
| 218 | 3300005614 | Ga0068856_100797058 | Ga0068856_1007970582 | 206 |
| 219 | 3300005616 | Ga0068852_100443087 | Ga0068852_1004430872 | 206 |
| 220 | 3300005834 | Ga0068851_10001629 | Ga0068851_100016298 | 206 |
| 221 | 3300005842 | Ga0068858_100016218 | Ga0068858_1000162187 | 206 |
| 222 | 3300005843 | Ga0068860_100323812 | Ga0068860_1003238121 | 206 |
| 223 | 3300009093 | Ga0105240_10000243 | Ga0105240_1000024353 | 206 |
| 224 | 3300009093 | Ga0105240_10223878 | Ga0105240_102238782 | 206 |
| 225 | 3300009174 | Ga0105241_10079670 | Ga0105241_100796703 | 206 |
| 226 | 3300009174 | Ga0105241_10613843 | Ga0105241_106138431 | 206 |
| 227 | 3300009545 | Ga0105237_10105815 | Ga0105237_101058153 | 206 |
| 228 | 3300009553 | Ga0105249_10152735 | Ga0105249_101527352 | 206 |
| 229 | 3300010375 | Ga0105239_10230454 | Ga0105239_102304542 | 206 |
| 230 | 3300025261 | Ga0209233_1007840 | Ga0209233_10078403 | 206 |
| 231 | 3300025321 | Ga0207656_10007696 | Ga0207656_100076962 | 206 |
| 232 | 3300025903 | Ga0207680_10039871 | Ga0207680_100398713 | 206 |
| 233 | 3300025904 | Ga0207647_10005480 | Ga0207647_100054808 | 206 |
| 234 | 3300025911 | Ga0207654_10173108 | Ga0207654_101731082 | 206 |
| 235 | 3300025913 | Ga0207695_10022225 | Ga0207695_100222253 | 206 |
| 236 | 3300025913 | Ga0207695_10022274 | Ga0207695_100222745 | 206 |
| 237 | 3300025914 | Ga0207671_10002882 | Ga0207671_100028823 | 206 |
| 238 | 3300025914 | Ga0207671_10033854 | Ga0207671_100338544 | 206 |
| 239 | 3300025920 | Ga0207649_10114042 | Ga0207649_101140422 | 206 |
| 240 | 3300025924 | Ga0207694_10003412 | Ga0207694_100034128 | 206 |
| 241 | 3300025933 | Ga0207706_10032026 | Ga0207706_100320264 | 206 |
| 242 | 3300025940 | Ga0207691_10073960 | Ga0207691_100739601 | 206 |
| 243 | 3300025961 | Ga0207712_10003217 | Ga0207712_100032173 | 206 |
| 244 | 3300025981 | Ga0207640_10020481 | Ga0207640_100204815 | 206 |
| 245 | 3300025986 | Ga0207658_10019618 | Ga0207658_100196182 | 206 |
| 246 | 3300025986 | Ga0207658_10052688 | Ga0207658_100526882 | 206 |
| 247 | 3300026023 | Ga0207677_10128239 | Ga0207677_101282392 | 206 |
| 248 | 3300026035 | Ga0207703_10001805 | Ga0207703_1000180511 | 206 |
| 249 | 3300026041 | Ga0207639_10000602 | Ga0207639_100006027 | 206 |
| 250 | 3300026067 | Ga0207678_10003270 | Ga0207678_1000327011 | 206 |
| 251 | 3300026078 | Ga0207702_10225507 | Ga0207702_102255072 | 206 |
| 252 | 3300026088 | Ga0207641_10429903 | Ga0207641_104299032 | 206 |
| 253 | 3300026142 | Ga0207698_10066641 | Ga0207698_100666413 | 206 |
| 254 | 3300028563 | Ga0265319_1000777 | Ga0265319_100077713 | 206 |
| 255 | 3300028577 | Ga0265318_10004691 | Ga0265318_100046915 | 206 |
| 256 | 3300031240 | Ga0265320_10025262 | Ga0265320_100252622 | 206 |
| 257 | 3300031838 | Ga0307518_10304507 | Ga0307518_103045071 | 206 |
| 258 | 3300044673 | Ga0453683_0000584 | Ga0453683_0000584_6621_7268 | 206 |
| 259 | 3300045051 | Ga0451576_0280510 | Ga0451576_0280510_865_1512 | 206 |
| 260 | 3300049571 | Ga0501034_0722985 | Ga0501034_0722985_80_700 | 206 |
| 261 | 3300049573 | Ga0501037_0496918 | Ga0501037_0496918_85_705 | 206 |
| 262 | 3300049575 | Ga0501039_0501632 | Ga0501039_0501632_195_815 | 206 |
| 263 | 3300049581 | Ga0501047_0334227 | Ga0501047_0334227_598_1218 | 206 |
| 264 | 3300049581 | Ga0501047_0428649 | Ga0501047_0428649_398_1018 | 206 |
| 265 | 3300049586 | Ga0501070_0630914 | Ga0501070_0630914_110_730 | 206 |
| 266 | 3300049589 | Ga0501073_0012576 | Ga0501073_0012576_907_1527 | 206 |
| 267 | 3300049742 | Ga0501080_0098327 | Ga0501080_0098327_2002_2622 | 206 |
| 268 | 3300049742 | Ga0501080_0805748 | Ga0501080_0805748_127_747 | 206 |
| 269 | 3300053087 | Ga0500643_000396 | Ga0500643_000396_5707_6330 | 206 |
| 270 | 3300053120 | Ga0500597_015612 | Ga0500597_015612_1033_1656 | 206 |
| 271 | 3300053148 | Ga0500590_150634 | Ga0500590_150634_16_669 | 206 |
| 272 | 3300054114 | Ga0501084_0093245 | Ga0501084_0093245_157_777 | 206 |
| 273 | 3300060353 | Ga0501082_0000075 | Ga0501082_0000075_69114_69734 | 206 |
| 274 | 3300003320 | rootH2_10003802 | rootH2_100038029 | 207 |
| 275 | 3300003323 | rootH1_10244250 | rootH1_102442504 | 207 |
| 276 | 3300005331 | Ga0070670_100311155 | Ga0070670_1003111552 | 207 |
| 277 | 3300005535 | Ga0070684_100340026 | Ga0070684_1003400262 | 207 |
| 278 | 3300005548 | Ga0070665_100453655 | Ga0070665_1004536552 | 207 |
| 279 | 3300005563 | Ga0068855_100436725 | Ga0068855_1004367252 | 207 |
| 280 | 3300005616 | Ga0068852_101016960 | Ga0068852_1010169601 | 207 |
| 281 | 3300005618 | Ga0068864_100265858 | Ga0068864_1002658582 | 207 |
| 282 | 3300005844 | Ga0068862_100503374 | Ga0068862_1005033742 | 207 |
| 283 | 3300009101 | Ga0105247_10097127 | Ga0105247_100971273 | 207 |
| 284 | 3300009553 | Ga0105249_10293143 | Ga0105249_102931432 | 207 |
| 285 | 3300014325 | Ga0163163_10738004 | Ga0163163_107380042 | 207 |
| 286 | 3300025321 | Ga0207656_10140059 | Ga0207656_101400592 | 207 |
| 287 | 3300025949 | Ga0207667_10718450 | Ga0207667_107184502 | 207 |
| 288 | 3300026095 | Ga0207676_10446970 | Ga0207676_104469702 | 207 |
| 289 | 3300026118 | Ga0207675_101076773 | Ga0207675_1010767732 | 207 |
| 290 | 3300028380 | Ga0268265_10453107 | Ga0268265_104531072 | 207 |
| 291 | 3300029957 | Ga0265324_10036760 | Ga0265324_100367602 | 207 |
| 292 | 3300031507 | Ga0307509_10313299 | Ga0307509_103132992 | 207 |
| 293 | 3300042876 | Ga0451577_0162885 | Ga0451577_0162885_45_695 | 207 |
| 294 | 3300044673 | Ga0453683_0028338 | Ga0453683_0028338_2173_2826 | 207 |
| 295 | 3300044712 | Ga0453684_0331508 | Ga0453684_0331508_248_898 | 207 |
| 296 | 3300045051 | Ga0451576_0142245 | Ga0451576_0142245_407_1060 | 207 |
| 297 | 3300046536 | Ga0495587_0050166 | Ga0495587_0050166_1227_1925 | 207 |
| 298 | 3300053106 | Ga0500558_108491 | Ga0500558_108491_386_1039 | 207 |
| 299 | 3300003322 | rootL2_10095019 | rootL2_100950192 | 208 |
| 300 | 3300005327 | Ga0070658_10449313 | Ga0070658_104493131 | 208 |
| 301 | 3300005328 | Ga0070676_10009973 | Ga0070676_100099735 | 208 |
| 302 | 3300005328 | Ga0070676_10132958 | Ga0070676_101329583 | 208 |
| 303 | 3300005334 | Ga0068869_100110730 | Ga0068869_1001107302 | 208 |
| 304 | 3300005335 | Ga0070666_10321439 | Ga0070666_103214392 | 208 |
| 305 | 3300005338 | Ga0068868_100094578 | Ga0068868_1000945782 | 208 |
| 306 | 3300005347 | Ga0070668_100024849 | Ga0070668_1000248496 | 208 |
| 307 | 3300005347 | Ga0070668_100289790 | Ga0070668_1002897902 | 208 |
| 308 | 3300005353 | Ga0070669_100134161 | Ga0070669_1001341612 | 208 |
| 309 | 3300005354 | Ga0070675_100091367 | Ga0070675_1000913673 | 208 |
| 310 | 3300005364 | Ga0070673_100443395 | Ga0070673_1004433952 | 208 |
| 311 | 3300005367 | Ga0070667_100591404 | Ga0070667_1005914041 | 208 |
| 312 | 3300005437 | Ga0070710_10156140 | Ga0070710_101561401 | 208 |
| 313 | 3300005441 | Ga0070700_100013808 | Ga0070700_1000138083 | 208 |
| 314 | 3300005456 | Ga0070678_100120737 | Ga0070678_1001207372 | 208 |
| 315 | 3300005459 | Ga0068867_100022629 | Ga0068867_1000226295 | 208 |
| 316 | 3300005459 | Ga0068867_100025240 | Ga0068867_1000252403 | 208 |
| 317 | 3300005459 | Ga0068867_100090222 | Ga0068867_1000902222 | 208 |
| 318 | 3300005543 | Ga0070672_100219683 | Ga0070672_1002196832 | 208 |
| 319 | 3300005548 | Ga0070665_100437813 | Ga0070665_1004378132 | 208 |
| 320 | 3300005577 | Ga0068857_100855020 | Ga0068857_1008550201 | 208 |
| 321 | 3300005577 | Ga0068857_101322220 | Ga0068857_1013222201 | 208 |
| 322 | 3300005578 | Ga0068854_100766937 | Ga0068854_1007669371 | 208 |
| 323 | 3300005617 | Ga0068859_100284369 | Ga0068859_1002843692 | 208 |
| 324 | 3300005617 | Ga0068859_101174319 | Ga0068859_1011743192 | 208 |
| 325 | 3300005719 | Ga0068861_100134761 | Ga0068861_1001347612 | 208 |
| 326 | 3300005842 | Ga0068858_100046651 | Ga0068858_1000466512 | 208 |
| 327 | 3300005844 | Ga0068862_100168931 | Ga0068862_1001689312 | 208 |
| 328 | 3300006237 | Ga0097621_100156877 | Ga0097621_1001568772 | 208 |
| 329 | 3300006358 | Ga0068871_100069852 | Ga0068871_1000698522 | 208 |
| 330 | 3300006881 | Ga0068865_100013736 | Ga0068865_1000137363 | 208 |
| 331 | 3300006931 | Ga0097620_100284371 | Ga0097620_1002843712 | 208 |
| 332 | 3300006931 | Ga0097620_101174762 | Ga0097620_1011747622 | 208 |
| 333 | 3300009098 | Ga0105245_11187890 | Ga0105245_111878901 | 208 |
| 334 | 3300009148 | Ga0105243_10382283 | Ga0105243_103822831 | 208 |
| 335 | 3300009545 | Ga0105237_10028008 | Ga0105237_100280084 | 208 |
| 336 | 3300009545 | Ga0105237_10755455 | Ga0105237_107554551 | 208 |
| 337 | 3300010375 | Ga0105239_10994680 | Ga0105239_109946802 | 208 |
| 338 | 3300014326 | Ga0157380_10004887 | Ga0157380_100048876 | 208 |
| 339 | 3300025898 | Ga0207692_10080365 | Ga0207692_100803651 | 208 |
| 340 | 3300025903 | Ga0207680_10181017 | Ga0207680_101810172 | 208 |
| 341 | 3300025905 | Ga0207685_10114313 | Ga0207685_101143132 | 208 |
| 342 | 3300025907 | Ga0207645_10026936 | Ga0207645_100269362 | 208 |
| 343 | 3300025908 | Ga0207643_10012952 | Ga0207643_100129522 | 208 |
| 344 | 3300025909 | Ga0207705_10016092 | Ga0207705_100160924 | 208 |
| 345 | 3300025914 | Ga0207671_10015791 | Ga0207671_100157912 | 208 |
| 346 | 3300025923 | Ga0207681_10018449 | Ga0207681_100184493 | 208 |
| 347 | 3300025933 | Ga0207706_10053512 | Ga0207706_100535123 | 208 |
| 348 | 3300025933 | Ga0207706_10125507 | Ga0207706_101255072 | 208 |
| 349 | 3300025933 | Ga0207706_10381431 | Ga0207706_103814312 | 208 |
| 350 | 3300025934 | Ga0207686_10287598 | Ga0207686_102875981 | 208 |
| 351 | 3300025938 | Ga0207704_10022303 | Ga0207704_100223032 | 208 |
| 352 | 3300025940 | Ga0207691_10432076 | Ga0207691_104320761 | 208 |
| 353 | 3300025942 | Ga0207689_10110436 | Ga0207689_101104362 | 208 |
| 354 | 3300025942 | Ga0207689_10487671 | Ga0207689_104876712 | 208 |
| 355 | 3300025949 | Ga0207667_10641997 | Ga0207667_106419972 | 208 |
| 356 | 3300025960 | Ga0207651_10176609 | Ga0207651_101766091 | 208 |
| 357 | 3300025972 | Ga0207668_10184956 | Ga0207668_101849562 | 208 |
| 358 | 3300025972 | Ga0207668_10227397 | Ga0207668_102273972 | 208 |
| 359 | 3300025981 | Ga0207640_10722151 | Ga0207640_107221512 | 208 |
| 360 | 3300025986 | Ga0207658_10202547 | Ga0207658_102025472 | 208 |
| 361 | 3300026035 | Ga0207703_10075965 | Ga0207703_100759652 | 208 |
| 362 | 3300026041 | Ga0207639_10480427 | Ga0207639_104804271 | 208 |
| 363 | 3300026075 | Ga0207708_10199468 | Ga0207708_101994682 | 208 |
| 364 | 3300026089 | Ga0207648_10065816 | Ga0207648_100658162 | 208 |
| 365 | 3300026089 | Ga0207648_10102235 | Ga0207648_101022353 | 208 |
| 366 | 3300026116 | Ga0207674_10211943 | Ga0207674_102119432 | 208 |
| 367 | 3300026116 | Ga0207674_10234977 | Ga0207674_102349771 | 208 |
| 368 | 3300026118 | Ga0207675_100091678 | Ga0207675_1000916782 | 208 |
| 369 | 3300026118 | Ga0207675_100501076 | Ga0207675_1005010761 | 208 |
| 370 | 3300026121 | Ga0207683_10007087 | Ga0207683_100070873 | 208 |
| 371 | 3300028379 | Ga0268266_10305193 | Ga0268266_103051932 | 208 |
| 372 | 3300028380 | Ga0268265_10912788 | Ga0268265_109127881 | 208 |
| 373 | 3300028563 | Ga0265319_1026809 | Ga0265319_10268092 | 208 |
| 374 | 3300028800 | Ga0265338_10011548 | Ga0265338_100115488 | 208 |
| 375 | 3300031251 | Ga0265327_10003286 | Ga0265327_100032867 | 208 |
| 376 | 3300031251 | Ga0265327_10103771 | Ga0265327_101037711 | 208 |
| 377 | 3300031731 | Ga0307405_10826351 | Ga0307405_108263512 | 208 |
| 378 | 3300031995 | Ga0307409_100144330 | Ga0307409_1001443302 | 208 |
| 379 | 3300032126 | Ga0307415_100510607 | Ga0307415_1005106072 | 208 |
| 380 | 3300032126 | Ga0307415_100816937 | Ga0307415_1008169371 | 208 |
| 381 | 3300035119 | Ga0373956_0115860 | Ga0373956_0115860_307_933 | 208 |
| 382 | 3300036401 | Ga0373937_0213003 | Ga0373937_0213003_52_678 | 208 |
| 383 | 3300041496 | Ga0451839_0591939 | Ga0451839_0591939_20_673 | 208 |
| 384 | 3300046457 | Ga0495590_0046972 | Ga0495590_0046972_276_902 | 208 |
| 385 | 3300046522 | Ga0495643_0000214 | Ga0495643_0000214_81370_82026 | 208 |
| 386 | 3300048907 | Ga0496104_0135615 | Ga0496104_0135615_545_1171 | 208 |
| 387 | 3300049571 | Ga0501034_0089507 | Ga0501034_0089507_1840_2490 | 208 |
| 388 | 3300049586 | Ga0501070_0583593 | Ga0501070_0583593_239_865 | 208 |
| 389 | 3300053153 | Ga0500616_0032412 | Ga0500616_0032412_1247_1903 | 208 |
| 390 | 3300061734 | Ga0530510_0077153 | Ga0530510_0077153_293_919 | 208 |
| 391 | 3300005337 | Ga0070682_100115377 | Ga0070682_1001153772 | 209 |
| 392 | 3300005367 | Ga0070667_100143690 | Ga0070667_1001436902 | 209 |
| 393 | 3300005530 | Ga0070679_100062616 | Ga0070679_1000626162 | 209 |
| 394 | 3300005841 | Ga0068863_100001082 | Ga0068863_10000108225 | 209 |
| 395 | 3300005842 | Ga0068858_100030767 | Ga0068858_1000307675 | 209 |
| 396 | 3300005843 | Ga0068860_100000878 | Ga0068860_10000087817 | 209 |
| 397 | 3300005844 | Ga0068862_100028773 | Ga0068862_1000287732 | 209 |
| 398 | 3300005844 | Ga0068862_100456597 | Ga0068862_1004565972 | 209 |
| 399 | 3300006358 | Ga0068871_100332048 | Ga0068871_1003320482 | 209 |
| 400 | 3300006881 | Ga0068865_100341125 | Ga0068865_1003411252 | 209 |
| 401 | 3300009093 | Ga0105240_10018068 | Ga0105240_100180685 | 209 |
| 402 | 3300009093 | Ga0105240_10057832 | Ga0105240_100578322 | 209 |
| 403 | 3300009551 | Ga0105238_10037280 | Ga0105238_100372802 | 209 |
| 404 | 3300009551 | Ga0105238_10331969 | Ga0105238_103319692 | 209 |
| 405 | 3300010375 | Ga0105239_10412875 | Ga0105239_104128752 | 209 |
| 406 | 3300013308 | Ga0157375_10004701 | Ga0157375_100047016 | 209 |
| 407 | 3300017792 | Ga0163161_10524622 | Ga0163161_105246222 | 209 |
| 408 | 3300025900 | Ga0207710_10166097 | Ga0207710_101660972 | 209 |
| 409 | 3300025913 | Ga0207695_10111236 | Ga0207695_101112362 | 209 |
| 410 | 3300025921 | Ga0207652_10046335 | Ga0207652_100463352 | 209 |
| 411 | 3300025924 | Ga0207694_10486284 | Ga0207694_104862842 | 209 |
| 412 | 3300025931 | Ga0207644_10179204 | Ga0207644_101792041 | 209 |
| 413 | 3300025942 | Ga0207689_10655053 | Ga0207689_106550531 | 209 |
| 414 | 3300025986 | Ga0207658_10362843 | Ga0207658_103628432 | 209 |
| 415 | 3300026035 | Ga0207703_10001858 | Ga0207703_100018586 | 209 |
| 416 | 3300026067 | Ga0207678_10069374 | Ga0207678_100693742 | 209 |
| 417 | 3300026078 | Ga0207702_10184420 | Ga0207702_101844202 | 209 |
| 418 | 3300026088 | Ga0207641_10000217 | Ga0207641_1000021753 | 209 |
| 419 | 3300026088 | Ga0207641_10427604 | Ga0207641_104276042 | 209 |
| 420 | 3300026089 | Ga0207648_10443515 | Ga0207648_104435152 | 209 |
| 421 | 3300028379 | Ga0268266_10008971 | Ga0268266_100089712 | 209 |
| 422 | 3300028380 | Ga0268265_10089988 | Ga0268265_100899882 | 209 |
| 423 | 3300028380 | Ga0268265_10555792 | Ga0268265_105557923 | 209 |
| 424 | 3300028381 | Ga0268264_10000058 | Ga0268264_1000005831 | 209 |
| 425 | 3300028381 | Ga0268264_10000060 | Ga0268264_1000006025 | 209 |
| 426 | 3300031456 | Ga0307513_10026034 | Ga0307513_100260343 | 209 |
| 427 | 3300041453 | Ga0451797_0171226 | Ga0451797_0171226_149_784 | 209 |
| 428 | 3300041460 | Ga0451802_0111061 | Ga0451802_0111061_1862_2497 | 209 |
| 429 | 3300041486 | Ga0451807_1688973 | Ga0451807_1688973_3060_3698 | 209 |
| 430 | 3300042156 | Ga0439446_0047201 | Ga0439446_0047201_435_1106 | 209 |
| 431 | 3300046457 | Ga0495590_0001029 | Ga0495590_0001029_5449_6087 | 209 |
| 432 | 3300046519 | Ga0495632_0053285 | Ga0495632_0053285_781_1419 | 209 |
| 433 | 3300046660 | Ga0495625_0010605 | Ga0495625_0010605_2805_3443 | 209 |
| 434 | 3300047320 | Ga0495672_0277719 | Ga0495672_0277719_150_788 | 209 |
| 435 | 3300047472 | Ga0495686_0246460 | Ga0495686_0246460_153_782 | 209 |
| 436 | 3300048921 | Ga0496118_0164018 | Ga0496118_0164018_243_872 | 209 |
| 437 | 3300048924 | Ga0496121_0066352 | Ga0496121_0066352_1059_1688 | 209 |
| 438 | 3300048928 | Ga0496125_0002234 | Ga0496125_0002234_14356_14985 | 209 |
| 439 | 3300048929 | Ga0496126_0478054 | Ga0496126_0478054_75_704 | 209 |
| 440 | 3300049459 | Ga0495678_022739 | Ga0495678_022739_967_1605 | 209 |
| 441 | 3300049583 | Ga0501067_0008524 | Ga0501067_0008524_2024_2662 | 209 |
| 442 | 3300049584 | Ga0501068_0005963 | Ga0501068_0005963_2748_3386 | 209 |
| 443 | 3300049586 | Ga0501070_0051592 | Ga0501070_0051592_1947_2585 | 209 |
| 444 | 3300049587 | Ga0501071_0006847 | Ga0501071_0006847_2411_3049 | 209 |
| 445 | 3300049589 | Ga0501073_0010359 | Ga0501073_0010359_4262_4900 | 209 |
| 446 | 3300049590 | Ga0501074_0000405 | Ga0501074_0000405_408_1046 | 209 |
| 447 | 3300049592 | Ga0501076_0007170 | Ga0501076_0007170_1613_2251 | 209 |
| 448 | 3300049593 | Ga0501077_0008833 | Ga0501077_0008833_964_1602 | 209 |
| 449 | 3300049741 | Ga0501079_0004012 | Ga0501079_0004012_6410_7048 | 209 |
| 450 | 3300049742 | Ga0501080_0003407 | Ga0501080_0003407_9994_10632 | 209 |
| 451 | 3300049743 | Ga0501081_0027625 | Ga0501081_0027625_3014_3652 | 209 |
| 452 | 3300049744 | Ga0501083_0016483 | Ga0501083_0016483_899_1537 | 209 |
| 453 | 3300054114 | Ga0501084_0012026 | Ga0501084_0012026_1492_2130 | 209 |
| 454 | 3300060353 | Ga0501082_0011806 | Ga0501082_0011806_2456_3094 | 209 |
| 455 | 3300005329 | Ga0070683_100803399 | Ga0070683_1008033992 | 210 |
| 456 | 3300005333 | Ga0070677_10063017 | Ga0070677_100630172 | 210 |
| 457 | 3300005334 | Ga0068869_100149280 | Ga0068869_1001492802 | 210 |
| 458 | 3300005334 | Ga0068869_100155783 | Ga0068869_1001557832 | 210 |
| 459 | 3300005335 | Ga0070666_10000239 | Ga0070666_100002395 | 210 |
| 460 | 3300005337 | Ga0070682_100002961 | Ga0070682_1000029619 | 210 |
| 461 | 3300005337 | Ga0070682_100137504 | Ga0070682_1001375042 | 210 |
| 462 | 3300005338 | Ga0068868_100720808 | Ga0068868_1007208081 | 210 |
| 463 | 3300005340 | Ga0070689_100010836 | Ga0070689_1000108365 | 210 |
| 464 | 3300005340 | Ga0070689_100530814 | Ga0070689_1005308142 | 210 |
| 465 | 3300005340 | Ga0070689_100641570 | Ga0070689_1006415701 | 210 |
| 466 | 3300005341 | Ga0070691_10494791 | Ga0070691_104947911 | 210 |
| 467 | 3300005343 | Ga0070687_100651501 | Ga0070687_1006515011 | 210 |
| 468 | 3300005344 | Ga0070661_100051593 | Ga0070661_1000515932 | 210 |
| 469 | 3300005344 | Ga0070661_100064639 | Ga0070661_1000646392 | 210 |
| 470 | 3300005347 | Ga0070668_100501690 | Ga0070668_1005016901 | 210 |
| 471 | 3300005347 | Ga0070668_100921229 | Ga0070668_1009212291 | 210 |
| 472 | 3300005353 | Ga0070669_100616081 | Ga0070669_1006160812 | 210 |
| 473 | 3300005354 | Ga0070675_100037736 | Ga0070675_1000377364 | 210 |
| 474 | 3300005354 | Ga0070675_100139446 | Ga0070675_1001394462 | 210 |
| 475 | 3300005354 | Ga0070675_100998002 | Ga0070675_1009980021 | 210 |
| 476 | 3300005364 | Ga0070673_100103082 | Ga0070673_1001030821 | 210 |
| 477 | 3300005364 | Ga0070673_100321176 | Ga0070673_1003211762 | 210 |
| 478 | 3300005364 | Ga0070673_100726957 | Ga0070673_1007269572 | 210 |
| 479 | 3300005365 | Ga0070688_100241554 | Ga0070688_1002415542 | 210 |
| 480 | 3300005365 | Ga0070688_100358850 | Ga0070688_1003588502 | 210 |
| 481 | 3300005365 | Ga0070688_100624940 | Ga0070688_1006249402 | 210 |
| 482 | 3300005367 | Ga0070667_100100676 | Ga0070667_1001006763 | 210 |
| 483 | 3300005438 | Ga0070701_10017426 | Ga0070701_100174262 | 210 |
| 484 | 3300005438 | Ga0070701_10172989 | Ga0070701_101729892 | 210 |
| 485 | 3300005441 | Ga0070700_100022106 | Ga0070700_1000221063 | 210 |
| 486 | 3300005444 | Ga0070694_100256003 | Ga0070694_1002560032 | 210 |
| 487 | 3300005455 | Ga0070663_100173728 | Ga0070663_1001737282 | 210 |
| 488 | 3300005455 | Ga0070663_100322822 | Ga0070663_1003228222 | 210 |
| 489 | 3300005455 | Ga0070663_100437979 | Ga0070663_1004379792 | 210 |
| 490 | 3300005456 | Ga0070678_100025465 | Ga0070678_1000254653 | 210 |
| 491 | 3300005456 | Ga0070678_100041542 | Ga0070678_1000415423 | 210 |
| 492 | 3300005457 | Ga0070662_100022542 | Ga0070662_1000225421 | 210 |
| 493 | 3300005457 | Ga0070662_100118024 | Ga0070662_1001180242 | 210 |
| 494 | 3300005466 | Ga0070685_10061807 | Ga0070685_100618072 | 210 |
| 495 | 3300005466 | Ga0070685_10363955 | Ga0070685_103639552 | 210 |
| 496 | 3300005543 | Ga0070672_100010396 | Ga0070672_1000103967 | 210 |
| 497 | 3300005543 | Ga0070672_100026815 | Ga0070672_1000268152 | 210 |
| 498 | 3300005543 | Ga0070672_100048540 | Ga0070672_1000485403 | 210 |
| 499 | 3300005544 | Ga0070686_100015956 | Ga0070686_1000159563 | 210 |
| 500 | 3300005548 | Ga0070665_100008331 | Ga0070665_1000083312 | 210 |
| 501 | 3300005548 | Ga0070665_100363777 | Ga0070665_1003637772 | 210 |
| 502 | 3300005563 | Ga0068855_100035915 | Ga0068855_1000359155 | 210 |
| 503 | 3300005564 | Ga0070664_100014517 | Ga0070664_1000145176 | 210 |
| 504 | 3300005578 | Ga0068854_100001633 | Ga0068854_1000016333 | 210 |
| 505 | 3300005614 | Ga0068856_100608688 | Ga0068856_1006086882 | 210 |
| 506 | 3300005615 | Ga0070702_100011956 | Ga0070702_1000119562 | 210 |
| 507 | 3300005615 | Ga0070702_100374767 | Ga0070702_1003747672 | 210 |
| 508 | 3300005615 | Ga0070702_100392047 | Ga0070702_1003920472 | 210 |
| 509 | 3300005616 | Ga0068852_100026314 | Ga0068852_1000263142 | 210 |
| 510 | 3300005617 | Ga0068859_100160391 | Ga0068859_1001603912 | 210 |
| 511 | 3300005617 | Ga0068859_100366986 | Ga0068859_1003669862 | 210 |
| 512 | 3300005618 | Ga0068864_100102696 | Ga0068864_1001026962 | 210 |
| 513 | 3300005618 | Ga0068864_100247640 | Ga0068864_1002476402 | 210 |
| 514 | 3300005718 | Ga0068866_10207352 | Ga0068866_102073522 | 210 |
| 515 | 3300005718 | Ga0068866_10222703 | Ga0068866_102227031 | 210 |
| 516 | 3300005719 | Ga0068861_100006072 | Ga0068861_1000060729 | 210 |
| 517 | 3300005719 | Ga0068861_100007372 | Ga0068861_1000073724 | 210 |
| 518 | 3300005719 | Ga0068861_100164035 | Ga0068861_1001640353 | 210 |
| 519 | 3300005719 | Ga0068861_100198619 | Ga0068861_1001986192 | 210 |
| 520 | 3300005719 | Ga0068861_100463860 | Ga0068861_1004638602 | 210 |
| 521 | 3300005834 | Ga0068851_10001806 | Ga0068851_100018063 | 210 |
| 522 | 3300005840 | Ga0068870_10001457 | Ga0068870_100014572 | 210 |
| 523 | 3300005840 | Ga0068870_10191787 | Ga0068870_101917872 | 210 |
| 524 | 3300005841 | Ga0068863_100128289 | Ga0068863_1001282893 | 210 |
| 525 | 3300005841 | Ga0068863_100146756 | Ga0068863_1001467563 | 210 |
| 526 | 3300005841 | Ga0068863_100284907 | Ga0068863_1002849072 | 210 |
| 527 | 3300005842 | Ga0068858_100003283 | Ga0068858_1000032835 | 210 |
| 528 | 3300005844 | Ga0068862_100057971 | Ga0068862_1000579713 | 210 |
| 529 | 3300005844 | Ga0068862_100482419 | Ga0068862_1004824192 | 210 |
| 530 | 3300006163 | Ga0070715_10507707 | Ga0070715_105077071 | 210 |
| 531 | 3300006237 | Ga0097621_100203097 | Ga0097621_1002030972 | 210 |
| 532 | 3300006237 | Ga0097621_100366002 | Ga0097621_1003660022 | 210 |
| 533 | 3300006358 | Ga0068871_100103159 | Ga0068871_1001031592 | 210 |
| 534 | 3300006358 | Ga0068871_100149280 | Ga0068871_1001492802 | 210 |
| 535 | 3300006881 | Ga0068865_100010271 | Ga0068865_1000102715 | 210 |
| 536 | 3300006881 | Ga0068865_100056466 | Ga0068865_1000564662 | 210 |
| 537 | 3300006881 | Ga0068865_100298502 | Ga0068865_1002985022 | 210 |
| 538 | 3300006931 | Ga0097620_100160396 | Ga0097620_1001603962 | 210 |
| 539 | 3300006931 | Ga0097620_100366991 | Ga0097620_1003669912 | 210 |
| 540 | 3300009094 | Ga0111539_10088809 | Ga0111539_100888093 | 210 |
| 541 | 3300009094 | Ga0111539_10209204 | Ga0111539_102092042 | 210 |
| 542 | 3300009148 | Ga0105243_10374074 | Ga0105243_103740742 | 210 |
| 543 | 3300009176 | Ga0105242_10222059 | Ga0105242_102220593 | 210 |
| 544 | 3300009177 | Ga0105248_10161297 | Ga0105248_101612972 | 210 |
| 545 | 3300009177 | Ga0105248_10170358 | Ga0105248_101703584 | 210 |
| 546 | 3300009553 | Ga0105249_10566131 | Ga0105249_105661312 | 210 |
| 547 | 3300013306 | Ga0163162_10169995 | Ga0163162_101699952 | 210 |
| 548 | 3300013308 | Ga0157375_11035011 | Ga0157375_110350112 | 210 |
| 549 | 3300014325 | Ga0163163_10043577 | Ga0163163_100435773 | 210 |
| 550 | 3300014326 | Ga0157380_10127130 | Ga0157380_101271303 | 210 |
| 551 | 3300014326 | Ga0157380_10133286 | Ga0157380_101332863 | 210 |
| 552 | 3300014326 | Ga0157380_10166658 | Ga0157380_101666583 | 210 |
| 553 | 3300014326 | Ga0157380_10237221 | Ga0157380_102372213 | 210 |
| 554 | 3300014968 | Ga0157379_10706706 | Ga0157379_107067062 | 210 |
| 555 | 3300014969 | Ga0157376_10038493 | Ga0157376_100384932 | 210 |
| 556 | 3300014969 | Ga0157376_10233686 | Ga0157376_102336862 | 210 |
| 557 | 3300014969 | Ga0157376_10426574 | Ga0157376_104265742 | 210 |
| 558 | 3300025893 | Ga0207682_10005406 | Ga0207682_100054062 | 210 |
| 559 | 3300025905 | Ga0207685_10415554 | Ga0207685_104155541 | 210 |
| 560 | 3300025908 | Ga0207643_10054590 | Ga0207643_100545902 | 210 |
| 561 | 3300025911 | Ga0207654_10042683 | Ga0207654_100426832 | 210 |
| 562 | 3300025913 | Ga0207695_10123568 | Ga0207695_101235682 | 210 |
| 563 | 3300025920 | Ga0207649_10041909 | Ga0207649_100419092 | 210 |
| 564 | 3300025924 | Ga0207694_10000784 | Ga0207694_1000078429 | 210 |
| 565 | 3300025926 | Ga0207659_10045020 | Ga0207659_100450204 | 210 |
| 566 | 3300025926 | Ga0207659_10115488 | Ga0207659_101154882 | 210 |
| 567 | 3300025926 | Ga0207659_10117147 | Ga0207659_101171472 | 210 |
| 568 | 3300025933 | Ga0207706_10004965 | Ga0207706_100049655 | 210 |
| 569 | 3300025935 | Ga0207709_10145941 | Ga0207709_101459411 | 210 |
| 570 | 3300025936 | Ga0207670_10007470 | Ga0207670_100074707 | 210 |
| 571 | 3300025937 | Ga0207669_10216422 | Ga0207669_102164222 | 210 |
| 572 | 3300025938 | Ga0207704_10032099 | Ga0207704_100320992 | 210 |
| 573 | 3300025940 | Ga0207691_10008149 | Ga0207691_100081499 | 210 |
| 574 | 3300025940 | Ga0207691_10043483 | Ga0207691_100434833 | 210 |
| 575 | 3300025940 | Ga0207691_10297280 | Ga0207691_102972801 | 210 |
| 576 | 3300025941 | Ga0207711_10156947 | Ga0207711_101569473 | 210 |
| 577 | 3300025941 | Ga0207711_10514909 | Ga0207711_105149092 | 210 |
| 578 | 3300025942 | Ga0207689_10029034 | Ga0207689_100290342 | 210 |
| 579 | 3300025942 | Ga0207689_10227515 | Ga0207689_102275153 | 210 |
| 580 | 3300025942 | Ga0207689_10248253 | Ga0207689_102482534 | 210 |
| 581 | 3300025949 | Ga0207667_11294703 | Ga0207667_112947031 | 210 |
| 582 | 3300025960 | Ga0207651_10136050 | Ga0207651_101360501 | 210 |
| 583 | 3300025961 | Ga0207712_10173600 | Ga0207712_101736002 | 210 |
| 584 | 3300025972 | Ga0207668_10356008 | Ga0207668_103560082 | 210 |
| 585 | 3300025981 | Ga0207640_10013953 | Ga0207640_100139534 | 210 |
| 586 | 3300026035 | Ga0207703_10004699 | Ga0207703_100046994 | 210 |
| 587 | 3300026041 | Ga0207639_10000836 | Ga0207639_1000083613 | 210 |
| 588 | 3300026067 | Ga0207678_10059818 | Ga0207678_100598184 | 210 |
| 589 | 3300026067 | Ga0207678_10205120 | Ga0207678_102051202 | 210 |
| 590 | 3300026075 | Ga0207708_10014631 | Ga0207708_100146313 | 210 |
| 591 | 3300026088 | Ga0207641_10081047 | Ga0207641_100810472 | 210 |
| 592 | 3300026088 | Ga0207641_10278870 | Ga0207641_102788702 | 210 |
| 593 | 3300026088 | Ga0207641_10696100 | Ga0207641_106961002 | 210 |
| 594 | 3300026089 | Ga0207648_10068616 | Ga0207648_100686164 | 210 |
| 595 | 3300026089 | Ga0207648_10932586 | Ga0207648_109325862 | 210 |
| 596 | 3300026095 | Ga0207676_10065516 | Ga0207676_100655163 | 210 |
| 597 | 3300026118 | Ga0207675_100002110 | Ga0207675_10000211017 | 210 |
| 598 | 3300026118 | Ga0207675_100002779 | Ga0207675_10000277919 | 210 |
| 599 | 3300026118 | Ga0207675_100186531 | Ga0207675_1001865313 | 210 |
| 600 | 3300026118 | Ga0207675_100198662 | Ga0207675_1001986623 | 210 |
| 601 | 3300026118 | Ga0207675_100673102 | Ga0207675_1006731022 | 210 |
| 602 | 3300026121 | Ga0207683_10014004 | Ga0207683_100140042 | 210 |
| 603 | 3300026121 | Ga0207683_10048570 | Ga0207683_100485702 | 210 |
| 604 | 3300028379 | Ga0268266_10098279 | Ga0268266_100982792 | 210 |
| 605 | 3300028379 | Ga0268266_10222782 | Ga0268266_102227823 | 210 |
| 606 | 3300028380 | Ga0268265_10438294 | Ga0268265_104382942 | 210 |
| 607 | 3300031456 | Ga0307513_10013647 | Ga0307513_100136476 | 210 |
| 608 | 3300031456 | Ga0307513_10023596 | Ga0307513_100235968 | 210 |
| 609 | 3300031456 | Ga0307513_10143864 | Ga0307513_101438643 | 210 |
| 610 | 3300031731 | Ga0307405_10219469 | Ga0307405_102194692 | 210 |
| 611 | 3300031824 | Ga0307413_10052491 | Ga0307413_100524912 | 210 |
| 612 | 3300031852 | Ga0307410_10028299 | Ga0307410_100282992 | 210 |
| 613 | 3300031852 | Ga0307410_10210176 | Ga0307410_102101762 | 210 |
| 614 | 3300031901 | Ga0307406_10340611 | Ga0307406_103406112 | 210 |
| 615 | 3300031903 | Ga0307407_10057003 | Ga0307407_100570032 | 210 |
| 616 | 3300031903 | Ga0307407_10282334 | Ga0307407_102823342 | 210 |
| 617 | 3300031995 | Ga0307409_100553631 | Ga0307409_1005536312 | 210 |
| 618 | 3300032002 | Ga0307416_100113217 | Ga0307416_1001132172 | 210 |
| 619 | 3300032002 | Ga0307416_100226911 | Ga0307416_1002269112 | 210 |
| 620 | 3300032005 | Ga0307411_10000884 | Ga0307411_1000088412 | 210 |
| 621 | 3300032005 | Ga0307411_10131559 | Ga0307411_101315592 | 210 |
| 622 | 3300032126 | Ga0307415_100036883 | Ga0307415_1000368831 | 210 |
| 623 | 3300032126 | Ga0307415_100133460 | Ga0307415_1001334602 | 210 |
| 624 | 3300046460 | Ga0495638_0006869 | Ga0495638_0006869_3098_3736 | 210 |
| 625 | 3300046513 | Ga0495616_0000837 | Ga0495616_0000837_17557_18204 | 210 |
| 626 | 3300046660 | Ga0495625_0175026 | Ga0495625_0175026_622_1260 | 210 |
| 627 | 3300046694 | Ga0495649_0018603 | Ga0495649_0018603_2956_3594 | 210 |
| 628 | 3300049568 | Ga0501031_0012034 | Ga0501031_0012034_36_701 | 210 |
| 629 | 3300049569 | Ga0501032_0001081 | Ga0501032_0001081_1746_2411 | 210 |
| 630 | 3300049570 | Ga0501033_0013136 | Ga0501033_0013136_3898_4563 | 210 |
| 631 | 3300049571 | Ga0501034_0169034 | Ga0501034_0169034_1024_1689 | 210 |
| 632 | 3300049572 | Ga0501036_0009221 | Ga0501036_0009221_6537_7202 | 210 |
| 633 | 3300049573 | Ga0501037_0005804 | Ga0501037_0005804_6721_7386 | 210 |
| 634 | 3300049574 | Ga0501038_0116972 | Ga0501038_0116972_1202_1867 | 210 |
| 635 | 3300049578 | Ga0501042_0003972 | Ga0501042_0003972_8069_8734 | 210 |
| 636 | 3300049579 | Ga0501043_0036679 | Ga0501043_0036679_1629_2294 | 210 |
| 637 | 3300049742 | Ga0501080_0089285 | Ga0501080_0089285_1537_2202 | 210 |
| 638 | 3300049744 | Ga0501083_0046539 | Ga0501083_0046539_1214_1879 | 210 |
| 639 | 3300049822 | Ga0501035_0019178 | Ga0501035_0019178_3898_4563 | 210 |
| 640 | 3300049823 | Ga0501044_0028790 | Ga0501044_0028790_1297_1962 | 210 |
| 641 | 3300050511 | nmdc:mga08y16_65792_c1 | nmdc:mga08y16_65792_c1_1420_2058 | 210 |
| 642 | 3300050511 | nmdc:mga08y16_859553_c1 | nmdc:mga08y16_859553_c1_244_882 | 210 |
| 643 | 3300005544 | Ga0070686_100258195 | Ga0070686_1002581952 | 211 |
| 644 | 3300005843 | Ga0068860_100018738 | Ga0068860_1000187385 | 211 |
| 645 | 3300006237 | Ga0097621_100214882 | Ga0097621_1002148822 | 211 |
| 646 | 3300006931 | Ga0097620_100688829 | Ga0097620_1006888292 | 211 |
| 647 | 3300009551 | Ga0105238_10024347 | Ga0105238_100243474 | 211 |
| 648 | 3300013308 | Ga0157375_10680513 | Ga0157375_106805132 | 211 |
| 649 | 3300014969 | Ga0157376_10057121 | Ga0157376_100571212 | 211 |
| 650 | 3300025924 | Ga0207694_10005868 | Ga0207694_100058688 | 211 |
| 651 | 3300028381 | Ga0268264_10061028 | Ga0268264_100610281 | 211 |
| 652 | 3300030521 | Ga0307511_10012417 | Ga0307511_100124179 | 211 |
| 653 | 3300032002 | Ga0307416_100269170 | Ga0307416_1002691702 | 211 |
| 654 | 3300032126 | Ga0307415_100160960 | Ga0307415_1001609602 | 211 |
| 655 | 3300039437 | Ga0436365_0208206 | Ga0436365_0208206_639_1280 | 211 |
| 656 | 3300041451 | Ga0451791_1748093 | Ga0451791_1748093_242_877 | 211 |
| 657 | 3300041459 | Ga0451800_0010766 | Ga0451800_0010766_264_899 | 211 |
| 658 | 3300041463 | Ga0451804_1183977 | Ga0451804_1183977_644_1279 | 211 |
| 659 | 3300041494 | Ga0451837_0957394 | Ga0451837_0957394_904_1539 | 211 |
| 660 | 3300041512 | Ga0451853_2579635 | Ga0451853_2579635_228_863 | 211 |
| 661 | 3300048906 | Ga0496103_0042528 | Ga0496103_0042528_268_909 | 211 |
| 662 | 3300048921 | Ga0496118_0008446 | Ga0496118_0008446_8990_9631 | 211 |
| 663 | 3300005327 | Ga0070658_10067994 | Ga0070658_100679943 | 212 |
| 664 | 3300005355 | Ga0070671_100000727 | Ga0070671_10000072717 | 212 |
| 665 | 3300005367 | Ga0070667_100071416 | Ga0070667_1000714162 | 212 |
| 666 | 3300005548 | Ga0070665_100073673 | Ga0070665_1000736732 | 212 |
| 667 | 3300005548 | Ga0070665_100163954 | Ga0070665_1001639542 | 212 |
| 668 | 3300005617 | Ga0068859_100015604 | Ga0068859_1000156042 | 212 |
| 669 | 3300005841 | Ga0068863_100004356 | Ga0068863_10000435613 | 212 |
| 670 | 3300005841 | Ga0068863_100563052 | Ga0068863_1005630523 | 212 |
| 671 | 3300005842 | Ga0068858_100000991 | Ga0068858_10000099121 | 212 |
| 672 | 3300005843 | Ga0068860_100021252 | Ga0068860_1000212523 | 212 |
| 673 | 3300005937 | Ga0081455_10005653 | Ga0081455_100056532 | 212 |
| 674 | 3300006931 | Ga0097620_100015605 | Ga0097620_1000156052 | 212 |
| 675 | 3300009101 | Ga0105247_10000743 | Ga0105247_1000074317 | 212 |
| 676 | 3300009177 | Ga0105248_10021102 | Ga0105248_100211022 | 212 |
| 677 | 3300013306 | Ga0163162_10030020 | Ga0163162_100300204 | 212 |
| 678 | 3300025900 | Ga0207710_10000510 | Ga0207710_1000051016 | 212 |
| 679 | 3300025931 | Ga0207644_10000910 | Ga0207644_1000091017 | 212 |
| 680 | 3300025941 | Ga0207711_10059660 | Ga0207711_100596602 | 212 |
| 681 | 3300025986 | Ga0207658_10018494 | Ga0207658_100184944 | 212 |
| 682 | 3300026035 | Ga0207703_10001490 | Ga0207703_100014908 | 212 |
| 683 | 3300026088 | Ga0207641_10003378 | Ga0207641_100033782 | 212 |
| 684 | 3300028379 | Ga0268266_10118317 | Ga0268266_101183172 | 212 |
| 685 | 3300028381 | Ga0268264_10058922 | Ga0268264_100589222 | 212 |
| 686 | 3300046517 | Ga0495630_0566472 | Ga0495630_0566472_120_764 | 212 |
| 687 | 3300046660 | Ga0495625_0041369 | Ga0495625_0041369_1608_2252 | 212 |
| 688 | 3300048905 | Ga0496102_0184614 | Ga0496102_0184614_596_1240 | 212 |
| 689 | 3300048910 | Ga0496107_0221381 | Ga0496107_0221381_717_1361 | 212 |
| 690 | 3300048911 | Ga0496108_0597922 | Ga0496108_0597922_222_866 | 212 |
| 691 | 3300048924 | Ga0496121_0003660 | Ga0496121_0003660_7321_7965 | 212 |
| 692 | 3300048928 | Ga0496125_0013999 | Ga0496125_0013999_4838_5482 | 212 |
| 693 | 3300049742 | Ga0501080_0555625 | Ga0501080_0555625_248_892 | 212 |
| 694 | 3300053727 | Ga0500611_005124 | Ga0500611_005124_486_1130 | 212 |
| 695 | 2162886006 | SwRhRL3b_contig_2609391 | SwRhRL3b_0276.00000600 | 213 |
| 696 | 2162886006 | SwRhRL3b_contig_4185416 | SwRhRL3b_0381.00000580 | 213 |
| 697 | 3300005295 | Ga0065707_10085706 | Ga0065707_100857063 | 213 |
| 698 | 3300005330 | Ga0070690_100272380 | Ga0070690_1002723802 | 213 |
| 699 | 3300005334 | Ga0068869_100263353 | Ga0068869_1002633532 | 213 |
| 700 | 3300005334 | Ga0068869_100495993 | Ga0068869_1004959931 | 213 |
| 701 | 3300005337 | Ga0070682_100230852 | Ga0070682_1002308522 | 213 |
| 702 | 3300005337 | Ga0070682_100702491 | Ga0070682_1007024911 | 213 |
| 703 | 3300005340 | Ga0070689_100500300 | Ga0070689_1005003001 | 213 |
| 704 | 3300005347 | Ga0070668_100203751 | Ga0070668_1002037512 | 213 |
| 705 | 3300005354 | Ga0070675_100058746 | Ga0070675_1000587462 | 213 |
| 706 | 3300005354 | Ga0070675_100291673 | Ga0070675_1002916731 | 213 |
| 707 | 3300005355 | Ga0070671_100184556 | Ga0070671_1001845562 | 213 |
| 708 | 3300005364 | Ga0070673_100257380 | Ga0070673_1002573802 | 213 |
| 709 | 3300005365 | Ga0070688_100232118 | Ga0070688_1002321182 | 213 |
| 710 | 3300005367 | Ga0070667_100437590 | Ga0070667_1004375901 | 213 |
| 711 | 3300005434 | Ga0070709_10268313 | Ga0070709_102683131 | 213 |
| 712 | 3300005439 | Ga0070711_100258179 | Ga0070711_1002581792 | 213 |
| 713 | 3300005439 | Ga0070711_100622853 | Ga0070711_1006228531 | 213 |
| 714 | 3300005456 | Ga0070678_100064409 | Ga0070678_1000644092 | 213 |
| 715 | 3300005456 | Ga0070678_100132854 | Ga0070678_1001328542 | 213 |
| 716 | 3300005466 | Ga0070685_10183743 | Ga0070685_101837432 | 213 |
| 717 | 3300005539 | Ga0068853_100360339 | Ga0068853_1003603392 | 213 |
| 718 | 3300005543 | Ga0070672_100016046 | Ga0070672_1000160462 | 213 |
| 719 | 3300005548 | Ga0070665_100229410 | Ga0070665_1002294102 | 213 |
| 720 | 3300005578 | Ga0068854_100229976 | Ga0068854_1002299762 | 213 |
| 721 | 3300005617 | Ga0068859_100305773 | Ga0068859_1003057732 | 213 |
| 722 | 3300005618 | Ga0068864_100185145 | Ga0068864_1001851452 | 213 |
| 723 | 3300005718 | Ga0068866_10352125 | Ga0068866_103521252 | 213 |
| 724 | 3300005841 | Ga0068863_100110088 | Ga0068863_1001100882 | 213 |
| 725 | 3300005841 | Ga0068863_100197202 | Ga0068863_1001972022 | 213 |
| 726 | 3300005843 | Ga0068860_100201894 | Ga0068860_1002018942 | 213 |
| 727 | 3300006237 | Ga0097621_100056808 | Ga0097621_1000568083 | 213 |
| 728 | 3300006237 | Ga0097621_100071442 | Ga0097621_1000714423 | 213 |
| 729 | 3300006358 | Ga0068871_100119081 | Ga0068871_1001190812 | 213 |
| 730 | 3300006358 | Ga0068871_100132092 | Ga0068871_1001320922 | 213 |
| 731 | 3300006358 | Ga0068871_100468342 | Ga0068871_1004683422 | 213 |
| 732 | 3300006881 | Ga0068865_100004141 | Ga0068865_1000041412 | 213 |
| 733 | 3300006881 | Ga0068865_100133055 | Ga0068865_1001330553 | 213 |
| 734 | 3300006881 | Ga0068865_100932667 | Ga0068865_1009326671 | 213 |
| 735 | 3300006931 | Ga0097620_100305777 | Ga0097620_1003057772 | 213 |
| 736 | 3300009093 | Ga0105240_10103314 | Ga0105240_101033143 | 213 |
| 737 | 3300009174 | Ga0105241_10048725 | Ga0105241_100487252 | 213 |
| 738 | 3300009176 | Ga0105242_10000796 | Ga0105242_100007963 | 213 |
| 739 | 3300009176 | Ga0105242_10309207 | Ga0105242_103092071 | 213 |
| 740 | 3300009177 | Ga0105248_10224910 | Ga0105248_102249101 | 213 |
| 741 | 3300009551 | Ga0105238_10074486 | Ga0105238_100744862 | 213 |
| 742 | 3300009551 | Ga0105238_10484683 | Ga0105238_104846831 | 213 |
| 743 | 3300009553 | Ga0105249_10104444 | Ga0105249_101044443 | 213 |
| 744 | 3300009553 | Ga0105249_10429312 | Ga0105249_104293122 | 213 |
| 745 | 3300013105 | Ga0157369_10000001 | Ga0157369_10000001202 | 213 |
| 746 | 3300013296 | Ga0157374_10110385 | Ga0157374_101103852 | 213 |
| 747 | 3300013296 | Ga0157374_10186692 | Ga0157374_101866922 | 213 |
| 748 | 3300013306 | Ga0163162_10019083 | Ga0163162_100190836 | 213 |
| 749 | 3300013306 | Ga0163162_10089462 | Ga0163162_100894622 | 213 |
| 750 | 3300013306 | Ga0163162_10205445 | Ga0163162_102054452 | 213 |
| 751 | 3300013306 | Ga0163162_10770703 | Ga0163162_107707032 | 213 |
| 752 | 3300013306 | Ga0163162_11396262 | Ga0163162_113962622 | 213 |
| 753 | 3300013307 | Ga0157372_10294252 | Ga0157372_102942522 | 213 |
| 754 | 3300013308 | Ga0157375_10000342 | Ga0157375_1000034213 | 213 |
| 755 | 3300013308 | Ga0157375_10018865 | Ga0157375_100188653 | 213 |
| 756 | 3300013308 | Ga0157375_10413367 | Ga0157375_104133672 | 213 |
| 757 | 3300014968 | Ga0157379_10071283 | Ga0157379_100712833 | 213 |
| 758 | 3300014969 | Ga0157376_10002154 | Ga0157376_100021547 | 213 |
| 759 | 3300014969 | Ga0157376_10074912 | Ga0157376_100749122 | 213 |
| 760 | 3300014969 | Ga0157376_10498435 | Ga0157376_104984351 | 213 |
| 761 | 3300025906 | Ga0207699_10085166 | Ga0207699_100851662 | 213 |
| 762 | 3300025913 | Ga0207695_10007103 | Ga0207695_100071034 | 213 |
| 763 | 3300025914 | Ga0207671_10002096 | Ga0207671_1000209610 | 213 |
| 764 | 3300025924 | Ga0207694_10003581 | Ga0207694_100035816 | 213 |
| 765 | 3300025925 | Ga0207650_10156575 | Ga0207650_101565752 | 213 |
| 766 | 3300025931 | Ga0207644_10552545 | Ga0207644_105525452 | 213 |
| 767 | 3300025933 | Ga0207706_10068854 | Ga0207706_100688542 | 213 |
| 768 | 3300025934 | Ga0207686_10074082 | Ga0207686_100740822 | 213 |
| 769 | 3300025936 | Ga0207670_10434456 | Ga0207670_104344562 | 213 |
| 770 | 3300025938 | Ga0207704_10080080 | Ga0207704_100800803 | 213 |
| 771 | 3300025938 | Ga0207704_10260073 | Ga0207704_102600732 | 213 |
| 772 | 3300025938 | Ga0207704_10281455 | Ga0207704_102814552 | 213 |
| 773 | 3300025940 | Ga0207691_10157723 | Ga0207691_101577232 | 213 |
| 774 | 3300025942 | Ga0207689_10132202 | Ga0207689_101322022 | 213 |
| 775 | 3300025949 | Ga0207667_10249497 | Ga0207667_102494972 | 213 |
| 776 | 3300025960 | Ga0207651_10169581 | Ga0207651_101695812 | 213 |
| 777 | 3300025961 | Ga0207712_10061496 | Ga0207712_100614963 | 213 |
| 778 | 3300025961 | Ga0207712_10095613 | Ga0207712_100956132 | 213 |
| 779 | 3300025972 | Ga0207668_10207424 | Ga0207668_102074242 | 213 |
| 780 | 3300025981 | Ga0207640_10189819 | Ga0207640_101898192 | 213 |
| 781 | 3300025986 | Ga0207658_10241078 | Ga0207658_102410782 | 213 |
| 782 | 3300026041 | Ga0207639_10040192 | Ga0207639_100401922 | 213 |
| 783 | 3300026041 | Ga0207639_10228512 | Ga0207639_102285121 | 213 |
| 784 | 3300026088 | Ga0207641_10065529 | Ga0207641_100655293 | 213 |
| 785 | 3300026088 | Ga0207641_10155506 | Ga0207641_101555062 | 213 |
| 786 | 3300026089 | Ga0207648_10057943 | Ga0207648_100579433 | 213 |
| 787 | 3300026118 | Ga0207675_100737526 | Ga0207675_1007375262 | 213 |
| 788 | 3300026121 | Ga0207683_10016610 | Ga0207683_100166105 | 213 |
| 789 | 3300026121 | Ga0207683_10242531 | Ga0207683_102425312 | 213 |
| 790 | 3300031507 | Ga0307509_10000004 | Ga0307509_10000004307 | 213 |
| 791 | 3300035410 | Ga0373924_0044956 | Ga0373924_0044956_1065_1706 | 213 |
| 792 | 3300035724 | Ga0373933_0259616 | Ga0373933_0259616_41_682 | 213 |
| 793 | 3300036401 | Ga0373937_0143168 | Ga0373937_0143168_1202_1843 | 213 |
| 794 | 3300046477 | Ga0495664_0330946 | Ga0495664_0330946_126_767 | 213 |
| 795 | 3300046531 | Ga0495665_0184210 | Ga0495665_0184210_67_708 | 213 |
| 796 | 3300046681 | Ga0495647_0026008 | Ga0495647_0026008_992_1633 | 213 |
| 797 | 3300046683 | Ga0495658_0005817 | Ga0495658_0005817_154_795 | 213 |
| 798 | 3300047471 | Ga0495684_0193000 | Ga0495684_0193000_161_802 | 213 |
| 799 | 3300048907 | Ga0496104_0000017 | Ga0496104_0000017_114172_114813 | 213 |
| 800 | 3300048908 | Ga0496105_0000009 | Ga0496105_0000009_240808_241449 | 213 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7tbp-assembly3.cif.gz_C | x-ray structure of the hiv-1 myristoylated matrix protein | 0.4224 | 117 | 191 |
| 3rag-assembly1.cif.gz_A | crystal structure of uncharacterized protein aaci_0196 from alicyclobacillus acidocaldarius subsp. acidocaldarius dsm 446 | 0.4016 | 111 | 182 |
| 2pon-assembly1.cif.gz_B | solution structure of the bcl-xl/beclin-1 complex | 0.3558 | 63 | 190 |
| 7tbp-assembly3.cif.gz_C | x-ray structure of the hiv-1 myristoylated matrix protein | 0.3402 | 117 | 191 |
| 7xgg-assembly2.cif.gz_E | crystal structure of bcl-xl in complex with computationally designed inhibitor protein | 0.3242 | 65 | 191 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A2R8QHQ6_21_158_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.383 | 91 | 174 | 3.30.40.10 |
| af_Q99M76_188_301_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.3748 | 102 | 189 | 1.25.10.10 |
| af_O70576_188_301_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.3714 | 102 | 189 | 1.25.10.10 |
| af_A4I620_205_313_1.10.238.10 | Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand | 0.3492 | 51 | 176 | 1.10.238.10 |
| 3adcB02 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain; | 0.3475 | 114 | 176 | 1.10.12.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V8XA03-F1-model_v4 | Gluconate 2-dehydrogenase subunit 3 family protein | 0.8906 | 64 | 170 |
|
| AF-A0A6L7JXK3-F1-model_v4 | deleted | 0.8739 | 62 | 213 |
|
| AF-A0A2V8BM29-F1-model_v4 | Gluconate 2-dehydrogenase subunit 3 family protein | 0.8728 | 64 | 196 |
|
| AF-A0A1L7I1D9-F1-model_v4 | Uncharacterized protein | 0.865 | 64 | 213 |
|
| AF-A0A6L7JXK3-F1-model_v4 | deleted | 0.8628 | 62 | 213 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar