F481379

General Info

Members Datasets Scaffolds Average Seq Length
800 300 798 210

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10022225|Ga0207695_100222253
Length 245
Sequence MDPKDPKGHQDPTDRRALMDSGAVISADASPLDTGTLTDRRTTLKWVLAAAAAMTAPLGSYAYAGAHAPARKGYGTDPDLSKVYKPGDLWPLTLTGPQRETSKSLCDLIIPADASSPSASEVGVVDFIDEWISAPYEQHRLDRIVILEGLVWLDAEAASRYGLGSSFAALSQQQQTAICDDICLADKATPNFAKAAKFFARYRDLTAGGFYTTPQGRQDLRYVGNVPSTHFDGPSPEVLKKVGLA

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
3 2738541337 Pelomonas sp. BT06 Isolate Unclassified
4 2831864461 Roseateles noduli HZ7 Isolate Nodule
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
103 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
165 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
166 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
167 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
170 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
171 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
172 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
173 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
176 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
177 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
191 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
200 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
201 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
202 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
203 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
204 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
205 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
206 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
207 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
215 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
218 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
221 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
222 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
225 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
226 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
231 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
232 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
235 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
248 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
249 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
250 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
251 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
252 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
253 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
254 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
255 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
259 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
274 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
275 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
276 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
277 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
278 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
282 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
291 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
292 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
293 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
294 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
295 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
296 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
297 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
298 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
299 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
300 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.88
Nodule 0.12
Rhizoplane 2.62
Rhizosphere 87.25
Stem 0
Stem Tuber 0
Unclassified 7.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_2609391 2162886006 Unclassified 1199
2 SwRhRL3b_contig_4185416 2162886006 Unclassified 1048
3 rootH1_10008880 3300003316 Unclassified 1745
4 rootH1_10008880 3300003323 Bacteria 4627
5 rootH2_10003802 3300003320 Bacteria 24313
6 rootL2_10095019 3300003322 Bacteria 3199
7 rootL2_10123247 3300003322 Bacteria 1101
8 rootH1_10000797 3300003323 Bacteria 7755
9 rootH1_10244250 3300003323 Bacteria 2402
10 Ga0055525_1000013 3300003759 Bacteria 440870
11 Ga0055526_1007082 3300003771 Bacteria 5924
12 Ga0055531_10000154 3300003794 Bacteria 79686
13 Ga0065707_10085706 3300005295 Bacteria 5948
14 Ga0070658_10067994 3300005327 Bacteria 2912
15 Ga0070658_10332657 3300005327 Bacteria 1298
16 Ga0070658_10449313 3300005327 Bacteria 1110
17 Ga0070676_10009973 3300005328 Bacteria 5141
18 Ga0070676_10132958 3300005328 Bacteria 1575
19 Ga0070683_100803399 3300005329 Unclassified 902
20 Ga0070690_100272380 3300005330 Bacteria 1205
21 Ga0070670_100078422 3300005331 Bacteria 2837
22 Ga0070670_100227308 3300005331 Bacteria 1624
23 Ga0070670_100311155 3300005331 Bacteria 1379
24 Ga0070670_100637608 3300005331 Bacteria 955
25 Ga0070677_10063017 3300005333 Bacteria 1535
26 Ga0068869_100110730 3300005334 Bacteria 2089
27 Ga0068869_100149280 3300005334 Bacteria 1811
28 Ga0068869_100155783 3300005334 Unclassified 1775
29 Ga0068869_100263353 3300005334 Bacteria 1381
30 Ga0068869_100495993 3300005334 Unclassified 1019
31 Ga0070666_10000239 3300005335 Bacteria 37286
32 Ga0070666_10003569 3300005335 Bacteria 9433
33 Ga0070666_10061313 3300005335 Bacteria 2547
34 Ga0070666_10321439 3300005335 Bacteria 1104
35 Ga0070682_100002961 3300005337 Bacteria 9427
36 Ga0070682_100047495 3300005337 Bacteria 2669
37 Ga0070682_100115377 3300005337 Bacteria 1796
38 Ga0070682_100137504 3300005337 Bacteria 1661
39 Ga0070682_100230852 3300005337 Unclassified 1323
40 Ga0070682_100702491 3300005337 Bacteria 811
41 Ga0068868_100059920 3300005338 Bacteria 3012
42 Ga0068868_100094578 3300005338 Bacteria 2411
43 Ga0068868_100720808 3300005338 Bacteria 894
44 Ga0070689_100010836 3300005340 Bacteria 6516
45 Ga0070689_100150054 3300005340 Unclassified 1879
46 Ga0070689_100239616 3300005340 Bacteria 1493
47 Ga0070689_100308589 3300005340 Bacteria 1319
48 Ga0070689_100500300 3300005340 Bacteria 1041
49 Ga0070689_100530814 3300005340 Bacteria 1012
50 Ga0070689_100641570 3300005340 Bacteria 923
51 Ga0070691_10494791 3300005341 Unclassified 706
52 Ga0070687_100651501 3300005343 Bacteria 730
53 Ga0070661_100051593 3300005344 Bacteria 3011
54 Ga0070661_100064639 3300005344 Bacteria 2689
55 Ga0070661_100168221 3300005344 Bacteria 1664
56 Ga0070661_100916433 3300005344 Unclassified 724
57 Ga0070668_100024849 3300005347 Bacteria 4541
58 Ga0070668_100203751 3300005347 Bacteria 1625
59 Ga0070668_100289790 3300005347 Bacteria 1370
60 Ga0070668_100501690 3300005347 Bacteria 1051
61 Ga0070668_100921229 3300005347 Bacteria 782
62 Ga0070669_100134161 3300005353 Bacteria 1903
63 Ga0070669_100616081 3300005353 Bacteria 910
64 Ga0070675_100037736 3300005354 Bacteria 3937
65 Ga0070675_100058746 3300005354 Bacteria 3172
66 Ga0070675_100091367 3300005354 Bacteria 2550
67 Ga0070675_100139446 3300005354 Bacteria 2072
68 Ga0070675_100291673 3300005354 Bacteria 1436
69 Ga0070675_100998002 3300005354 Bacteria 769
70 Ga0070671_100000727 3300005355 Bacteria 23552
71 Ga0070671_100062046 3300005355 Bacteria 3113
72 Ga0070671_100184556 3300005355 Bacteria 1767
73 Ga0070673_100103082 3300005364 Bacteria 2353
74 Ga0070673_100257380 3300005364 Bacteria 1523
75 Ga0070673_100321176 3300005364 Bacteria 1367
76 Ga0070673_100443395 3300005364 Bacteria 1167
77 Ga0070673_100726957 3300005364 Bacteria 913
78 Ga0070688_100152351 3300005365 Unclassified 1581
79 Ga0070688_100232118 3300005365 Bacteria 1306
80 Ga0070688_100241554 3300005365 Bacteria 1282
81 Ga0070688_100358850 3300005365 Bacteria 1069
82 Ga0070688_100624940 3300005365 Unclassified 827
83 Ga0070667_100029948 3300005367 Bacteria 4539
84 Ga0070667_100071416 3300005367 Bacteria 2956
85 Ga0070667_100100676 3300005367 Bacteria 2496
86 Ga0070667_100143690 3300005367 Bacteria 2091
87 Ga0070667_100192445 3300005367 Bacteria 1807
88 Ga0070667_100437590 3300005367 Unclassified 1194
89 Ga0070667_100591404 3300005367 Bacteria 1022
90 Ga0070709_10268313 3300005434 Bacteria 1236
91 Ga0070713_100022634 3300005436 Bacteria 4859
92 Ga0070710_10156140 3300005437 Bacteria 1411
93 Ga0070701_10017426 3300005438 Bacteria 3356
94 Ga0070701_10172989 3300005438 Bacteria 1259
95 Ga0070711_100132225 3300005439 Bacteria 1860
96 Ga0070711_100258179 3300005439 Bacteria 1370
97 Ga0070711_100622853 3300005439 Bacteria 902
98 Ga0070700_100013808 3300005441 Bacteria 4544
99 Ga0070700_100022106 3300005441 Bacteria 3705
100 Ga0070694_100256003 3300005444 Bacteria 1326
101 Ga0070694_100793912 3300005444 Unclassified 776
102 Ga0070663_100005805 3300005455 Bacteria 7373
103 Ga0070663_100027649 3300005455 Bacteria 3853
104 Ga0070663_100173728 3300005455 Bacteria 1667
105 Ga0070663_100322822 3300005455 Unclassified 1242
106 Ga0070663_100437979 3300005455 Bacteria 1075
107 Ga0070678_100025465 3300005456 Bacteria 3980
108 Ga0070678_100041542 3300005456 Bacteria 3261
109 Ga0070678_100064409 3300005456 Bacteria 2717
110 Ga0070678_100120737 3300005456 Bacteria 2066
111 Ga0070678_100132854 3300005456 Bacteria 1980
112 Ga0070662_100008323 3300005457 Bacteria 6759
113 Ga0070662_100022542 3300005457 Bacteria 4313
114 Ga0070662_100118024 3300005457 Bacteria 2030
115 Ga0068867_100022629 3300005459 Bacteria 4494
116 Ga0068867_100025240 3300005459 Bacteria 4263
117 Ga0068867_100090222 3300005459 Bacteria 2325
118 Ga0068867_100130729 3300005459 Bacteria 1951
119 Ga0068867_100334027 3300005459 Bacteria 1260
120 Ga0068867_100338004 3300005459 Bacteria 1253
121 Ga0070685_10061807 3300005466 Bacteria 2194
122 Ga0070685_10183743 3300005466 Bacteria 1348
123 Ga0070685_10363955 3300005466 Unclassified 992
124 Ga0070679_100053216 3300005530 Bacteria 4030
125 Ga0070679_100062616 3300005530 Bacteria 3709
126 Ga0070684_100340026 3300005535 Bacteria 1380
127 Ga0068853_100240992 3300005539 Bacteria 1657
128 Ga0068853_100360339 3300005539 Bacteria 1354
129 Ga0070672_100010396 3300005543 Bacteria 6455
130 Ga0070672_100016046 3300005543 Bacteria 5354
131 Ga0070672_100026815 3300005543 Bacteria 4293
132 Ga0070672_100048540 3300005543 Bacteria 3299
133 Ga0070672_100219683 3300005543 Bacteria 1594
134 Ga0070672_100304032 3300005543 Bacteria 1353
135 Ga0070686_100015956 3300005544 Bacteria 4362
136 Ga0070686_100095023 3300005544 Bacteria 2002
137 Ga0070686_100258195 3300005544 Bacteria 1276
138 Ga0070665_100000283 3300005548 Bacteria 82138
139 Ga0070665_100008331 3300005548 Bacteria 10484
140 Ga0070665_100011239 3300005548 Bacteria 9052
141 Ga0070665_100025117 3300005548 Bacteria 6003
142 Ga0070665_100044691 3300005548 Bacteria 4448
143 Ga0070665_100073673 3300005548 Bacteria 3420
144 Ga0070665_100163954 3300005548 Bacteria 2225
145 Ga0070665_100229410 3300005548 Bacteria 1857
146 Ga0070665_100363777 3300005548 Bacteria 1453
147 Ga0070665_100437813 3300005548 Bacteria 1316
148 Ga0070665_100453655 3300005548 Bacteria 1292
149 Ga0068855_100035915 3300005563 Bacteria 5902
150 Ga0068855_100175572 3300005563 Bacteria 2424
151 Ga0068855_100436725 3300005563 Bacteria 1430
152 Ga0070664_100014517 3300005564 Bacteria 6424
153 Ga0070664_100318947 3300005564 Bacteria 1408
154 Ga0070664_100611496 3300005564 Unclassified 1011
155 Ga0068857_100042281 3300005577 Bacteria 4042
156 Ga0068857_100174834 3300005577 Bacteria 1953
157 Ga0068857_100855020 3300005577 Bacteria 871
158 Ga0068857_101322220 3300005577 Bacteria 700
159 Ga0068854_100001633 3300005578 Bacteria 13647
160 Ga0068854_100009334 3300005578 Bacteria 6333
161 Ga0068854_100057180 3300005578 Bacteria 2813
162 Ga0068854_100229976 3300005578 Bacteria 1471
163 Ga0068854_100766937 3300005578 Bacteria 838
164 Ga0068856_100050403 3300005614 Bacteria 4104
165 Ga0068856_100215261 3300005614 Unclassified 1936
166 Ga0068856_100608688 3300005614 Bacteria 1113
167 Ga0068856_100797058 3300005614 Bacteria 964
168 Ga0070702_100011956 3300005615 Bacteria 4333
169 Ga0070702_100374767 3300005615 Bacteria 1010
170 Ga0070702_100392047 3300005615 Bacteria 991
171 Ga0068852_100026314 3300005616 Bacteria 4727
172 Ga0068852_100147859 3300005616 Bacteria 2181
173 Ga0068852_100443087 3300005616 Bacteria 1284
174 Ga0068852_101016960 3300005616 Unclassified 848
175 Ga0068859_100015604 3300005617 Bacteria 7633
176 Ga0068859_100160391 3300005617 Bacteria 2328
177 Ga0068859_100284369 3300005617 Bacteria 1747
178 Ga0068859_100305773 3300005617 Bacteria 1683
179 Ga0068859_100366986 3300005617 Bacteria 1535
180 Ga0068859_101174319 3300005617 Bacteria 845
181 Ga0068864_100102696 3300005618 Bacteria 2537
182 Ga0068864_100185145 3300005618 Bacteria 1906
183 Ga0068864_100247640 3300005618 Unclassified 1653
184 Ga0068864_100265858 3300005618 Unclassified 1597
185 Ga0068866_10207352 3300005718 Bacteria 1174
186 Ga0068866_10222703 3300005718 Bacteria 1139
187 Ga0068866_10352125 3300005718 Bacteria 936
188 Ga0068861_100006072 3300005719 Bacteria 8214
189 Ga0068861_100007372 3300005719 Bacteria 7537
190 Ga0068861_100134761 3300005719 Bacteria 2008
191 Ga0068861_100164035 3300005719 Bacteria 1835
192 Ga0068861_100198619 3300005719 Bacteria 1682
193 Ga0068861_100463860 3300005719 Bacteria 1138
194 Ga0068851_10001629 3300005834 Bacteria 9843
195 Ga0068851_10001806 3300005834 Bacteria 9368
196 Ga0068851_10098068 3300005834 Bacteria 1551
197 Ga0068870_10001457 3300005840 Bacteria 9574
198 Ga0068870_10191787 3300005840 Bacteria 1233
199 Ga0068863_100001082 3300005841 Bacteria 27269
200 Ga0068863_100004356 3300005841 Bacteria 13950
201 Ga0068863_100110088 3300005841 Bacteria 2623
202 Ga0068863_100128289 3300005841 Bacteria 2420
203 Ga0068863_100146756 3300005841 Bacteria 2256
204 Ga0068863_100197202 3300005841 Bacteria 1935
205 Ga0068863_100234424 3300005841 Bacteria 1771
206 Ga0068863_100284907 3300005841 Bacteria 1601
207 Ga0068863_100434000 3300005841 Unclassified 1288
208 Ga0068863_100563052 3300005841 Viruses 1126
209 Ga0068858_100000101 3300005842 Bacteria 89093
210 Ga0068858_100000991 3300005842 Bacteria 29310
211 Ga0068858_100003283 3300005842 Bacteria 16113
212 Ga0068858_100016218 3300005842 Bacteria 6999
213 Ga0068858_100030767 3300005842 Bacteria 4985
214 Ga0068858_100046651 3300005842 Bacteria 4016
215 Ga0068860_100000878 3300005843 Bacteria 33413
216 Ga0068860_100018738 3300005843 Bacteria 6726
217 Ga0068860_100021252 3300005843 Bacteria 6286
218 Ga0068860_100201894 3300005843 Unclassified 1927
219 Ga0068860_100323812 3300005843 Unclassified 1513
220 Ga0068860_100580491 3300005843 Bacteria 1125
221 Ga0068862_100028773 3300005844 Unclassified 4680
222 Ga0068862_100057971 3300005844 Bacteria 3322
223 Ga0068862_100168931 3300005844 Bacteria 1957
224 Ga0068862_100456597 3300005844 Unclassified 1205
225 Ga0068862_100482419 3300005844 Bacteria 1174
226 Ga0068862_100503374 3300005844 Bacteria 1150
227 Ga0081455_10005653 3300005937 Bacteria 13650
228 Ga0070717_10000038 3300006028 Bacteria 119189
229 Ga0070717_10049927 3300006028 Bacteria 3436
230 Ga0070715_10507707 3300006163 Bacteria 691
231 Ga0097621_100056808 3300006237 Bacteria 3198
232 Ga0097621_100071442 3300006237 Bacteria 2868
233 Ga0097621_100156877 3300006237 Bacteria 1954
234 Ga0097621_100203097 3300006237 Bacteria 1721
235 Ga0097621_100214882 3300006237 Bacteria 1674
236 Ga0097621_100235552 3300006237 Bacteria 1599
237 Ga0097621_100366002 3300006237 Bacteria 1285
238 Ga0068871_100069852 3300006358 Bacteria 2885
239 Ga0068871_100082681 3300006358 Bacteria 2663
240 Ga0068871_100103159 3300006358 Unclassified 2391
241 Ga0068871_100119081 3300006358 Bacteria 2228
242 Ga0068871_100132092 3300006358 Bacteria 2117
243 Ga0068871_100149280 3300006358 Bacteria 1992
244 Ga0068871_100332048 3300006358 Bacteria 1341
245 Ga0068871_100468342 3300006358 Bacteria 1132
246 Ga0075428_100017573 3300006844 Bacteria 7900
247 Ga0075431_100000257 3300006847 Bacteria 40664
248 Ga0075429_100001404 3300006880 Bacteria 19710
249 Ga0075429_100886461 3300006880 Bacteria 781
250 Ga0068865_100004141 3300006881 Bacteria 8718
251 Ga0068865_100010271 3300006881 Bacteria 5823
252 Ga0068865_100013736 3300006881 Bacteria 5129
253 Ga0068865_100056466 3300006881 Bacteria 2735
254 Ga0068865_100133055 3300006881 Bacteria 1865
255 Ga0068865_100298502 3300006881 Bacteria 1288
256 Ga0068865_100341125 3300006881 Bacteria 1211
257 Ga0068865_100932667 3300006881 Bacteria 757
258 Ga0097620_100015605 3300006931 Bacteria 7633
259 Ga0097620_100160396 3300006931 Bacteria 2328
260 Ga0097620_100284371 3300006931 Bacteria 1747
261 Ga0097620_100305777 3300006931 Bacteria 1683
262 Ga0097620_100366991 3300006931 Bacteria 1535
263 Ga0097620_100688829 3300006931 Bacteria 1113
264 Ga0097620_101174762 3300006931 Bacteria 845
265 Ga0105240_10000243 3300009093 Bacteria 107903
266 Ga0105240_10018068 3300009093 Bacteria 9481
267 Ga0105240_10057832 3300009093 Bacteria 4842
268 Ga0105240_10103314 3300009093 Bacteria 3463
269 Ga0105240_10223878 3300009093 Bacteria 2190
270 Ga0105240_10423493 3300009093 Bacteria 1495
271 Ga0105240_11211215 3300009093 Bacteria 799
272 Ga0111539_10016527 3300009094 Bacteria 9146
273 Ga0111539_10088809 3300009094 Bacteria 3631
274 Ga0111539_10209204 3300009094 Bacteria 2273
275 Ga0111539_10295919 3300009094 Unclassified 1884
276 Ga0105245_11187890 3300009098 Bacteria 811
277 Ga0105247_10000743 3300009101 Bacteria 25155
278 Ga0105247_10097127 3300009101 Bacteria 1879
279 Ga0114129_10002305 3300009147 Bacteria 26465
280 Ga0105243_10374074 3300009148 Bacteria 1315
281 Ga0105243_10382283 3300009148 Bacteria 1303
282 Ga0105241_10010519 3300009174 Bacteria 6788
283 Ga0105241_10048725 3300009174 Bacteria 3225
284 Ga0105241_10079670 3300009174 Bacteria 2562
285 Ga0105241_10613843 3300009174 Bacteria 984
286 Ga0105242_10000796 3300009176 Bacteria 24434
287 Ga0105242_10222059 3300009176 Unclassified 1689
288 Ga0105242_10246527 3300009176 Bacteria 1608
289 Ga0105242_10309207 3300009176 Unclassified 1445
290 Ga0105248_10021102 3300009177 Bacteria 7217
291 Ga0105248_10161297 3300009177 Bacteria 2529
292 Ga0105248_10170358 3300009177 Bacteria 2454
293 Ga0105248_10224910 3300009177 Bacteria 2112
294 Ga0105248_10492867 3300009177 Bacteria 1381
295 Ga0105237_10028008 3300009545 Bacteria 5741
296 Ga0105237_10105815 3300009545 Bacteria 2805
297 Ga0105237_10281952 3300009545 Bacteria 1664
298 Ga0105237_10755455 3300009545 Unclassified 979
299 Ga0105238_10002571 3300009551 Bacteria 18109
300 Ga0105238_10024347 3300009551 Bacteria 6171
301 Ga0105238_10037280 3300009551 Bacteria 4943
302 Ga0105238_10074486 3300009551 Bacteria 3388
303 Ga0105238_10330985 3300009551 Bacteria 1510
304 Ga0105238_10331969 3300009551 Bacteria 1508
305 Ga0105238_10484683 3300009551 Bacteria 1236
306 Ga0105249_10002100 3300009553 Bacteria 17282
307 Ga0105249_10104444 3300009553 Bacteria 2670
308 Ga0105249_10119239 3300009553 Bacteria 2505
309 Ga0105249_10152735 3300009553 Bacteria 2224
310 Ga0105249_10293143 3300009553 Bacteria 1629
311 Ga0105249_10429312 3300009553 Bacteria 1357
312 Ga0105249_10566131 3300009553 Bacteria 1188
313 Ga0105239_10006656 3300010375 Bacteria 13367
314 Ga0105239_10230454 3300010375 Bacteria 2078
315 Ga0105239_10412875 3300010375 Bacteria 1529
316 Ga0105239_10994680 3300010375 Bacteria 964
317 Ga0157369_10000001 3300013105 Bacteria 554908
318 Ga0157369_10046965 3300013105 Bacteria 4690
319 Ga0157374_10087355 3300013296 Bacteria 2968
320 Ga0157374_10110385 3300013296 Bacteria 2645
321 Ga0157374_10186692 3300013296 Bacteria 2027
322 Ga0157374_10250319 3300013296 Bacteria 1743
323 Ga0157374_10660485 3300013296 Bacteria 1057
324 Ga0163162_10019083 3300013306 Bacteria 6724
325 Ga0163162_10030020 3300013306 Bacteria 5383
326 Ga0163162_10089462 3300013306 Bacteria 3159
327 Ga0163162_10169995 3300013306 Bacteria 2304
328 Ga0163162_10205445 3300013306 Bacteria 2099
329 Ga0163162_10770703 3300013306 Unclassified 1080
330 Ga0163162_11396262 3300013306 Bacteria 797
331 Ga0157372_10134437 3300013307 Bacteria 2847
332 Ga0157372_10294252 3300013307 Bacteria 1888
333 Ga0157375_10000342 3300013308 Bacteria 42091
334 Ga0157375_10004701 3300013308 Bacteria 11887
335 Ga0157375_10018865 3300013308 Bacteria 6262
336 Ga0157375_10413367 3300013308 Bacteria 1515
337 Ga0157375_10680513 3300013308 Unclassified 1183
338 Ga0157375_11035011 3300013308 Bacteria 959
339 Ga0163163_10043577 3300014325 Bacteria 4400
340 Ga0163163_10738004 3300014325 Unclassified 1048
341 Ga0157380_10004887 3300014326 Bacteria 9338
342 Ga0157380_10127130 3300014326 Bacteria 2168
343 Ga0157380_10133286 3300014326 Bacteria 2123
344 Ga0157380_10166658 3300014326 Bacteria 1921
345 Ga0157380_10237221 3300014326 Bacteria 1642
346 Ga0157379_10071283 3300014968 Bacteria 3109
347 Ga0157379_10162183 3300014968 Bacteria 2018
348 Ga0157379_10706706 3300014968 Bacteria 946
349 Ga0157376_10002154 3300014969 Bacteria 13258
350 Ga0157376_10038493 3300014969 Bacteria 3891
351 Ga0157376_10057121 3300014969 Bacteria 3263
352 Ga0157376_10074912 3300014969 Bacteria 2887
353 Ga0157376_10195729 3300014969 Bacteria 1857
354 Ga0157376_10233686 3300014969 Bacteria 1709
355 Ga0157376_10426574 3300014969 Bacteria 1288
356 Ga0157376_10498435 3300014969 Bacteria 1196
357 Ga0163161_10524622 3300017792 Bacteria 968
358 Ga0213872_10000085 3300021361 Bacteria 85496
359 Ga0209674_112304 3300025226 Bacteria 839
360 Ga0209563_100025 3300025230 Bacteria 596456
361 Ga0209233_1007840 3300025261 Bacteria 3350
362 Ga0209673_1017194 3300025273 Bacteria 2672
363 Ga0209564_1000097 3300025295 Bacteria 231436
364 Ga0209050_1002369 3300025298 Bacteria 16384
365 Ga0209051_1003041 3300025303 Bacteria 11345
366 Ga0209257_1000016 3300025304 Bacteria 908015
367 Ga0209257_1021170 3300025304 Bacteria 2373
368 Ga0207656_10000407 3300025321 Bacteria 14423
369 Ga0207656_10007696 3300025321 Bacteria 3938
370 Ga0207656_10140059 3300025321 Bacteria 1140
371 Ga0207682_10005406 3300025893 Bacteria 5201
372 Ga0207692_10080365 3300025898 Bacteria 1742
373 Ga0207710_10000510 3300025900 Bacteria 24240
374 Ga0207710_10166097 3300025900 Unclassified 1077
375 Ga0207680_10002251 3300025903 Bacteria 9006
376 Ga0207680_10039871 3300025903 Bacteria 2728
377 Ga0207680_10181017 3300025903 Bacteria 1425
378 Ga0207647_10000075 3300025904 Bacteria 76289
379 Ga0207647_10005480 3300025904 Bacteria 9289
380 Ga0207685_10114313 3300025905 Unclassified 1175
381 Ga0207685_10415554 3300025905 Bacteria 692
382 Ga0207699_10085166 3300025906 Bacteria 1970
383 Ga0207645_10026936 3300025907 Bacteria 3715
384 Ga0207643_10012952 3300025908 Bacteria 4510
385 Ga0207643_10054590 3300025908 Bacteria 2271
386 Ga0207705_10016092 3300025909 Bacteria 5368
387 Ga0207654_10042683 3300025911 Bacteria 2568
388 Ga0207654_10173108 3300025911 Bacteria 1403
389 Ga0207654_10319681 3300025911 Bacteria 1061
390 Ga0207695_10007103 3300025913 Bacteria 14345
391 Ga0207695_10022225 3300025913 Bacteria 7212
392 Ga0207695_10022274 3300025913 Bacteria 7201
393 Ga0207695_10087629 3300025913 Bacteria 3136
394 Ga0207695_10111236 3300025913 Unclassified 2718
395 Ga0207695_10123568 3300025913 Bacteria 2554
396 Ga0207695_10806897 3300025913 Unclassified 818
397 Ga0207671_10002096 3300025914 Bacteria 21815
398 Ga0207671_10002882 3300025914 Bacteria 17809
399 Ga0207671_10015791 3300025914 Bacteria 5894
400 Ga0207671_10033854 3300025914 Bacteria 3799
401 Ga0207671_10038094 3300025914 Bacteria 3564
402 Ga0207671_10062103 3300025914 Bacteria 2774
403 Ga0207671_10261972 3300025914 Bacteria 1361
404 Ga0207649_10041909 3300025920 Bacteria 2790
405 Ga0207649_10114042 3300025920 Bacteria 1811
406 Ga0207649_10569437 3300025920 Unclassified 869
407 Ga0207652_10039167 3300025921 Bacteria 4022
408 Ga0207652_10046335 3300025921 Bacteria 3710
409 Ga0207681_10018449 3300025923 Bacteria 4396
410 Ga0207694_10000784 3300025924 Bacteria 28556
411 Ga0207694_10003412 3300025924 Bacteria 12649
412 Ga0207694_10003581 3300025924 Bacteria 12319
413 Ga0207694_10005868 3300025924 Bacteria 9412
414 Ga0207694_10218158 3300025924 Bacteria 1555
415 Ga0207694_10486284 3300025924 Unclassified 1033
416 Ga0207650_10037643 3300025925 Bacteria 3527
417 Ga0207650_10068382 3300025925 Bacteria 2667
418 Ga0207650_10156575 3300025925 Bacteria 1802
419 Ga0207650_10186750 3300025925 Bacteria 1654
420 Ga0207659_10045020 3300025926 Bacteria 3108
421 Ga0207659_10115488 3300025926 Bacteria 2048
422 Ga0207659_10117147 3300025926 Bacteria 2035
423 Ga0207644_10000910 3300025931 Bacteria 18751
424 Ga0207644_10179204 3300025931 Bacteria 1660
425 Ga0207644_10552545 3300025931 Bacteria 953
426 Ga0207706_10004965 3300025933 Bacteria 12434
427 Ga0207706_10018566 3300025933 Bacteria 6258
428 Ga0207706_10032026 3300025933 Bacteria 4684
429 Ga0207706_10053512 3300025933 Bacteria 3563
430 Ga0207706_10068854 3300025933 Bacteria 3113
431 Ga0207706_10125507 3300025933 Bacteria 2257
432 Ga0207706_10381431 3300025933 Bacteria 1223
433 Ga0207686_10074082 3300025934 Bacteria 2199
434 Ga0207686_10287598 3300025934 Bacteria 1216
435 Ga0207709_10145941 3300025935 Bacteria 1632
436 Ga0207670_10007470 3300025936 Bacteria 6098
437 Ga0207670_10071145 3300025936 Unclassified 2405
438 Ga0207670_10197307 3300025936 Bacteria 1527
439 Ga0207670_10434456 3300025936 Bacteria 1056
440 Ga0207669_10216422 3300025937 Bacteria 1402
441 Ga0207704_10022303 3300025938 Bacteria 3390
442 Ga0207704_10032099 3300025938 Bacteria 2967
443 Ga0207704_10080080 3300025938 Bacteria 2107
444 Ga0207704_10260073 3300025938 Bacteria 1308
445 Ga0207704_10281455 3300025938 Bacteria 1264
446 Ga0207691_10008149 3300025940 Bacteria 10057
447 Ga0207691_10043483 3300025940 Bacteria 4140
448 Ga0207691_10073960 3300025940 Bacteria 3074
449 Ga0207691_10157723 3300025940 Bacteria 1992
450 Ga0207691_10297280 3300025940 Bacteria 1387
451 Ga0207691_10432076 3300025940 Bacteria 1121
452 Ga0207711_10059660 3300025941 Bacteria 3285
453 Ga0207711_10156947 3300025941 Bacteria 2057
454 Ga0207711_10514909 3300025941 Bacteria 1115
455 Ga0207689_10029034 3300025942 Bacteria 4623
456 Ga0207689_10110436 3300025942 Bacteria 2260
457 Ga0207689_10132202 3300025942 Unclassified 2054
458 Ga0207689_10227515 3300025942 Unclassified 1542
459 Ga0207689_10248253 3300025942 Bacteria 1472
460 Ga0207689_10487671 3300025942 Bacteria 1032
461 Ga0207689_10655053 3300025942 Unclassified 885
462 Ga0207679_10374664 3300025945 Bacteria 1246
463 Ga0207679_10658934 3300025945 Unclassified 947
464 Ga0207667_10249497 3300025949 Bacteria 1816
465 Ga0207667_10641997 3300025949 Bacteria 1068
466 Ga0207667_10718450 3300025949 Bacteria 1000
467 Ga0207667_11294703 3300025949 Unclassified 705
468 Ga0207651_10136050 3300025960 Bacteria 1890
469 Ga0207651_10169581 3300025960 Bacteria 1720
470 Ga0207651_10176609 3300025960 Bacteria 1690
471 Ga0207712_10000211 3300025961 Bacteria 58110
472 Ga0207712_10003217 3300025961 Bacteria 10379
473 Ga0207712_10027904 3300025961 Bacteria 3772
474 Ga0207712_10061496 3300025961 Bacteria 2665
475 Ga0207712_10095613 3300025961 Bacteria 2197
476 Ga0207712_10173600 3300025961 Bacteria 1687
477 Ga0207668_10184956 3300025972 Bacteria 1646
478 Ga0207668_10207424 3300025972 Bacteria 1565
479 Ga0207668_10227397 3300025972 Bacteria 1502
480 Ga0207668_10356008 3300025972 Bacteria 1225
481 Ga0207640_10013953 3300025981 Bacteria 4614
482 Ga0207640_10020481 3300025981 Bacteria 3928
483 Ga0207640_10189819 3300025981 Bacteria 1548
484 Ga0207640_10722151 3300025981 Bacteria 856
485 Ga0207658_10018494 3300025986 Bacteria 4812
486 Ga0207658_10019618 3300025986 Bacteria 4677
487 Ga0207658_10044849 3300025986 Bacteria 3220
488 Ga0207658_10052688 3300025986 Bacteria 3003
489 Ga0207658_10202547 3300025986 Bacteria 1658
490 Ga0207658_10241078 3300025986 Unclassified 1532
491 Ga0207658_10362843 3300025986 Bacteria 1264
492 Ga0207658_10957605 3300025986 Bacteria 780
493 Ga0207658_11029370 3300025986 Unclassified 751
494 Ga0207677_10128239 3300026023 Bacteria 1921
495 Ga0207703_10000180 3300026035 Bacteria 73584
496 Ga0207703_10001490 3300026035 Bacteria 21362
497 Ga0207703_10001805 3300026035 Bacteria 19093
498 Ga0207703_10001858 3300026035 Bacteria 18776
499 Ga0207703_10004699 3300026035 Bacteria 11153
500 Ga0207703_10075965 3300026035 Bacteria 2786
501 Ga0207639_10000209 3300026041 Bacteria 44317
502 Ga0207639_10000602 3300026041 Bacteria 24789
503 Ga0207639_10000836 3300026041 Bacteria 20877
504 Ga0207639_10040192 3300026041 Bacteria 3489
505 Ga0207639_10228512 3300026041 Unclassified 1611
506 Ga0207639_10480427 3300026041 Bacteria 1132
507 Ga0207678_10003270 3300026067 Bacteria 14620
508 Ga0207678_10020169 3300026067 Bacteria 5853
509 Ga0207678_10048413 3300026067 Bacteria 3674
510 Ga0207678_10059818 3300026067 Bacteria 3278
511 Ga0207678_10069374 3300026067 Bacteria 3022
512 Ga0207678_10205120 3300026067 Bacteria 1686
513 Ga0207708_10014631 3300026075 Bacteria 5871
514 Ga0207708_10199468 3300026075 Bacteria 1596
515 Ga0207702_10062232 3300026078 Bacteria 3186
516 Ga0207702_10179396 3300026078 Bacteria 1949
517 Ga0207702_10184420 3300026078 Bacteria 1924
518 Ga0207702_10225507 3300026078 Bacteria 1748
519 Ga0207702_10729830 3300026078 Unclassified 977
520 Ga0207641_10000217 3300026088 Bacteria 74684
521 Ga0207641_10003378 3300026088 Bacteria 14170
522 Ga0207641_10065529 3300026088 Bacteria 3108
523 Ga0207641_10081047 3300026088 Bacteria 2817
524 Ga0207641_10155506 3300026088 Bacteria 2074
525 Ga0207641_10278870 3300026088 Bacteria 1571
526 Ga0207641_10283124 3300026088 Bacteria 1560
527 Ga0207641_10427604 3300026088 Bacteria 1276
528 Ga0207641_10429903 3300026088 Unclassified 1273
529 Ga0207641_10546460 3300026088 Unclassified 1129
530 Ga0207641_10696100 3300026088 Bacteria 1000
531 Ga0207641_10966810 3300026088 Unclassified 847
532 Ga0207648_10057943 3300026089 Bacteria 3379
533 Ga0207648_10065816 3300026089 Bacteria 3160
534 Ga0207648_10068616 3300026089 Bacteria 3089
535 Ga0207648_10102235 3300026089 Bacteria 2512
536 Ga0207648_10158301 3300026089 Bacteria 2000
537 Ga0207648_10241657 3300026089 Bacteria 1608
538 Ga0207648_10443515 3300026089 Unclassified 1181
539 Ga0207648_10932586 3300026089 Bacteria 812
540 Ga0207676_10065516 3300026095 Bacteria 2893
541 Ga0207676_10446970 3300026095 Unclassified 1218
542 Ga0207674_10054980 3300026116 Bacteria 4050
543 Ga0207674_10111725 3300026116 Bacteria 2707
544 Ga0207674_10150158 3300026116 Bacteria 2287
545 Ga0207674_10211943 3300026116 Bacteria 1886
546 Ga0207674_10234977 3300026116 Bacteria 1781
547 Ga0207675_100002110 3300026118 Bacteria 19700
548 Ga0207675_100002779 3300026118 Bacteria 17193
549 Ga0207675_100091678 3300026118 Bacteria 2857
550 Ga0207675_100186531 3300026118 Bacteria 1988
551 Ga0207675_100198662 3300026118 Bacteria 1926
552 Ga0207675_100501076 3300026118 Bacteria 1209
553 Ga0207675_100673102 3300026118 Bacteria 1042
554 Ga0207675_100737526 3300026118 Bacteria 996
555 Ga0207675_101076773 3300026118 Bacteria 823
556 Ga0207683_10007087 3300026121 Bacteria 9610
557 Ga0207683_10014004 3300026121 Bacteria 6838
558 Ga0207683_10016610 3300026121 Bacteria 6265
559 Ga0207683_10048570 3300026121 Bacteria 3716
560 Ga0207683_10242531 3300026121 Bacteria 1644
561 Ga0207698_10066641 3300026142 Bacteria 2835
562 Ga0268266_10000001 3300028379 Bacteria 4040580
563 Ga0268266_10000008 3300028379 Bacteria 1161875
564 Ga0268266_10008971 3300028379 Bacteria 8850
565 Ga0268266_10022170 3300028379 Bacteria 5412
566 Ga0268266_10098279 3300028379 Bacteria 2575
567 Ga0268266_10118317 3300028379 Bacteria 2355
568 Ga0268266_10222782 3300028379 Bacteria 1735
569 Ga0268266_10305193 3300028379 Bacteria 1486
570 Ga0268265_10089988 3300028380 Unclassified 2450
571 Ga0268265_10438294 3300028380 Bacteria 1217
572 Ga0268265_10453107 3300028380 Bacteria 1199
573 Ga0268265_10555792 3300028380 Unclassified 1090
574 Ga0268265_10912788 3300028380 Bacteria 863
575 Ga0268264_10000058 3300028381 Bacteria 308956
576 Ga0268264_10000060 3300028381 Bacteria 305056
577 Ga0268264_10058922 3300028381 Bacteria 3217
578 Ga0268264_10061028 3300028381 Bacteria 3162
579 Ga0268264_10417631 3300028381 Bacteria 1293
580 Ga0265319_1000777 3300028563 Bacteria 20762
581 Ga0265319_1026809 3300028563 Bacteria 2049
582 Ga0265318_10004691 3300028577 Bacteria 6560
583 Ga0307517_10176140 3300028786 Bacteria 1392
584 Ga0307515_10000037 3300028794 Bacteria 331970
585 Ga0307515_10012918 3300028794 Bacteria 15662
586 Ga0307515_10047411 3300028794 Bacteria 6532
587 Ga0307515_10146047 3300028794 Unclassified 2504
588 Ga0265338_10011548 3300028800 Bacteria 10185
589 Ga0265324_10036760 3300029957 Unclassified 1702
590 Ga0307511_10012417 3300030521 Bacteria 8355
591 Ga0265320_10025262 3300031240 Bacteria 3125
592 Ga0265331_10000857 3300031250 Bacteria 24739
593 Ga0265327_10001107 3300031251 Bacteria 37348
594 Ga0265327_10003286 3300031251 Bacteria 15659
595 Ga0265327_10103771 3300031251 Bacteria 1368
596 Ga0307513_10006084 3300031456 Bacteria 15833
597 Ga0307513_10013647 3300031456 Bacteria 9964
598 Ga0307513_10019540 3300031456 Bacteria 8065
599 Ga0307513_10023596 3300031456 Bacteria 7183
600 Ga0307513_10026034 3300031456 Bacteria 6755
601 Ga0307513_10143864 3300031456 Bacteria 2306
602 Ga0307513_10163836 3300031456 Bacteria 2111
603 Ga0307513_10255915 3300031456 Bacteria 1544
604 Ga0307509_10000004 3300031507 Bacteria 535507
605 Ga0307509_10313299 3300031507 Bacteria 1310
606 Ga0265313_10003091 3300031595 Bacteria 13807
607 Ga0307514_10023305 3300031649 Bacteria 5022
608 Ga0265314_10018622 3300031711 Bacteria 5408
609 Ga0265314_10040677 3300031711 Bacteria 3334
610 Ga0307516_10000973 3300031730 Bacteria 39600
611 Ga0307516_10315374 3300031730 Bacteria 1236
612 Ga0307405_10219469 3300031731 Bacteria 1394
613 Ga0307405_10826351 3300031731 Unclassified 778
614 Ga0307413_10052491 3300031824 Bacteria 2462
615 Ga0307518_10304507 3300031838 Unclassified 966
616 Ga0307410_10028299 3300031852 Bacteria 3553
617 Ga0307410_10210176 3300031852 Bacteria 1490
618 Ga0307406_10340611 3300031901 Bacteria 1168
619 Ga0307407_10057003 3300031903 Bacteria 2265
620 Ga0307407_10282334 3300031903 Bacteria 1150
621 Ga0307409_100144330 3300031995 Bacteria 2056
622 Ga0307409_100553631 3300031995 Bacteria 1129
623 Ga0307416_100113217 3300032002 Bacteria 2397
624 Ga0307416_100226911 3300032002 Bacteria 1797
625 Ga0307416_100269170 3300032002 Bacteria 1671
626 Ga0307411_10000884 3300032005 Bacteria 11352
627 Ga0307411_10131559 3300032005 Bacteria 1829
628 Ga0307415_100036883 3300032126 Bacteria 3208
629 Ga0307415_100133460 3300032126 Bacteria 1884
630 Ga0307415_100160960 3300032126 Unclassified 1740
631 Ga0307415_100510607 3300032126 Unclassified 1053
632 Ga0307415_100816937 3300032126 Unclassified 852
633 Ga0307510_10000006 3300033180 Bacteria 566474
634 Ga0307510_10112942 3300033180 Bacteria 2452
635 Ga0307510_10364002 3300033180 Bacteria 894
636 Ga0373956_0115860 3300035119 Bacteria 1250
637 Ga0373955_0315635 3300035172 Bacteria 944
638 Ga0373924_0044956 3300035410 Bacteria 1816
639 Ga0373935_0844717 3300035692 Unclassified 677
640 Ga0373933_0259616 3300035724 Bacteria 1120
641 Ga0373937_0143168 3300036401 Bacteria 2237
642 Ga0373937_0213003 3300036401 Bacteria 1818
643 Ga0395905_0010252 3300037471 Bacteria 9127
644 Ga0395905_0036179 3300037471 Bacteria 4636
645 Ga0436365_0208206 3300039437 Bacteria 1387
646 Ga0436365_1218812 3300039437 Bacteria 2107
647 Ga0436361_0019641 3300039447 Bacteria 127735
648 Ga0436361_1131838 3300039447 Unclassified 1085
649 Ga0451791_0728188 3300041451 Bacteria 1272
650 Ga0451791_1748093 3300041451 Bacteria 1195
651 Ga0451797_0171226 3300041453 Unclassified 1068
652 Ga0451800_0010766 3300041459 Bacteria 1017
653 Ga0451802_0111061 3300041460 Bacteria 2653
654 Ga0451804_1183977 3300041463 Bacteria 1471
655 Ga0451807_1688973 3300041486 Bacteria 4227
656 Ga0451837_0957394 3300041494 Bacteria 3478
657 Ga0451839_0591939 3300041496 Bacteria 695
658 Ga0451853_2579635 3300041512 Unclassified 1313
659 Ga0439446_0047201 3300042156 Bacteria 1281
660 Ga0451577_0162885 3300042876 Bacteria 2009
661 Ga0453683_0000584 3300044673 Bacteria 40423
662 Ga0453683_0028338 3300044673 Bacteria 3547
663 Ga0466966_0222209 3300044684 Bacteria 1140
664 Ga0466961_0097843 3300044693 Bacteria 1850
665 Ga0453684_0331508 3300044712 Unclassified 1721
666 Ga0466970_0201573 3300044765 Unclassified 1107
667 Ga0451576_0000708 3300045051 Bacteria 67318
668 Ga0451576_0003454 3300045051 Bacteria 21672
669 Ga0451576_0142245 3300045051 Unclassified 2501
670 Ga0451576_0280510 3300045051 Bacteria 1742
671 Ga0495590_0001029 3300046457 Bacteria 12278
672 Ga0495590_0046972 3300046457 Unclassified 1506
673 Ga0495638_0006869 3300046460 Bacteria 8215
674 Ga0495580_0224617 3300046472 Unclassified 1290
675 Ga0495664_0330946 3300046477 Bacteria 918
676 Ga0495594_0489014 3300046499 Unclassified 699
677 Ga0495616_0000837 3300046513 Bacteria 22426
678 Ga0495630_0566472 3300046517 Unclassified 871
679 Ga0495632_0034293 3300046519 Bacteria 2599
680 Ga0495632_0053285 3300046519 Bacteria 1987
681 Ga0495643_0000214 3300046522 Bacteria 88979
682 Ga0495648_0070833 3300046524 Bacteria 2024
683 Ga0495665_0184210 3300046531 Bacteria 1084
684 Ga0495587_0050166 3300046536 Unclassified 2469
685 Ga0495645_0403780 3300046543 Bacteria 870
686 Ga0495625_0010605 3300046660 Bacteria 7603
687 Ga0495625_0041369 3300046660 Bacteria 3355
688 Ga0495625_0175026 3300046660 Bacteria 1430
689 Ga0495599_0014613 3300046678 Bacteria 4863
690 Ga0495647_0026008 3300046681 Bacteria 2142
691 Ga0495658_0005817 3300046683 Bacteria 6053
692 Ga0495649_0018603 3300046694 Bacteria 3906
693 Ga0495672_0277719 3300047320 Unclassified 802
694 Ga0495684_0193000 3300047471 Bacteria 1505
695 Ga0495686_0002983 3300047472 Bacteria 15069
696 Ga0495686_0246460 3300047472 Unclassified 1005
697 Ga0496100_0083187 3300048903 Unclassified 2166
698 Ga0496102_0184614 3300048905 Bacteria 1965
699 Ga0496103_0042528 3300048906 Bacteria 2797
700 Ga0496103_0090499 3300048906 Bacteria 1931
701 Ga0496104_0000017 3300048907 Bacteria 325877
702 Ga0496104_0004579 3300048907 Bacteria 12046
703 Ga0496104_0135615 3300048907 Bacteria 2365
704 Ga0496105_0000009 3300048908 Bacteria 325734
705 Ga0496105_0000256 3300048908 Bacteria 35835
706 Ga0496107_0204424 3300048910 Bacteria 1468
707 Ga0496107_0221381 3300048910 Bacteria 1408
708 Ga0496108_0597922 3300048911 Bacteria 961
709 Ga0496114_0002670 3300048917 Bacteria 13618
710 Ga0496115_0081437 3300048918 Bacteria 2637
711 Ga0496116_0066326 3300048919 Bacteria 2310
712 Ga0496117_0000523 3300048920 Bacteria 63335
713 Ga0496118_0000180 3300048921 Bacteria 112199
714 Ga0496118_0008446 3300048921 Bacteria 10643
715 Ga0496118_0164018 3300048921 Bacteria 1369
716 Ga0496119_0000998 3300048922 Bacteria 36271
717 Ga0496119_0004217 3300048922 Bacteria 14432
718 Ga0496119_0124758 3300048922 Bacteria 1410
719 Ga0496120_0000814 3300048923 Bacteria 44686
720 Ga0496120_0019980 3300048923 Bacteria 4270
721 Ga0496120_0234583 3300048923 Unclassified 869
722 Ga0496121_0003660 3300048924 Bacteria 21605
723 Ga0496121_0035773 3300048924 Bacteria 4441
724 Ga0496121_0066352 3300048924 Bacteria 2931
725 Ga0496122_0000725 3300048925 Bacteria 64489
726 Ga0496123_0001443 3300048926 Bacteria 33137
727 Ga0496124_0014972 3300048927 Bacteria 7466
728 Ga0496125_0002234 3300048928 Bacteria 25765
729 Ga0496125_0006868 3300048928 Bacteria 12194
730 Ga0496125_0013999 3300048928 Bacteria 7844
731 Ga0496126_0478054 3300048929 Unclassified 999
732 Ga0495678_022739 3300049459 Bacteria 2737
733 Ga0501031_0012034 3300049568 Bacteria 5641
734 Ga0501032_0001081 3300049569 Bacteria 21777
735 Ga0501032_0140155 3300049569 Bacteria 1593
736 Ga0501033_0013136 3300049570 Bacteria 6308
737 Ga0501034_0089507 3300049571 Bacteria 3076
738 Ga0501034_0169034 3300049571 Bacteria 2154
739 Ga0501034_0722985 3300049571 Bacteria 893
740 Ga0501036_0009221 3300049572 Bacteria 8111
741 Ga0501037_0005804 3300049573 Bacteria 9010
742 Ga0501037_0496918 3300049573 Bacteria 828
743 Ga0501038_0116972 3300049574 Unclassified 2202
744 Ga0501039_0501632 3300049575 Bacteria 953
745 Ga0501042_0003972 3300049578 Bacteria 9364
746 Ga0501043_0036679 3300049579 Unclassified 3857
747 Ga0501046_0006085 3300049580 Bacteria 10731
748 Ga0501047_0017668 3300049581 Bacteria 6835
749 Ga0501047_0092769 3300049581 Bacteria 2898
750 Ga0501047_0334227 3300049581 Bacteria 1353
751 Ga0501047_0428649 3300049581 Bacteria 1153
752 Ga0501067_0008524 3300049583 Bacteria 5685
753 Ga0501068_0005963 3300049584 Bacteria 6687
754 Ga0501070_0051592 3300049586 Bacteria 3414
755 Ga0501070_0583593 3300049586 Bacteria 892
756 Ga0501070_0630914 3300049586 Bacteria 852
757 Ga0501071_0006847 3300049587 Bacteria 7428
758 Ga0501073_0010359 3300049589 Bacteria 6839
759 Ga0501073_0012576 3300049589 Bacteria 6175
760 Ga0501074_0000405 3300049590 Bacteria 25788
761 Ga0501076_0007170 3300049592 Bacteria 8104
762 Ga0501077_0008833 3300049593 Bacteria 6253
763 Ga0501079_0004012 3300049741 Bacteria 10889
764 Ga0501080_0003407 3300049742 Bacteria 14011
765 Ga0501080_0089285 3300049742 Unclassified 2863
766 Ga0501080_0098327 3300049742 Bacteria 2716
767 Ga0501080_0555625 3300049742 Bacteria 1022
768 Ga0501080_0805748 3300049742 Bacteria 823
769 Ga0501081_0027625 3300049743 Bacteria 3827
770 Ga0501083_0016483 3300049744 Bacteria 5171
771 Ga0501083_0046539 3300049744 Unclassified 2933
772 Ga0501035_0019178 3300049822 Bacteria 6296
773 Ga0501035_0334631 3300049822 Bacteria 1270
774 Ga0501044_0028790 3300049823 Bacteria 5859
775 nmdc:mga05p37_5926_c1 3300050507 Bacteria 14383
776 nmdc:mga09592_934_c2 3300050508 Bacteria 22024
777 nmdc:mga06r32_518_c1 3300050510 Bacteria 33229
778 nmdc:mga08y16_218280_c1 3300050511 Unclassified 1974
779 nmdc:mga08y16_571_c2 3300050511 Bacteria 30328
780 nmdc:mga08y16_65792_c1 3300050511 Bacteria 3783
781 nmdc:mga08y16_859553_c1 3300050511 Bacteria 896
782 Ga0495601_0120166 3300053077 Bacteria 1706
783 Ga0500643_000396 3300053087 Bacteria 33542
784 Ga0500583_0023539 3300053092 Bacteria 2597
785 Ga0500558_108491 3300053106 Unclassified 1092
786 Ga0500597_015612 3300053120 Bacteria 2876
787 Ga0500590_150634 3300053148 Bacteria 1050
788 Ga0500616_0032412 3300053153 Bacteria 2857
789 Ga0500622_0002571 3300053156 Bacteria 13005
790 Ga0500622_0017409 3300053156 Bacteria 3823
791 Ga0500622_0047814 3300053156 Bacteria 2208
792 Ga0500622_0209908 3300053156 Bacteria 880
793 Ga0500611_005124 3300053727 Bacteria 1821
794 Ga0501084_0012026 3300054114 Bacteria 7165
795 Ga0501084_0093245 3300054114 Bacteria 2528
796 Ga0501082_0000075 3300060353 Bacteria 73206
797 Ga0501082_0011806 3300060353 Bacteria 7509
798 Ga0530510_0077153 3300061734 Bacteria 2422

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005530 Ga0070679_100053216 Ga0070679_1000532162 175
2 3300025921 Ga0207652_10039167 Ga0207652_100391673 175
3 3300044693 Ga0466961_0097843 Ga0466961_0097843_1297_1836 176
4 3300037471 Ga0395905_0036179 Ga0395905_0036179_3249_3830 180
5 3300046499 Ga0495594_0489014 Ga0495594_0489014_25_567 180
6 3300013296 Ga0157374_10660485 Ga0157374_106604852 184
7 3300005327 Ga0070658_10332657 Ga0070658_103326572 190
8 3300053156 Ga0500622_0017409 Ga0500622_0017409_225_884 190
9 3300039447 Ga0436361_1131838 Ga0436361_1131838_364_978 191
10 3300005436 Ga0070713_100022634 Ga0070713_1000226342 192
11 3300053156 Ga0500622_0002571 Ga0500622_0002571_148_801 194
12 3300028794 Ga0307515_10000037 Ga0307515_10000037140 195
13 3300005544 Ga0070686_100095023 Ga0070686_1000950232 196
14 3300009553 Ga0105249_10119239 Ga0105249_101192392 196
15 3300010375 Ga0105239_10006656 Ga0105239_100066565 196
16 3300025961 Ga0207712_10027904 Ga0207712_100279042 196
17 iso_pu_bacteria 2643221646 2644255569 196
18 3300035692 Ga0373935_0844717 Ga0373935_0844717_70_663 197
19 3300047472 Ga0495686_0002983 Ga0495686_0002983_6427_7023 197
20 3300048925 Ga0496122_0000725 Ga0496122_0000725_24662_25258 197
21 3300048926 Ga0496123_0001443 Ga0496123_0001443_17888_18484 197
22 3300003759 Ga0055525_1000013 Ga0055525_1000013414 198
23 3300021361 Ga0213872_10000085 Ga0213872_1000008580 198
24 3300025226 Ga0209674_112304 Ga0209674_1123041 198
25 3300025230 Ga0209563_100025 Ga0209563_100025173 198
26 3300033180 Ga0307510_10112942 Ga0307510_101129422 198
27 3300039447 Ga0436361_0019641 Ga0436361_0019641_23760_24368 198
28 3300005340 Ga0070689_100308589 Ga0070689_1003085892 199
29 3300005564 Ga0070664_100318947 Ga0070664_1003189472 199
30 3300005841 Ga0068863_100234424 Ga0068863_1002344242 199
31 3300006844 Ga0075428_100017573 Ga0075428_10001757310 199
32 3300006847 Ga0075431_100000257 Ga0075431_10000025727 199
33 3300006880 Ga0075429_100001404 Ga0075429_10000140410 199
34 3300009094 Ga0111539_10016527 Ga0111539_100165273 199
35 3300009147 Ga0114129_10002305 Ga0114129_100023058 199
36 3300025936 Ga0207670_10197307 Ga0207670_101973072 199
37 3300025945 Ga0207679_10374664 Ga0207679_103746642 199
38 3300026088 Ga0207641_10966810 Ga0207641_109668102 199
39 3300031250 Ga0265331_10000857 Ga0265331_1000085711 199
40 3300031251 Ga0265327_10001107 Ga0265327_1000110711 199
41 3300031649 Ga0307514_10023305 Ga0307514_100233053 199
42 3300033180 Ga0307510_10364002 Ga0307510_103640022 199
43 3300044765 Ga0466970_0201573 Ga0466970_0201573_149_781 199
44 3300046524 Ga0495648_0070833 Ga0495648_0070833_586_1185 199
45 3300050507 nmdc:mga05p37_5926_c1 nmdc:mga05p37_5926_c1_3036_3662 199
46 3300050508 nmdc:mga09592_934_c2 nmdc:mga09592_934_c2_13509_14135 199
47 3300050510 nmdc:mga06r32_518_c1 nmdc:mga06r32_518_c1_5841_6467 199
48 3300050511 nmdc:mga08y16_571_c2 nmdc:mga08y16_571_c2_1102_1728 199
49 iso_pu_bacteria 2738541337 2739054029 199
50 3300003322 rootL2_10123247 rootL2_101232472 200
51 3300003323 rootH1_10000797 rootH1_100007974 200
52 3300003794 Ga0055531_10000154 Ga0055531_1000015467 200
53 3300005337 Ga0070682_100047495 Ga0070682_1000474952 200
54 3300005340 Ga0070689_100150054 Ga0070689_1001500542 200
55 3300005340 Ga0070689_100239616 Ga0070689_1002396162 200
56 3300005365 Ga0070688_100152351 Ga0070688_1001523513 200
57 3300005444 Ga0070694_100793912 Ga0070694_1007939121 200
58 3300005548 Ga0070665_100044691 Ga0070665_1000446913 200
59 3300005577 Ga0068857_100174834 Ga0068857_1001748342 200
60 3300009094 Ga0111539_10295919 Ga0111539_102959192 200
61 3300025298 Ga0209050_1002369 Ga0209050_10023694 200
62 3300025303 Ga0209051_1003041 Ga0209051_10030412 200
63 3300025304 Ga0209257_1000016 Ga0209257_1000016872 200
64 3300025920 Ga0207649_10569437 Ga0207649_105694372 200
65 3300025936 Ga0207670_10071145 Ga0207670_100711452 200
66 3300026088 Ga0207641_10283124 Ga0207641_102831242 200
67 3300026116 Ga0207674_10111725 Ga0207674_101117252 200
68 3300028379 Ga0268266_10022170 Ga0268266_100221704 200
69 3300031456 Ga0307513_10163836 Ga0307513_101638363 200
70 3300037471 Ga0395905_0010252 Ga0395905_0010252_1983_2600 200
71 3300041451 Ga0451791_0728188 Ga0451791_0728188_363_1001 200
72 3300050511 nmdc:mga08y16_218280_c1 nmdc:mga08y16_218280_c1_209_835 200
73 iso_pu_bacteria 2831864461 2831866885 200
74 3300005331 Ga0070670_100227308 Ga0070670_1002273082 201
75 3300005439 Ga0070711_100132225 Ga0070711_1001322252 201
76 3300005459 Ga0068867_100334027 Ga0068867_1003340272 201
77 3300005539 Ga0068853_100240992 Ga0068853_1002409922 201
78 3300005548 Ga0070665_100011239 Ga0070665_1000112396 201
79 3300006237 Ga0097621_100235552 Ga0097621_1002355521 201
80 3300009174 Ga0105241_10010519 Ga0105241_100105193 201
81 3300009176 Ga0105242_10246527 Ga0105242_102465272 201
82 3300009177 Ga0105248_10492867 Ga0105248_104928672 201
83 3300009545 Ga0105237_10281952 Ga0105237_102819522 201
84 3300009551 Ga0105238_10002571 Ga0105238_1000257118 201
85 3300013105 Ga0157369_10046965 Ga0157369_100469654 201
86 3300013296 Ga0157374_10087355 Ga0157374_100873552 201
87 3300013307 Ga0157372_10134437 Ga0157372_101344372 201
88 3300014968 Ga0157379_10162183 Ga0157379_101621832 201
89 3300025304 Ga0209257_1021170 Ga0209257_10211702 201
90 3300025914 Ga0207671_10062103 Ga0207671_100621032 201
91 3300025914 Ga0207671_10261972 Ga0207671_102619722 201
92 3300025924 Ga0207694_10218158 Ga0207694_102181581 201
93 3300025925 Ga0207650_10186750 Ga0207650_101867502 201
94 3300026067 Ga0207678_10048413 Ga0207678_100484132 201
95 3300026089 Ga0207648_10241657 Ga0207648_102416572 201
96 3300028786 Ga0307517_10176140 Ga0307517_101761402 201
97 3300028794 Ga0307515_10012918 Ga0307515_100129184 201
98 3300028794 Ga0307515_10047411 Ga0307515_100474118 201
99 3300028794 Ga0307515_10146047 Ga0307515_101460473 201
100 3300031456 Ga0307513_10006084 Ga0307513_1000608410 201
101 3300031456 Ga0307513_10019540 Ga0307513_100195402 201
102 3300031730 Ga0307516_10000973 Ga0307516_1000097315 201
103 3300035172 Ga0373955_0315635 Ga0373955_0315635_186_800 201
104 3300046519 Ga0495632_0034293 Ga0495632_0034293_1660_2265 201
105 3300049580 Ga0501046_0006085 Ga0501046_0006085_3552_4214 201
106 3300049581 Ga0501047_0092769 Ga0501047_0092769_411_1073 201
107 3300049822 Ga0501035_0334631 Ga0501035_0334631_609_1223 201
108 3300053092 Ga0500583_0023539 Ga0500583_0023539_1626_2231 201
109 3300003316 rootH1_10008880 rootH1_100088802 202
110 3300003771 Ga0055526_1007082 Ga0055526_10070822 202
111 3300005614 Ga0068856_100050403 Ga0068856_1000504032 202
112 3300009093 Ga0105240_11211215 Ga0105240_112112151 202
113 3300025273 Ga0209673_1017194 Ga0209673_10171942 202
114 3300025295 Ga0209564_1000097 Ga0209564_1000097157 202
115 3300026078 Ga0207702_10179396 Ga0207702_101793961 202
116 3300031456 Ga0307513_10255915 Ga0307513_102559152 202
117 3300033180 Ga0307510_10000006 Ga0307510_1000000628 202
118 3300039437 Ga0436365_1218812 Ga0436365_1218812_407_1021 202
119 3300044684 Ga0466966_0222209 Ga0466966_0222209_217_825 202
120 3300048906 Ga0496103_0090499 Ga0496103_0090499_1069_1680 202
121 3300048918 Ga0496115_0081437 Ga0496115_0081437_319_930 202
122 3300048919 Ga0496116_0066326 Ga0496116_0066326_1011_1622 202
123 3300048920 Ga0496117_0000523 Ga0496117_0000523_2513_3124 202
124 3300048921 Ga0496118_0000180 Ga0496118_0000180_61665_62276 202
125 3300048922 Ga0496119_0000998 Ga0496119_0000998_21392_22000 202
126 3300048922 Ga0496119_0004217 Ga0496119_0004217_9455_10063 202
127 3300048922 Ga0496119_0124758 Ga0496119_0124758_202_813 202
128 3300048923 Ga0496120_0000814 Ga0496120_0000814_24157_24765 202
129 3300048923 Ga0496120_0019980 Ga0496120_0019980_2534_3145 202
130 3300048923 Ga0496120_0234583 Ga0496120_0234583_103_711 202
131 3300048924 Ga0496121_0035773 Ga0496121_0035773_3733_4344 202
132 3300048927 Ga0496124_0014972 Ga0496124_0014972_4925_5536 202
133 3300048928 Ga0496125_0006868 Ga0496125_0006868_730_1338 202
134 3300049581 Ga0501047_0017668 Ga0501047_0017668_2006_2626 202
135 3300053156 Ga0500622_0209908 Ga0500622_0209908_96_704 202
136 3300005577 Ga0068857_100042281 Ga0068857_1000422814 203
137 3300006028 Ga0070717_10000038 Ga0070717_1000003820 203
138 3300006028 Ga0070717_10049927 Ga0070717_100499275 203
139 3300026116 Ga0207674_10054980 Ga0207674_100549804 203
140 3300031595 Ga0265313_10003091 Ga0265313_100030913 203
141 3300031711 Ga0265314_10018622 Ga0265314_100186223 203
142 3300031711 Ga0265314_10040677 Ga0265314_100406772 203
143 3300046472 Ga0495580_0224617 Ga0495580_0224617_315_947 203
144 3300046543 Ga0495645_0403780 Ga0495645_0403780_126_755 203
145 3300046678 Ga0495599_0014613 Ga0495599_0014613_3592_4218 203
146 3300048903 Ga0496100_0083187 Ga0496100_0083187_395_1015 203
147 3300048907 Ga0496104_0004579 Ga0496104_0004579_6362_6982 203
148 3300048908 Ga0496105_0000256 Ga0496105_0000256_23319_23939 203
149 3300048910 Ga0496107_0204424 Ga0496107_0204424_150_770 203
150 3300048917 Ga0496114_0002670 Ga0496114_0002670_8448_9068 203
151 3300053077 Ga0495601_0120166 Ga0495601_0120166_625_1254 203
152 3300005331 Ga0070670_100078422 Ga0070670_1000784222 204
153 3300005335 Ga0070666_10003569 Ga0070666_100035695 204
154 3300005455 Ga0070663_100005805 Ga0070663_1000058053 204
155 3300005457 Ga0070662_100008323 Ga0070662_1000083234 204
156 3300005459 Ga0068867_100338004 Ga0068867_1003380041 204
157 3300005548 Ga0070665_100025117 Ga0070665_1000251174 204
158 3300005563 Ga0068855_100175572 Ga0068855_1001755722 204
159 3300005564 Ga0070664_100611496 Ga0070664_1006114962 204
160 3300005578 Ga0068854_100009334 Ga0068854_1000093342 204
161 3300005616 Ga0068852_100147859 Ga0068852_1001478592 204
162 3300005834 Ga0068851_10098068 Ga0068851_100980682 204
163 3300005841 Ga0068863_100434000 Ga0068863_1004340002 204
164 3300005842 Ga0068858_100000101 Ga0068858_1000001015 204
165 3300006358 Ga0068871_100082681 Ga0068871_1000826812 204
166 3300009551 Ga0105238_10330985 Ga0105238_103309852 204
167 3300009553 Ga0105249_10002100 Ga0105249_100021003 204
168 3300013296 Ga0157374_10250319 Ga0157374_102503192 204
169 3300014969 Ga0157376_10195729 Ga0157376_101957293 204
170 3300025321 Ga0207656_10000407 Ga0207656_1000040710 204
171 3300025903 Ga0207680_10002251 Ga0207680_100022512 204
172 3300025904 Ga0207647_10000075 Ga0207647_1000007546 204
173 3300025911 Ga0207654_10319681 Ga0207654_103196812 204
174 3300025913 Ga0207695_10087629 Ga0207695_100876293 204
175 3300025914 Ga0207671_10038094 Ga0207671_100380942 204
176 3300025925 Ga0207650_10068382 Ga0207650_100683822 204
177 3300025933 Ga0207706_10018566 Ga0207706_100185664 204
178 3300025945 Ga0207679_10658934 Ga0207679_106589342 204
179 3300025961 Ga0207712_10000211 Ga0207712_1000021155 204
180 3300025986 Ga0207658_10044849 Ga0207658_100448492 204
181 3300025986 Ga0207658_10957605 Ga0207658_109576052 204
182 3300025986 Ga0207658_11029370 Ga0207658_110293701 204
183 3300026035 Ga0207703_10000180 Ga0207703_1000018056 204
184 3300026041 Ga0207639_10000209 Ga0207639_100002094 204
185 3300026067 Ga0207678_10020169 Ga0207678_100201693 204
186 3300026078 Ga0207702_10062232 Ga0207702_100622322 204
187 3300026088 Ga0207641_10546460 Ga0207641_105464602 204
188 3300026089 Ga0207648_10158301 Ga0207648_101583012 204
189 3300026116 Ga0207674_10150158 Ga0207674_101501582 204
190 3300028379 Ga0268266_10000008 Ga0268266_10000008433 204
191 3300045051 Ga0451576_0000708 Ga0451576_0000708_44235_44882 204
192 3300045051 Ga0451576_0003454 Ga0451576_0003454_17575_18222 204
193 3300005331 Ga0070670_100637608 Ga0070670_1006376082 205
194 3300005367 Ga0070667_100029948 Ga0070667_1000299483 205
195 3300005548 Ga0070665_100000283 Ga0070665_10000028372 205
196 3300005614 Ga0068856_100215261 Ga0068856_1002152612 205
197 3300005843 Ga0068860_100580491 Ga0068860_1005804912 205
198 3300006880 Ga0075429_100886461 Ga0075429_1008864612 205
199 3300009093 Ga0105240_10423493 Ga0105240_104234932 205
200 3300025913 Ga0207695_10806897 Ga0207695_108068971 205
201 3300025925 Ga0207650_10037643 Ga0207650_100376434 205
202 3300026078 Ga0207702_10729830 Ga0207702_107298302 205
203 3300028379 Ga0268266_10000001 Ga0268266_100000012333 205
204 3300028381 Ga0268264_10417631 Ga0268264_104176312 205
205 3300031730 Ga0307516_10315374 Ga0307516_103153742 205
206 3300049569 Ga0501032_0140155 Ga0501032_0140155_789_1406 205
207 3300053156 Ga0500622_0047814 Ga0500622_0047814_745_1371 205
208 3300005335 Ga0070666_10061313 Ga0070666_100613132 206
209 3300005338 Ga0068868_100059920 Ga0068868_1000599202 206
210 3300005344 Ga0070661_100168221 Ga0070661_1001682212 206
211 3300005344 Ga0070661_100916433 Ga0070661_1009164331 206
212 3300005355 Ga0070671_100062046 Ga0070671_1000620462 206
213 3300005367 Ga0070667_100192445 Ga0070667_1001924452 206
214 3300005455 Ga0070663_100027649 Ga0070663_1000276493 206
215 3300005459 Ga0068867_100130729 Ga0068867_1001307292 206
216 3300005543 Ga0070672_100304032 Ga0070672_1003040322 206
217 3300005578 Ga0068854_100057180 Ga0068854_1000571802 206
218 3300005614 Ga0068856_100797058 Ga0068856_1007970582 206
219 3300005616 Ga0068852_100443087 Ga0068852_1004430872 206
220 3300005834 Ga0068851_10001629 Ga0068851_100016298 206
221 3300005842 Ga0068858_100016218 Ga0068858_1000162187 206
222 3300005843 Ga0068860_100323812 Ga0068860_1003238121 206
223 3300009093 Ga0105240_10000243 Ga0105240_1000024353 206
224 3300009093 Ga0105240_10223878 Ga0105240_102238782 206
225 3300009174 Ga0105241_10079670 Ga0105241_100796703 206
226 3300009174 Ga0105241_10613843 Ga0105241_106138431 206
227 3300009545 Ga0105237_10105815 Ga0105237_101058153 206
228 3300009553 Ga0105249_10152735 Ga0105249_101527352 206
229 3300010375 Ga0105239_10230454 Ga0105239_102304542 206
230 3300025261 Ga0209233_1007840 Ga0209233_10078403 206
231 3300025321 Ga0207656_10007696 Ga0207656_100076962 206
232 3300025903 Ga0207680_10039871 Ga0207680_100398713 206
233 3300025904 Ga0207647_10005480 Ga0207647_100054808 206
234 3300025911 Ga0207654_10173108 Ga0207654_101731082 206
235 3300025913 Ga0207695_10022225 Ga0207695_100222253 206
236 3300025913 Ga0207695_10022274 Ga0207695_100222745 206
237 3300025914 Ga0207671_10002882 Ga0207671_100028823 206
238 3300025914 Ga0207671_10033854 Ga0207671_100338544 206
239 3300025920 Ga0207649_10114042 Ga0207649_101140422 206
240 3300025924 Ga0207694_10003412 Ga0207694_100034128 206
241 3300025933 Ga0207706_10032026 Ga0207706_100320264 206
242 3300025940 Ga0207691_10073960 Ga0207691_100739601 206
243 3300025961 Ga0207712_10003217 Ga0207712_100032173 206
244 3300025981 Ga0207640_10020481 Ga0207640_100204815 206
245 3300025986 Ga0207658_10019618 Ga0207658_100196182 206
246 3300025986 Ga0207658_10052688 Ga0207658_100526882 206
247 3300026023 Ga0207677_10128239 Ga0207677_101282392 206
248 3300026035 Ga0207703_10001805 Ga0207703_1000180511 206
249 3300026041 Ga0207639_10000602 Ga0207639_100006027 206
250 3300026067 Ga0207678_10003270 Ga0207678_1000327011 206
251 3300026078 Ga0207702_10225507 Ga0207702_102255072 206
252 3300026088 Ga0207641_10429903 Ga0207641_104299032 206
253 3300026142 Ga0207698_10066641 Ga0207698_100666413 206
254 3300028563 Ga0265319_1000777 Ga0265319_100077713 206
255 3300028577 Ga0265318_10004691 Ga0265318_100046915 206
256 3300031240 Ga0265320_10025262 Ga0265320_100252622 206
257 3300031838 Ga0307518_10304507 Ga0307518_103045071 206
258 3300044673 Ga0453683_0000584 Ga0453683_0000584_6621_7268 206
259 3300045051 Ga0451576_0280510 Ga0451576_0280510_865_1512 206
260 3300049571 Ga0501034_0722985 Ga0501034_0722985_80_700 206
261 3300049573 Ga0501037_0496918 Ga0501037_0496918_85_705 206
262 3300049575 Ga0501039_0501632 Ga0501039_0501632_195_815 206
263 3300049581 Ga0501047_0334227 Ga0501047_0334227_598_1218 206
264 3300049581 Ga0501047_0428649 Ga0501047_0428649_398_1018 206
265 3300049586 Ga0501070_0630914 Ga0501070_0630914_110_730 206
266 3300049589 Ga0501073_0012576 Ga0501073_0012576_907_1527 206
267 3300049742 Ga0501080_0098327 Ga0501080_0098327_2002_2622 206
268 3300049742 Ga0501080_0805748 Ga0501080_0805748_127_747 206
269 3300053087 Ga0500643_000396 Ga0500643_000396_5707_6330 206
270 3300053120 Ga0500597_015612 Ga0500597_015612_1033_1656 206
271 3300053148 Ga0500590_150634 Ga0500590_150634_16_669 206
272 3300054114 Ga0501084_0093245 Ga0501084_0093245_157_777 206
273 3300060353 Ga0501082_0000075 Ga0501082_0000075_69114_69734 206
274 3300003320 rootH2_10003802 rootH2_100038029 207
275 3300003323 rootH1_10244250 rootH1_102442504 207
276 3300005331 Ga0070670_100311155 Ga0070670_1003111552 207
277 3300005535 Ga0070684_100340026 Ga0070684_1003400262 207
278 3300005548 Ga0070665_100453655 Ga0070665_1004536552 207
279 3300005563 Ga0068855_100436725 Ga0068855_1004367252 207
280 3300005616 Ga0068852_101016960 Ga0068852_1010169601 207
281 3300005618 Ga0068864_100265858 Ga0068864_1002658582 207
282 3300005844 Ga0068862_100503374 Ga0068862_1005033742 207
283 3300009101 Ga0105247_10097127 Ga0105247_100971273 207
284 3300009553 Ga0105249_10293143 Ga0105249_102931432 207
285 3300014325 Ga0163163_10738004 Ga0163163_107380042 207
286 3300025321 Ga0207656_10140059 Ga0207656_101400592 207
287 3300025949 Ga0207667_10718450 Ga0207667_107184502 207
288 3300026095 Ga0207676_10446970 Ga0207676_104469702 207
289 3300026118 Ga0207675_101076773 Ga0207675_1010767732 207
290 3300028380 Ga0268265_10453107 Ga0268265_104531072 207
291 3300029957 Ga0265324_10036760 Ga0265324_100367602 207
292 3300031507 Ga0307509_10313299 Ga0307509_103132992 207
293 3300042876 Ga0451577_0162885 Ga0451577_0162885_45_695 207
294 3300044673 Ga0453683_0028338 Ga0453683_0028338_2173_2826 207
295 3300044712 Ga0453684_0331508 Ga0453684_0331508_248_898 207
296 3300045051 Ga0451576_0142245 Ga0451576_0142245_407_1060 207
297 3300046536 Ga0495587_0050166 Ga0495587_0050166_1227_1925 207
298 3300053106 Ga0500558_108491 Ga0500558_108491_386_1039 207
299 3300003322 rootL2_10095019 rootL2_100950192 208
300 3300005327 Ga0070658_10449313 Ga0070658_104493131 208
301 3300005328 Ga0070676_10009973 Ga0070676_100099735 208
302 3300005328 Ga0070676_10132958 Ga0070676_101329583 208
303 3300005334 Ga0068869_100110730 Ga0068869_1001107302 208
304 3300005335 Ga0070666_10321439 Ga0070666_103214392 208
305 3300005338 Ga0068868_100094578 Ga0068868_1000945782 208
306 3300005347 Ga0070668_100024849 Ga0070668_1000248496 208
307 3300005347 Ga0070668_100289790 Ga0070668_1002897902 208
308 3300005353 Ga0070669_100134161 Ga0070669_1001341612 208
309 3300005354 Ga0070675_100091367 Ga0070675_1000913673 208
310 3300005364 Ga0070673_100443395 Ga0070673_1004433952 208
311 3300005367 Ga0070667_100591404 Ga0070667_1005914041 208
312 3300005437 Ga0070710_10156140 Ga0070710_101561401 208
313 3300005441 Ga0070700_100013808 Ga0070700_1000138083 208
314 3300005456 Ga0070678_100120737 Ga0070678_1001207372 208
315 3300005459 Ga0068867_100022629 Ga0068867_1000226295 208
316 3300005459 Ga0068867_100025240 Ga0068867_1000252403 208
317 3300005459 Ga0068867_100090222 Ga0068867_1000902222 208
318 3300005543 Ga0070672_100219683 Ga0070672_1002196832 208
319 3300005548 Ga0070665_100437813 Ga0070665_1004378132 208
320 3300005577 Ga0068857_100855020 Ga0068857_1008550201 208
321 3300005577 Ga0068857_101322220 Ga0068857_1013222201 208
322 3300005578 Ga0068854_100766937 Ga0068854_1007669371 208
323 3300005617 Ga0068859_100284369 Ga0068859_1002843692 208
324 3300005617 Ga0068859_101174319 Ga0068859_1011743192 208
325 3300005719 Ga0068861_100134761 Ga0068861_1001347612 208
326 3300005842 Ga0068858_100046651 Ga0068858_1000466512 208
327 3300005844 Ga0068862_100168931 Ga0068862_1001689312 208
328 3300006237 Ga0097621_100156877 Ga0097621_1001568772 208
329 3300006358 Ga0068871_100069852 Ga0068871_1000698522 208
330 3300006881 Ga0068865_100013736 Ga0068865_1000137363 208
331 3300006931 Ga0097620_100284371 Ga0097620_1002843712 208
332 3300006931 Ga0097620_101174762 Ga0097620_1011747622 208
333 3300009098 Ga0105245_11187890 Ga0105245_111878901 208
334 3300009148 Ga0105243_10382283 Ga0105243_103822831 208
335 3300009545 Ga0105237_10028008 Ga0105237_100280084 208
336 3300009545 Ga0105237_10755455 Ga0105237_107554551 208
337 3300010375 Ga0105239_10994680 Ga0105239_109946802 208
338 3300014326 Ga0157380_10004887 Ga0157380_100048876 208
339 3300025898 Ga0207692_10080365 Ga0207692_100803651 208
340 3300025903 Ga0207680_10181017 Ga0207680_101810172 208
341 3300025905 Ga0207685_10114313 Ga0207685_101143132 208
342 3300025907 Ga0207645_10026936 Ga0207645_100269362 208
343 3300025908 Ga0207643_10012952 Ga0207643_100129522 208
344 3300025909 Ga0207705_10016092 Ga0207705_100160924 208
345 3300025914 Ga0207671_10015791 Ga0207671_100157912 208
346 3300025923 Ga0207681_10018449 Ga0207681_100184493 208
347 3300025933 Ga0207706_10053512 Ga0207706_100535123 208
348 3300025933 Ga0207706_10125507 Ga0207706_101255072 208
349 3300025933 Ga0207706_10381431 Ga0207706_103814312 208
350 3300025934 Ga0207686_10287598 Ga0207686_102875981 208
351 3300025938 Ga0207704_10022303 Ga0207704_100223032 208
352 3300025940 Ga0207691_10432076 Ga0207691_104320761 208
353 3300025942 Ga0207689_10110436 Ga0207689_101104362 208
354 3300025942 Ga0207689_10487671 Ga0207689_104876712 208
355 3300025949 Ga0207667_10641997 Ga0207667_106419972 208
356 3300025960 Ga0207651_10176609 Ga0207651_101766091 208
357 3300025972 Ga0207668_10184956 Ga0207668_101849562 208
358 3300025972 Ga0207668_10227397 Ga0207668_102273972 208
359 3300025981 Ga0207640_10722151 Ga0207640_107221512 208
360 3300025986 Ga0207658_10202547 Ga0207658_102025472 208
361 3300026035 Ga0207703_10075965 Ga0207703_100759652 208
362 3300026041 Ga0207639_10480427 Ga0207639_104804271 208
363 3300026075 Ga0207708_10199468 Ga0207708_101994682 208
364 3300026089 Ga0207648_10065816 Ga0207648_100658162 208
365 3300026089 Ga0207648_10102235 Ga0207648_101022353 208
366 3300026116 Ga0207674_10211943 Ga0207674_102119432 208
367 3300026116 Ga0207674_10234977 Ga0207674_102349771 208
368 3300026118 Ga0207675_100091678 Ga0207675_1000916782 208
369 3300026118 Ga0207675_100501076 Ga0207675_1005010761 208
370 3300026121 Ga0207683_10007087 Ga0207683_100070873 208
371 3300028379 Ga0268266_10305193 Ga0268266_103051932 208
372 3300028380 Ga0268265_10912788 Ga0268265_109127881 208
373 3300028563 Ga0265319_1026809 Ga0265319_10268092 208
374 3300028800 Ga0265338_10011548 Ga0265338_100115488 208
375 3300031251 Ga0265327_10003286 Ga0265327_100032867 208
376 3300031251 Ga0265327_10103771 Ga0265327_101037711 208
377 3300031731 Ga0307405_10826351 Ga0307405_108263512 208
378 3300031995 Ga0307409_100144330 Ga0307409_1001443302 208
379 3300032126 Ga0307415_100510607 Ga0307415_1005106072 208
380 3300032126 Ga0307415_100816937 Ga0307415_1008169371 208
381 3300035119 Ga0373956_0115860 Ga0373956_0115860_307_933 208
382 3300036401 Ga0373937_0213003 Ga0373937_0213003_52_678 208
383 3300041496 Ga0451839_0591939 Ga0451839_0591939_20_673 208
384 3300046457 Ga0495590_0046972 Ga0495590_0046972_276_902 208
385 3300046522 Ga0495643_0000214 Ga0495643_0000214_81370_82026 208
386 3300048907 Ga0496104_0135615 Ga0496104_0135615_545_1171 208
387 3300049571 Ga0501034_0089507 Ga0501034_0089507_1840_2490 208
388 3300049586 Ga0501070_0583593 Ga0501070_0583593_239_865 208
389 3300053153 Ga0500616_0032412 Ga0500616_0032412_1247_1903 208
390 3300061734 Ga0530510_0077153 Ga0530510_0077153_293_919 208
391 3300005337 Ga0070682_100115377 Ga0070682_1001153772 209
392 3300005367 Ga0070667_100143690 Ga0070667_1001436902 209
393 3300005530 Ga0070679_100062616 Ga0070679_1000626162 209
394 3300005841 Ga0068863_100001082 Ga0068863_10000108225 209
395 3300005842 Ga0068858_100030767 Ga0068858_1000307675 209
396 3300005843 Ga0068860_100000878 Ga0068860_10000087817 209
397 3300005844 Ga0068862_100028773 Ga0068862_1000287732 209
398 3300005844 Ga0068862_100456597 Ga0068862_1004565972 209
399 3300006358 Ga0068871_100332048 Ga0068871_1003320482 209
400 3300006881 Ga0068865_100341125 Ga0068865_1003411252 209
401 3300009093 Ga0105240_10018068 Ga0105240_100180685 209
402 3300009093 Ga0105240_10057832 Ga0105240_100578322 209
403 3300009551 Ga0105238_10037280 Ga0105238_100372802 209
404 3300009551 Ga0105238_10331969 Ga0105238_103319692 209
405 3300010375 Ga0105239_10412875 Ga0105239_104128752 209
406 3300013308 Ga0157375_10004701 Ga0157375_100047016 209
407 3300017792 Ga0163161_10524622 Ga0163161_105246222 209
408 3300025900 Ga0207710_10166097 Ga0207710_101660972 209
409 3300025913 Ga0207695_10111236 Ga0207695_101112362 209
410 3300025921 Ga0207652_10046335 Ga0207652_100463352 209
411 3300025924 Ga0207694_10486284 Ga0207694_104862842 209
412 3300025931 Ga0207644_10179204 Ga0207644_101792041 209
413 3300025942 Ga0207689_10655053 Ga0207689_106550531 209
414 3300025986 Ga0207658_10362843 Ga0207658_103628432 209
415 3300026035 Ga0207703_10001858 Ga0207703_100018586 209
416 3300026067 Ga0207678_10069374 Ga0207678_100693742 209
417 3300026078 Ga0207702_10184420 Ga0207702_101844202 209
418 3300026088 Ga0207641_10000217 Ga0207641_1000021753 209
419 3300026088 Ga0207641_10427604 Ga0207641_104276042 209
420 3300026089 Ga0207648_10443515 Ga0207648_104435152 209
421 3300028379 Ga0268266_10008971 Ga0268266_100089712 209
422 3300028380 Ga0268265_10089988 Ga0268265_100899882 209
423 3300028380 Ga0268265_10555792 Ga0268265_105557923 209
424 3300028381 Ga0268264_10000058 Ga0268264_1000005831 209
425 3300028381 Ga0268264_10000060 Ga0268264_1000006025 209
426 3300031456 Ga0307513_10026034 Ga0307513_100260343 209
427 3300041453 Ga0451797_0171226 Ga0451797_0171226_149_784 209
428 3300041460 Ga0451802_0111061 Ga0451802_0111061_1862_2497 209
429 3300041486 Ga0451807_1688973 Ga0451807_1688973_3060_3698 209
430 3300042156 Ga0439446_0047201 Ga0439446_0047201_435_1106 209
431 3300046457 Ga0495590_0001029 Ga0495590_0001029_5449_6087 209
432 3300046519 Ga0495632_0053285 Ga0495632_0053285_781_1419 209
433 3300046660 Ga0495625_0010605 Ga0495625_0010605_2805_3443 209
434 3300047320 Ga0495672_0277719 Ga0495672_0277719_150_788 209
435 3300047472 Ga0495686_0246460 Ga0495686_0246460_153_782 209
436 3300048921 Ga0496118_0164018 Ga0496118_0164018_243_872 209
437 3300048924 Ga0496121_0066352 Ga0496121_0066352_1059_1688 209
438 3300048928 Ga0496125_0002234 Ga0496125_0002234_14356_14985 209
439 3300048929 Ga0496126_0478054 Ga0496126_0478054_75_704 209
440 3300049459 Ga0495678_022739 Ga0495678_022739_967_1605 209
441 3300049583 Ga0501067_0008524 Ga0501067_0008524_2024_2662 209
442 3300049584 Ga0501068_0005963 Ga0501068_0005963_2748_3386 209
443 3300049586 Ga0501070_0051592 Ga0501070_0051592_1947_2585 209
444 3300049587 Ga0501071_0006847 Ga0501071_0006847_2411_3049 209
445 3300049589 Ga0501073_0010359 Ga0501073_0010359_4262_4900 209
446 3300049590 Ga0501074_0000405 Ga0501074_0000405_408_1046 209
447 3300049592 Ga0501076_0007170 Ga0501076_0007170_1613_2251 209
448 3300049593 Ga0501077_0008833 Ga0501077_0008833_964_1602 209
449 3300049741 Ga0501079_0004012 Ga0501079_0004012_6410_7048 209
450 3300049742 Ga0501080_0003407 Ga0501080_0003407_9994_10632 209
451 3300049743 Ga0501081_0027625 Ga0501081_0027625_3014_3652 209
452 3300049744 Ga0501083_0016483 Ga0501083_0016483_899_1537 209
453 3300054114 Ga0501084_0012026 Ga0501084_0012026_1492_2130 209
454 3300060353 Ga0501082_0011806 Ga0501082_0011806_2456_3094 209
455 3300005329 Ga0070683_100803399 Ga0070683_1008033992 210
456 3300005333 Ga0070677_10063017 Ga0070677_100630172 210
457 3300005334 Ga0068869_100149280 Ga0068869_1001492802 210
458 3300005334 Ga0068869_100155783 Ga0068869_1001557832 210
459 3300005335 Ga0070666_10000239 Ga0070666_100002395 210
460 3300005337 Ga0070682_100002961 Ga0070682_1000029619 210
461 3300005337 Ga0070682_100137504 Ga0070682_1001375042 210
462 3300005338 Ga0068868_100720808 Ga0068868_1007208081 210
463 3300005340 Ga0070689_100010836 Ga0070689_1000108365 210
464 3300005340 Ga0070689_100530814 Ga0070689_1005308142 210
465 3300005340 Ga0070689_100641570 Ga0070689_1006415701 210
466 3300005341 Ga0070691_10494791 Ga0070691_104947911 210
467 3300005343 Ga0070687_100651501 Ga0070687_1006515011 210
468 3300005344 Ga0070661_100051593 Ga0070661_1000515932 210
469 3300005344 Ga0070661_100064639 Ga0070661_1000646392 210
470 3300005347 Ga0070668_100501690 Ga0070668_1005016901 210
471 3300005347 Ga0070668_100921229 Ga0070668_1009212291 210
472 3300005353 Ga0070669_100616081 Ga0070669_1006160812 210
473 3300005354 Ga0070675_100037736 Ga0070675_1000377364 210
474 3300005354 Ga0070675_100139446 Ga0070675_1001394462 210
475 3300005354 Ga0070675_100998002 Ga0070675_1009980021 210
476 3300005364 Ga0070673_100103082 Ga0070673_1001030821 210
477 3300005364 Ga0070673_100321176 Ga0070673_1003211762 210
478 3300005364 Ga0070673_100726957 Ga0070673_1007269572 210
479 3300005365 Ga0070688_100241554 Ga0070688_1002415542 210
480 3300005365 Ga0070688_100358850 Ga0070688_1003588502 210
481 3300005365 Ga0070688_100624940 Ga0070688_1006249402 210
482 3300005367 Ga0070667_100100676 Ga0070667_1001006763 210
483 3300005438 Ga0070701_10017426 Ga0070701_100174262 210
484 3300005438 Ga0070701_10172989 Ga0070701_101729892 210
485 3300005441 Ga0070700_100022106 Ga0070700_1000221063 210
486 3300005444 Ga0070694_100256003 Ga0070694_1002560032 210
487 3300005455 Ga0070663_100173728 Ga0070663_1001737282 210
488 3300005455 Ga0070663_100322822 Ga0070663_1003228222 210
489 3300005455 Ga0070663_100437979 Ga0070663_1004379792 210
490 3300005456 Ga0070678_100025465 Ga0070678_1000254653 210
491 3300005456 Ga0070678_100041542 Ga0070678_1000415423 210
492 3300005457 Ga0070662_100022542 Ga0070662_1000225421 210
493 3300005457 Ga0070662_100118024 Ga0070662_1001180242 210
494 3300005466 Ga0070685_10061807 Ga0070685_100618072 210
495 3300005466 Ga0070685_10363955 Ga0070685_103639552 210
496 3300005543 Ga0070672_100010396 Ga0070672_1000103967 210
497 3300005543 Ga0070672_100026815 Ga0070672_1000268152 210
498 3300005543 Ga0070672_100048540 Ga0070672_1000485403 210
499 3300005544 Ga0070686_100015956 Ga0070686_1000159563 210
500 3300005548 Ga0070665_100008331 Ga0070665_1000083312 210
501 3300005548 Ga0070665_100363777 Ga0070665_1003637772 210
502 3300005563 Ga0068855_100035915 Ga0068855_1000359155 210
503 3300005564 Ga0070664_100014517 Ga0070664_1000145176 210
504 3300005578 Ga0068854_100001633 Ga0068854_1000016333 210
505 3300005614 Ga0068856_100608688 Ga0068856_1006086882 210
506 3300005615 Ga0070702_100011956 Ga0070702_1000119562 210
507 3300005615 Ga0070702_100374767 Ga0070702_1003747672 210
508 3300005615 Ga0070702_100392047 Ga0070702_1003920472 210
509 3300005616 Ga0068852_100026314 Ga0068852_1000263142 210
510 3300005617 Ga0068859_100160391 Ga0068859_1001603912 210
511 3300005617 Ga0068859_100366986 Ga0068859_1003669862 210
512 3300005618 Ga0068864_100102696 Ga0068864_1001026962 210
513 3300005618 Ga0068864_100247640 Ga0068864_1002476402 210
514 3300005718 Ga0068866_10207352 Ga0068866_102073522 210
515 3300005718 Ga0068866_10222703 Ga0068866_102227031 210
516 3300005719 Ga0068861_100006072 Ga0068861_1000060729 210
517 3300005719 Ga0068861_100007372 Ga0068861_1000073724 210
518 3300005719 Ga0068861_100164035 Ga0068861_1001640353 210
519 3300005719 Ga0068861_100198619 Ga0068861_1001986192 210
520 3300005719 Ga0068861_100463860 Ga0068861_1004638602 210
521 3300005834 Ga0068851_10001806 Ga0068851_100018063 210
522 3300005840 Ga0068870_10001457 Ga0068870_100014572 210
523 3300005840 Ga0068870_10191787 Ga0068870_101917872 210
524 3300005841 Ga0068863_100128289 Ga0068863_1001282893 210
525 3300005841 Ga0068863_100146756 Ga0068863_1001467563 210
526 3300005841 Ga0068863_100284907 Ga0068863_1002849072 210
527 3300005842 Ga0068858_100003283 Ga0068858_1000032835 210
528 3300005844 Ga0068862_100057971 Ga0068862_1000579713 210
529 3300005844 Ga0068862_100482419 Ga0068862_1004824192 210
530 3300006163 Ga0070715_10507707 Ga0070715_105077071 210
531 3300006237 Ga0097621_100203097 Ga0097621_1002030972 210
532 3300006237 Ga0097621_100366002 Ga0097621_1003660022 210
533 3300006358 Ga0068871_100103159 Ga0068871_1001031592 210
534 3300006358 Ga0068871_100149280 Ga0068871_1001492802 210
535 3300006881 Ga0068865_100010271 Ga0068865_1000102715 210
536 3300006881 Ga0068865_100056466 Ga0068865_1000564662 210
537 3300006881 Ga0068865_100298502 Ga0068865_1002985022 210
538 3300006931 Ga0097620_100160396 Ga0097620_1001603962 210
539 3300006931 Ga0097620_100366991 Ga0097620_1003669912 210
540 3300009094 Ga0111539_10088809 Ga0111539_100888093 210
541 3300009094 Ga0111539_10209204 Ga0111539_102092042 210
542 3300009148 Ga0105243_10374074 Ga0105243_103740742 210
543 3300009176 Ga0105242_10222059 Ga0105242_102220593 210
544 3300009177 Ga0105248_10161297 Ga0105248_101612972 210
545 3300009177 Ga0105248_10170358 Ga0105248_101703584 210
546 3300009553 Ga0105249_10566131 Ga0105249_105661312 210
547 3300013306 Ga0163162_10169995 Ga0163162_101699952 210
548 3300013308 Ga0157375_11035011 Ga0157375_110350112 210
549 3300014325 Ga0163163_10043577 Ga0163163_100435773 210
550 3300014326 Ga0157380_10127130 Ga0157380_101271303 210
551 3300014326 Ga0157380_10133286 Ga0157380_101332863 210
552 3300014326 Ga0157380_10166658 Ga0157380_101666583 210
553 3300014326 Ga0157380_10237221 Ga0157380_102372213 210
554 3300014968 Ga0157379_10706706 Ga0157379_107067062 210
555 3300014969 Ga0157376_10038493 Ga0157376_100384932 210
556 3300014969 Ga0157376_10233686 Ga0157376_102336862 210
557 3300014969 Ga0157376_10426574 Ga0157376_104265742 210
558 3300025893 Ga0207682_10005406 Ga0207682_100054062 210
559 3300025905 Ga0207685_10415554 Ga0207685_104155541 210
560 3300025908 Ga0207643_10054590 Ga0207643_100545902 210
561 3300025911 Ga0207654_10042683 Ga0207654_100426832 210
562 3300025913 Ga0207695_10123568 Ga0207695_101235682 210
563 3300025920 Ga0207649_10041909 Ga0207649_100419092 210
564 3300025924 Ga0207694_10000784 Ga0207694_1000078429 210
565 3300025926 Ga0207659_10045020 Ga0207659_100450204 210
566 3300025926 Ga0207659_10115488 Ga0207659_101154882 210
567 3300025926 Ga0207659_10117147 Ga0207659_101171472 210
568 3300025933 Ga0207706_10004965 Ga0207706_100049655 210
569 3300025935 Ga0207709_10145941 Ga0207709_101459411 210
570 3300025936 Ga0207670_10007470 Ga0207670_100074707 210
571 3300025937 Ga0207669_10216422 Ga0207669_102164222 210
572 3300025938 Ga0207704_10032099 Ga0207704_100320992 210
573 3300025940 Ga0207691_10008149 Ga0207691_100081499 210
574 3300025940 Ga0207691_10043483 Ga0207691_100434833 210
575 3300025940 Ga0207691_10297280 Ga0207691_102972801 210
576 3300025941 Ga0207711_10156947 Ga0207711_101569473 210
577 3300025941 Ga0207711_10514909 Ga0207711_105149092 210
578 3300025942 Ga0207689_10029034 Ga0207689_100290342 210
579 3300025942 Ga0207689_10227515 Ga0207689_102275153 210
580 3300025942 Ga0207689_10248253 Ga0207689_102482534 210
581 3300025949 Ga0207667_11294703 Ga0207667_112947031 210
582 3300025960 Ga0207651_10136050 Ga0207651_101360501 210
583 3300025961 Ga0207712_10173600 Ga0207712_101736002 210
584 3300025972 Ga0207668_10356008 Ga0207668_103560082 210
585 3300025981 Ga0207640_10013953 Ga0207640_100139534 210
586 3300026035 Ga0207703_10004699 Ga0207703_100046994 210
587 3300026041 Ga0207639_10000836 Ga0207639_1000083613 210
588 3300026067 Ga0207678_10059818 Ga0207678_100598184 210
589 3300026067 Ga0207678_10205120 Ga0207678_102051202 210
590 3300026075 Ga0207708_10014631 Ga0207708_100146313 210
591 3300026088 Ga0207641_10081047 Ga0207641_100810472 210
592 3300026088 Ga0207641_10278870 Ga0207641_102788702 210
593 3300026088 Ga0207641_10696100 Ga0207641_106961002 210
594 3300026089 Ga0207648_10068616 Ga0207648_100686164 210
595 3300026089 Ga0207648_10932586 Ga0207648_109325862 210
596 3300026095 Ga0207676_10065516 Ga0207676_100655163 210
597 3300026118 Ga0207675_100002110 Ga0207675_10000211017 210
598 3300026118 Ga0207675_100002779 Ga0207675_10000277919 210
599 3300026118 Ga0207675_100186531 Ga0207675_1001865313 210
600 3300026118 Ga0207675_100198662 Ga0207675_1001986623 210
601 3300026118 Ga0207675_100673102 Ga0207675_1006731022 210
602 3300026121 Ga0207683_10014004 Ga0207683_100140042 210
603 3300026121 Ga0207683_10048570 Ga0207683_100485702 210
604 3300028379 Ga0268266_10098279 Ga0268266_100982792 210
605 3300028379 Ga0268266_10222782 Ga0268266_102227823 210
606 3300028380 Ga0268265_10438294 Ga0268265_104382942 210
607 3300031456 Ga0307513_10013647 Ga0307513_100136476 210
608 3300031456 Ga0307513_10023596 Ga0307513_100235968 210
609 3300031456 Ga0307513_10143864 Ga0307513_101438643 210
610 3300031731 Ga0307405_10219469 Ga0307405_102194692 210
611 3300031824 Ga0307413_10052491 Ga0307413_100524912 210
612 3300031852 Ga0307410_10028299 Ga0307410_100282992 210
613 3300031852 Ga0307410_10210176 Ga0307410_102101762 210
614 3300031901 Ga0307406_10340611 Ga0307406_103406112 210
615 3300031903 Ga0307407_10057003 Ga0307407_100570032 210
616 3300031903 Ga0307407_10282334 Ga0307407_102823342 210
617 3300031995 Ga0307409_100553631 Ga0307409_1005536312 210
618 3300032002 Ga0307416_100113217 Ga0307416_1001132172 210
619 3300032002 Ga0307416_100226911 Ga0307416_1002269112 210
620 3300032005 Ga0307411_10000884 Ga0307411_1000088412 210
621 3300032005 Ga0307411_10131559 Ga0307411_101315592 210
622 3300032126 Ga0307415_100036883 Ga0307415_1000368831 210
623 3300032126 Ga0307415_100133460 Ga0307415_1001334602 210
624 3300046460 Ga0495638_0006869 Ga0495638_0006869_3098_3736 210
625 3300046513 Ga0495616_0000837 Ga0495616_0000837_17557_18204 210
626 3300046660 Ga0495625_0175026 Ga0495625_0175026_622_1260 210
627 3300046694 Ga0495649_0018603 Ga0495649_0018603_2956_3594 210
628 3300049568 Ga0501031_0012034 Ga0501031_0012034_36_701 210
629 3300049569 Ga0501032_0001081 Ga0501032_0001081_1746_2411 210
630 3300049570 Ga0501033_0013136 Ga0501033_0013136_3898_4563 210
631 3300049571 Ga0501034_0169034 Ga0501034_0169034_1024_1689 210
632 3300049572 Ga0501036_0009221 Ga0501036_0009221_6537_7202 210
633 3300049573 Ga0501037_0005804 Ga0501037_0005804_6721_7386 210
634 3300049574 Ga0501038_0116972 Ga0501038_0116972_1202_1867 210
635 3300049578 Ga0501042_0003972 Ga0501042_0003972_8069_8734 210
636 3300049579 Ga0501043_0036679 Ga0501043_0036679_1629_2294 210
637 3300049742 Ga0501080_0089285 Ga0501080_0089285_1537_2202 210
638 3300049744 Ga0501083_0046539 Ga0501083_0046539_1214_1879 210
639 3300049822 Ga0501035_0019178 Ga0501035_0019178_3898_4563 210
640 3300049823 Ga0501044_0028790 Ga0501044_0028790_1297_1962 210
641 3300050511 nmdc:mga08y16_65792_c1 nmdc:mga08y16_65792_c1_1420_2058 210
642 3300050511 nmdc:mga08y16_859553_c1 nmdc:mga08y16_859553_c1_244_882 210
643 3300005544 Ga0070686_100258195 Ga0070686_1002581952 211
644 3300005843 Ga0068860_100018738 Ga0068860_1000187385 211
645 3300006237 Ga0097621_100214882 Ga0097621_1002148822 211
646 3300006931 Ga0097620_100688829 Ga0097620_1006888292 211
647 3300009551 Ga0105238_10024347 Ga0105238_100243474 211
648 3300013308 Ga0157375_10680513 Ga0157375_106805132 211
649 3300014969 Ga0157376_10057121 Ga0157376_100571212 211
650 3300025924 Ga0207694_10005868 Ga0207694_100058688 211
651 3300028381 Ga0268264_10061028 Ga0268264_100610281 211
652 3300030521 Ga0307511_10012417 Ga0307511_100124179 211
653 3300032002 Ga0307416_100269170 Ga0307416_1002691702 211
654 3300032126 Ga0307415_100160960 Ga0307415_1001609602 211
655 3300039437 Ga0436365_0208206 Ga0436365_0208206_639_1280 211
656 3300041451 Ga0451791_1748093 Ga0451791_1748093_242_877 211
657 3300041459 Ga0451800_0010766 Ga0451800_0010766_264_899 211
658 3300041463 Ga0451804_1183977 Ga0451804_1183977_644_1279 211
659 3300041494 Ga0451837_0957394 Ga0451837_0957394_904_1539 211
660 3300041512 Ga0451853_2579635 Ga0451853_2579635_228_863 211
661 3300048906 Ga0496103_0042528 Ga0496103_0042528_268_909 211
662 3300048921 Ga0496118_0008446 Ga0496118_0008446_8990_9631 211
663 3300005327 Ga0070658_10067994 Ga0070658_100679943 212
664 3300005355 Ga0070671_100000727 Ga0070671_10000072717 212
665 3300005367 Ga0070667_100071416 Ga0070667_1000714162 212
666 3300005548 Ga0070665_100073673 Ga0070665_1000736732 212
667 3300005548 Ga0070665_100163954 Ga0070665_1001639542 212
668 3300005617 Ga0068859_100015604 Ga0068859_1000156042 212
669 3300005841 Ga0068863_100004356 Ga0068863_10000435613 212
670 3300005841 Ga0068863_100563052 Ga0068863_1005630523 212
671 3300005842 Ga0068858_100000991 Ga0068858_10000099121 212
672 3300005843 Ga0068860_100021252 Ga0068860_1000212523 212
673 3300005937 Ga0081455_10005653 Ga0081455_100056532 212
674 3300006931 Ga0097620_100015605 Ga0097620_1000156052 212
675 3300009101 Ga0105247_10000743 Ga0105247_1000074317 212
676 3300009177 Ga0105248_10021102 Ga0105248_100211022 212
677 3300013306 Ga0163162_10030020 Ga0163162_100300204 212
678 3300025900 Ga0207710_10000510 Ga0207710_1000051016 212
679 3300025931 Ga0207644_10000910 Ga0207644_1000091017 212
680 3300025941 Ga0207711_10059660 Ga0207711_100596602 212
681 3300025986 Ga0207658_10018494 Ga0207658_100184944 212
682 3300026035 Ga0207703_10001490 Ga0207703_100014908 212
683 3300026088 Ga0207641_10003378 Ga0207641_100033782 212
684 3300028379 Ga0268266_10118317 Ga0268266_101183172 212
685 3300028381 Ga0268264_10058922 Ga0268264_100589222 212
686 3300046517 Ga0495630_0566472 Ga0495630_0566472_120_764 212
687 3300046660 Ga0495625_0041369 Ga0495625_0041369_1608_2252 212
688 3300048905 Ga0496102_0184614 Ga0496102_0184614_596_1240 212
689 3300048910 Ga0496107_0221381 Ga0496107_0221381_717_1361 212
690 3300048911 Ga0496108_0597922 Ga0496108_0597922_222_866 212
691 3300048924 Ga0496121_0003660 Ga0496121_0003660_7321_7965 212
692 3300048928 Ga0496125_0013999 Ga0496125_0013999_4838_5482 212
693 3300049742 Ga0501080_0555625 Ga0501080_0555625_248_892 212
694 3300053727 Ga0500611_005124 Ga0500611_005124_486_1130 212
695 2162886006 SwRhRL3b_contig_2609391 SwRhRL3b_0276.00000600 213
696 2162886006 SwRhRL3b_contig_4185416 SwRhRL3b_0381.00000580 213
697 3300005295 Ga0065707_10085706 Ga0065707_100857063 213
698 3300005330 Ga0070690_100272380 Ga0070690_1002723802 213
699 3300005334 Ga0068869_100263353 Ga0068869_1002633532 213
700 3300005334 Ga0068869_100495993 Ga0068869_1004959931 213
701 3300005337 Ga0070682_100230852 Ga0070682_1002308522 213
702 3300005337 Ga0070682_100702491 Ga0070682_1007024911 213
703 3300005340 Ga0070689_100500300 Ga0070689_1005003001 213
704 3300005347 Ga0070668_100203751 Ga0070668_1002037512 213
705 3300005354 Ga0070675_100058746 Ga0070675_1000587462 213
706 3300005354 Ga0070675_100291673 Ga0070675_1002916731 213
707 3300005355 Ga0070671_100184556 Ga0070671_1001845562 213
708 3300005364 Ga0070673_100257380 Ga0070673_1002573802 213
709 3300005365 Ga0070688_100232118 Ga0070688_1002321182 213
710 3300005367 Ga0070667_100437590 Ga0070667_1004375901 213
711 3300005434 Ga0070709_10268313 Ga0070709_102683131 213
712 3300005439 Ga0070711_100258179 Ga0070711_1002581792 213
713 3300005439 Ga0070711_100622853 Ga0070711_1006228531 213
714 3300005456 Ga0070678_100064409 Ga0070678_1000644092 213
715 3300005456 Ga0070678_100132854 Ga0070678_1001328542 213
716 3300005466 Ga0070685_10183743 Ga0070685_101837432 213
717 3300005539 Ga0068853_100360339 Ga0068853_1003603392 213
718 3300005543 Ga0070672_100016046 Ga0070672_1000160462 213
719 3300005548 Ga0070665_100229410 Ga0070665_1002294102 213
720 3300005578 Ga0068854_100229976 Ga0068854_1002299762 213
721 3300005617 Ga0068859_100305773 Ga0068859_1003057732 213
722 3300005618 Ga0068864_100185145 Ga0068864_1001851452 213
723 3300005718 Ga0068866_10352125 Ga0068866_103521252 213
724 3300005841 Ga0068863_100110088 Ga0068863_1001100882 213
725 3300005841 Ga0068863_100197202 Ga0068863_1001972022 213
726 3300005843 Ga0068860_100201894 Ga0068860_1002018942 213
727 3300006237 Ga0097621_100056808 Ga0097621_1000568083 213
728 3300006237 Ga0097621_100071442 Ga0097621_1000714423 213
729 3300006358 Ga0068871_100119081 Ga0068871_1001190812 213
730 3300006358 Ga0068871_100132092 Ga0068871_1001320922 213
731 3300006358 Ga0068871_100468342 Ga0068871_1004683422 213
732 3300006881 Ga0068865_100004141 Ga0068865_1000041412 213
733 3300006881 Ga0068865_100133055 Ga0068865_1001330553 213
734 3300006881 Ga0068865_100932667 Ga0068865_1009326671 213
735 3300006931 Ga0097620_100305777 Ga0097620_1003057772 213
736 3300009093 Ga0105240_10103314 Ga0105240_101033143 213
737 3300009174 Ga0105241_10048725 Ga0105241_100487252 213
738 3300009176 Ga0105242_10000796 Ga0105242_100007963 213
739 3300009176 Ga0105242_10309207 Ga0105242_103092071 213
740 3300009177 Ga0105248_10224910 Ga0105248_102249101 213
741 3300009551 Ga0105238_10074486 Ga0105238_100744862 213
742 3300009551 Ga0105238_10484683 Ga0105238_104846831 213
743 3300009553 Ga0105249_10104444 Ga0105249_101044443 213
744 3300009553 Ga0105249_10429312 Ga0105249_104293122 213
745 3300013105 Ga0157369_10000001 Ga0157369_10000001202 213
746 3300013296 Ga0157374_10110385 Ga0157374_101103852 213
747 3300013296 Ga0157374_10186692 Ga0157374_101866922 213
748 3300013306 Ga0163162_10019083 Ga0163162_100190836 213
749 3300013306 Ga0163162_10089462 Ga0163162_100894622 213
750 3300013306 Ga0163162_10205445 Ga0163162_102054452 213
751 3300013306 Ga0163162_10770703 Ga0163162_107707032 213
752 3300013306 Ga0163162_11396262 Ga0163162_113962622 213
753 3300013307 Ga0157372_10294252 Ga0157372_102942522 213
754 3300013308 Ga0157375_10000342 Ga0157375_1000034213 213
755 3300013308 Ga0157375_10018865 Ga0157375_100188653 213
756 3300013308 Ga0157375_10413367 Ga0157375_104133672 213
757 3300014968 Ga0157379_10071283 Ga0157379_100712833 213
758 3300014969 Ga0157376_10002154 Ga0157376_100021547 213
759 3300014969 Ga0157376_10074912 Ga0157376_100749122 213
760 3300014969 Ga0157376_10498435 Ga0157376_104984351 213
761 3300025906 Ga0207699_10085166 Ga0207699_100851662 213
762 3300025913 Ga0207695_10007103 Ga0207695_100071034 213
763 3300025914 Ga0207671_10002096 Ga0207671_1000209610 213
764 3300025924 Ga0207694_10003581 Ga0207694_100035816 213
765 3300025925 Ga0207650_10156575 Ga0207650_101565752 213
766 3300025931 Ga0207644_10552545 Ga0207644_105525452 213
767 3300025933 Ga0207706_10068854 Ga0207706_100688542 213
768 3300025934 Ga0207686_10074082 Ga0207686_100740822 213
769 3300025936 Ga0207670_10434456 Ga0207670_104344562 213
770 3300025938 Ga0207704_10080080 Ga0207704_100800803 213
771 3300025938 Ga0207704_10260073 Ga0207704_102600732 213
772 3300025938 Ga0207704_10281455 Ga0207704_102814552 213
773 3300025940 Ga0207691_10157723 Ga0207691_101577232 213
774 3300025942 Ga0207689_10132202 Ga0207689_101322022 213
775 3300025949 Ga0207667_10249497 Ga0207667_102494972 213
776 3300025960 Ga0207651_10169581 Ga0207651_101695812 213
777 3300025961 Ga0207712_10061496 Ga0207712_100614963 213
778 3300025961 Ga0207712_10095613 Ga0207712_100956132 213
779 3300025972 Ga0207668_10207424 Ga0207668_102074242 213
780 3300025981 Ga0207640_10189819 Ga0207640_101898192 213
781 3300025986 Ga0207658_10241078 Ga0207658_102410782 213
782 3300026041 Ga0207639_10040192 Ga0207639_100401922 213
783 3300026041 Ga0207639_10228512 Ga0207639_102285121 213
784 3300026088 Ga0207641_10065529 Ga0207641_100655293 213
785 3300026088 Ga0207641_10155506 Ga0207641_101555062 213
786 3300026089 Ga0207648_10057943 Ga0207648_100579433 213
787 3300026118 Ga0207675_100737526 Ga0207675_1007375262 213
788 3300026121 Ga0207683_10016610 Ga0207683_100166105 213
789 3300026121 Ga0207683_10242531 Ga0207683_102425312 213
790 3300031507 Ga0307509_10000004 Ga0307509_10000004307 213
791 3300035410 Ga0373924_0044956 Ga0373924_0044956_1065_1706 213
792 3300035724 Ga0373933_0259616 Ga0373933_0259616_41_682 213
793 3300036401 Ga0373937_0143168 Ga0373937_0143168_1202_1843 213
794 3300046477 Ga0495664_0330946 Ga0495664_0330946_126_767 213
795 3300046531 Ga0495665_0184210 Ga0495665_0184210_67_708 213
796 3300046681 Ga0495647_0026008 Ga0495647_0026008_992_1633 213
797 3300046683 Ga0495658_0005817 Ga0495658_0005817_154_795 213
798 3300047471 Ga0495684_0193000 Ga0495684_0193000_161_802 213
799 3300048907 Ga0496104_0000017 Ga0496104_0000017_114172_114813 213
800 3300048908 Ga0496105_0000009 Ga0496105_0000009_240808_241449 213

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13618

Gluconate_2-dh3

Gluconate 2-dehydrogenase subunit 3

97

229

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tbp-assembly3.cif.gz_C x-ray structure of the hiv-1 myristoylated matrix protein 0.4224 117 191
3rag-assembly1.cif.gz_A crystal structure of uncharacterized protein aaci_0196 from alicyclobacillus acidocaldarius subsp. acidocaldarius dsm 446 0.4016 111 182
2pon-assembly1.cif.gz_B solution structure of the bcl-xl/beclin-1 complex 0.3558 63 190
7tbp-assembly3.cif.gz_C x-ray structure of the hiv-1 myristoylated matrix protein 0.3402 117 191
7xgg-assembly2.cif.gz_E crystal structure of bcl-xl in complex with computationally designed inhibitor protein 0.3242 65 191
ID Description Score Start End Superfamily
af_A0A2R8QHQ6_21_158_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.383 91 174 3.30.40.10
af_Q99M76_188_301_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.3748 102 189 1.25.10.10
af_O70576_188_301_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.3714 102 189 1.25.10.10
af_A4I620_205_313_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.3492 51 176 1.10.238.10
3adcB02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain; 0.3475 114 176 1.10.12.40
ID Description Score Start End GO Terms
AF-A0A7V8XA03-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.8906 64 170
AF-A0A6L7JXK3-F1-model_v4 deleted 0.8739 62 213
AF-A0A2V8BM29-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.8728 64 196
AF-A0A1L7I1D9-F1-model_v4 Uncharacterized protein 0.865 64 213
AF-A0A6L7JXK3-F1-model_v4 deleted 0.8628 62 213

Feature Viewer

pLDDT pTM Quality
83.21 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map