F481391

General Info

Members Datasets Scaffolds Average Seq Length
800 421 725 186

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0000017|Ga0495686_0000017_156386_157009
Length 200
Sequence MAPCVSPRNNLLKKNSIEAMKASDVKKGNVVENDGTVYQVRDIERSSPSARGGNITYRFTLYSVPGNRKFDLSIRADDELKEVDLLRRAAKFSYMDGEAFVFMDDEDYTQYTLDAAVVGDNAGYVVIQVIDDAPVGLQVPSSVVLVVVDTAPEMKGSSATKRNKPARLSTGIEIQVPEYITNGEKVTVNTLTGEFSGRAS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
4 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
5 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
6 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
7 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
8 2643221559 Lysobacter sp. Root559 Isolate Unclassified
9 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
10 2643221573 Lysobacter sp. Root604 Isolate Unclassified
11 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
12 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
13 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
14 2643221586 Lysobacter sp. Root667 Isolate Unclassified
15 2643221593 Lysobacter sp. Root690 Isolate Unclassified
16 2643221612 Lysobacter sp. Root76 Isolate Unclassified
17 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
18 2643221695 Lysobacter sp. Root494 Isolate Unclassified
19 2643221720 Lysobacter sp. Root916 Isolate Unclassified
20 2643221727 Lysobacter sp. Root96 Isolate Unclassified
21 2643221728 Lysobacter sp. Root983 Isolate Unclassified
22 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
23 2734482264 Dyella sp. AD052 Isolate Unclassified
24 2738543009 Luteibacter sp. OK325 Isolate Unclassified
25 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
26 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
27 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
28 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
29 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
30 2818991457 Xanthomonas translucens 569 Isolate Unclassified
31 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
32 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
33 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
34 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
35 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
36 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
37 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
38 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
39 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
40 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
41 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
42 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
43 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
44 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
45 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
46 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
47 2919085039 Luteibacter sp. 1214 Isolate Unclassified
48 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
49 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
50 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
51 2919513703 Luteimonas sp. 3794 Isolate Unclassified
52 2919675420 Luteimonas terrae 4099 Isolate Unclassified
53 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
54 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
55 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
56 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
57 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
58 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
59 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
60 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
61 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
62 2941471342 Luteibacter sp. 621 Isolate Unclassified
63 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
64 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
65 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
66 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
67 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
68 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
69 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
70 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
71 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
72 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
73 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
74 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
75 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
76 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
77 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
78 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
79 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
80 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
81 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
82 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
83 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
84 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
85 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
86 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
87 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
88 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
89 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
90 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
91 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
92 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
93 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
94 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
95 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
96 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
97 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
98 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
99 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
100 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
101 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
102 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
103 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
104 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
105 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
106 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
107 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
108 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
109 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
110 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
111 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
112 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
113 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
114 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
115 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
116 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
117 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
118 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
119 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
120 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
121 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
122 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
123 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
124 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
125 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
126 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
127 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
128 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
129 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
130 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
131 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
132 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
133 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
134 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
135 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
136 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
137 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
138 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
139 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
140 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
141 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
142 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
143 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
144 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
145 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
146 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
147 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
148 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
149 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
150 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
151 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
152 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
153 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
154 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
155 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
156 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
157 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
158 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
159 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
160 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
161 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
162 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
163 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
164 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
165 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
166 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
167 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
168 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
169 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
170 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
171 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
172 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
173 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
174 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
176 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
177 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
179 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
181 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
184 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
187 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
189 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
192 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
246 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
250 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
251 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
252 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
253 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
254 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
255 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
256 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
257 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
258 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
259 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
260 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
261 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
262 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
263 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
264 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
265 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
266 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
267 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
268 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
269 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
270 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
271 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
272 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
273 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
274 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
275 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
276 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
277 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
278 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
279 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
280 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
281 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
282 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
283 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
284 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
285 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
286 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
287 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
288 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
289 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
290 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
291 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
292 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
293 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
294 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
295 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
296 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
297 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
298 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
299 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
300 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
301 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
302 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
303 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
304 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
305 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
306 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
307 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
308 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
309 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
310 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
311 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
312 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
313 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
314 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
315 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
316 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
317 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
318 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
319 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
320 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
321 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
322 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
323 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
324 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
325 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
326 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
327 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
328 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
329 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
330 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
331 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
332 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
333 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
334 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
335 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
336 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
337 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
338 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
339 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
340 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
341 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
342 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
343 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
344 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
345 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
346 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
347 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
348 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
349 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
350 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
351 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
352 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
353 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
354 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
355 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
356 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
357 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
358 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
359 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
360 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
361 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
362 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
363 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
364 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
365 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
366 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
367 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
368 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
369 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
370 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
371 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
372 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
373 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
374 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
375 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
376 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
377 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
378 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
379 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
380 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
394 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
395 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
396 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
397 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
398 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
399 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
400 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
401 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
402 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
403 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
404 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
405 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
407 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
408 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
409 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
410 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
411 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
412 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
413 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
414 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
415 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
416 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
417 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
418 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
419 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
420 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
421 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.5
Metatranscriptomes 0
Isolates 9.5

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 14.75
Nodule 0.12
Rhizoplane 4
Rhizosphere 65.12
Stem 0
Stem Tuber 0
Unclassified 15.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1819724 2162886007 Bacteria 3369
2 JGI24736J21556_1013905 3300001904 Bacteria 1297
3 JGI25152J39213_1000118 3300002773 Bacteria 55168
4 JGI25152J39213_1020380 3300002773 Bacteria 1185
5 JGI25150J39212_1000434 3300002774 Bacteria 18752
6 JGI25151J46595_10000315 3300003187 Bacteria 52657
7 JGI25151J46595_10103966 3300003187 Bacteria 758
8 JGI25153J46596_10000167 3300003215 Bacteria 66040
9 rootH1_10033715 3300003316 Bacteria 5415
10 rootH1_10033715 3300003323 Bacteria 2049
11 Ga0055526_1000182 3300003771 Bacteria 55008
12 Ga0055526_1002395 3300003771 Bacteria 12700
13 Ga0055537_1000091 3300003773 Bacteria 66379
14 Ga0055537_1000136 3300003773 Bacteria 55008
15 Ga0055524_1000254 3300003775 Bacteria 55008
16 Ga0055524_1030331 3300003775 Bacteria 1579
17 Ga0055536_1000812 3300003781 Bacteria 20671
18 Ga0055536_1000925 3300003781 Bacteria 18922
19 Ga0055536_1006090 3300003781 Bacteria 5716
20 Ga0055536_1013569 3300003781 Bacteria 2925
21 Ga0055536_1030512 3300003781 Bacteria 1429
22 Ga0055534_1000043 3300003784 Bacteria 99338
23 Ga0055534_1000137 3300003784 Bacteria 55008
24 Ga0055528_1000087 3300003790 Bacteria 72896
25 Ga0055528_1000169 3300003790 Bacteria 55008
26 Ga0055530_10017857 3300003791 Bacteria 2207
27 Ga0055540_1044902 3300003792 Bacteria 935
28 Ga0055531_10001450 3300003794 Bacteria 17510
29 Ga0055531_10004122 3300003794 Bacteria 8979
30 Ga0055531_10004970 3300003794 Bacteria 7893
31 Ga0055531_10007659 3300003794 Bacteria 5845
32 Ga0055531_10007895 3300003794 Bacteria 5714
33 Ga0055531_10012585 3300003794 Bacteria 3968
34 Ga0055531_10030430 3300003794 Bacteria 1813
35 Ga0058692_1000031 3300003856 Bacteria 188488
36 Ga0058692_1000060 3300003856 Bacteria 98866
37 Ga0065165_1000118 3300005262 Bacteria 134488
38 Ga0065165_1022436 3300005262 Bacteria 2164
39 Ga0065165_1051736 3300005262 Bacteria 1163
40 Ga0065704_10070531 3300005289 Bacteria 21590
41 Ga0065704_10079591 3300005289 Bacteria 4122
42 Ga0065715_10050260 3300005293 Bacteria 956
43 Ga0070658_10142010 3300005327 Bacteria 2006
44 Ga0070658_10302455 3300005327 Bacteria 1364
45 Ga0070683_101226924 3300005329 Bacteria 721
46 Ga0070670_100012694 3300005331 Bacteria 7212
47 Ga0070670_100121722 3300005331 Bacteria 2251
48 Ga0068869_100091510 3300005334 Bacteria 2288
49 Ga0068869_100722964 3300005334 Bacteria 851
50 Ga0070666_10000844 3300005335 Bacteria 18583
51 Ga0070680_100070391 3300005336 Bacteria 2873
52 Ga0070680_100210961 3300005336 Bacteria 1638
53 Ga0068868_100020407 3300005338 Bacteria 4977
54 Ga0070660_100052790 3300005339 Bacteria 3134
55 Ga0070660_100709462 3300005339 Bacteria 844
56 Ga0070661_100124614 3300005344 Bacteria 1932
57 Ga0070661_100539807 3300005344 Bacteria 937
58 Ga0070661_100562343 3300005344 Bacteria 919
59 Ga0070692_10304728 3300005345 Bacteria 974
60 Ga0070668_100021352 3300005347 Bacteria 4890
61 Ga0070668_100167532 3300005347 Bacteria 1787
62 Ga0070668_100186338 3300005347 Bacteria 1698
63 Ga0070668_100579678 3300005347 Bacteria 979
64 Ga0070668_100625637 3300005347 Bacteria 944
65 Ga0070671_100081121 3300005355 Bacteria 2712
66 Ga0070671_100239338 3300005355 Bacteria 1541
67 Ga0070674_100135692 3300005356 Bacteria 1840
68 Ga0070673_100661858 3300005364 Bacteria 957
69 Ga0070688_100747359 3300005365 Bacteria 761
70 Ga0070659_100276854 3300005366 Bacteria 1395
71 Ga0070667_100030697 3300005367 Bacteria 4482
72 Ga0070667_100048471 3300005367 Bacteria 3575
73 Ga0070667_100629183 3300005367 Bacteria 990
74 Ga0070709_10478688 3300005434 Bacteria 942
75 Ga0070711_100818808 3300005439 Bacteria 791
76 Ga0070678_101138446 3300005456 Bacteria 722
77 Ga0070662_100092034 3300005457 Bacteria 2278
78 Ga0070662_100369198 3300005457 Bacteria 1179
79 Ga0070681_10004840 3300005458 Bacteria 12907
80 Ga0070681_10014094 3300005458 Bacteria 7956
81 Ga0070681_10128362 3300005458 Bacteria 2468
82 Ga0068867_100256876 3300005459 Bacteria 1423
83 Ga0070685_10000546 3300005466 Bacteria 21084
84 Ga0070679_100014695 3300005530 Bacteria 7525
85 Ga0070679_100047097 3300005530 Bacteria 4299
86 Ga0070679_100738042 3300005530 Bacteria 927
87 Ga0068853_100024041 3300005539 Bacteria 5107
88 Ga0068853_100036227 3300005539 Bacteria 4194
89 Ga0070672_100002961 3300005543 Bacteria 10930
90 Ga0070672_100008454 3300005543 Bacteria 7041
91 Ga0070696_100026884 3300005546 Bacteria 3917
92 Ga0070696_100084215 3300005546 Bacteria 2256
93 Ga0070693_100019133 3300005547 Bacteria 3586
94 Ga0070693_100236580 3300005547 Bacteria 1204
95 Ga0070665_100007381 3300005548 Bacteria 11184
96 Ga0070665_100094122 3300005548 Bacteria 3001
97 Ga0070665_100117136 3300005548 Bacteria 2666
98 Ga0070665_101345819 3300005548 Bacteria 724
99 Ga0068855_100047003 3300005563 Bacteria 5101
100 Ga0068855_100353373 3300005563 Bacteria 1619
101 Ga0070664_100152562 3300005564 Bacteria 2040
102 Ga0070664_101460634 3300005564 Bacteria 647
103 Ga0068857_100243855 3300005577 Bacteria 1646
104 Ga0068854_100012080 3300005578 Bacteria 5647
105 Ga0068856_100682819 3300005614 Bacteria 1047
106 Ga0068852_100154810 3300005616 Bacteria 2134
107 Ga0068851_10001586 3300005834 Bacteria 9980
108 Ga0068863_100252755 3300005841 Bacteria 1703
109 Ga0068863_100316395 3300005841 Bacteria 1516
110 Ga0068858_100032794 3300005842 Bacteria 4824
111 Ga0068862_100546453 3300005844 Bacteria 1106
112 Ga0068862_100879641 3300005844 Bacteria 880
113 Ga0081539_10157391 3300005985 Bacteria 1086
114 Ga0075364_10000075 3300006051 Bacteria 38780
115 Ga0075364_10075928 3300006051 Bacteria 2217
116 Ga0075364_10090167 3300006051 Bacteria 2033
117 Ga0075364_10154064 3300006051 Bacteria 1549
118 Ga0075364_10201042 3300006051 Bacteria 1350
119 Ga0075369_10056644 3300006186 Bacteria 1704
120 Ga0075369_10111897 3300006186 Bacteria 1231
121 Ga0068865_100399013 3300006881 Bacteria 1126
122 Ga0105251_10000364 3300009011 Bacteria 44484
123 Ga0105244_10170837 3300009036 Bacteria 1034
124 Ga0105244_10209024 3300009036 Bacteria 918
125 Ga0105244_10289050 3300009036 Bacteria 760
126 Ga0105240_10034195 3300009093 Bacteria 6559
127 Ga0105245_10197244 3300009098 Bacteria 1932
128 Ga0105247_10003765 3300009101 Bacteria 9838
129 Ga0105243_10012792 3300009148 Bacteria 6338
130 Ga0105243_10020218 3300009148 Bacteria 5048
131 Ga0105241_10095021 3300009174 Bacteria 2359
132 Ga0105241_10146228 3300009174 Bacteria 1929
133 Ga0105242_10139482 3300009176 Bacteria 2102
134 Ga0105248_10460750 3300009177 Bacteria 1433
135 Ga0105248_11418510 3300009177 Bacteria 786
136 Ga0105237_10446690 3300009545 Bacteria 1299
137 Ga0105238_10606121 3300009551 Bacteria 1103
138 Ga0105238_10923428 3300009551 Bacteria 892
139 Ga0105249_10105989 3300009553 Bacteria 2651
140 Ga0105249_10415622 3300009553 Bacteria 1378
141 Ga0105032_108202 3300009979 Bacteria 862
142 Ga0105239_10004720 3300010375 Bacteria 16183
143 Ga0105239_10034421 3300010375 Bacteria 5562
144 Ga0105239_10312027 3300010375 Bacteria 1773
145 Ga0157337_1003328 3300012483 Bacteria 967
146 Ga0157323_1009100 3300012495 Bacteria 754
147 Ga0157347_1022160 3300012502 Bacteria 750
148 Ga0157324_1009876 3300012506 Bacteria 797
149 Ga0157326_1024241 3300012513 Bacteria 768
150 Ga0157373_10160012 3300013100 Bacteria 1584
151 Ga0157373_10476773 3300013100 Bacteria 900
152 Ga0157371_10002405 3300013102 Bacteria 17908
153 Ga0157371_10006531 3300013102 Bacteria 9596
154 Ga0157371_10122281 3300013102 Bacteria 1851
155 Ga0157371_10596638 3300013102 Bacteria 821
156 Ga0157370_10000293 3300013104 Bacteria 63396
157 Ga0157370_10025372 3300013104 Bacteria 5867
158 Ga0157370_10117492 3300013104 Bacteria 2484
159 Ga0157370_10383224 3300013104 Bacteria 1295
160 Ga0157369_10000025 3300013105 Bacteria 225515
161 Ga0157369_10001434 3300013105 Bacteria 29251
162 Ga0157369_10041790 3300013105 Bacteria 5003
163 Ga0157369_10093022 3300013105 Bacteria 3218
164 Ga0157374_10003664 3300013296 Bacteria 12915
165 Ga0157374_10067651 3300013296 Bacteria 3359
166 Ga0157374_10386574 3300013296 Bacteria 1394
167 Ga0157378_10059570 3300013297 Bacteria 3407
168 Ga0163162_10281171 3300013306 Bacteria 1796
169 Ga0163162_11111517 3300013306 Bacteria 896
170 Ga0163162_11380824 3300013306 Bacteria 801
171 Ga0157372_10188057 3300013307 Bacteria 2391
172 Ga0157375_10124460 3300013308 Bacteria 2692
173 Ga0157375_10800574 3300013308 Bacteria 1091
174 Ga0157375_11095926 3300013308 Bacteria 932
175 Ga0163163_11220843 3300014325 Bacteria 814
176 Ga0157380_10374967 3300014326 Bacteria 1341
177 Ga0157380_10661593 3300014326 Bacteria 1044
178 Ga0157380_11366390 3300014326 Bacteria 758
179 Ga0182008_10001118 3300014497 Bacteria 18460
180 Ga0182008_10003258 3300014497 Bacteria 9900
181 Ga0157379_10177029 3300014968 Bacteria 1926
182 Ga0157376_10555963 3300014969 Bacteria 1136
183 Ga0157376_11785452 3300014969 Bacteria 651
184 Ga0182006_1000085 3300015261 Bacteria 117595
185 Ga0182006_1001555 3300015261 Bacteria 13706
186 Ga0182007_10000556 3300015262 Bacteria 22049
187 Ga0182007_10014554 3300015262 Bacteria 2962
188 Ga0182005_1000028 3300015265 Bacteria 221889
189 Ga0182005_1000463 3300015265 Bacteria 21182
190 Ga0182005_1001893 3300015265 Bacteria 7928
191 Ga0182005_1004454 3300015265 Bacteria 4528
192 Ga0183360_10001 3300015689 Bacteria 3943671
193 Ga0163161_10001824 3300017792 Bacteria 15555
194 Ga0163161_10149136 3300017792 Bacteria 1776
195 Ga0163161_10241850 3300017792 Bacteria 1404
196 Ga0209674_100933 3300025226 Bacteria 9345
197 Ga0207427_103125 3300025231 Bacteria 3724
198 Ga0209437_100224 3300025233 Bacteria 101515
199 Ga0209437_100955 3300025233 Bacteria 10606
200 Ga0209258_106928 3300025242 Bacteria 1722
201 Ga0207425_1000097 3300025245 Bacteria 84719
202 Ga0207425_1036230 3300025245 Bacteria 958
203 Ga0209148_1000005 3300025254 Bacteria 1806504
204 Ga0209129_1000189 3300025258 Bacteria 84712
205 Ga0209129_1002415 3300025258 Bacteria 9181
206 Ga0209565_1000005 3300025263 Bacteria 947317
207 Ga0209565_1000063 3300025263 Bacteria 183711
208 Ga0209673_1000027 3300025273 Bacteria 360561
209 Ga0209673_1000065 3300025273 Bacteria 252799
210 Ga0209673_1003263 3300025273 Bacteria 9783
211 Ga0209130_1009009 3300025284 Bacteria 2883
212 Ga0209130_1011298 3300025284 Bacteria 2398
213 Ga0209130_1024979 3300025284 Bacteria 1299
214 Ga0209675_1000004 3300025291 Bacteria 947166
215 Ga0209675_1000011 3300025291 Bacteria 520597
216 Ga0209676_1000011 3300025292 Bacteria 860463
217 Ga0209676_1000034 3300025292 Bacteria 460125
218 Ga0209676_1000068 3300025292 Bacteria 314068
219 Ga0209676_1000728 3300025292 Bacteria 45109
220 Ga0209676_1000981 3300025292 Bacteria 34140
221 Ga0209676_1003532 3300025292 Bacteria 9525
222 Ga0209676_1006825 3300025292 Bacteria 5536
223 Ga0209676_1008020 3300025292 Bacteria 4804
224 Ga0209676_1009417 3300025292 Bacteria 4215
225 Ga0209025_1000005 3300025294 Bacteria 1272149
226 Ga0209025_1000054 3300025294 Bacteria 317002
227 Ga0209025_1004511 3300025294 Bacteria 12025
228 Ga0209025_1010913 3300025294 Bacteria 6080
229 Ga0209564_1000050 3300025295 Bacteria 360560
230 Ga0209564_1000433 3300025295 Bacteria 72594
231 Ga0209564_1008048 3300025295 Bacteria 5283
232 Ga0209564_1026629 3300025295 Bacteria 1904
233 Ga0209758_1000062 3300025297 Bacteria 317002
234 Ga0209758_1004731 3300025297 Bacteria 11083
235 Ga0209758_1008133 3300025297 Bacteria 6894
236 Ga0209758_1023839 3300025297 Bacteria 2750
237 Ga0209050_1000239 3300025298 Bacteria 119530
238 Ga0209050_1000599 3300025298 Bacteria 57405
239 Ga0209050_1006127 3300025298 Bacteria 7253
240 Ga0209256_1000031 3300025299 Bacteria 410189
241 Ga0209256_1003080 3300025299 Bacteria 12238
242 Ga0209256_1003541 3300025299 Bacteria 10843
243 Ga0209256_1005136 3300025299 Bacteria 7741
244 Ga0209256_1006995 3300025299 Bacteria 5737
245 Ga0209256_1018166 3300025299 Bacteria 2300
246 Ga0207426_1025885 3300025302 Bacteria 1972
247 Ga0209051_1002354 3300025303 Bacteria 13679
248 Ga0209051_1027400 3300025303 Bacteria 2272
249 Ga0209257_1000014 3300025304 Bacteria 946850
250 Ga0209257_1000263 3300025304 Bacteria 120530
251 Ga0209257_1000283 3300025304 Bacteria 113507
252 Ga0209257_1000645 3300025304 Bacteria 55704
253 Ga0209257_1001034 3300025304 Bacteria 37233
254 Ga0209257_1001651 3300025304 Bacteria 25402
255 Ga0209257_1002860 3300025304 Bacteria 16121
256 Ga0209257_1003306 3300025304 Bacteria 14041
257 Ga0209257_1004492 3300025304 Bacteria 10753
258 Ga0209257_1008923 3300025304 Bacteria 5518
259 Ga0209257_1021546 3300025304 Bacteria 2336
260 Ga0209257_1024761 3300025304 Bacteria 2068
261 Ga0207655_1145642 3300025728 Bacteria 755
262 Ga0207713_1000422 3300025735 Bacteria 44963
263 Ga0207682_10152782 3300025893 Bacteria 1042
264 Ga0207710_10013753 3300025900 Bacteria 3406
265 Ga0207680_10005768 3300025903 Bacteria 5941
266 Ga0207647_10000271 3300025904 Bacteria 42575
267 Ga0207647_10000747 3300025904 Bacteria 25485
268 Ga0207647_10004013 3300025904 Bacteria 10985
269 Ga0207699_10461780 3300025906 Bacteria 912
270 Ga0207705_10019748 3300025909 Bacteria 4818
271 Ga0207705_10447987 3300025909 Bacteria 1001
272 Ga0207654_10319341 3300025911 Bacteria 1061
273 Ga0207707_10000374 3300025912 Bacteria 46934
274 Ga0207707_10305064 3300025912 Bacteria 1376
275 Ga0207695_10007273 3300025913 Bacteria 14139
276 Ga0207695_10047399 3300025913 Bacteria 4549
277 Ga0207695_10153096 3300025913 Bacteria 2243
278 Ga0207695_10687301 3300025913 Bacteria 904
279 Ga0207671_10001096 3300025914 Bacteria 32746
280 Ga0207671_10034751 3300025914 Bacteria 3745
281 Ga0207671_10406782 3300025914 Bacteria 1082
282 Ga0207660_10048413 3300025917 Bacteria 3008
283 Ga0207657_10011781 3300025919 Bacteria 8662
284 Ga0207657_10077231 3300025919 Bacteria 2807
285 Ga0207657_10293940 3300025919 Bacteria 1288
286 Ga0207649_10225574 3300025920 Bacteria 1337
287 Ga0207649_10631818 3300025920 Bacteria 826
288 Ga0207652_10005403 3300025921 Bacteria 10367
289 Ga0207652_10316830 3300025921 Bacteria 1408
290 Ga0207652_10521960 3300025921 Bacteria 1068
291 Ga0207681_10033056 3300025923 Bacteria 3390
292 Ga0207681_10166007 3300025923 Bacteria 1669
293 Ga0207681_10371081 3300025923 Bacteria 1150
294 Ga0207694_10008972 3300025924 Bacteria 7548
295 Ga0207694_10011861 3300025924 Bacteria 6572
296 Ga0207694_10094964 3300025924 Bacteria 2356
297 Ga0207650_10027823 3300025925 Bacteria 4050
298 Ga0207650_10034031 3300025925 Bacteria 3694
299 Ga0207650_10190209 3300025925 Bacteria 1640
300 Ga0207659_10363646 3300025926 Bacteria 1203
301 Ga0207687_10537290 3300025927 Bacteria 979
302 Ga0207664_10000093 3300025929 Bacteria 81829
303 Ga0207690_10002061 3300025932 Bacteria 12324
304 Ga0207690_10014240 3300025932 Bacteria 4800
305 Ga0207690_10019429 3300025932 Bacteria 4184
306 Ga0207706_10006960 3300025933 Bacteria 10452
307 Ga0207706_10030008 3300025933 Bacteria 4853
308 Ga0207706_10575543 3300025933 Bacteria 968
309 Ga0207709_10000632 3300025935 Bacteria 28799
310 Ga0207709_10341998 3300025935 Bacteria 1126
311 Ga0207669_10084647 3300025937 Bacteria 2044
312 Ga0207691_10009924 3300025940 Bacteria 9141
313 Ga0207691_10127613 3300025940 Bacteria 2249
314 Ga0207711_10104880 3300025941 Bacteria 2506
315 Ga0207689_10105299 3300025942 Bacteria 2317
316 Ga0207689_10422731 3300025942 Bacteria 1112
317 Ga0207679_10103132 3300025945 Bacteria 2235
318 Ga0207679_10753021 3300025945 Bacteria 886
319 Ga0207667_10000119 3300025949 Bacteria 124365
320 Ga0207667_10006961 3300025949 Bacteria 13669
321 Ga0207667_10095325 3300025949 Bacteria 3072
322 Ga0207651_10398009 3300025960 Bacteria 1171
323 Ga0207712_10004994 3300025961 Bacteria 8390
324 Ga0207712_10183070 3300025961 Bacteria 1647
325 Ga0207668_10007253 3300025972 Bacteria 6585
326 Ga0207668_10091507 3300025972 Bacteria 2236
327 Ga0207668_10259530 3300025972 Bacteria 1415
328 Ga0207668_10876254 3300025972 Bacteria 798
329 Ga0207640_10000185 3300025981 Bacteria 44459
330 Ga0207640_10307927 3300025981 Bacteria 1256
331 Ga0207658_10010233 3300025986 Bacteria 6371
332 Ga0207658_10174676 3300025986 Bacteria 1773
333 Ga0207703_10023236 3300026035 Bacteria 4870
334 Ga0207639_10000216 3300026041 Bacteria 43037
335 Ga0207639_10016756 3300026041 Bacteria 5191
336 Ga0207639_11074441 3300026041 Bacteria 754
337 Ga0207678_10143123 3300026067 Bacteria 2041
338 Ga0207708_10763240 3300026075 Bacteria 830
339 Ga0207702_10049155 3300026078 Bacteria 3558
340 Ga0207702_10077061 3300026078 Bacteria 2883
341 Ga0207641_10103684 3300026088 Bacteria 2510
342 Ga0207648_10228570 3300026089 Bacteria 1654
343 Ga0207648_10941347 3300026089 Bacteria 808
344 Ga0207674_10329569 3300026116 Bacteria 1476
345 Ga0207683_10235723 3300026121 Bacteria 1669
346 Ga0207683_11257719 3300026121 Bacteria 686
347 Ga0207698_10100669 3300026142 Bacteria 2394
348 Ga0209371_1000004 3300027312 Bacteria 1098197
349 Ga0209371_1000139 3300027312 Bacteria 120350
350 Ga0209995_1038181 3300027471 Bacteria 809
351 Ga0209982_1014132 3300027552 Bacteria 1205
352 Ga0210002_1012531 3300027617 Bacteria 1319
353 Ga0209971_1001630 3300027682 Bacteria 5551
354 Ga0209813_10151705 3300027866 Bacteria 830
355 Ga0209974_10010966 3300027876 Bacteria 3050
356 Ga0209974_10107567 3300027876 Bacteria 979
357 Ga0268266_10000013 3300028379 Bacteria 649715
358 Ga0268266_10037476 3300028379 Bacteria 4131
359 Ga0268266_10098205 3300028379 Bacteria 2576
360 Ga0268266_11143513 3300028379 Bacteria 753
361 Ga0268265_10078162 3300028380 Bacteria 2602
362 Ga0268265_10850062 3300028380 Bacteria 893
363 Ga0268256_1000005 3300030500 Bacteria 1082342
364 Ga0268256_1000109 3300030500 Bacteria 120350
365 Ga0316177_1014219 3300030731 Bacteria 6930
366 Ga0316177_1060205 3300030731 Bacteria 1270
367 Ga0316176_1137489 3300030732 Bacteria 4544
368 Ga0316176_1150837 3300030732 Bacteria 1001
369 Ga0314311_1207988 3300030733 Bacteria 1892
370 Ga0316178_1111912 3300030735 Bacteria 1073
371 Ga0316183_1000379 3300030742 Bacteria 918
372 Ga0316183_1073792 3300030742 Bacteria 4285
373 Ga0316182_1180068 3300030745 Bacteria 1827
374 Ga0307513_10009900 3300031456 Bacteria 12027
375 Ga0307513_10048166 3300031456 Bacteria 4628
376 Ga0307509_10025648 3300031507 Bacteria 6580
377 Ga0307408_100498030 3300031548 Bacteria 1066
378 Ga0307405_10110996 3300031731 Bacteria 1858
379 Ga0307413_10001980 3300031824 Bacteria 8131
380 Ga0307413_10107096 3300031824 Bacteria 1862
381 Ga0307413_10144252 3300031824 Bacteria 1650
382 Ga0307413_10163763 3300031824 Bacteria 1565
383 Ga0307413_10313494 3300031824 Bacteria 1195
384 Ga0307413_10767900 3300031824 Bacteria 807
385 Ga0307410_10220048 3300031852 Bacteria 1460
386 Ga0307410_10646388 3300031852 Bacteria 887
387 Ga0307406_10002948 3300031901 Bacteria 9270
388 Ga0307406_10684692 3300031901 Bacteria 854
389 Ga0307407_10348328 3300031903 Bacteria 1048
390 Ga0307412_10013730 3300031911 Bacteria 4758
391 Ga0307412_10111646 3300031911 Bacteria 1953
392 Ga0307412_10384520 3300031911 Bacteria 1137
393 Ga0307412_10789010 3300031911 Bacteria 823
394 Ga0307416_100326325 3300032002 Bacteria 1540
395 Ga0307414_10004260 3300032004 Bacteria 7761
396 Ga0307414_10038814 3300032004 Bacteria 3201
397 Ga0307414_10049127 3300032004 Bacteria 2915
398 Ga0307414_10072191 3300032004 Bacteria 2492
399 Ga0307414_10120628 3300032004 Bacteria 2015
400 Ga0307414_10222988 3300032004 Bacteria 1549
401 Ga0307414_10358111 3300032004 Bacteria 1254
402 Ga0307414_10444790 3300032004 Bacteria 1135
403 Ga0307414_10910785 3300032004 Bacteria 806
404 Ga0307414_11164240 3300032004 Bacteria 713
405 Ga0307411_10056428 3300032005 Bacteria 2589
406 Ga0307411_10262120 3300032005 Bacteria 1365
407 Ga0395899_0131662 3300037312 Bacteria 1785
408 Ga0395900_0537431 3300037418 Bacteria 1115
409 Ga0395898_0071216 3300037466 Bacteria 3360
410 Ga0395898_0083391 3300037466 Bacteria 3081
411 Ga0395905_0034860 3300037471 Bacteria 4724
412 Ga0395905_0154998 3300037471 Bacteria 2154
413 Ga0395905_0179496 3300037471 Bacteria 1988
414 Ga0395905_0512794 3300037471 Bacteria 1099
415 Ga0395905_0530077 3300037471 Bacteria 1078
416 Ga0395901_0063541 3300038443 Bacteria 3842
417 Ga0237819_00164 3300038705 Bacteria 24369
418 Ga0237819_05553 3300038705 Bacteria 1967
419 Ga0237816_00136 3300039145 Bacteria 5722
420 Ga0436363_0039191 3300039450 Bacteria 1485
421 Ga0439436_0028420 3300041404 Bacteria 1632
422 Ga0439436_0037627 3300041404 Bacteria 1393
423 Ga0439465_0000040 3300041413 Bacteria 26319
424 Ga0439465_0000426 3300041413 Bacteria 12326
425 Ga0439465_0000996 3300041413 Bacteria 9020
426 Ga0439465_0002646 3300041413 Bacteria 5850
427 Ga0439465_0015599 3300041413 Bacteria 2370
428 Ga0451789_0368362 3300041443 Bacteria 912
429 Ga0451789_0612999 3300041443 Bacteria 793
430 Ga0451797_0221459 3300041453 Bacteria 933
431 Ga0451797_0985516 3300041453 Bacteria 1075
432 Ga0451798_0443259 3300041458 Bacteria 736
433 Ga0451800_1224437 3300041459 Bacteria 3605
434 Ga0451806_620901 3300041462 Bacteria 1847
435 Ga0451804_0653443 3300041463 Bacteria 1087
436 Ga0451807_1378455 3300041486 Bacteria 2158
437 Ga0451807_2757209 3300041486 Bacteria 728
438 Ga0451837_1411285 3300041494 Bacteria 1434
439 Ga0451843_0119213 3300041509 Bacteria 2064
440 Ga0451853_0695473 3300041512 Bacteria 2997
441 Ga0451853_0982692 3300041512 Bacteria 1001
442 Ga0451853_1076376 3300041512 Bacteria 1082
443 Ga0451853_4052864 3300041512 Bacteria 925
444 Ga0439433_0057639 3300041999 Bacteria 923
445 Ga0439445_0008723 3300042004 Bacteria 2377
446 Ga0439445_0037452 3300042004 Bacteria 1280
447 Ga0439445_0057355 3300042004 Bacteria 1060
448 Ga0439445_0130758 3300042004 Bacteria 724
449 Ga0439432_005823 3300042006 Bacteria 4424
450 Ga0439432_027180 3300042006 Bacteria 1870
451 Ga0439449_0000134 3300042007 Bacteria 25113
452 Ga0439449_0004260 3300042007 Bacteria 5532
453 Ga0439449_0008474 3300042007 Bacteria 3907
454 Ga0439449_0012239 3300042007 Bacteria 3224
455 Ga0439449_0047789 3300042007 Bacteria 1584
456 Ga0439449_0047882 3300042007 Bacteria 1583
457 Ga0439455_0072954 3300042012 Bacteria 925
458 Ga0439462_0080623 3300042015 Bacteria 889
459 Ga0450908_000427 3300042184 Bacteria 8125
460 Ga0450901_003256 3300042533 Bacteria 1704
461 Ga0451577_0051922 3300042876 Bacteria 3660
462 Ga0466969_0061651 3300044656 Bacteria 1821
463 Ga0466972_0074236 3300044658 Bacteria 1620
464 Ga0466982_0000003 3300044672 Bacteria 417243
465 Ga0466982_0000061 3300044672 Bacteria 29699
466 Ga0466965_0014613 3300044683 Bacteria 3717
467 Ga0466966_0012748 3300044684 Bacteria 5572
468 Ga0466964_0007101 3300044706 Bacteria 4189
469 Ga0453684_0002948 3300044712 Bacteria 39915
470 Ga0453684_0978132 3300044712 Bacteria 901
471 Ga0466971_0054782 3300044719 Bacteria 1797
472 Ga0466968_0002058 3300044735 Bacteria 7323
473 Ga0466960_0004681 3300044901 Bacteria 5365
474 Ga0466959_0054469 3300045049 Bacteria 2922
475 Ga0451576_0000156 3300045051 Bacteria 174140
476 Ga0466958_0034030 3300045836 Bacteria 3038
477 Ga0466967_1183456 3300045976 Bacteria 762
478 Ga0495617_001863 3300046452 Bacteria 8915
479 Ga0495627_038463 3300046453 Bacteria 1479
480 Ga0495627_046097 3300046453 Bacteria 1326
481 Ga0495590_0015786 3300046457 Bacteria 2735
482 Ga0495638_0000153 3300046460 Bacteria 109155
483 Ga0495638_0007554 3300046460 Bacteria 7776
484 Ga0495638_0019522 3300046460 Bacteria 4485
485 Ga0495638_0142646 3300046460 Bacteria 1396
486 Ga0495650_0002162 3300046471 Bacteria 16654
487 Ga0495650_0220430 3300046471 Bacteria 653
488 Ga0495584_0000598 3300046491 Bacteria 24294
489 Ga0495585_0000104 3300046492 Bacteria 90097
490 Ga0495585_0001499 3300046492 Bacteria 18186
491 Ga0495607_0000088 3300046501 Bacteria 95203
492 Ga0495607_0000120 3300046501 Bacteria 82667
493 Ga0495607_0037418 3300046501 Bacteria 2915
494 Ga0495606_0000338 3300046507 Bacteria 80898
495 Ga0495606_0001054 3300046507 Bacteria 39827
496 Ga0495606_0012571 3300046507 Bacteria 6776
497 Ga0495606_0194423 3300046507 Bacteria 1160
498 Ga0495610_0003255 3300046512 Bacteria 12817
499 Ga0495610_0079918 3300046512 Bacteria 1504
500 Ga0495616_0000086 3300046513 Bacteria 78187
501 Ga0495616_0095615 3300046513 Bacteria 1400
502 Ga0495616_0175926 3300046513 Bacteria 954
503 Ga0495620_0000469 3300046515 Bacteria 26346
504 Ga0495620_0000533 3300046515 Bacteria 24362
505 Ga0495631_0000029 3300046518 Bacteria 86555
506 Ga0495631_0000298 3300046518 Bacteria 34707
507 Ga0495632_0000004 3300046519 Bacteria 381372
508 Ga0495632_0003675 3300046519 Bacteria 10763
509 Ga0495643_0002752 3300046522 Bacteria 13485
510 Ga0495643_0083522 3300046522 Bacteria 1658
511 Ga0495648_0000914 3300046524 Bacteria 30767
512 Ga0495648_0008185 3300046524 Bacteria 8251
513 Ga0495663_0000499 3300046525 Bacteria 14134
514 Ga0495663_0002900 3300046525 Bacteria 5062
515 Ga0495598_0008364 3300046537 Bacteria 2407
516 Ga0495609_0003684 3300046538 Bacteria 8675
517 Ga0495621_0001151 3300046539 Bacteria 6843
518 Ga0495633_0005962 3300046558 Bacteria 7322
519 Ga0495656_0003170 3300046615 Bacteria 5537
520 Ga0495656_0015285 3300046615 Bacteria 2895
521 Ga0495656_0133344 3300046615 Bacteria 1184
522 Ga0495668_0000820 3300046616 Bacteria 35709
523 Ga0495668_0001397 3300046616 Bacteria 23507
524 Ga0495611_0000001 3300046648 Bacteria 2628469
525 Ga0495611_0000313 3300046648 Bacteria 32576
526 Ga0495625_0000022 3300046660 Bacteria 278823
527 Ga0495625_0003692 3300046660 Bacteria 14968
528 Ga0495625_0068644 3300046660 Bacteria 2491
529 Ga0495659_0236357 3300046664 Bacteria 758
530 Ga0495661_0000733 3300046665 Bacteria 32129
531 Ga0495661_0055636 3300046665 Bacteria 2371
532 Ga0495670_0000495 3300046691 Bacteria 18653
533 Ga0495670_0032130 3300046691 Bacteria 2609
534 Ga0495670_0042012 3300046691 Bacteria 2281
535 Ga0495670_0287176 3300046691 Bacteria 880
536 Ga0495671_0000492 3300046692 Bacteria 30463
537 Ga0495671_0022825 3300046692 Bacteria 3274
538 Ga0495589_0000059 3300046794 Bacteria 107171
539 Ga0495660_0000092 3300046810 Bacteria 96197
540 Ga0495660_0000583 3300046810 Bacteria 29142
541 Ga0495636_0000599 3300047318 Bacteria 13258
542 Ga0495636_0031233 3300047318 Bacteria 2182
543 Ga0495636_0054110 3300047318 Bacteria 1686
544 Ga0495672_0000105 3300047320 Bacteria 133882
545 Ga0495683_0002566 3300047323 Bacteria 10907
546 Ga0495679_000004 3300047446 Bacteria 748056
547 Ga0495685_088416 3300047447 Bacteria 1028
548 Ga0495685_116030 3300047447 Bacteria 880
549 Ga0495673_0000004 3300047469 Bacteria 1354526
550 Ga0495673_0000048 3300047469 Bacteria 265950
551 Ga0495673_0000902 3300047469 Bacteria 27227
552 Ga0495686_0000017 3300047472 Bacteria 435554
553 Ga0495686_0001142 3300047472 Bacteria 31243
554 Ga0495686_0023097 3300047472 Bacteria 4108
555 Ga0495686_0024683 3300047472 Bacteria 3946
556 Ga0495686_0030760 3300047472 Bacteria 3485
557 Ga0495686_0055465 3300047472 Bacteria 2478
558 Ga0495615_0134486 3300048090 Bacteria 725
559 Ga0496100_0119977 3300048903 Bacteria 1838
560 Ga0496101_0000755 3300048904 Bacteria 19172
561 Ga0496102_0267651 3300048905 Bacteria 1611
562 Ga0496103_0481785 3300048906 Bacteria 795
563 Ga0496103_0483138 3300048906 Bacteria 793
564 Ga0496105_0028104 3300048908 Bacteria 4600
565 Ga0496106_0000509 3300048909 Bacteria 27515
566 Ga0496106_0018214 3300048909 Bacteria 5193
567 Ga0496107_0057629 3300048910 Bacteria 2808
568 Ga0496108_0059524 3300048911 Bacteria 3212
569 Ga0496108_0360155 3300048911 Bacteria 1269
570 Ga0496109_0667651 3300048912 Bacteria 976
571 Ga0496110_0131824 3300048913 Bacteria 2257
572 Ga0496110_0245302 3300048913 Bacteria 1630
573 Ga0496111_0018274 3300048914 Bacteria 4854
574 Ga0496112_0082804 3300048915 Bacteria 3173
575 Ga0496112_0496368 3300048915 Bacteria 1156
576 Ga0496113_0138986 3300048916 Bacteria 1910
577 Ga0496113_0209540 3300048916 Bacteria 1551
578 Ga0496114_0003583 3300048917 Bacteria 11930
579 Ga0496114_0135241 3300048917 Bacteria 2131
580 Ga0496115_0000073 3300048918 Bacteria 90289
581 Ga0496116_0012613 3300048919 Bacteria 6884
582 Ga0496116_0092031 3300048919 Bacteria 1840
583 Ga0496116_0244668 3300048919 Bacteria 898
584 Ga0496116_0258762 3300048919 Bacteria 860
585 Ga0496117_0001191 3300048920 Bacteria 39121
586 Ga0496117_0002104 3300048920 Bacteria 26184
587 Ga0496117_0027633 3300048920 Bacteria 4414
588 Ga0496117_0142236 3300048920 Bacteria 1434
589 Ga0496117_0174406 3300048920 Bacteria 1244
590 Ga0496118_0000858 3300048921 Bacteria 48244
591 Ga0496118_0003962 3300048921 Bacteria 18085
592 Ga0496118_0003986 3300048921 Bacteria 17999
593 Ga0496118_0006565 3300048921 Bacteria 12718
594 Ga0496118_0012772 3300048921 Bacteria 8021
595 Ga0496118_0041177 3300048921 Bacteria 3661
596 Ga0496118_0066272 3300048921 Bacteria 2637
597 Ga0496118_0203986 3300048921 Bacteria 1167
598 Ga0496119_0001416 3300048922 Bacteria 29034
599 Ga0496119_0002285 3300048922 Bacteria 21233
600 Ga0496119_0027194 3300048922 Bacteria 3940
601 Ga0496120_0000181 3300048923 Bacteria 107114
602 Ga0496120_0000676 3300048923 Bacteria 50058
603 Ga0496121_0000045 3300048924 Bacteria 336130
604 Ga0496121_0002194 3300048924 Bacteria 30543
605 Ga0496121_0007169 3300048924 Bacteria 13510
606 Ga0496121_0007504 3300048924 Bacteria 13160
607 Ga0496121_0008475 3300048924 Bacteria 12069
608 Ga0496121_0033804 3300048924 Bacteria 4618
609 Ga0496121_0082866 3300048924 Bacteria 2533
610 Ga0496122_0000372 3300048925 Bacteria 96314
611 Ga0496122_0000901 3300048925 Bacteria 54955
612 Ga0496122_0012430 3300048925 Bacteria 8476
613 Ga0496122_0024918 3300048925 Bacteria 5220
614 Ga0496122_0036868 3300048925 Bacteria 3945
615 Ga0496122_0069617 3300048925 Bacteria 2519
616 Ga0496122_0089106 3300048925 Bacteria 2111
617 Ga0496123_0000694 3300048926 Bacteria 55393
618 Ga0496123_0000727 3300048926 Bacteria 53518
619 Ga0496123_0004944 3300048926 Bacteria 13665
620 Ga0496123_0010650 3300048926 Bacteria 8092
621 Ga0496123_0016723 3300048926 Bacteria 5938
622 Ga0496123_0018011 3300048926 Bacteria 5649
623 Ga0496123_0029353 3300048926 Bacteria 4051
624 Ga0496123_0046163 3300048926 Bacteria 2957
625 Ga0496123_0127277 3300048926 Bacteria 1419
626 Ga0496124_0000009 3300048927 Bacteria 734820
627 Ga0496124_0001044 3300048927 Bacteria 43754
628 Ga0496124_0001061 3300048927 Bacteria 43394
629 Ga0496124_0001822 3300048927 Bacteria 29452
630 Ga0496124_0004084 3300048927 Bacteria 17267
631 Ga0496124_0005543 3300048927 Bacteria 14139
632 Ga0496124_0009788 3300048927 Bacteria 9808
633 Ga0496124_0044030 3300048927 Bacteria 3832
634 Ga0496124_0057116 3300048927 Bacteria 3290
635 Ga0496125_0002711 3300048928 Bacteria 22502
636 Ga0496125_0004432 3300048928 Bacteria 16200
637 Ga0496125_0006197 3300048928 Bacteria 13028
638 Ga0496125_0016772 3300048928 Bacteria 7021
639 Ga0496125_0027468 3300048928 Bacteria 5157
640 Ga0496125_0031061 3300048928 Bacteria 4767
641 Ga0496125_0248080 3300048928 Bacteria 1125
642 Ga0496126_0000169 3300048929 Bacteria 150322
643 Ga0496126_0004409 3300048929 Bacteria 16857
644 Ga0496126_0047949 3300048929 Bacteria 3909
645 Ga0496126_0416307 3300048929 Bacteria 1087
646 Ga0496126_0667712 3300048929 Bacteria 811
647 Ga0495678_000237 3300049459 Bacteria 62286
648 Ga0495682_0001382 3300049460 Bacteria 13255
649 Ga0501290_001797 3300049513 Bacteria 2850
650 Ga0501300_010663 3300049523 Bacteria 1340
651 Ga0501031_0011773 3300049568 Bacteria 5707
652 Ga0501031_0076495 3300049568 Bacteria 2180
653 Ga0501031_0326141 3300049568 Bacteria 994
654 Ga0501032_0024438 3300049569 Bacteria 4172
655 Ga0501032_0146126 3300049569 Bacteria 1556
656 Ga0501033_0000506 3300049570 Bacteria 36672
657 Ga0501033_0027175 3300049570 Bacteria 4303
658 Ga0501033_0307729 3300049570 Bacteria 1114
659 Ga0501033_0657475 3300049570 Bacteria 715
660 Ga0501034_0000083 3300049571 Bacteria 169656
661 Ga0501034_0000091 3300049571 Bacteria 164456
662 Ga0501034_0001599 3300049571 Bacteria 29470
663 Ga0501034_0527303 3300049571 Bacteria 1092
664 Ga0501034_1163558 3300049571 Bacteria 651
665 Ga0501036_0039556 3300049572 Bacteria 3990
666 Ga0501037_0037418 3300049573 Bacteria 3577
667 Ga0501037_0393202 3300049573 Bacteria 951
668 Ga0501038_0004860 3300049574 Bacteria 12487
669 Ga0501038_0027114 3300049574 Bacteria 5099
670 Ga0501038_0059544 3300049574 Bacteria 3271
671 Ga0501038_0280711 3300049574 Bacteria 1311
672 Ga0501039_0260499 3300049575 Bacteria 1363
673 Ga0501039_0413023 3300049575 Bacteria 1060
674 Ga0501039_0532086 3300049575 Bacteria 922
675 Ga0501042_0336236 3300049578 Bacteria 1092
676 Ga0501043_0003936 3300049579 Bacteria 12179
677 Ga0501043_0010778 3300049579 Bacteria 7159
678 Ga0501043_0222098 3300049579 Bacteria 1461
679 Ga0501046_0033161 3300049580 Bacteria 4175
680 Ga0501046_0424874 3300049580 Bacteria 958
681 Ga0501047_0002672 3300049581 Bacteria 16964
682 Ga0501047_0107738 3300049581 Bacteria 2668
683 Ga0501047_0353300 3300049581 Bacteria 1306
684 Ga0501047_0407320 3300049581 Bacteria 1192
685 Ga0501048_0318237 3300049582 Bacteria 1108
686 Ga0501069_0005665 3300049585 Bacteria 6505
687 Ga0501069_0617578 3300049585 Bacteria 651
688 Ga0501070_0000587 3300049586 Bacteria 33165
689 Ga0501070_0005501 3300049586 Bacteria 10807
690 Ga0501073_0034266 3300049589 Bacteria 3614
691 Ga0501073_0111420 3300049589 Bacteria 1898
692 Ga0501074_0012874 3300049590 Bacteria 6082
693 Ga0501216_042049 3300049660 Bacteria 877
694 Ga0501223_068512 3300049663 Bacteria 699
695 Ga0501252_018425 3300049682 Bacteria 894
696 Ga0501261_020923 3300049690 Bacteria 938
697 Ga0501225_0045815 3300049705 Bacteria 1211
698 Ga0501245_016371 3300049708 Bacteria 1124
699 Ga0501080_0010284 3300049742 Bacteria 8554
700 Ga0501080_0356841 3300049742 Bacteria 1319
701 Ga0501080_0456946 3300049742 Bacteria 1144
702 Ga0501080_0618989 3300049742 Bacteria 960
703 Ga0501268_072129 3300049765 Bacteria 700
704 Ga0501035_0021930 3300049822 Bacteria 5868
705 Ga0501035_0085487 3300049822 Bacteria 2780
706 Ga0501035_0095998 3300049822 Bacteria 2605
707 Ga0501035_0125501 3300049822 Bacteria 2240
708 Ga0501044_0009743 3300049823 Bacteria 10451
709 Ga0501044_0019975 3300049823 Bacteria 7153
710 Ga0501044_0057862 3300049823 Bacteria 3977
711 Ga0501044_0253846 3300049823 Bacteria 1698
712 Ga0501044_0714426 3300049823 Bacteria 887
713 nmdc:mga00v17_227116_c1 3300050491 Bacteria 1209
714 nmdc:mga00v17_24698_c1 3300050491 Bacteria 3488
715 nmdc:mga00v17_31031_c1 3300050491 Bacteria 3149
716 nmdc:mga00v17_6748_c1 3300050491 Bacteria 6099
717 nmdc:mga0sz30_4265_c1 3300050516 Bacteria 2854
718 Ga0500643_000108 3300053087 Bacteria 86547
719 Ga0500651_0149916 3300053093 Bacteria 1401
720 Ga0500555_000973 3300053103 Bacteria 9908
721 Ga0500562_071166 3300053108 Bacteria 938
722 Ga0500600_0123028 3300053149 Bacteria 1334
723 Ga0500634_0000098 3300053161 Bacteria 34065
724 Ga0500645_001933 3300053730 Bacteria 9842
725 Ga0466962_0003059 3300061719 Bacteria 7969

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005367 Ga0070667_100048471 Ga0070667_1000484713 160
2 3300009093 Ga0105240_10034195 Ga0105240_100341957 160
3 3300009174 Ga0105241_10146228 Ga0105241_101462283 160
4 3300014968 Ga0157379_10177029 Ga0157379_101770292 160
5 3300025911 Ga0207654_10319341 Ga0207654_103193412 160
6 3300025913 Ga0207695_10153096 Ga0207695_101530962 160
7 3300025986 Ga0207658_10174676 Ga0207658_101746762 160
8 3300005466 Ga0070685_10000546 Ga0070685_1000054613 162
9 3300005327 Ga0070658_10302455 Ga0070658_103024552 163
10 3300005334 Ga0068869_100722964 Ga0068869_1007229642 163
11 3300005335 Ga0070666_10000844 Ga0070666_1000084410 163
12 3300005338 Ga0068868_100020407 Ga0068868_1000204074 163
13 3300005344 Ga0070661_100124614 Ga0070661_1001246142 163
14 3300005347 Ga0070668_100579678 Ga0070668_1005796782 163
15 3300005367 Ga0070667_100030697 Ga0070667_1000306972 163
16 3300005457 Ga0070662_100092034 Ga0070662_1000920343 163
17 3300005459 Ga0068867_100256876 Ga0068867_1002568763 163
18 3300005539 Ga0068853_100036227 Ga0068853_1000362275 163
19 3300005548 Ga0070665_100007381 Ga0070665_1000073815 163
20 3300005563 Ga0068855_100353373 Ga0068855_1003533733 163
21 3300005578 Ga0068854_100012080 Ga0068854_1000120803 163
22 3300005614 Ga0068856_100682819 Ga0068856_1006828192 163
23 3300005616 Ga0068852_100154810 Ga0068852_1001548102 163
24 3300005834 Ga0068851_10001586 Ga0068851_100015867 163
25 3300005841 Ga0068863_100316395 Ga0068863_1003163952 163
26 3300005842 Ga0068858_100032794 Ga0068858_1000327944 163
27 3300006881 Ga0068865_100399013 Ga0068865_1003990132 163
28 3300009174 Ga0105241_10095021 Ga0105241_100950213 163
29 3300009176 Ga0105242_10139482 Ga0105242_101394822 163
30 3300009177 Ga0105248_10460750 Ga0105248_104607503 163
31 3300009553 Ga0105249_10415622 Ga0105249_104156223 163
32 3300013105 Ga0157369_10041790 Ga0157369_100417902 163
33 3300013296 Ga0157374_10067651 Ga0157374_100676514 163
34 3300013307 Ga0157372_10188057 Ga0157372_101880572 163
35 3300014325 Ga0163163_11220843 Ga0163163_112208432 163
36 3300025903 Ga0207680_10005768 Ga0207680_100057685 163
37 3300025904 Ga0207647_10000271 Ga0207647_1000027133 163
38 3300025913 Ga0207695_10047399 Ga0207695_100473995 163
39 3300025914 Ga0207671_10034751 Ga0207671_100347514 163
40 3300025924 Ga0207694_10008972 Ga0207694_100089725 163
41 3300025933 Ga0207706_10006960 Ga0207706_100069603 163
42 3300025942 Ga0207689_10422731 Ga0207689_104227312 163
43 3300025961 Ga0207712_10004994 Ga0207712_100049945 163
44 3300025972 Ga0207668_10876254 Ga0207668_108762542 163
45 3300025986 Ga0207658_10010233 Ga0207658_100102336 163
46 3300026035 Ga0207703_10023236 Ga0207703_100232364 163
47 3300026041 Ga0207639_10000216 Ga0207639_1000021632 163
48 3300026067 Ga0207678_10143123 Ga0207678_101431232 163
49 3300026078 Ga0207702_10049155 Ga0207702_100491554 163
50 3300026089 Ga0207648_10228570 Ga0207648_102285702 163
51 3300026142 Ga0207698_10100669 Ga0207698_101006694 163
52 3300028379 Ga0268266_10000013 Ga0268266_10000013529 163
53 3300001904 JGI24736J21556_1013905 JGI24736J21556_10139051 165
54 3300013104 Ga0157370_10025372 Ga0157370_100253726 165
55 3300013105 Ga0157369_10001434 Ga0157369_100014346 165
56 3300025904 Ga0207647_10000747 Ga0207647_100007479 165
57 3300048919 Ga0496116_0244668 Ga0496116_0244668_250_813 165
58 3300048920 Ga0496117_0027633 Ga0496117_0027633_2050_2613 165
59 3300048921 Ga0496118_0003986 Ga0496118_0003986_4921_5484 165
60 3300048926 Ga0496123_0046163 Ga0496123_0046163_966_1529 165
61 3300048928 Ga0496125_0027468 Ga0496125_0027468_4304_4867 165
62 3300048909 Ga0496106_0018214 Ga0496106_0018214_2272_2835 166
63 3300048924 Ga0496121_0000045 Ga0496121_0000045_318046_318609 166
64 3300048925 Ga0496122_0024918 Ga0496122_0024918_1002_1565 166
65 3300048929 Ga0496126_0047949 Ga0496126_0047949_154_717 166
66 3300049580 Ga0501046_0424874 Ga0501046_0424874_383_946 175
67 3300049742 Ga0501080_0456946 Ga0501080_0456946_261_824 175
68 3300003187 JGI25151J46595_10103966 JGI25151J46595_101039661 178
69 3300003781 Ga0055536_1006090 Ga0055536_10060903 178
70 3300025292 Ga0209676_1000728 Ga0209676_100072825 178
71 3300025294 Ga0209025_1010913 Ga0209025_10109134 178
72 3300048915 Ga0496112_0082804 Ga0496112_0082804_1191_1727 178
73 3300048909 Ga0496106_0000509 Ga0496106_0000509_8124_8690 179
74 3300047472 Ga0495686_0000017 Ga0495686_0000017_156386_157009 181
75 3300048905 Ga0496102_0267651 Ga0496102_0267651_979_1545 181
76 3300048920 Ga0496117_0142236 Ga0496117_0142236_581_1147 181
77 3300048921 Ga0496118_0041177 Ga0496118_0041177_2709_3275 181
78 3300041453 Ga0451797_0221459 Ga0451797_0221459_286_849 182
79 3300025292 Ga0209676_1008020 Ga0209676_10080203 183
80 3300027471 Ga0209995_1038181 Ga0209995_10381811 183
81 iso_pu_bacteria 2524614729 2525555729 183
82 iso_pu_bacteria 2627854209 2630650743 183
83 iso_pu_bacteria 2643221562 2643830324 183
84 iso_pu_bacteria 2643221577 2643894886 183
85 iso_pu_bacteria 2643221685 2644477045 183
86 iso_pu_bacteria 2842914999 2842918535 183
87 iso_pu_bacteria 2919085039 2919088358 183
88 iso_pu_bacteria 2939611941 2939612488 183
89 iso_pu_bacteria 2941471342 2941472892 183
90 iso_pu_bacteria 2547132130 2547502963 184
91 iso_pu_bacteria 2571042365 2572253697 184
92 iso_pu_bacteria 2576861471 2578458499 184
93 iso_pu_bacteria 2593339238 2595446767 184
94 iso_pu_bacteria 2643221559 2643818883 184
95 iso_pu_bacteria 2643221573 2643878540 184
96 iso_pu_bacteria 2643221579 2643907993 184
97 iso_pu_bacteria 2643221581 2643915804 184
98 iso_pu_bacteria 2643221586 2643941457 184
99 iso_pu_bacteria 2643221593 2643975987 184
100 iso_pu_bacteria 2643221612 2644080303 184
101 iso_pu_bacteria 2643221695 2644529003 184
102 iso_pu_bacteria 2643221720 2644659851 184
103 iso_pu_bacteria 2643221727 2644696917 184
104 iso_pu_bacteria 2643221728 2644700408 184
105 iso_pu_bacteria 2718218334 2721026556 184
106 iso_pu_bacteria 2734482264 2735833449 184
107 iso_pu_bacteria 2738543009 2739229451 184
108 iso_pu_bacteria 2747842428 2747949481 184
109 iso_pu_bacteria 2747842501 2748019771 184
110 iso_pu_bacteria 2765235840 2765578885 184
111 iso_pu_bacteria 2816332141 2816516960 184
112 iso_pu_bacteria 2818991440 2819563927 184
113 iso_pu_bacteria 2818991457 2819659671 184
114 iso_pu_bacteria 2842391507 2842393057 184
115 iso_pu_bacteria 2842757796 2842760214 184
116 iso_pu_bacteria 2842780639 2842780904 184
117 iso_pu_bacteria 2842918807 2842919845 184
118 iso_pu_bacteria 2852649853 2852650919 184
119 iso_pu_bacteria 2852684882 2852685526 184
120 iso_pu_bacteria 2857442823 2857443766 184
121 iso_pu_bacteria 2874220319 2874221537 184
122 iso_pu_bacteria 2884338543 2884341442 184
123 iso_pu_bacteria 2894414249 2894415930 184
124 iso_pu_bacteria 2895498888 2895500764 184
125 iso_pu_bacteria 2895511927 2895516366 184
126 iso_pu_bacteria 2895522137 2895523715 184
127 iso_pu_bacteria 2895525241 2895526704 184
128 iso_pu_bacteria 2904463128 2904464563 184
129 iso_pu_bacteria 2919089067 2919089796 184
130 iso_pu_bacteria 2919130084 2919131681 184
131 iso_pu_bacteria 2919134579 2919137734 184
132 iso_pu_bacteria 2919513703 2919517209 184
133 iso_pu_bacteria 2919675420 2919677060 184
134 iso_pu_bacteria 2923516293 2923518643 184
135 iso_pu_bacteria 2928496128 2928500254 184
136 iso_pu_bacteria 2929195423 2929197949 184
137 iso_pu_bacteria 2931380184 2931380839 184
138 iso_pu_bacteria 2937610967 2937612354 184
139 iso_pu_bacteria 2939589442 2939591372 184
140 iso_pu_bacteria 2939622612 2939623503 184
141 iso_pu_bacteria 2939626828 2939630903 184
142 iso_pu_bacteria 2941475908 2941478232 184
143 iso_pu_bacteria 2941489479 2941492951 184
144 iso_pu_bacteria 2953994433 2953995141 184
145 iso_pu_bacteria 2961047084 2961048304 184
146 iso_pu_bacteria 2961064222 2961065301 184
147 iso_pu_bacteria 2974307012 2974309065 184
148 iso_pu_bacteria 2977247770 2977249783 184
149 iso_pu_bacteria 2984514374 2984515728 184
150 iso_pu_bacteria 2987605356 2987606345 184
151 iso_pu_bacteria 2995948881 2995952270 184
152 iso_pu_bacteria 8002869464 8002871866 184
153 iso_pu_bacteria 8003014200 8003016193 184
154 iso_pu_bacteria 8021626552 8021626610 184
155 3300005262 Ga0065165_1000118 Ga0065165_100011815 187
156 3300005331 Ga0070670_100121722 Ga0070670_1001217222 187
157 3300005334 Ga0068869_100091510 Ga0068869_1000915103 187
158 3300005336 Ga0070680_100070391 Ga0070680_1000703912 187
159 3300005336 Ga0070680_100210961 Ga0070680_1002109612 187
160 3300005339 Ga0070660_100052790 Ga0070660_1000527902 187
161 3300005344 Ga0070661_100539807 Ga0070661_1005398071 187
162 3300005365 Ga0070688_100747359 Ga0070688_1007473591 187
163 3300005366 Ga0070659_100276854 Ga0070659_1002768542 187
164 3300005434 Ga0070709_10478688 Ga0070709_104786882 187
165 3300005439 Ga0070711_100818808 Ga0070711_1008188081 187
166 3300005458 Ga0070681_10004840 Ga0070681_1000484014 187
167 3300005458 Ga0070681_10014094 Ga0070681_100140949 187
168 3300005458 Ga0070681_10128362 Ga0070681_101283622 187
169 3300005530 Ga0070679_100014695 Ga0070679_1000146952 187
170 3300005530 Ga0070679_100047097 Ga0070679_1000470973 187
171 3300005539 Ga0068853_100024041 Ga0068853_1000240412 187
172 3300005543 Ga0070672_100002961 Ga0070672_10000296112 187
173 3300005546 Ga0070696_100026884 Ga0070696_1000268843 187
174 3300005546 Ga0070696_100084215 Ga0070696_1000842152 187
175 3300005547 Ga0070693_100019133 Ga0070693_1000191333 187
176 3300005547 Ga0070693_100236580 Ga0070693_1002365801 187
177 3300005548 Ga0070665_100117136 Ga0070665_1001171362 187
178 3300005563 Ga0068855_100047003 Ga0068855_1000470035 187
179 3300005577 Ga0068857_100243855 Ga0068857_1002438552 187
180 3300006186 Ga0075369_10111897 Ga0075369_101118972 187
181 3300009098 Ga0105245_10197244 Ga0105245_101972442 187
182 3300009545 Ga0105237_10446690 Ga0105237_104466901 187
183 3300009551 Ga0105238_10923428 Ga0105238_109234281 187
184 3300009553 Ga0105249_10105989 Ga0105249_101059892 187
185 3300010375 Ga0105239_10004720 Ga0105239_1000472012 187
186 3300010375 Ga0105239_10034421 Ga0105239_100344213 187
187 3300010375 Ga0105239_10312027 Ga0105239_103120272 187
188 3300012506 Ga0157324_1009876 Ga0157324_10098762 187
189 3300013100 Ga0157373_10476773 Ga0157373_104767732 187
190 3300013104 Ga0157370_10000293 Ga0157370_1000029331 187
191 3300013104 Ga0157370_10383224 Ga0157370_103832242 187
192 3300013105 Ga0157369_10000025 Ga0157369_1000002528 187
193 3300013296 Ga0157374_10003664 Ga0157374_1000366410 187
194 3300013296 Ga0157374_10386574 Ga0157374_103865742 187
195 3300013297 Ga0157378_10059570 Ga0157378_100595703 187
196 3300013306 Ga0163162_11111517 Ga0163162_111115172 187
197 3300013306 Ga0163162_11380824 Ga0163162_113808242 187
198 3300014969 Ga0157376_10555963 Ga0157376_105559632 187
199 3300014969 Ga0157376_11785452 Ga0157376_117854521 187
200 3300015265 Ga0182005_1000028 Ga0182005_1000028175 187
201 3300025231 Ga0207427_103125 Ga0207427_1031253 187
202 3300025233 Ga0209437_100224 Ga0209437_1002247 187
203 3300025242 Ga0209258_106928 Ga0209258_1069282 187
204 3300025254 Ga0209148_1000005 Ga0209148_1000005953 187
205 3300025302 Ga0207426_1025885 Ga0207426_10258852 187
206 3300025303 Ga0209051_1027400 Ga0209051_10274004 187
207 3300025893 Ga0207682_10152782 Ga0207682_101527822 187
208 3300025904 Ga0207647_10004013 Ga0207647_100040135 187
209 3300025906 Ga0207699_10461780 Ga0207699_104617802 187
210 3300025909 Ga0207705_10019748 Ga0207705_100197483 187
211 3300025909 Ga0207705_10447987 Ga0207705_104479872 187
212 3300025912 Ga0207707_10000374 Ga0207707_1000037427 187
213 3300025912 Ga0207707_10305064 Ga0207707_103050642 187
214 3300025913 Ga0207695_10007273 Ga0207695_1000727311 187
215 3300025913 Ga0207695_10687301 Ga0207695_106873012 187
216 3300025914 Ga0207671_10001096 Ga0207671_100010965 187
217 3300025914 Ga0207671_10406782 Ga0207671_104067822 187
218 3300025917 Ga0207660_10048413 Ga0207660_100484134 187
219 3300025919 Ga0207657_10011781 Ga0207657_100117813 187
220 3300025919 Ga0207657_10293940 Ga0207657_102939402 187
221 3300025920 Ga0207649_10225574 Ga0207649_102255742 187
222 3300025920 Ga0207649_10631818 Ga0207649_106318182 187
223 3300025921 Ga0207652_10005403 Ga0207652_100054033 187
224 3300025921 Ga0207652_10316830 Ga0207652_103168302 187
225 3300025923 Ga0207681_10371081 Ga0207681_103710812 187
226 3300025924 Ga0207694_10011861 Ga0207694_100118616 187
227 3300025924 Ga0207694_10094964 Ga0207694_100949643 187
228 3300025925 Ga0207650_10027823 Ga0207650_100278233 187
229 3300025927 Ga0207687_10537290 Ga0207687_105372902 187
230 3300025929 Ga0207664_10000093 Ga0207664_1000009355 187
231 3300025932 Ga0207690_10002061 Ga0207690_100020612 187
232 3300025932 Ga0207690_10014240 Ga0207690_100142407 187
233 3300025932 Ga0207690_10019429 Ga0207690_100194293 187
234 3300025933 Ga0207706_10030008 Ga0207706_100300083 187
235 3300025941 Ga0207711_10104880 Ga0207711_101048802 187
236 3300025942 Ga0207689_10105299 Ga0207689_101052993 187
237 3300025949 Ga0207667_10000119 Ga0207667_1000011934 187
238 3300025949 Ga0207667_10006961 Ga0207667_100069613 187
239 3300025949 Ga0207667_10095325 Ga0207667_100953253 187
240 3300025961 Ga0207712_10183070 Ga0207712_101830703 187
241 3300025981 Ga0207640_10000185 Ga0207640_1000018531 187
242 3300026041 Ga0207639_10016756 Ga0207639_100167564 187
243 3300026041 Ga0207639_11074441 Ga0207639_110744411 187
244 3300026078 Ga0207702_10077061 Ga0207702_100770612 187
245 3300026089 Ga0207648_10941347 Ga0207648_109413471 187
246 3300026116 Ga0207674_10329569 Ga0207674_103295692 187
247 3300028379 Ga0268266_10098205 Ga0268266_100982052 187
248 3300031507 Ga0307509_10025648 Ga0307509_100256485 187
249 3300031824 Ga0307413_10313494 Ga0307413_103134942 187
250 3300039450 Ga0436363_0039191 Ga0436363_0039191_714_1277 187
251 3300041458 Ga0451798_0443259 Ga0451798_0443259_43_606 187
252 3300041463 Ga0451804_0653443 Ga0451804_0653443_31_594 187
253 3300041512 Ga0451853_0695473 Ga0451853_0695473_1905_2468 187
254 3300041512 Ga0451853_0982692 Ga0451853_0982692_248_814 187
255 3300041512 Ga0451853_4052864 Ga0451853_4052864_68_631 187
256 3300044712 Ga0453684_0002948 Ga0453684_0002948_480_1043 187
257 3300045051 Ga0451576_0000156 Ga0451576_0000156_39072_39635 187
258 3300046501 Ga0495607_0000088 Ga0495607_0000088_16064_16627 187
259 3300046519 Ga0495632_0000004 Ga0495632_0000004_186600_187163 187
260 3300048906 Ga0496103_0481785 Ga0496103_0481785_76_639 187
261 3300048918 Ga0496115_0000073 Ga0496115_0000073_75487_76050 187
262 3300048919 Ga0496116_0258762 Ga0496116_0258762_267_830 187
263 3300048920 Ga0496117_0174406 Ga0496117_0174406_145_708 187
264 3300048921 Ga0496118_0012772 Ga0496118_0012772_6377_6940 187
265 3300048926 Ga0496123_0010650 Ga0496123_0010650_6214_6777 187
266 3300048927 Ga0496124_0001044 Ga0496124_0001044_33697_34260 187
267 3300048927 Ga0496124_0001822 Ga0496124_0001822_9271_9834 187
268 3300048929 Ga0496126_0000169 Ga0496126_0000169_84686_85249 187
269 3300049568 Ga0501031_0326141 Ga0501031_0326141_152_715 187
270 3300049569 Ga0501032_0146126 Ga0501032_0146126_31_594 187
271 3300049570 Ga0501033_0027175 Ga0501033_0027175_815_1378 187
272 3300049570 Ga0501033_0307729 Ga0501033_0307729_467_1030 187
273 3300049570 Ga0501033_0657475 Ga0501033_0657475_116_679 187
274 3300049571 Ga0501034_0527303 Ga0501034_0527303_79_642 187
275 3300049571 Ga0501034_1163558 Ga0501034_1163558_46_609 187
276 3300049572 Ga0501036_0039556 Ga0501036_0039556_68_631 187
277 3300049573 Ga0501037_0393202 Ga0501037_0393202_34_597 187
278 3300049574 Ga0501038_0027114 Ga0501038_0027114_17_580 187
279 3300049574 Ga0501038_0280711 Ga0501038_0280711_427_990 187
280 3300049575 Ga0501039_0260499 Ga0501039_0260499_659_1303 187
281 3300049575 Ga0501039_0532086 Ga0501039_0532086_149_712 187
282 3300049578 Ga0501042_0336236 Ga0501042_0336236_81_644 187
283 3300049579 Ga0501043_0010778 Ga0501043_0010778_6519_7082 187
284 3300049579 Ga0501043_0222098 Ga0501043_0222098_875_1438 187
285 3300049580 Ga0501046_0033161 Ga0501046_0033161_1743_2306 187
286 3300049581 Ga0501047_0002672 Ga0501047_0002672_5136_5699 187
287 3300049581 Ga0501047_0353300 Ga0501047_0353300_241_804 187
288 3300049581 Ga0501047_0407320 Ga0501047_0407320_578_1141 187
289 3300049582 Ga0501048_0318237 Ga0501048_0318237_462_1025 187
290 3300049585 Ga0501069_0005665 Ga0501069_0005665_5262_5825 187
291 3300049585 Ga0501069_0617578 Ga0501069_0617578_46_609 187
292 3300049586 Ga0501070_0000587 Ga0501070_0000587_5977_6540 187
293 3300049586 Ga0501070_0005501 Ga0501070_0005501_153_716 187
294 3300049589 Ga0501073_0111420 Ga0501073_0111420_431_994 187
295 3300049590 Ga0501074_0012874 Ga0501074_0012874_1164_1727 187
296 3300049742 Ga0501080_0010284 Ga0501080_0010284_2955_3518 187
297 3300049742 Ga0501080_0618989 Ga0501080_0618989_121_684 187
298 3300049822 Ga0501035_0021930 Ga0501035_0021930_905_1468 187
299 3300049822 Ga0501035_0125501 Ga0501035_0125501_414_977 187
300 3300049823 Ga0501044_0019975 Ga0501044_0019975_1243_1806 187
301 3300049823 Ga0501044_0057862 Ga0501044_0057862_3134_3778 187
302 3300049823 Ga0501044_0253846 Ga0501044_0253846_812_1375 187
303 3300050516 nmdc:mga0sz30_4265_c1 nmdc:mga0sz30_4265_c1_356_919 187
304 3300053149 Ga0500600_0123028 Ga0500600_0123028_719_1282 187
305 2162886007 SwRhRL2b_contig_1819724 SwRhRL2b_0550.00001830 188
306 3300002773 JGI25152J39213_1000118 JGI25152J39213_100011834 188
307 3300002773 JGI25152J39213_1020380 JGI25152J39213_10203801 188
308 3300002774 JGI25150J39212_1000434 JGI25150J39212_10004341 188
309 3300003187 JGI25151J46595_10000315 JGI25151J46595_1000031534 188
310 3300003215 JGI25153J46596_10000167 JGI25153J46596_1000016734 188
311 3300003316 rootH1_10033715 rootH1_100337152 188
312 3300003771 Ga0055526_1000182 Ga0055526_100018251 188
313 3300003771 Ga0055526_1002395 Ga0055526_10023955 188
314 3300003773 Ga0055537_1000091 Ga0055537_100009144 188
315 3300003773 Ga0055537_1000136 Ga0055537_100013651 188
316 3300003775 Ga0055524_1000254 Ga0055524_100025451 188
317 3300003775 Ga0055524_1030331 Ga0055524_10303312 188
318 3300003781 Ga0055536_1000812 Ga0055536_100081213 188
319 3300003781 Ga0055536_1000925 Ga0055536_100092511 188
320 3300003781 Ga0055536_1013569 Ga0055536_10135693 188
321 3300003781 Ga0055536_1030512 Ga0055536_10305122 188
322 3300003784 Ga0055534_1000043 Ga0055534_100004353 188
323 3300003784 Ga0055534_1000137 Ga0055534_10001371 188
324 3300003790 Ga0055528_1000087 Ga0055528_100008718 188
325 3300003790 Ga0055528_1000169 Ga0055528_10001691 188
326 3300003791 Ga0055530_10017857 Ga0055530_100178571 188
327 3300003792 Ga0055540_1044902 Ga0055540_10449021 188
328 3300003794 Ga0055531_10001450 Ga0055531_1000145010 188
329 3300003794 Ga0055531_10004122 Ga0055531_100041226 188
330 3300003794 Ga0055531_10004970 Ga0055531_100049704 188
331 3300003794 Ga0055531_10007659 Ga0055531_100076592 188
332 3300003794 Ga0055531_10007895 Ga0055531_100078954 188
333 3300003794 Ga0055531_10012585 Ga0055531_100125853 188
334 3300003794 Ga0055531_10030430 Ga0055531_100304301 188
335 3300003856 Ga0058692_1000031 Ga0058692_1000031123 188
336 3300003856 Ga0058692_1000060 Ga0058692_100006042 188
337 3300005262 Ga0065165_1022436 Ga0065165_10224363 188
338 3300005262 Ga0065165_1051736 Ga0065165_10517362 188
339 3300005289 Ga0065704_10070531 Ga0065704_100705313 188
340 3300005289 Ga0065704_10079591 Ga0065704_100795911 188
341 3300005293 Ga0065715_10050260 Ga0065715_100502602 188
342 3300005327 Ga0070658_10142010 Ga0070658_101420102 188
343 3300005329 Ga0070683_101226924 Ga0070683_1012269241 188
344 3300005331 Ga0070670_100012694 Ga0070670_1000126944 188
345 3300005339 Ga0070660_100709462 Ga0070660_1007094622 188
346 3300005344 Ga0070661_100562343 Ga0070661_1005623431 188
347 3300005345 Ga0070692_10304728 Ga0070692_103047281 188
348 3300005347 Ga0070668_100021352 Ga0070668_1000213522 188
349 3300005347 Ga0070668_100167532 Ga0070668_1001675323 188
350 3300005347 Ga0070668_100186338 Ga0070668_1001863382 188
351 3300005347 Ga0070668_100625637 Ga0070668_1006256371 188
352 3300005355 Ga0070671_100081121 Ga0070671_1000811212 188
353 3300005355 Ga0070671_100239338 Ga0070671_1002393382 188
354 3300005356 Ga0070674_100135692 Ga0070674_1001356923 188
355 3300005364 Ga0070673_100661858 Ga0070673_1006618582 188
356 3300005367 Ga0070667_100629183 Ga0070667_1006291831 188
357 3300005456 Ga0070678_101138446 Ga0070678_1011384461 188
358 3300005457 Ga0070662_100369198 Ga0070662_1003691981 188
359 3300005530 Ga0070679_100738042 Ga0070679_1007380422 188
360 3300005543 Ga0070672_100008454 Ga0070672_1000084543 188
361 3300005548 Ga0070665_100094122 Ga0070665_1000941223 188
362 3300005548 Ga0070665_101345819 Ga0070665_1013458191 188
363 3300005564 Ga0070664_100152562 Ga0070664_1001525621 188
364 3300005564 Ga0070664_101460634 Ga0070664_1014606341 188
365 3300005841 Ga0068863_100252755 Ga0068863_1002527553 188
366 3300005844 Ga0068862_100546453 Ga0068862_1005464532 188
367 3300005844 Ga0068862_100879641 Ga0068862_1008796412 188
368 3300005985 Ga0081539_10157391 Ga0081539_101573912 188
369 3300006051 Ga0075364_10000075 Ga0075364_1000007528 188
370 3300006051 Ga0075364_10075928 Ga0075364_100759281 188
371 3300006051 Ga0075364_10090167 Ga0075364_100901672 188
372 3300006051 Ga0075364_10154064 Ga0075364_101540642 188
373 3300006051 Ga0075364_10201042 Ga0075364_102010422 188
374 3300006186 Ga0075369_10056644 Ga0075369_100566441 188
375 3300009011 Ga0105251_10000364 Ga0105251_1000036434 188
376 3300009036 Ga0105244_10170837 Ga0105244_101708372 188
377 3300009036 Ga0105244_10209024 Ga0105244_102090242 188
378 3300009036 Ga0105244_10289050 Ga0105244_102890501 188
379 3300009101 Ga0105247_10003765 Ga0105247_100037656 188
380 3300009148 Ga0105243_10012792 Ga0105243_100127928 188
381 3300009148 Ga0105243_10020218 Ga0105243_100202182 188
382 3300009177 Ga0105248_11418510 Ga0105248_114185101 188
383 3300009551 Ga0105238_10606121 Ga0105238_106061212 188
384 3300009979 Ga0105032_108202 Ga0105032_1082022 188
385 3300012483 Ga0157337_1003328 Ga0157337_10033282 188
386 3300012495 Ga0157323_1009100 Ga0157323_10091001 188
387 3300012502 Ga0157347_1022160 Ga0157347_10221601 188
388 3300012513 Ga0157326_1024241 Ga0157326_10242412 188
389 3300013100 Ga0157373_10160012 Ga0157373_101600123 188
390 3300013102 Ga0157371_10002405 Ga0157371_1000240511 188
391 3300013102 Ga0157371_10006531 Ga0157371_100065318 188
392 3300013102 Ga0157371_10122281 Ga0157371_101222812 188
393 3300013102 Ga0157371_10596638 Ga0157371_105966381 188
394 3300013104 Ga0157370_10117492 Ga0157370_101174923 188
395 3300013105 Ga0157369_10093022 Ga0157369_100930224 188
396 3300013306 Ga0163162_10281171 Ga0163162_102811712 188
397 3300013308 Ga0157375_10124460 Ga0157375_101244602 188
398 3300013308 Ga0157375_10800574 Ga0157375_108005741 188
399 3300013308 Ga0157375_11095926 Ga0157375_110959262 188
400 3300014326 Ga0157380_10374967 Ga0157380_103749672 188
401 3300014326 Ga0157380_10661593 Ga0157380_106615931 188
402 3300014326 Ga0157380_11366390 Ga0157380_113663901 188
403 3300014497 Ga0182008_10001118 Ga0182008_100011187 188
404 3300014497 Ga0182008_10003258 Ga0182008_100032589 188
405 3300015261 Ga0182006_1000085 Ga0182006_100008540 188
406 3300015261 Ga0182006_1001555 Ga0182006_10015557 188
407 3300015262 Ga0182007_10000556 Ga0182007_1000055616 188
408 3300015262 Ga0182007_10014554 Ga0182007_100145542 188
409 3300015265 Ga0182005_1000463 Ga0182005_100046314 188
410 3300015265 Ga0182005_1001893 Ga0182005_10018934 188
411 3300015265 Ga0182005_1004454 Ga0182005_10044542 188
412 3300015689 Ga0183360_10001 Ga0183360_10001972 188
413 3300017792 Ga0163161_10001824 Ga0163161_1000182412 188
414 3300017792 Ga0163161_10149136 Ga0163161_101491361 188
415 3300017792 Ga0163161_10241850 Ga0163161_102418501 188
416 3300025226 Ga0209674_100933 Ga0209674_1009334 188
417 3300025233 Ga0209437_100955 Ga0209437_1009556 188
418 3300025245 Ga0207425_1000097 Ga0207425_100009749 188
419 3300025245 Ga0207425_1036230 Ga0207425_10362302 188
420 3300025258 Ga0209129_1000189 Ga0209129_100018949 188
421 3300025258 Ga0209129_1002415 Ga0209129_10024156 188
422 3300025263 Ga0209565_1000005 Ga0209565_1000005163 188
423 3300025263 Ga0209565_1000063 Ga0209565_100006343 188
424 3300025273 Ga0209673_1000027 Ga0209673_1000027164 188
425 3300025273 Ga0209673_1000065 Ga0209673_100006596 188
426 3300025273 Ga0209673_1003263 Ga0209673_10032635 188
427 3300025284 Ga0209130_1009009 Ga0209130_10090093 188
428 3300025284 Ga0209130_1011298 Ga0209130_10112982 188
429 3300025284 Ga0209130_1024979 Ga0209130_10249791 188
430 3300025291 Ga0209675_1000004 Ga0209675_1000004163 188
431 3300025291 Ga0209675_1000011 Ga0209675_1000011239 188
432 3300025292 Ga0209676_1000011 Ga0209676_1000011596 188
433 3300025292 Ga0209676_1000034 Ga0209676_1000034452 188
434 3300025292 Ga0209676_1000068 Ga0209676_1000068162 188
435 3300025292 Ga0209676_1000981 Ga0209676_100098113 188
436 3300025292 Ga0209676_1003532 Ga0209676_10035325 188
437 3300025292 Ga0209676_1006825 Ga0209676_10068255 188
438 3300025292 Ga0209676_1009417 Ga0209676_10094172 188
439 3300025294 Ga0209025_1000005 Ga0209025_1000005212 188
440 3300025294 Ga0209025_1000054 Ga0209025_100005449 188
441 3300025294 Ga0209025_1004511 Ga0209025_100451110 188
442 3300025295 Ga0209564_1000050 Ga0209564_1000050164 188
443 3300025295 Ga0209564_1000433 Ga0209564_100043322 188
444 3300025295 Ga0209564_1008048 Ga0209564_10080484 188
445 3300025295 Ga0209564_1026629 Ga0209564_10266292 188
446 3300025297 Ga0209758_1000062 Ga0209758_100006249 188
447 3300025297 Ga0209758_1004731 Ga0209758_10047314 188
448 3300025297 Ga0209758_1008133 Ga0209758_10081337 188
449 3300025297 Ga0209758_1023839 Ga0209758_10238391 188
450 3300025298 Ga0209050_1000239 Ga0209050_100023965 188
451 3300025298 Ga0209050_1000599 Ga0209050_100059911 188
452 3300025298 Ga0209050_1006127 Ga0209050_10061273 188
453 3300025299 Ga0209256_1000031 Ga0209256_1000031164 188
454 3300025299 Ga0209256_1003080 Ga0209256_100308010 188
455 3300025299 Ga0209256_1003541 Ga0209256_10035413 188
456 3300025299 Ga0209256_1005136 Ga0209256_10051366 188
457 3300025299 Ga0209256_1006995 Ga0209256_10069952 188
458 3300025299 Ga0209256_1018166 Ga0209256_10181662 188
459 3300025303 Ga0209051_1002354 Ga0209051_10023547 188
460 3300025304 Ga0209257_1000014 Ga0209257_1000014655 188
461 3300025304 Ga0209257_1000263 Ga0209257_100026346 188
462 3300025304 Ga0209257_1000283 Ga0209257_10002835 188
463 3300025304 Ga0209257_1000645 Ga0209257_100064511 188
464 3300025304 Ga0209257_1001034 Ga0209257_100103413 188
465 3300025304 Ga0209257_1001651 Ga0209257_100165115 188
466 3300025304 Ga0209257_1002860 Ga0209257_10028606 188
467 3300025304 Ga0209257_1003306 Ga0209257_10033066 188
468 3300025304 Ga0209257_1004492 Ga0209257_10044922 188
469 3300025304 Ga0209257_1008923 Ga0209257_10089234 188
470 3300025304 Ga0209257_1021546 Ga0209257_10215461 188
471 3300025304 Ga0209257_1024761 Ga0209257_10247613 188
472 3300025728 Ga0207655_1145642 Ga0207655_11456421 188
473 3300025735 Ga0207713_1000422 Ga0207713_10004223 188
474 3300025900 Ga0207710_10013753 Ga0207710_100137532 188
475 3300025919 Ga0207657_10077231 Ga0207657_100772313 188
476 3300025921 Ga0207652_10521960 Ga0207652_105219602 188
477 3300025923 Ga0207681_10033056 Ga0207681_100330563 188
478 3300025923 Ga0207681_10166007 Ga0207681_101660072 188
479 3300025925 Ga0207650_10034031 Ga0207650_100340313 188
480 3300025925 Ga0207650_10190209 Ga0207650_101902093 188
481 3300025926 Ga0207659_10363646 Ga0207659_103636462 188
482 3300025933 Ga0207706_10575543 Ga0207706_105755432 188
483 3300025935 Ga0207709_10000632 Ga0207709_100006325 188
484 3300025935 Ga0207709_10341998 Ga0207709_103419982 188
485 3300025937 Ga0207669_10084647 Ga0207669_100846472 188
486 3300025940 Ga0207691_10009924 Ga0207691_100099248 188
487 3300025940 Ga0207691_10127613 Ga0207691_101276132 188
488 3300025945 Ga0207679_10103132 Ga0207679_101031323 188
489 3300025945 Ga0207679_10753021 Ga0207679_107530212 188
490 3300025960 Ga0207651_10398009 Ga0207651_103980093 188
491 3300025972 Ga0207668_10007253 Ga0207668_100072537 188
492 3300025972 Ga0207668_10091507 Ga0207668_100915072 188
493 3300025972 Ga0207668_10259530 Ga0207668_102595302 188
494 3300025981 Ga0207640_10307927 Ga0207640_103079272 188
495 3300026075 Ga0207708_10763240 Ga0207708_107632402 188
496 3300026088 Ga0207641_10103684 Ga0207641_101036843 188
497 3300026121 Ga0207683_10235723 Ga0207683_102357233 188
498 3300026121 Ga0207683_11257719 Ga0207683_112577191 188
499 3300027312 Ga0209371_1000004 Ga0209371_100000455 188
500 3300027312 Ga0209371_1000139 Ga0209371_100013942 188
501 3300027552 Ga0209982_1014132 Ga0209982_10141322 188
502 3300027617 Ga0210002_1012531 Ga0210002_10125312 188
503 3300027682 Ga0209971_1001630 Ga0209971_10016302 188
504 3300027866 Ga0209813_10151705 Ga0209813_101517052 188
505 3300027876 Ga0209974_10010966 Ga0209974_100109662 188
506 3300027876 Ga0209974_10107567 Ga0209974_101075672 188
507 3300028379 Ga0268266_10037476 Ga0268266_100374764 188
508 3300028379 Ga0268266_11143513 Ga0268266_111435131 188
509 3300028380 Ga0268265_10078162 Ga0268265_100781622 188
510 3300028380 Ga0268265_10850062 Ga0268265_108500621 188
511 3300030500 Ga0268256_1000005 Ga0268256_1000005990 188
512 3300030500 Ga0268256_1000109 Ga0268256_100010960 188
513 3300030731 Ga0316177_1014219 Ga0316177_10142193 188
514 3300030731 Ga0316177_1060205 Ga0316177_10602052 188
515 3300030732 Ga0316176_1137489 Ga0316176_11374893 188
516 3300030732 Ga0316176_1150837 Ga0316176_11508371 188
517 3300030733 Ga0314311_1207988 Ga0314311_12079883 188
518 3300030735 Ga0316178_1111912 Ga0316178_11119122 188
519 3300030742 Ga0316183_1000379 Ga0316183_10003792 188
520 3300030742 Ga0316183_1073792 Ga0316183_10737923 188
521 3300030745 Ga0316182_1180068 Ga0316182_11800682 188
522 3300031456 Ga0307513_10009900 Ga0307513_1000990011 188
523 3300031456 Ga0307513_10048166 Ga0307513_100481665 188
524 3300031548 Ga0307408_100498030 Ga0307408_1004980303 188
525 3300031731 Ga0307405_10110996 Ga0307405_101109962 188
526 3300031824 Ga0307413_10001980 Ga0307413_100019805 188
527 3300031824 Ga0307413_10107096 Ga0307413_101070962 188
528 3300031824 Ga0307413_10144252 Ga0307413_101442523 188
529 3300031824 Ga0307413_10163763 Ga0307413_101637632 188
530 3300031824 Ga0307413_10767900 Ga0307413_107679002 188
531 3300031852 Ga0307410_10220048 Ga0307410_102200482 188
532 3300031852 Ga0307410_10646388 Ga0307410_106463882 188
533 3300031901 Ga0307406_10002948 Ga0307406_100029486 188
534 3300031901 Ga0307406_10684692 Ga0307406_106846921 188
535 3300031903 Ga0307407_10348328 Ga0307407_103483282 188
536 3300031911 Ga0307412_10013730 Ga0307412_100137306 188
537 3300031911 Ga0307412_10111646 Ga0307412_101116462 188
538 3300031911 Ga0307412_10384520 Ga0307412_103845202 188
539 3300031911 Ga0307412_10789010 Ga0307412_107890101 188
540 3300032002 Ga0307416_100326325 Ga0307416_1003263251 188
541 3300032004 Ga0307414_10004260 Ga0307414_100042604 188
542 3300032004 Ga0307414_10038814 Ga0307414_100388142 188
543 3300032004 Ga0307414_10049127 Ga0307414_100491274 188
544 3300032004 Ga0307414_10072191 Ga0307414_100721913 188
545 3300032004 Ga0307414_10120628 Ga0307414_101206282 188
546 3300032004 Ga0307414_10222988 Ga0307414_102229883 188
547 3300032004 Ga0307414_10358111 Ga0307414_103581112 188
548 3300032004 Ga0307414_10444790 Ga0307414_104447902 188
549 3300032004 Ga0307414_10910785 Ga0307414_109107852 188
550 3300032004 Ga0307414_11164240 Ga0307414_111642401 188
551 3300032005 Ga0307411_10056428 Ga0307411_100564282 188
552 3300032005 Ga0307411_10262120 Ga0307411_102621203 188
553 3300037312 Ga0395899_0131662 Ga0395899_0131662_1018_1584 188
554 3300037418 Ga0395900_0537431 Ga0395900_0537431_267_833 188
555 3300037466 Ga0395898_0071216 Ga0395898_0071216_2138_2704 188
556 3300037466 Ga0395898_0083391 Ga0395898_0083391_345_911 188
557 3300037471 Ga0395905_0034860 Ga0395905_0034860_63_629 188
558 3300037471 Ga0395905_0154998 Ga0395905_0154998_566_1132 188
559 3300037471 Ga0395905_0179496 Ga0395905_0179496_104_670 188
560 3300037471 Ga0395905_0512794 Ga0395905_0512794_35_601 188
561 3300037471 Ga0395905_0530077 Ga0395905_0530077_17_583 188
562 3300038443 Ga0395901_0063541 Ga0395901_0063541_2915_3481 188
563 3300038705 Ga0237819_00164 Ga0237819_00164_11792_12358 188
564 3300038705 Ga0237819_05553 Ga0237819_05553_161_727 188
565 3300039145 Ga0237816_00136 Ga0237816_00136_3636_4202 188
566 3300041404 Ga0439436_0028420 Ga0439436_0028420_912_1478 188
567 3300041404 Ga0439436_0037627 Ga0439436_0037627_189_755 188
568 3300041413 Ga0439465_0000040 Ga0439465_0000040_15698_16264 188
569 3300041413 Ga0439465_0000426 Ga0439465_0000426_8255_8821 188
570 3300041413 Ga0439465_0000996 Ga0439465_0000996_5875_6441 188
571 3300041413 Ga0439465_0002646 Ga0439465_0002646_1948_2514 188
572 3300041413 Ga0439465_0015599 Ga0439465_0015599_946_1512 188
573 3300041443 Ga0451789_0368362 Ga0451789_0368362_216_782 188
574 3300041443 Ga0451789_0612999 Ga0451789_0612999_12_626 188
575 3300041453 Ga0451797_0985516 Ga0451797_0985516_347_913 188
576 3300041459 Ga0451800_1224437 Ga0451800_1224437_2754_3320 188
577 3300041462 Ga0451806_620901 Ga0451806_620901_286_852 188
578 3300041486 Ga0451807_1378455 Ga0451807_1378455_1260_1826 188
579 3300041486 Ga0451807_2757209 Ga0451807_2757209_26_592 188
580 3300041494 Ga0451837_1411285 Ga0451837_1411285_679_1245 188
581 3300041509 Ga0451843_0119213 Ga0451843_0119213_1470_2036 188
582 3300041512 Ga0451853_1076376 Ga0451853_1076376_379_945 188
583 3300041999 Ga0439433_0057639 Ga0439433_0057639_36_602 188
584 3300042004 Ga0439445_0008723 Ga0439445_0008723_1167_1733 188
585 3300042004 Ga0439445_0037452 Ga0439445_0037452_427_993 188
586 3300042004 Ga0439445_0057355 Ga0439445_0057355_471_1037 188
587 3300042004 Ga0439445_0130758 Ga0439445_0130758_35_601 188
588 3300042006 Ga0439432_005823 Ga0439432_005823_2332_2898 188
589 3300042006 Ga0439432_027180 Ga0439432_027180_493_1059 188
590 3300042007 Ga0439449_0000134 Ga0439449_0000134_4668_5234 188
591 3300042007 Ga0439449_0004260 Ga0439449_0004260_2740_3306 188
592 3300042007 Ga0439449_0008474 Ga0439449_0008474_1045_1611 188
593 3300042007 Ga0439449_0012239 Ga0439449_0012239_988_1554 188
594 3300042007 Ga0439449_0047789 Ga0439449_0047789_43_609 188
595 3300042007 Ga0439449_0047882 Ga0439449_0047882_866_1435 188
596 3300042012 Ga0439455_0072954 Ga0439455_0072954_259_825 188
597 3300042015 Ga0439462_0080623 Ga0439462_0080623_284_850 188
598 3300042184 Ga0450908_000427 Ga0450908_000427_327_893 188
599 3300042533 Ga0450901_003256 Ga0450901_003256_983_1549 188
600 3300042876 Ga0451577_0051922 Ga0451577_0051922_2808_3374 188
601 3300044656 Ga0466969_0061651 Ga0466969_0061651_873_1439 188
602 3300044658 Ga0466972_0074236 Ga0466972_0074236_1020_1586 188
603 3300044672 Ga0466982_0000003 Ga0466982_0000003_366129_366695 188
604 3300044672 Ga0466982_0000061 Ga0466982_0000061_18511_19077 188
605 3300044683 Ga0466965_0014613 Ga0466965_0014613_1766_2332 188
606 3300044684 Ga0466966_0012748 Ga0466966_0012748_1584_2150 188
607 3300044706 Ga0466964_0007101 Ga0466964_0007101_1241_1807 188
608 3300044712 Ga0453684_0978132 Ga0453684_0978132_135_701 188
609 3300044719 Ga0466971_0054782 Ga0466971_0054782_1203_1769 188
610 3300044735 Ga0466968_0002058 Ga0466968_0002058_3766_4332 188
611 3300044901 Ga0466960_0004681 Ga0466960_0004681_3652_4218 188
612 3300045049 Ga0466959_0054469 Ga0466959_0054469_393_959 188
613 3300045836 Ga0466958_0034030 Ga0466958_0034030_21_587 188
614 3300045976 Ga0466967_1183456 Ga0466967_1183456_119_685 188
615 3300046452 Ga0495617_001863 Ga0495617_001863_7215_7781 188
616 3300046453 Ga0495627_038463 Ga0495627_038463_882_1448 188
617 3300046453 Ga0495627_046097 Ga0495627_046097_186_752 188
618 3300046457 Ga0495590_0015786 Ga0495590_0015786_1781_2347 188
619 3300046460 Ga0495638_0000153 Ga0495638_0000153_63814_64380 188
620 3300046460 Ga0495638_0007554 Ga0495638_0007554_592_1158 188
621 3300046460 Ga0495638_0019522 Ga0495638_0019522_172_738 188
622 3300046460 Ga0495638_0142646 Ga0495638_0142646_61_627 188
623 3300046471 Ga0495650_0002162 Ga0495650_0002162_648_1214 188
624 3300046471 Ga0495650_0220430 Ga0495650_0220430_58_624 188
625 3300046491 Ga0495584_0000598 Ga0495584_0000598_17322_17888 188
626 3300046492 Ga0495585_0000104 Ga0495585_0000104_25255_25821 188
627 3300046492 Ga0495585_0001499 Ga0495585_0001499_11438_12004 188
628 3300046501 Ga0495607_0000120 Ga0495607_0000120_11770_12336 188
629 3300046501 Ga0495607_0037418 Ga0495607_0037418_1027_1593 188
630 3300046507 Ga0495606_0000338 Ga0495606_0000338_37701_38267 188
631 3300046507 Ga0495606_0001054 Ga0495606_0001054_15519_16085 188
632 3300046507 Ga0495606_0012571 Ga0495606_0012571_1607_2173 188
633 3300046507 Ga0495606_0194423 Ga0495606_0194423_489_1055 188
634 3300046512 Ga0495610_0003255 Ga0495610_0003255_6721_7287 188
635 3300046512 Ga0495610_0079918 Ga0495610_0079918_864_1430 188
636 3300046513 Ga0495616_0000086 Ga0495616_0000086_48124_48690 188
637 3300046513 Ga0495616_0095615 Ga0495616_0095615_822_1388 188
638 3300046513 Ga0495616_0175926 Ga0495616_0175926_268_834 188
639 3300046515 Ga0495620_0000469 Ga0495620_0000469_10762_11328 188
640 3300046515 Ga0495620_0000533 Ga0495620_0000533_12046_12612 188
641 3300046518 Ga0495631_0000029 Ga0495631_0000029_13613_14179 188
642 3300046518 Ga0495631_0000298 Ga0495631_0000298_23637_24203 188
643 3300046519 Ga0495632_0003675 Ga0495632_0003675_2394_2960 188
644 3300046522 Ga0495643_0002752 Ga0495643_0002752_5578_6144 188
645 3300046522 Ga0495643_0083522 Ga0495643_0083522_560_1126 188
646 3300046524 Ga0495648_0000914 Ga0495648_0000914_161_727 188
647 3300046524 Ga0495648_0008185 Ga0495648_0008185_4807_5373 188
648 3300046525 Ga0495663_0000499 Ga0495663_0000499_9253_9819 188
649 3300046525 Ga0495663_0002900 Ga0495663_0002900_3496_4062 188
650 3300046537 Ga0495598_0008364 Ga0495598_0008364_1418_1984 188
651 3300046538 Ga0495609_0003684 Ga0495609_0003684_6200_6766 188
652 3300046539 Ga0495621_0001151 Ga0495621_0001151_3042_3608 188
653 3300046558 Ga0495633_0005962 Ga0495633_0005962_3411_3977 188
654 3300046615 Ga0495656_0003170 Ga0495656_0003170_4138_4704 188
655 3300046615 Ga0495656_0015285 Ga0495656_0015285_1928_2494 188
656 3300046615 Ga0495656_0133344 Ga0495656_0133344_324_890 188
657 3300046616 Ga0495668_0000820 Ga0495668_0000820_12534_13100 188
658 3300046616 Ga0495668_0001397 Ga0495668_0001397_7670_8236 188
659 3300046648 Ga0495611_0000001 Ga0495611_0000001_2135018_2135584 188
660 3300046648 Ga0495611_0000313 Ga0495611_0000313_25205_25771 188
661 3300046660 Ga0495625_0000022 Ga0495625_0000022_121197_121763 188
662 3300046660 Ga0495625_0003692 Ga0495625_0003692_12170_12736 188
663 3300046660 Ga0495625_0068644 Ga0495625_0068644_1440_2006 188
664 3300046664 Ga0495659_0236357 Ga0495659_0236357_166_732 188
665 3300046665 Ga0495661_0000733 Ga0495661_0000733_24854_25420 188
666 3300046665 Ga0495661_0055636 Ga0495661_0055636_244_810 188
667 3300046691 Ga0495670_0000495 Ga0495670_0000495_18031_18597 188
668 3300046691 Ga0495670_0032130 Ga0495670_0032130_229_795 188
669 3300046691 Ga0495670_0042012 Ga0495670_0042012_842_1408 188
670 3300046691 Ga0495670_0287176 Ga0495670_0287176_112_678 188
671 3300046692 Ga0495671_0000492 Ga0495671_0000492_17194_17760 188
672 3300046692 Ga0495671_0022825 Ga0495671_0022825_209_775 188
673 3300046794 Ga0495589_0000059 Ga0495589_0000059_21736_22302 188
674 3300046810 Ga0495660_0000092 Ga0495660_0000092_71754_72320 188
675 3300046810 Ga0495660_0000583 Ga0495660_0000583_12861_13427 188
676 3300047318 Ga0495636_0000599 Ga0495636_0000599_7961_8527 188
677 3300047318 Ga0495636_0031233 Ga0495636_0031233_787_1353 188
678 3300047318 Ga0495636_0054110 Ga0495636_0054110_1006_1572 188
679 3300047320 Ga0495672_0000105 Ga0495672_0000105_122582_123148 188
680 3300047323 Ga0495683_0002566 Ga0495683_0002566_7720_8286 188
681 3300047446 Ga0495679_000004 Ga0495679_000004_245792_246358 188
682 3300047447 Ga0495685_088416 Ga0495685_088416_414_980 188
683 3300047447 Ga0495685_116030 Ga0495685_116030_188_754 188
684 3300047469 Ga0495673_0000004 Ga0495673_0000004_80892_81458 188
685 3300047469 Ga0495673_0000048 Ga0495673_0000048_46796_47362 188
686 3300047469 Ga0495673_0000902 Ga0495673_0000902_10243_10809 188
687 3300047472 Ga0495686_0001142 Ga0495686_0001142_18664_19230 188
688 3300047472 Ga0495686_0023097 Ga0495686_0023097_3377_3943 188
689 3300047472 Ga0495686_0024683 Ga0495686_0024683_1459_2025 188
690 3300047472 Ga0495686_0030760 Ga0495686_0030760_2834_3400 188
691 3300047472 Ga0495686_0055465 Ga0495686_0055465_1077_1643 188
692 3300048090 Ga0495615_0134486 Ga0495615_0134486_89_655 188
693 3300048903 Ga0496100_0119977 Ga0496100_0119977_396_962 188
694 3300048904 Ga0496101_0000755 Ga0496101_0000755_12841_13407 188
695 3300048906 Ga0496103_0483138 Ga0496103_0483138_28_594 188
696 3300048908 Ga0496105_0028104 Ga0496105_0028104_3846_4412 188
697 3300048910 Ga0496107_0057629 Ga0496107_0057629_231_797 188
698 3300048911 Ga0496108_0059524 Ga0496108_0059524_635_1201 188
699 3300048911 Ga0496108_0360155 Ga0496108_0360155_68_634 188
700 3300048912 Ga0496109_0667651 Ga0496109_0667651_28_594 188
701 3300048913 Ga0496110_0131824 Ga0496110_0131824_30_596 188
702 3300048913 Ga0496110_0245302 Ga0496110_0245302_203_769 188
703 3300048914 Ga0496111_0018274 Ga0496111_0018274_1554_2120 188
704 3300048915 Ga0496112_0496368 Ga0496112_0496368_561_1127 188
705 3300048916 Ga0496113_0138986 Ga0496113_0138986_394_960 188
706 3300048916 Ga0496113_0209540 Ga0496113_0209540_482_1048 188
707 3300048917 Ga0496114_0003583 Ga0496114_0003583_1515_2081 188
708 3300048917 Ga0496114_0135241 Ga0496114_0135241_1490_2056 188
709 3300048919 Ga0496116_0012613 Ga0496116_0012613_6146_6760 188
710 3300048919 Ga0496116_0092031 Ga0496116_0092031_773_1339 188
711 3300048920 Ga0496117_0001191 Ga0496117_0001191_27527_28093 188
712 3300048920 Ga0496117_0002104 Ga0496117_0002104_9525_10091 188
713 3300048921 Ga0496118_0000858 Ga0496118_0000858_11525_12091 188
714 3300048921 Ga0496118_0003962 Ga0496118_0003962_12340_12906 188
715 3300048921 Ga0496118_0006565 Ga0496118_0006565_5523_6089 188
716 3300048921 Ga0496118_0066272 Ga0496118_0066272_479_1045 188
717 3300048921 Ga0496118_0203986 Ga0496118_0203986_567_1133 188
718 3300048922 Ga0496119_0001416 Ga0496119_0001416_15615_16229 188
719 3300048922 Ga0496119_0002285 Ga0496119_0002285_9645_10211 188
720 3300048922 Ga0496119_0027194 Ga0496119_0027194_3357_3923 188
721 3300048923 Ga0496120_0000181 Ga0496120_0000181_95357_95971 188
722 3300048923 Ga0496120_0000676 Ga0496120_0000676_11049_11615 188
723 3300048924 Ga0496121_0002194 Ga0496121_0002194_14352_14918 188
724 3300048924 Ga0496121_0007169 Ga0496121_0007169_12372_12938 188
725 3300048924 Ga0496121_0007504 Ga0496121_0007504_6631_7197 188
726 3300048924 Ga0496121_0008475 Ga0496121_0008475_5095_5661 188
727 3300048924 Ga0496121_0033804 Ga0496121_0033804_2120_2734 188
728 3300048924 Ga0496121_0082866 Ga0496121_0082866_1807_2373 188
729 3300048925 Ga0496122_0000372 Ga0496122_0000372_89086_89652 188
730 3300048925 Ga0496122_0000901 Ga0496122_0000901_41669_42235 188
731 3300048925 Ga0496122_0012430 Ga0496122_0012430_5187_5753 188
732 3300048925 Ga0496122_0036868 Ga0496122_0036868_3335_3901 188
733 3300048925 Ga0496122_0069617 Ga0496122_0069617_64_630 188
734 3300048925 Ga0496122_0089106 Ga0496122_0089106_1118_1684 188
735 3300048926 Ga0496123_0000694 Ga0496123_0000694_6650_7216 188
736 3300048926 Ga0496123_0000727 Ga0496123_0000727_41935_42501 188
737 3300048926 Ga0496123_0004944 Ga0496123_0004944_8560_9126 188
738 3300048926 Ga0496123_0016723 Ga0496123_0016723_3366_3932 188
739 3300048926 Ga0496123_0018011 Ga0496123_0018011_3359_3925 188
740 3300048926 Ga0496123_0029353 Ga0496123_0029353_2835_3401 188
741 3300048926 Ga0496123_0127277 Ga0496123_0127277_565_1131 188
742 3300048927 Ga0496124_0000009 Ga0496124_0000009_424853_425419 188
743 3300048927 Ga0496124_0001061 Ga0496124_0001061_31822_32388 188
744 3300048927 Ga0496124_0004084 Ga0496124_0004084_6488_7054 188
745 3300048927 Ga0496124_0005543 Ga0496124_0005543_12887_13453 188
746 3300048927 Ga0496124_0009788 Ga0496124_0009788_5200_5766 188
747 3300048927 Ga0496124_0044030 Ga0496124_0044030_3216_3782 188
748 3300048927 Ga0496124_0057116 Ga0496124_0057116_1923_2489 188
749 3300048928 Ga0496125_0002711 Ga0496125_0002711_10438_11052 188
750 3300048928 Ga0496125_0004432 Ga0496125_0004432_7040_7654 188
751 3300048928 Ga0496125_0006197 Ga0496125_0006197_5200_5814 188
752 3300048928 Ga0496125_0016772 Ga0496125_0016772_2937_3503 188
753 3300048928 Ga0496125_0031061 Ga0496125_0031061_76_642 188
754 3300048928 Ga0496125_0248080 Ga0496125_0248080_444_1010 188
755 3300048929 Ga0496126_0004409 Ga0496126_0004409_11154_11768 188
756 3300048929 Ga0496126_0416307 Ga0496126_0416307_68_634 188
757 3300048929 Ga0496126_0667712 Ga0496126_0667712_39_605 188
758 3300049459 Ga0495678_000237 Ga0495678_000237_57978_58544 188
759 3300049460 Ga0495682_0001382 Ga0495682_0001382_1079_1645 188
760 3300049513 Ga0501290_001797 Ga0501290_001797_1388_1954 188
761 3300049523 Ga0501300_010663 Ga0501300_010663_226_792 188
762 3300049568 Ga0501031_0011773 Ga0501031_0011773_855_1421 188
763 3300049568 Ga0501031_0076495 Ga0501031_0076495_97_663 188
764 3300049569 Ga0501032_0024438 Ga0501032_0024438_1871_2437 188
765 3300049570 Ga0501033_0000506 Ga0501033_0000506_2141_2707 188
766 3300049571 Ga0501034_0000083 Ga0501034_0000083_49482_50048 188
767 3300049571 Ga0501034_0000091 Ga0501034_0000091_44179_44745 188
768 3300049571 Ga0501034_0001599 Ga0501034_0001599_3682_4248 188
769 3300049573 Ga0501037_0037418 Ga0501037_0037418_912_1478 188
770 3300049574 Ga0501038_0004860 Ga0501038_0004860_1110_1676 188
771 3300049574 Ga0501038_0059544 Ga0501038_0059544_2029_2595 188
772 3300049575 Ga0501039_0413023 Ga0501039_0413023_300_866 188
773 3300049579 Ga0501043_0003936 Ga0501043_0003936_4235_4801 188
774 3300049581 Ga0501047_0107738 Ga0501047_0107738_370_936 188
775 3300049589 Ga0501073_0034266 Ga0501073_0034266_201_767 188
776 3300049660 Ga0501216_042049 Ga0501216_042049_274_840 188
777 3300049663 Ga0501223_068512 Ga0501223_068512_71_637 188
778 3300049682 Ga0501252_018425 Ga0501252_018425_257_823 188
779 3300049690 Ga0501261_020923 Ga0501261_020923_100_666 188
780 3300049705 Ga0501225_0045815 Ga0501225_0045815_284_850 188
781 3300049708 Ga0501245_016371 Ga0501245_016371_381_947 188
782 3300049742 Ga0501080_0356841 Ga0501080_0356841_566_1132 188
783 3300049765 Ga0501268_072129 Ga0501268_072129_46_612 188
784 3300049822 Ga0501035_0085487 Ga0501035_0085487_118_684 188
785 3300049822 Ga0501035_0095998 Ga0501035_0095998_568_1134 188
786 3300049823 Ga0501044_0009743 Ga0501044_0009743_1813_2379 188
787 3300049823 Ga0501044_0714426 Ga0501044_0714426_101_667 188
788 3300050491 nmdc:mga00v17_227116_c1 nmdc:mga00v17_227116_c1_289_855 188
789 3300050491 nmdc:mga00v17_24698_c1 nmdc:mga00v17_24698_c1_945_1511 188
790 3300050491 nmdc:mga00v17_31031_c1 nmdc:mga00v17_31031_c1_428_994 188
791 3300050491 nmdc:mga00v17_6748_c1 nmdc:mga00v17_6748_c1_3390_3956 188
792 3300053087 Ga0500643_000108 Ga0500643_000108_74179_74745 188
793 3300053093 Ga0500651_0149916 Ga0500651_0149916_595_1161 188
794 3300053103 Ga0500555_000973 Ga0500555_000973_1106_1672 188
795 3300053108 Ga0500562_071166 Ga0500562_071166_149_715 188
796 3300053161 Ga0500634_0000098 Ga0500634_0000098_4488_5054 188
797 3300053730 Ga0500645_001933 Ga0500645_001933_958_1524 188
798 3300061719 Ga0466962_0003059 Ga0466962_0003059_388_954 188
799 iso_pu_bacteria 8021622325 8021624259 188
800 iso_pu_bacteria 8021648035 8021649094 188

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09285

Elong-fact-P_C

Elongation factor P, C-terminal

143

198

0.98

PF01132

EFP

Elongation factor P (EF-P) OB domain

88

126

0.94

PF08207

EFP_N

Elongation factor P (EF-P) KOW-like domain

21

80

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rji-assembly1.cif.gz_A x-ray structure of the elongation factor p of s. aureus 0.9011 1 187
6rji-assembly1.cif.gz_A x-ray structure of the elongation factor p of s. aureus 0.8918 1 187
5wxk-assembly1.cif.gz_B earp bound with domain i of ef-p 0.8899 1 63
4v6a-assembly2.cif.gz_CV structure of ef-p bound to the 70s ribosome. 0.8885 1 187
4v6a-assembly2.cif.gz_CV structure of ef-p bound to the 70s ribosome. 0.8792 1 187
ID Description Score Start End Superfamily
af_P0A6N8_1_64_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9621 2 62 2.30.30.30
5j3bA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9591 131 187 2.40.50.140
af_P0A6N8_132_190_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9368 131 188 2.40.50.140
af_Q557H6_34_95_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9342 1 63 2.30.30.30
af_P9WNM3_64_126_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9294 65 128 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A1V6J014-F1-model_v4 Elongation factor P-like protein 0.9467 64 187 GO:0003746
GO:0005737
GO:0043043
AF-A0A7X5SBV0-F1-model_v4 Elongation factor P-like protein YeiP 0.9381 59 188 GO:0003746
GO:0005737
GO:0043043
AF-A0A377CC18-F1-model_v4 Elongation factor P-like protein 0.9364 2 103 GO:0003746
GO:0005829
AF-A0A661ADR7-F1-model_v4 Elongation factor P 0.9356 64 187 GO:0003746
GO:0005737
GO:0043043
AF-A0A090S6D7-F1-model_v4 Translation elongation factor P-related protein 0.9313 67 187 GO:0003746
GO:0005737
GO:0043043

Feature Viewer

pLDDT pTM Quality
92.78 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map