F481391
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 800 | 421 | 725 | 186 |
Family's Representative Sequence
| Representative Sequence | 3300047472|Ga0495686_0000017|Ga0495686_0000017_156386_157009 |
| Length | 200 |
| Sequence | MAPCVSPRNNLLKKNSIEAMKASDVKKGNVVENDGTVYQVRDIERSSPSARGGNITYRFTLYSVPGNRKFDLSIRADDELKEVDLLRRAAKFSYMDGEAFVFMDDEDYTQYTLDAAVVGDNAGYVVIQVIDDAPVGLQVPSSVVLVVVDTAPEMKGSSATKRNKPARLSTGIEIQVPEYITNGEKVTVNTLTGEFSGRAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 3 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 4 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 5 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 6 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 7 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 8 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 9 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 10 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 11 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 12 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 13 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 14 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 15 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 16 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 17 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 18 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 19 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 20 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 21 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 22 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 23 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 24 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 25 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 26 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 27 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 28 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 29 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 30 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 31 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 32 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 33 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 34 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 35 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 36 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 37 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 38 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 39 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 40 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 41 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 42 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 43 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 44 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 45 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 46 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 47 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 48 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 49 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 50 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 51 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 52 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 53 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 54 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 55 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 56 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 57 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 58 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 59 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 60 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 61 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 62 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 63 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 64 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 65 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 66 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 67 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 68 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 69 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 70 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 71 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 72 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 73 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 74 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 75 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 76 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 77 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 78 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 79 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 80 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 81 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 82 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 83 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 84 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 85 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 86 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 87 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 88 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 89 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 90 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 91 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 92 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 94 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 96 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 98 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 99 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 107 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 114 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 115 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 116 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 117 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 118 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 123 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 125 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 126 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 127 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 128 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 129 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 130 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 131 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 132 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 133 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 134 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 135 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 136 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 149 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 151 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 152 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 153 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 154 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 155 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 167 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 170 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 171 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 172 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 173 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 191 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 246 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 250 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 251 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 252 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 253 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 254 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 255 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 256 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 257 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 258 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 259 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 260 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 261 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 262 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 263 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 264 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 265 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 266 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 267 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 268 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 269 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 270 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 271 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 272 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 273 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 274 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 275 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 276 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 277 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 278 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 280 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 281 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 282 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 284 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 285 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 286 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 287 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 288 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 289 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 290 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 291 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 292 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 293 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 294 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 295 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 296 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 297 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 298 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 299 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 300 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 301 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 302 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 303 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 304 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 305 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 306 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 307 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 308 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 309 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 310 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 311 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 353 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 354 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 355 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 356 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 357 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 360 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 361 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 362 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 363 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 364 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 365 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 366 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 367 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 368 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 369 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 370 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 371 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 372 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 373 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 374 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 375 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 376 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 379 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 380 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 398 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 399 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 400 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 401 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 402 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 403 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 405 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 408 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 409 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 410 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 411 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 412 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 413 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 414 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 415 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 416 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 417 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 418 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 419 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 420 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 421 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.5 |
| Metatranscriptomes | 0 |
| Isolates | 9.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 14.75 |
| Nodule | 0.12 |
| Rhizoplane | 4 |
| Rhizosphere | 65.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1819724 | 2162886007 | Bacteria | 3369 |
| 2 | JGI24736J21556_1013905 | 3300001904 | Bacteria | 1297 |
| 3 | JGI25152J39213_1000118 | 3300002773 | Bacteria | 55168 |
| 4 | JGI25152J39213_1020380 | 3300002773 | Bacteria | 1185 |
| 5 | JGI25150J39212_1000434 | 3300002774 | Bacteria | 18752 |
| 6 | JGI25151J46595_10000315 | 3300003187 | Bacteria | 52657 |
| 7 | JGI25151J46595_10103966 | 3300003187 | Bacteria | 758 |
| 8 | JGI25153J46596_10000167 | 3300003215 | Bacteria | 66040 |
| 9 | rootH1_10033715 | 3300003316 | Bacteria | 5415 |
| 10 | rootH1_10033715 | 3300003323 | Bacteria | 2049 |
| 11 | Ga0055526_1000182 | 3300003771 | Bacteria | 55008 |
| 12 | Ga0055526_1002395 | 3300003771 | Bacteria | 12700 |
| 13 | Ga0055537_1000091 | 3300003773 | Bacteria | 66379 |
| 14 | Ga0055537_1000136 | 3300003773 | Bacteria | 55008 |
| 15 | Ga0055524_1000254 | 3300003775 | Bacteria | 55008 |
| 16 | Ga0055524_1030331 | 3300003775 | Bacteria | 1579 |
| 17 | Ga0055536_1000812 | 3300003781 | Bacteria | 20671 |
| 18 | Ga0055536_1000925 | 3300003781 | Bacteria | 18922 |
| 19 | Ga0055536_1006090 | 3300003781 | Bacteria | 5716 |
| 20 | Ga0055536_1013569 | 3300003781 | Bacteria | 2925 |
| 21 | Ga0055536_1030512 | 3300003781 | Bacteria | 1429 |
| 22 | Ga0055534_1000043 | 3300003784 | Bacteria | 99338 |
| 23 | Ga0055534_1000137 | 3300003784 | Bacteria | 55008 |
| 24 | Ga0055528_1000087 | 3300003790 | Bacteria | 72896 |
| 25 | Ga0055528_1000169 | 3300003790 | Bacteria | 55008 |
| 26 | Ga0055530_10017857 | 3300003791 | Bacteria | 2207 |
| 27 | Ga0055540_1044902 | 3300003792 | Bacteria | 935 |
| 28 | Ga0055531_10001450 | 3300003794 | Bacteria | 17510 |
| 29 | Ga0055531_10004122 | 3300003794 | Bacteria | 8979 |
| 30 | Ga0055531_10004970 | 3300003794 | Bacteria | 7893 |
| 31 | Ga0055531_10007659 | 3300003794 | Bacteria | 5845 |
| 32 | Ga0055531_10007895 | 3300003794 | Bacteria | 5714 |
| 33 | Ga0055531_10012585 | 3300003794 | Bacteria | 3968 |
| 34 | Ga0055531_10030430 | 3300003794 | Bacteria | 1813 |
| 35 | Ga0058692_1000031 | 3300003856 | Bacteria | 188488 |
| 36 | Ga0058692_1000060 | 3300003856 | Bacteria | 98866 |
| 37 | Ga0065165_1000118 | 3300005262 | Bacteria | 134488 |
| 38 | Ga0065165_1022436 | 3300005262 | Bacteria | 2164 |
| 39 | Ga0065165_1051736 | 3300005262 | Bacteria | 1163 |
| 40 | Ga0065704_10070531 | 3300005289 | Bacteria | 21590 |
| 41 | Ga0065704_10079591 | 3300005289 | Bacteria | 4122 |
| 42 | Ga0065715_10050260 | 3300005293 | Bacteria | 956 |
| 43 | Ga0070658_10142010 | 3300005327 | Bacteria | 2006 |
| 44 | Ga0070658_10302455 | 3300005327 | Bacteria | 1364 |
| 45 | Ga0070683_101226924 | 3300005329 | Bacteria | 721 |
| 46 | Ga0070670_100012694 | 3300005331 | Bacteria | 7212 |
| 47 | Ga0070670_100121722 | 3300005331 | Bacteria | 2251 |
| 48 | Ga0068869_100091510 | 3300005334 | Bacteria | 2288 |
| 49 | Ga0068869_100722964 | 3300005334 | Bacteria | 851 |
| 50 | Ga0070666_10000844 | 3300005335 | Bacteria | 18583 |
| 51 | Ga0070680_100070391 | 3300005336 | Bacteria | 2873 |
| 52 | Ga0070680_100210961 | 3300005336 | Bacteria | 1638 |
| 53 | Ga0068868_100020407 | 3300005338 | Bacteria | 4977 |
| 54 | Ga0070660_100052790 | 3300005339 | Bacteria | 3134 |
| 55 | Ga0070660_100709462 | 3300005339 | Bacteria | 844 |
| 56 | Ga0070661_100124614 | 3300005344 | Bacteria | 1932 |
| 57 | Ga0070661_100539807 | 3300005344 | Bacteria | 937 |
| 58 | Ga0070661_100562343 | 3300005344 | Bacteria | 919 |
| 59 | Ga0070692_10304728 | 3300005345 | Bacteria | 974 |
| 60 | Ga0070668_100021352 | 3300005347 | Bacteria | 4890 |
| 61 | Ga0070668_100167532 | 3300005347 | Bacteria | 1787 |
| 62 | Ga0070668_100186338 | 3300005347 | Bacteria | 1698 |
| 63 | Ga0070668_100579678 | 3300005347 | Bacteria | 979 |
| 64 | Ga0070668_100625637 | 3300005347 | Bacteria | 944 |
| 65 | Ga0070671_100081121 | 3300005355 | Bacteria | 2712 |
| 66 | Ga0070671_100239338 | 3300005355 | Bacteria | 1541 |
| 67 | Ga0070674_100135692 | 3300005356 | Bacteria | 1840 |
| 68 | Ga0070673_100661858 | 3300005364 | Bacteria | 957 |
| 69 | Ga0070688_100747359 | 3300005365 | Bacteria | 761 |
| 70 | Ga0070659_100276854 | 3300005366 | Bacteria | 1395 |
| 71 | Ga0070667_100030697 | 3300005367 | Bacteria | 4482 |
| 72 | Ga0070667_100048471 | 3300005367 | Bacteria | 3575 |
| 73 | Ga0070667_100629183 | 3300005367 | Bacteria | 990 |
| 74 | Ga0070709_10478688 | 3300005434 | Bacteria | 942 |
| 75 | Ga0070711_100818808 | 3300005439 | Bacteria | 791 |
| 76 | Ga0070678_101138446 | 3300005456 | Bacteria | 722 |
| 77 | Ga0070662_100092034 | 3300005457 | Bacteria | 2278 |
| 78 | Ga0070662_100369198 | 3300005457 | Bacteria | 1179 |
| 79 | Ga0070681_10004840 | 3300005458 | Bacteria | 12907 |
| 80 | Ga0070681_10014094 | 3300005458 | Bacteria | 7956 |
| 81 | Ga0070681_10128362 | 3300005458 | Bacteria | 2468 |
| 82 | Ga0068867_100256876 | 3300005459 | Bacteria | 1423 |
| 83 | Ga0070685_10000546 | 3300005466 | Bacteria | 21084 |
| 84 | Ga0070679_100014695 | 3300005530 | Bacteria | 7525 |
| 85 | Ga0070679_100047097 | 3300005530 | Bacteria | 4299 |
| 86 | Ga0070679_100738042 | 3300005530 | Bacteria | 927 |
| 87 | Ga0068853_100024041 | 3300005539 | Bacteria | 5107 |
| 88 | Ga0068853_100036227 | 3300005539 | Bacteria | 4194 |
| 89 | Ga0070672_100002961 | 3300005543 | Bacteria | 10930 |
| 90 | Ga0070672_100008454 | 3300005543 | Bacteria | 7041 |
| 91 | Ga0070696_100026884 | 3300005546 | Bacteria | 3917 |
| 92 | Ga0070696_100084215 | 3300005546 | Bacteria | 2256 |
| 93 | Ga0070693_100019133 | 3300005547 | Bacteria | 3586 |
| 94 | Ga0070693_100236580 | 3300005547 | Bacteria | 1204 |
| 95 | Ga0070665_100007381 | 3300005548 | Bacteria | 11184 |
| 96 | Ga0070665_100094122 | 3300005548 | Bacteria | 3001 |
| 97 | Ga0070665_100117136 | 3300005548 | Bacteria | 2666 |
| 98 | Ga0070665_101345819 | 3300005548 | Bacteria | 724 |
| 99 | Ga0068855_100047003 | 3300005563 | Bacteria | 5101 |
| 100 | Ga0068855_100353373 | 3300005563 | Bacteria | 1619 |
| 101 | Ga0070664_100152562 | 3300005564 | Bacteria | 2040 |
| 102 | Ga0070664_101460634 | 3300005564 | Bacteria | 647 |
| 103 | Ga0068857_100243855 | 3300005577 | Bacteria | 1646 |
| 104 | Ga0068854_100012080 | 3300005578 | Bacteria | 5647 |
| 105 | Ga0068856_100682819 | 3300005614 | Bacteria | 1047 |
| 106 | Ga0068852_100154810 | 3300005616 | Bacteria | 2134 |
| 107 | Ga0068851_10001586 | 3300005834 | Bacteria | 9980 |
| 108 | Ga0068863_100252755 | 3300005841 | Bacteria | 1703 |
| 109 | Ga0068863_100316395 | 3300005841 | Bacteria | 1516 |
| 110 | Ga0068858_100032794 | 3300005842 | Bacteria | 4824 |
| 111 | Ga0068862_100546453 | 3300005844 | Bacteria | 1106 |
| 112 | Ga0068862_100879641 | 3300005844 | Bacteria | 880 |
| 113 | Ga0081539_10157391 | 3300005985 | Bacteria | 1086 |
| 114 | Ga0075364_10000075 | 3300006051 | Bacteria | 38780 |
| 115 | Ga0075364_10075928 | 3300006051 | Bacteria | 2217 |
| 116 | Ga0075364_10090167 | 3300006051 | Bacteria | 2033 |
| 117 | Ga0075364_10154064 | 3300006051 | Bacteria | 1549 |
| 118 | Ga0075364_10201042 | 3300006051 | Bacteria | 1350 |
| 119 | Ga0075369_10056644 | 3300006186 | Bacteria | 1704 |
| 120 | Ga0075369_10111897 | 3300006186 | Bacteria | 1231 |
| 121 | Ga0068865_100399013 | 3300006881 | Bacteria | 1126 |
| 122 | Ga0105251_10000364 | 3300009011 | Bacteria | 44484 |
| 123 | Ga0105244_10170837 | 3300009036 | Bacteria | 1034 |
| 124 | Ga0105244_10209024 | 3300009036 | Bacteria | 918 |
| 125 | Ga0105244_10289050 | 3300009036 | Bacteria | 760 |
| 126 | Ga0105240_10034195 | 3300009093 | Bacteria | 6559 |
| 127 | Ga0105245_10197244 | 3300009098 | Bacteria | 1932 |
| 128 | Ga0105247_10003765 | 3300009101 | Bacteria | 9838 |
| 129 | Ga0105243_10012792 | 3300009148 | Bacteria | 6338 |
| 130 | Ga0105243_10020218 | 3300009148 | Bacteria | 5048 |
| 131 | Ga0105241_10095021 | 3300009174 | Bacteria | 2359 |
| 132 | Ga0105241_10146228 | 3300009174 | Bacteria | 1929 |
| 133 | Ga0105242_10139482 | 3300009176 | Bacteria | 2102 |
| 134 | Ga0105248_10460750 | 3300009177 | Bacteria | 1433 |
| 135 | Ga0105248_11418510 | 3300009177 | Bacteria | 786 |
| 136 | Ga0105237_10446690 | 3300009545 | Bacteria | 1299 |
| 137 | Ga0105238_10606121 | 3300009551 | Bacteria | 1103 |
| 138 | Ga0105238_10923428 | 3300009551 | Bacteria | 892 |
| 139 | Ga0105249_10105989 | 3300009553 | Bacteria | 2651 |
| 140 | Ga0105249_10415622 | 3300009553 | Bacteria | 1378 |
| 141 | Ga0105032_108202 | 3300009979 | Bacteria | 862 |
| 142 | Ga0105239_10004720 | 3300010375 | Bacteria | 16183 |
| 143 | Ga0105239_10034421 | 3300010375 | Bacteria | 5562 |
| 144 | Ga0105239_10312027 | 3300010375 | Bacteria | 1773 |
| 145 | Ga0157337_1003328 | 3300012483 | Bacteria | 967 |
| 146 | Ga0157323_1009100 | 3300012495 | Bacteria | 754 |
| 147 | Ga0157347_1022160 | 3300012502 | Bacteria | 750 |
| 148 | Ga0157324_1009876 | 3300012506 | Bacteria | 797 |
| 149 | Ga0157326_1024241 | 3300012513 | Bacteria | 768 |
| 150 | Ga0157373_10160012 | 3300013100 | Bacteria | 1584 |
| 151 | Ga0157373_10476773 | 3300013100 | Bacteria | 900 |
| 152 | Ga0157371_10002405 | 3300013102 | Bacteria | 17908 |
| 153 | Ga0157371_10006531 | 3300013102 | Bacteria | 9596 |
| 154 | Ga0157371_10122281 | 3300013102 | Bacteria | 1851 |
| 155 | Ga0157371_10596638 | 3300013102 | Bacteria | 821 |
| 156 | Ga0157370_10000293 | 3300013104 | Bacteria | 63396 |
| 157 | Ga0157370_10025372 | 3300013104 | Bacteria | 5867 |
| 158 | Ga0157370_10117492 | 3300013104 | Bacteria | 2484 |
| 159 | Ga0157370_10383224 | 3300013104 | Bacteria | 1295 |
| 160 | Ga0157369_10000025 | 3300013105 | Bacteria | 225515 |
| 161 | Ga0157369_10001434 | 3300013105 | Bacteria | 29251 |
| 162 | Ga0157369_10041790 | 3300013105 | Bacteria | 5003 |
| 163 | Ga0157369_10093022 | 3300013105 | Bacteria | 3218 |
| 164 | Ga0157374_10003664 | 3300013296 | Bacteria | 12915 |
| 165 | Ga0157374_10067651 | 3300013296 | Bacteria | 3359 |
| 166 | Ga0157374_10386574 | 3300013296 | Bacteria | 1394 |
| 167 | Ga0157378_10059570 | 3300013297 | Bacteria | 3407 |
| 168 | Ga0163162_10281171 | 3300013306 | Bacteria | 1796 |
| 169 | Ga0163162_11111517 | 3300013306 | Bacteria | 896 |
| 170 | Ga0163162_11380824 | 3300013306 | Bacteria | 801 |
| 171 | Ga0157372_10188057 | 3300013307 | Bacteria | 2391 |
| 172 | Ga0157375_10124460 | 3300013308 | Bacteria | 2692 |
| 173 | Ga0157375_10800574 | 3300013308 | Bacteria | 1091 |
| 174 | Ga0157375_11095926 | 3300013308 | Bacteria | 932 |
| 175 | Ga0163163_11220843 | 3300014325 | Bacteria | 814 |
| 176 | Ga0157380_10374967 | 3300014326 | Bacteria | 1341 |
| 177 | Ga0157380_10661593 | 3300014326 | Bacteria | 1044 |
| 178 | Ga0157380_11366390 | 3300014326 | Bacteria | 758 |
| 179 | Ga0182008_10001118 | 3300014497 | Bacteria | 18460 |
| 180 | Ga0182008_10003258 | 3300014497 | Bacteria | 9900 |
| 181 | Ga0157379_10177029 | 3300014968 | Bacteria | 1926 |
| 182 | Ga0157376_10555963 | 3300014969 | Bacteria | 1136 |
| 183 | Ga0157376_11785452 | 3300014969 | Bacteria | 651 |
| 184 | Ga0182006_1000085 | 3300015261 | Bacteria | 117595 |
| 185 | Ga0182006_1001555 | 3300015261 | Bacteria | 13706 |
| 186 | Ga0182007_10000556 | 3300015262 | Bacteria | 22049 |
| 187 | Ga0182007_10014554 | 3300015262 | Bacteria | 2962 |
| 188 | Ga0182005_1000028 | 3300015265 | Bacteria | 221889 |
| 189 | Ga0182005_1000463 | 3300015265 | Bacteria | 21182 |
| 190 | Ga0182005_1001893 | 3300015265 | Bacteria | 7928 |
| 191 | Ga0182005_1004454 | 3300015265 | Bacteria | 4528 |
| 192 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 193 | Ga0163161_10001824 | 3300017792 | Bacteria | 15555 |
| 194 | Ga0163161_10149136 | 3300017792 | Bacteria | 1776 |
| 195 | Ga0163161_10241850 | 3300017792 | Bacteria | 1404 |
| 196 | Ga0209674_100933 | 3300025226 | Bacteria | 9345 |
| 197 | Ga0207427_103125 | 3300025231 | Bacteria | 3724 |
| 198 | Ga0209437_100224 | 3300025233 | Bacteria | 101515 |
| 199 | Ga0209437_100955 | 3300025233 | Bacteria | 10606 |
| 200 | Ga0209258_106928 | 3300025242 | Bacteria | 1722 |
| 201 | Ga0207425_1000097 | 3300025245 | Bacteria | 84719 |
| 202 | Ga0207425_1036230 | 3300025245 | Bacteria | 958 |
| 203 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 204 | Ga0209129_1000189 | 3300025258 | Bacteria | 84712 |
| 205 | Ga0209129_1002415 | 3300025258 | Bacteria | 9181 |
| 206 | Ga0209565_1000005 | 3300025263 | Bacteria | 947317 |
| 207 | Ga0209565_1000063 | 3300025263 | Bacteria | 183711 |
| 208 | Ga0209673_1000027 | 3300025273 | Bacteria | 360561 |
| 209 | Ga0209673_1000065 | 3300025273 | Bacteria | 252799 |
| 210 | Ga0209673_1003263 | 3300025273 | Bacteria | 9783 |
| 211 | Ga0209130_1009009 | 3300025284 | Bacteria | 2883 |
| 212 | Ga0209130_1011298 | 3300025284 | Bacteria | 2398 |
| 213 | Ga0209130_1024979 | 3300025284 | Bacteria | 1299 |
| 214 | Ga0209675_1000004 | 3300025291 | Bacteria | 947166 |
| 215 | Ga0209675_1000011 | 3300025291 | Bacteria | 520597 |
| 216 | Ga0209676_1000011 | 3300025292 | Bacteria | 860463 |
| 217 | Ga0209676_1000034 | 3300025292 | Bacteria | 460125 |
| 218 | Ga0209676_1000068 | 3300025292 | Bacteria | 314068 |
| 219 | Ga0209676_1000728 | 3300025292 | Bacteria | 45109 |
| 220 | Ga0209676_1000981 | 3300025292 | Bacteria | 34140 |
| 221 | Ga0209676_1003532 | 3300025292 | Bacteria | 9525 |
| 222 | Ga0209676_1006825 | 3300025292 | Bacteria | 5536 |
| 223 | Ga0209676_1008020 | 3300025292 | Bacteria | 4804 |
| 224 | Ga0209676_1009417 | 3300025292 | Bacteria | 4215 |
| 225 | Ga0209025_1000005 | 3300025294 | Bacteria | 1272149 |
| 226 | Ga0209025_1000054 | 3300025294 | Bacteria | 317002 |
| 227 | Ga0209025_1004511 | 3300025294 | Bacteria | 12025 |
| 228 | Ga0209025_1010913 | 3300025294 | Bacteria | 6080 |
| 229 | Ga0209564_1000050 | 3300025295 | Bacteria | 360560 |
| 230 | Ga0209564_1000433 | 3300025295 | Bacteria | 72594 |
| 231 | Ga0209564_1008048 | 3300025295 | Bacteria | 5283 |
| 232 | Ga0209564_1026629 | 3300025295 | Bacteria | 1904 |
| 233 | Ga0209758_1000062 | 3300025297 | Bacteria | 317002 |
| 234 | Ga0209758_1004731 | 3300025297 | Bacteria | 11083 |
| 235 | Ga0209758_1008133 | 3300025297 | Bacteria | 6894 |
| 236 | Ga0209758_1023839 | 3300025297 | Bacteria | 2750 |
| 237 | Ga0209050_1000239 | 3300025298 | Bacteria | 119530 |
| 238 | Ga0209050_1000599 | 3300025298 | Bacteria | 57405 |
| 239 | Ga0209050_1006127 | 3300025298 | Bacteria | 7253 |
| 240 | Ga0209256_1000031 | 3300025299 | Bacteria | 410189 |
| 241 | Ga0209256_1003080 | 3300025299 | Bacteria | 12238 |
| 242 | Ga0209256_1003541 | 3300025299 | Bacteria | 10843 |
| 243 | Ga0209256_1005136 | 3300025299 | Bacteria | 7741 |
| 244 | Ga0209256_1006995 | 3300025299 | Bacteria | 5737 |
| 245 | Ga0209256_1018166 | 3300025299 | Bacteria | 2300 |
| 246 | Ga0207426_1025885 | 3300025302 | Bacteria | 1972 |
| 247 | Ga0209051_1002354 | 3300025303 | Bacteria | 13679 |
| 248 | Ga0209051_1027400 | 3300025303 | Bacteria | 2272 |
| 249 | Ga0209257_1000014 | 3300025304 | Bacteria | 946850 |
| 250 | Ga0209257_1000263 | 3300025304 | Bacteria | 120530 |
| 251 | Ga0209257_1000283 | 3300025304 | Bacteria | 113507 |
| 252 | Ga0209257_1000645 | 3300025304 | Bacteria | 55704 |
| 253 | Ga0209257_1001034 | 3300025304 | Bacteria | 37233 |
| 254 | Ga0209257_1001651 | 3300025304 | Bacteria | 25402 |
| 255 | Ga0209257_1002860 | 3300025304 | Bacteria | 16121 |
| 256 | Ga0209257_1003306 | 3300025304 | Bacteria | 14041 |
| 257 | Ga0209257_1004492 | 3300025304 | Bacteria | 10753 |
| 258 | Ga0209257_1008923 | 3300025304 | Bacteria | 5518 |
| 259 | Ga0209257_1021546 | 3300025304 | Bacteria | 2336 |
| 260 | Ga0209257_1024761 | 3300025304 | Bacteria | 2068 |
| 261 | Ga0207655_1145642 | 3300025728 | Bacteria | 755 |
| 262 | Ga0207713_1000422 | 3300025735 | Bacteria | 44963 |
| 263 | Ga0207682_10152782 | 3300025893 | Bacteria | 1042 |
| 264 | Ga0207710_10013753 | 3300025900 | Bacteria | 3406 |
| 265 | Ga0207680_10005768 | 3300025903 | Bacteria | 5941 |
| 266 | Ga0207647_10000271 | 3300025904 | Bacteria | 42575 |
| 267 | Ga0207647_10000747 | 3300025904 | Bacteria | 25485 |
| 268 | Ga0207647_10004013 | 3300025904 | Bacteria | 10985 |
| 269 | Ga0207699_10461780 | 3300025906 | Bacteria | 912 |
| 270 | Ga0207705_10019748 | 3300025909 | Bacteria | 4818 |
| 271 | Ga0207705_10447987 | 3300025909 | Bacteria | 1001 |
| 272 | Ga0207654_10319341 | 3300025911 | Bacteria | 1061 |
| 273 | Ga0207707_10000374 | 3300025912 | Bacteria | 46934 |
| 274 | Ga0207707_10305064 | 3300025912 | Bacteria | 1376 |
| 275 | Ga0207695_10007273 | 3300025913 | Bacteria | 14139 |
| 276 | Ga0207695_10047399 | 3300025913 | Bacteria | 4549 |
| 277 | Ga0207695_10153096 | 3300025913 | Bacteria | 2243 |
| 278 | Ga0207695_10687301 | 3300025913 | Bacteria | 904 |
| 279 | Ga0207671_10001096 | 3300025914 | Bacteria | 32746 |
| 280 | Ga0207671_10034751 | 3300025914 | Bacteria | 3745 |
| 281 | Ga0207671_10406782 | 3300025914 | Bacteria | 1082 |
| 282 | Ga0207660_10048413 | 3300025917 | Bacteria | 3008 |
| 283 | Ga0207657_10011781 | 3300025919 | Bacteria | 8662 |
| 284 | Ga0207657_10077231 | 3300025919 | Bacteria | 2807 |
| 285 | Ga0207657_10293940 | 3300025919 | Bacteria | 1288 |
| 286 | Ga0207649_10225574 | 3300025920 | Bacteria | 1337 |
| 287 | Ga0207649_10631818 | 3300025920 | Bacteria | 826 |
| 288 | Ga0207652_10005403 | 3300025921 | Bacteria | 10367 |
| 289 | Ga0207652_10316830 | 3300025921 | Bacteria | 1408 |
| 290 | Ga0207652_10521960 | 3300025921 | Bacteria | 1068 |
| 291 | Ga0207681_10033056 | 3300025923 | Bacteria | 3390 |
| 292 | Ga0207681_10166007 | 3300025923 | Bacteria | 1669 |
| 293 | Ga0207681_10371081 | 3300025923 | Bacteria | 1150 |
| 294 | Ga0207694_10008972 | 3300025924 | Bacteria | 7548 |
| 295 | Ga0207694_10011861 | 3300025924 | Bacteria | 6572 |
| 296 | Ga0207694_10094964 | 3300025924 | Bacteria | 2356 |
| 297 | Ga0207650_10027823 | 3300025925 | Bacteria | 4050 |
| 298 | Ga0207650_10034031 | 3300025925 | Bacteria | 3694 |
| 299 | Ga0207650_10190209 | 3300025925 | Bacteria | 1640 |
| 300 | Ga0207659_10363646 | 3300025926 | Bacteria | 1203 |
| 301 | Ga0207687_10537290 | 3300025927 | Bacteria | 979 |
| 302 | Ga0207664_10000093 | 3300025929 | Bacteria | 81829 |
| 303 | Ga0207690_10002061 | 3300025932 | Bacteria | 12324 |
| 304 | Ga0207690_10014240 | 3300025932 | Bacteria | 4800 |
| 305 | Ga0207690_10019429 | 3300025932 | Bacteria | 4184 |
| 306 | Ga0207706_10006960 | 3300025933 | Bacteria | 10452 |
| 307 | Ga0207706_10030008 | 3300025933 | Bacteria | 4853 |
| 308 | Ga0207706_10575543 | 3300025933 | Bacteria | 968 |
| 309 | Ga0207709_10000632 | 3300025935 | Bacteria | 28799 |
| 310 | Ga0207709_10341998 | 3300025935 | Bacteria | 1126 |
| 311 | Ga0207669_10084647 | 3300025937 | Bacteria | 2044 |
| 312 | Ga0207691_10009924 | 3300025940 | Bacteria | 9141 |
| 313 | Ga0207691_10127613 | 3300025940 | Bacteria | 2249 |
| 314 | Ga0207711_10104880 | 3300025941 | Bacteria | 2506 |
| 315 | Ga0207689_10105299 | 3300025942 | Bacteria | 2317 |
| 316 | Ga0207689_10422731 | 3300025942 | Bacteria | 1112 |
| 317 | Ga0207679_10103132 | 3300025945 | Bacteria | 2235 |
| 318 | Ga0207679_10753021 | 3300025945 | Bacteria | 886 |
| 319 | Ga0207667_10000119 | 3300025949 | Bacteria | 124365 |
| 320 | Ga0207667_10006961 | 3300025949 | Bacteria | 13669 |
| 321 | Ga0207667_10095325 | 3300025949 | Bacteria | 3072 |
| 322 | Ga0207651_10398009 | 3300025960 | Bacteria | 1171 |
| 323 | Ga0207712_10004994 | 3300025961 | Bacteria | 8390 |
| 324 | Ga0207712_10183070 | 3300025961 | Bacteria | 1647 |
| 325 | Ga0207668_10007253 | 3300025972 | Bacteria | 6585 |
| 326 | Ga0207668_10091507 | 3300025972 | Bacteria | 2236 |
| 327 | Ga0207668_10259530 | 3300025972 | Bacteria | 1415 |
| 328 | Ga0207668_10876254 | 3300025972 | Bacteria | 798 |
| 329 | Ga0207640_10000185 | 3300025981 | Bacteria | 44459 |
| 330 | Ga0207640_10307927 | 3300025981 | Bacteria | 1256 |
| 331 | Ga0207658_10010233 | 3300025986 | Bacteria | 6371 |
| 332 | Ga0207658_10174676 | 3300025986 | Bacteria | 1773 |
| 333 | Ga0207703_10023236 | 3300026035 | Bacteria | 4870 |
| 334 | Ga0207639_10000216 | 3300026041 | Bacteria | 43037 |
| 335 | Ga0207639_10016756 | 3300026041 | Bacteria | 5191 |
| 336 | Ga0207639_11074441 | 3300026041 | Bacteria | 754 |
| 337 | Ga0207678_10143123 | 3300026067 | Bacteria | 2041 |
| 338 | Ga0207708_10763240 | 3300026075 | Bacteria | 830 |
| 339 | Ga0207702_10049155 | 3300026078 | Bacteria | 3558 |
| 340 | Ga0207702_10077061 | 3300026078 | Bacteria | 2883 |
| 341 | Ga0207641_10103684 | 3300026088 | Bacteria | 2510 |
| 342 | Ga0207648_10228570 | 3300026089 | Bacteria | 1654 |
| 343 | Ga0207648_10941347 | 3300026089 | Bacteria | 808 |
| 344 | Ga0207674_10329569 | 3300026116 | Bacteria | 1476 |
| 345 | Ga0207683_10235723 | 3300026121 | Bacteria | 1669 |
| 346 | Ga0207683_11257719 | 3300026121 | Bacteria | 686 |
| 347 | Ga0207698_10100669 | 3300026142 | Bacteria | 2394 |
| 348 | Ga0209371_1000004 | 3300027312 | Bacteria | 1098197 |
| 349 | Ga0209371_1000139 | 3300027312 | Bacteria | 120350 |
| 350 | Ga0209995_1038181 | 3300027471 | Bacteria | 809 |
| 351 | Ga0209982_1014132 | 3300027552 | Bacteria | 1205 |
| 352 | Ga0210002_1012531 | 3300027617 | Bacteria | 1319 |
| 353 | Ga0209971_1001630 | 3300027682 | Bacteria | 5551 |
| 354 | Ga0209813_10151705 | 3300027866 | Bacteria | 830 |
| 355 | Ga0209974_10010966 | 3300027876 | Bacteria | 3050 |
| 356 | Ga0209974_10107567 | 3300027876 | Bacteria | 979 |
| 357 | Ga0268266_10000013 | 3300028379 | Bacteria | 649715 |
| 358 | Ga0268266_10037476 | 3300028379 | Bacteria | 4131 |
| 359 | Ga0268266_10098205 | 3300028379 | Bacteria | 2576 |
| 360 | Ga0268266_11143513 | 3300028379 | Bacteria | 753 |
| 361 | Ga0268265_10078162 | 3300028380 | Bacteria | 2602 |
| 362 | Ga0268265_10850062 | 3300028380 | Bacteria | 893 |
| 363 | Ga0268256_1000005 | 3300030500 | Bacteria | 1082342 |
| 364 | Ga0268256_1000109 | 3300030500 | Bacteria | 120350 |
| 365 | Ga0316177_1014219 | 3300030731 | Bacteria | 6930 |
| 366 | Ga0316177_1060205 | 3300030731 | Bacteria | 1270 |
| 367 | Ga0316176_1137489 | 3300030732 | Bacteria | 4544 |
| 368 | Ga0316176_1150837 | 3300030732 | Bacteria | 1001 |
| 369 | Ga0314311_1207988 | 3300030733 | Bacteria | 1892 |
| 370 | Ga0316178_1111912 | 3300030735 | Bacteria | 1073 |
| 371 | Ga0316183_1000379 | 3300030742 | Bacteria | 918 |
| 372 | Ga0316183_1073792 | 3300030742 | Bacteria | 4285 |
| 373 | Ga0316182_1180068 | 3300030745 | Bacteria | 1827 |
| 374 | Ga0307513_10009900 | 3300031456 | Bacteria | 12027 |
| 375 | Ga0307513_10048166 | 3300031456 | Bacteria | 4628 |
| 376 | Ga0307509_10025648 | 3300031507 | Bacteria | 6580 |
| 377 | Ga0307408_100498030 | 3300031548 | Bacteria | 1066 |
| 378 | Ga0307405_10110996 | 3300031731 | Bacteria | 1858 |
| 379 | Ga0307413_10001980 | 3300031824 | Bacteria | 8131 |
| 380 | Ga0307413_10107096 | 3300031824 | Bacteria | 1862 |
| 381 | Ga0307413_10144252 | 3300031824 | Bacteria | 1650 |
| 382 | Ga0307413_10163763 | 3300031824 | Bacteria | 1565 |
| 383 | Ga0307413_10313494 | 3300031824 | Bacteria | 1195 |
| 384 | Ga0307413_10767900 | 3300031824 | Bacteria | 807 |
| 385 | Ga0307410_10220048 | 3300031852 | Bacteria | 1460 |
| 386 | Ga0307410_10646388 | 3300031852 | Bacteria | 887 |
| 387 | Ga0307406_10002948 | 3300031901 | Bacteria | 9270 |
| 388 | Ga0307406_10684692 | 3300031901 | Bacteria | 854 |
| 389 | Ga0307407_10348328 | 3300031903 | Bacteria | 1048 |
| 390 | Ga0307412_10013730 | 3300031911 | Bacteria | 4758 |
| 391 | Ga0307412_10111646 | 3300031911 | Bacteria | 1953 |
| 392 | Ga0307412_10384520 | 3300031911 | Bacteria | 1137 |
| 393 | Ga0307412_10789010 | 3300031911 | Bacteria | 823 |
| 394 | Ga0307416_100326325 | 3300032002 | Bacteria | 1540 |
| 395 | Ga0307414_10004260 | 3300032004 | Bacteria | 7761 |
| 396 | Ga0307414_10038814 | 3300032004 | Bacteria | 3201 |
| 397 | Ga0307414_10049127 | 3300032004 | Bacteria | 2915 |
| 398 | Ga0307414_10072191 | 3300032004 | Bacteria | 2492 |
| 399 | Ga0307414_10120628 | 3300032004 | Bacteria | 2015 |
| 400 | Ga0307414_10222988 | 3300032004 | Bacteria | 1549 |
| 401 | Ga0307414_10358111 | 3300032004 | Bacteria | 1254 |
| 402 | Ga0307414_10444790 | 3300032004 | Bacteria | 1135 |
| 403 | Ga0307414_10910785 | 3300032004 | Bacteria | 806 |
| 404 | Ga0307414_11164240 | 3300032004 | Bacteria | 713 |
| 405 | Ga0307411_10056428 | 3300032005 | Bacteria | 2589 |
| 406 | Ga0307411_10262120 | 3300032005 | Bacteria | 1365 |
| 407 | Ga0395899_0131662 | 3300037312 | Bacteria | 1785 |
| 408 | Ga0395900_0537431 | 3300037418 | Bacteria | 1115 |
| 409 | Ga0395898_0071216 | 3300037466 | Bacteria | 3360 |
| 410 | Ga0395898_0083391 | 3300037466 | Bacteria | 3081 |
| 411 | Ga0395905_0034860 | 3300037471 | Bacteria | 4724 |
| 412 | Ga0395905_0154998 | 3300037471 | Bacteria | 2154 |
| 413 | Ga0395905_0179496 | 3300037471 | Bacteria | 1988 |
| 414 | Ga0395905_0512794 | 3300037471 | Bacteria | 1099 |
| 415 | Ga0395905_0530077 | 3300037471 | Bacteria | 1078 |
| 416 | Ga0395901_0063541 | 3300038443 | Bacteria | 3842 |
| 417 | Ga0237819_00164 | 3300038705 | Bacteria | 24369 |
| 418 | Ga0237819_05553 | 3300038705 | Bacteria | 1967 |
| 419 | Ga0237816_00136 | 3300039145 | Bacteria | 5722 |
| 420 | Ga0436363_0039191 | 3300039450 | Bacteria | 1485 |
| 421 | Ga0439436_0028420 | 3300041404 | Bacteria | 1632 |
| 422 | Ga0439436_0037627 | 3300041404 | Bacteria | 1393 |
| 423 | Ga0439465_0000040 | 3300041413 | Bacteria | 26319 |
| 424 | Ga0439465_0000426 | 3300041413 | Bacteria | 12326 |
| 425 | Ga0439465_0000996 | 3300041413 | Bacteria | 9020 |
| 426 | Ga0439465_0002646 | 3300041413 | Bacteria | 5850 |
| 427 | Ga0439465_0015599 | 3300041413 | Bacteria | 2370 |
| 428 | Ga0451789_0368362 | 3300041443 | Bacteria | 912 |
| 429 | Ga0451789_0612999 | 3300041443 | Bacteria | 793 |
| 430 | Ga0451797_0221459 | 3300041453 | Bacteria | 933 |
| 431 | Ga0451797_0985516 | 3300041453 | Bacteria | 1075 |
| 432 | Ga0451798_0443259 | 3300041458 | Bacteria | 736 |
| 433 | Ga0451800_1224437 | 3300041459 | Bacteria | 3605 |
| 434 | Ga0451806_620901 | 3300041462 | Bacteria | 1847 |
| 435 | Ga0451804_0653443 | 3300041463 | Bacteria | 1087 |
| 436 | Ga0451807_1378455 | 3300041486 | Bacteria | 2158 |
| 437 | Ga0451807_2757209 | 3300041486 | Bacteria | 728 |
| 438 | Ga0451837_1411285 | 3300041494 | Bacteria | 1434 |
| 439 | Ga0451843_0119213 | 3300041509 | Bacteria | 2064 |
| 440 | Ga0451853_0695473 | 3300041512 | Bacteria | 2997 |
| 441 | Ga0451853_0982692 | 3300041512 | Bacteria | 1001 |
| 442 | Ga0451853_1076376 | 3300041512 | Bacteria | 1082 |
| 443 | Ga0451853_4052864 | 3300041512 | Bacteria | 925 |
| 444 | Ga0439433_0057639 | 3300041999 | Bacteria | 923 |
| 445 | Ga0439445_0008723 | 3300042004 | Bacteria | 2377 |
| 446 | Ga0439445_0037452 | 3300042004 | Bacteria | 1280 |
| 447 | Ga0439445_0057355 | 3300042004 | Bacteria | 1060 |
| 448 | Ga0439445_0130758 | 3300042004 | Bacteria | 724 |
| 449 | Ga0439432_005823 | 3300042006 | Bacteria | 4424 |
| 450 | Ga0439432_027180 | 3300042006 | Bacteria | 1870 |
| 451 | Ga0439449_0000134 | 3300042007 | Bacteria | 25113 |
| 452 | Ga0439449_0004260 | 3300042007 | Bacteria | 5532 |
| 453 | Ga0439449_0008474 | 3300042007 | Bacteria | 3907 |
| 454 | Ga0439449_0012239 | 3300042007 | Bacteria | 3224 |
| 455 | Ga0439449_0047789 | 3300042007 | Bacteria | 1584 |
| 456 | Ga0439449_0047882 | 3300042007 | Bacteria | 1583 |
| 457 | Ga0439455_0072954 | 3300042012 | Bacteria | 925 |
| 458 | Ga0439462_0080623 | 3300042015 | Bacteria | 889 |
| 459 | Ga0450908_000427 | 3300042184 | Bacteria | 8125 |
| 460 | Ga0450901_003256 | 3300042533 | Bacteria | 1704 |
| 461 | Ga0451577_0051922 | 3300042876 | Bacteria | 3660 |
| 462 | Ga0466969_0061651 | 3300044656 | Bacteria | 1821 |
| 463 | Ga0466972_0074236 | 3300044658 | Bacteria | 1620 |
| 464 | Ga0466982_0000003 | 3300044672 | Bacteria | 417243 |
| 465 | Ga0466982_0000061 | 3300044672 | Bacteria | 29699 |
| 466 | Ga0466965_0014613 | 3300044683 | Bacteria | 3717 |
| 467 | Ga0466966_0012748 | 3300044684 | Bacteria | 5572 |
| 468 | Ga0466964_0007101 | 3300044706 | Bacteria | 4189 |
| 469 | Ga0453684_0002948 | 3300044712 | Bacteria | 39915 |
| 470 | Ga0453684_0978132 | 3300044712 | Bacteria | 901 |
| 471 | Ga0466971_0054782 | 3300044719 | Bacteria | 1797 |
| 472 | Ga0466968_0002058 | 3300044735 | Bacteria | 7323 |
| 473 | Ga0466960_0004681 | 3300044901 | Bacteria | 5365 |
| 474 | Ga0466959_0054469 | 3300045049 | Bacteria | 2922 |
| 475 | Ga0451576_0000156 | 3300045051 | Bacteria | 174140 |
| 476 | Ga0466958_0034030 | 3300045836 | Bacteria | 3038 |
| 477 | Ga0466967_1183456 | 3300045976 | Bacteria | 762 |
| 478 | Ga0495617_001863 | 3300046452 | Bacteria | 8915 |
| 479 | Ga0495627_038463 | 3300046453 | Bacteria | 1479 |
| 480 | Ga0495627_046097 | 3300046453 | Bacteria | 1326 |
| 481 | Ga0495590_0015786 | 3300046457 | Bacteria | 2735 |
| 482 | Ga0495638_0000153 | 3300046460 | Bacteria | 109155 |
| 483 | Ga0495638_0007554 | 3300046460 | Bacteria | 7776 |
| 484 | Ga0495638_0019522 | 3300046460 | Bacteria | 4485 |
| 485 | Ga0495638_0142646 | 3300046460 | Bacteria | 1396 |
| 486 | Ga0495650_0002162 | 3300046471 | Bacteria | 16654 |
| 487 | Ga0495650_0220430 | 3300046471 | Bacteria | 653 |
| 488 | Ga0495584_0000598 | 3300046491 | Bacteria | 24294 |
| 489 | Ga0495585_0000104 | 3300046492 | Bacteria | 90097 |
| 490 | Ga0495585_0001499 | 3300046492 | Bacteria | 18186 |
| 491 | Ga0495607_0000088 | 3300046501 | Bacteria | 95203 |
| 492 | Ga0495607_0000120 | 3300046501 | Bacteria | 82667 |
| 493 | Ga0495607_0037418 | 3300046501 | Bacteria | 2915 |
| 494 | Ga0495606_0000338 | 3300046507 | Bacteria | 80898 |
| 495 | Ga0495606_0001054 | 3300046507 | Bacteria | 39827 |
| 496 | Ga0495606_0012571 | 3300046507 | Bacteria | 6776 |
| 497 | Ga0495606_0194423 | 3300046507 | Bacteria | 1160 |
| 498 | Ga0495610_0003255 | 3300046512 | Bacteria | 12817 |
| 499 | Ga0495610_0079918 | 3300046512 | Bacteria | 1504 |
| 500 | Ga0495616_0000086 | 3300046513 | Bacteria | 78187 |
| 501 | Ga0495616_0095615 | 3300046513 | Bacteria | 1400 |
| 502 | Ga0495616_0175926 | 3300046513 | Bacteria | 954 |
| 503 | Ga0495620_0000469 | 3300046515 | Bacteria | 26346 |
| 504 | Ga0495620_0000533 | 3300046515 | Bacteria | 24362 |
| 505 | Ga0495631_0000029 | 3300046518 | Bacteria | 86555 |
| 506 | Ga0495631_0000298 | 3300046518 | Bacteria | 34707 |
| 507 | Ga0495632_0000004 | 3300046519 | Bacteria | 381372 |
| 508 | Ga0495632_0003675 | 3300046519 | Bacteria | 10763 |
| 509 | Ga0495643_0002752 | 3300046522 | Bacteria | 13485 |
| 510 | Ga0495643_0083522 | 3300046522 | Bacteria | 1658 |
| 511 | Ga0495648_0000914 | 3300046524 | Bacteria | 30767 |
| 512 | Ga0495648_0008185 | 3300046524 | Bacteria | 8251 |
| 513 | Ga0495663_0000499 | 3300046525 | Bacteria | 14134 |
| 514 | Ga0495663_0002900 | 3300046525 | Bacteria | 5062 |
| 515 | Ga0495598_0008364 | 3300046537 | Bacteria | 2407 |
| 516 | Ga0495609_0003684 | 3300046538 | Bacteria | 8675 |
| 517 | Ga0495621_0001151 | 3300046539 | Bacteria | 6843 |
| 518 | Ga0495633_0005962 | 3300046558 | Bacteria | 7322 |
| 519 | Ga0495656_0003170 | 3300046615 | Bacteria | 5537 |
| 520 | Ga0495656_0015285 | 3300046615 | Bacteria | 2895 |
| 521 | Ga0495656_0133344 | 3300046615 | Bacteria | 1184 |
| 522 | Ga0495668_0000820 | 3300046616 | Bacteria | 35709 |
| 523 | Ga0495668_0001397 | 3300046616 | Bacteria | 23507 |
| 524 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 525 | Ga0495611_0000313 | 3300046648 | Bacteria | 32576 |
| 526 | Ga0495625_0000022 | 3300046660 | Bacteria | 278823 |
| 527 | Ga0495625_0003692 | 3300046660 | Bacteria | 14968 |
| 528 | Ga0495625_0068644 | 3300046660 | Bacteria | 2491 |
| 529 | Ga0495659_0236357 | 3300046664 | Bacteria | 758 |
| 530 | Ga0495661_0000733 | 3300046665 | Bacteria | 32129 |
| 531 | Ga0495661_0055636 | 3300046665 | Bacteria | 2371 |
| 532 | Ga0495670_0000495 | 3300046691 | Bacteria | 18653 |
| 533 | Ga0495670_0032130 | 3300046691 | Bacteria | 2609 |
| 534 | Ga0495670_0042012 | 3300046691 | Bacteria | 2281 |
| 535 | Ga0495670_0287176 | 3300046691 | Bacteria | 880 |
| 536 | Ga0495671_0000492 | 3300046692 | Bacteria | 30463 |
| 537 | Ga0495671_0022825 | 3300046692 | Bacteria | 3274 |
| 538 | Ga0495589_0000059 | 3300046794 | Bacteria | 107171 |
| 539 | Ga0495660_0000092 | 3300046810 | Bacteria | 96197 |
| 540 | Ga0495660_0000583 | 3300046810 | Bacteria | 29142 |
| 541 | Ga0495636_0000599 | 3300047318 | Bacteria | 13258 |
| 542 | Ga0495636_0031233 | 3300047318 | Bacteria | 2182 |
| 543 | Ga0495636_0054110 | 3300047318 | Bacteria | 1686 |
| 544 | Ga0495672_0000105 | 3300047320 | Bacteria | 133882 |
| 545 | Ga0495683_0002566 | 3300047323 | Bacteria | 10907 |
| 546 | Ga0495679_000004 | 3300047446 | Bacteria | 748056 |
| 547 | Ga0495685_088416 | 3300047447 | Bacteria | 1028 |
| 548 | Ga0495685_116030 | 3300047447 | Bacteria | 880 |
| 549 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 550 | Ga0495673_0000048 | 3300047469 | Bacteria | 265950 |
| 551 | Ga0495673_0000902 | 3300047469 | Bacteria | 27227 |
| 552 | Ga0495686_0000017 | 3300047472 | Bacteria | 435554 |
| 553 | Ga0495686_0001142 | 3300047472 | Bacteria | 31243 |
| 554 | Ga0495686_0023097 | 3300047472 | Bacteria | 4108 |
| 555 | Ga0495686_0024683 | 3300047472 | Bacteria | 3946 |
| 556 | Ga0495686_0030760 | 3300047472 | Bacteria | 3485 |
| 557 | Ga0495686_0055465 | 3300047472 | Bacteria | 2478 |
| 558 | Ga0495615_0134486 | 3300048090 | Bacteria | 725 |
| 559 | Ga0496100_0119977 | 3300048903 | Bacteria | 1838 |
| 560 | Ga0496101_0000755 | 3300048904 | Bacteria | 19172 |
| 561 | Ga0496102_0267651 | 3300048905 | Bacteria | 1611 |
| 562 | Ga0496103_0481785 | 3300048906 | Bacteria | 795 |
| 563 | Ga0496103_0483138 | 3300048906 | Bacteria | 793 |
| 564 | Ga0496105_0028104 | 3300048908 | Bacteria | 4600 |
| 565 | Ga0496106_0000509 | 3300048909 | Bacteria | 27515 |
| 566 | Ga0496106_0018214 | 3300048909 | Bacteria | 5193 |
| 567 | Ga0496107_0057629 | 3300048910 | Bacteria | 2808 |
| 568 | Ga0496108_0059524 | 3300048911 | Bacteria | 3212 |
| 569 | Ga0496108_0360155 | 3300048911 | Bacteria | 1269 |
| 570 | Ga0496109_0667651 | 3300048912 | Bacteria | 976 |
| 571 | Ga0496110_0131824 | 3300048913 | Bacteria | 2257 |
| 572 | Ga0496110_0245302 | 3300048913 | Bacteria | 1630 |
| 573 | Ga0496111_0018274 | 3300048914 | Bacteria | 4854 |
| 574 | Ga0496112_0082804 | 3300048915 | Bacteria | 3173 |
| 575 | Ga0496112_0496368 | 3300048915 | Bacteria | 1156 |
| 576 | Ga0496113_0138986 | 3300048916 | Bacteria | 1910 |
| 577 | Ga0496113_0209540 | 3300048916 | Bacteria | 1551 |
| 578 | Ga0496114_0003583 | 3300048917 | Bacteria | 11930 |
| 579 | Ga0496114_0135241 | 3300048917 | Bacteria | 2131 |
| 580 | Ga0496115_0000073 | 3300048918 | Bacteria | 90289 |
| 581 | Ga0496116_0012613 | 3300048919 | Bacteria | 6884 |
| 582 | Ga0496116_0092031 | 3300048919 | Bacteria | 1840 |
| 583 | Ga0496116_0244668 | 3300048919 | Bacteria | 898 |
| 584 | Ga0496116_0258762 | 3300048919 | Bacteria | 860 |
| 585 | Ga0496117_0001191 | 3300048920 | Bacteria | 39121 |
| 586 | Ga0496117_0002104 | 3300048920 | Bacteria | 26184 |
| 587 | Ga0496117_0027633 | 3300048920 | Bacteria | 4414 |
| 588 | Ga0496117_0142236 | 3300048920 | Bacteria | 1434 |
| 589 | Ga0496117_0174406 | 3300048920 | Bacteria | 1244 |
| 590 | Ga0496118_0000858 | 3300048921 | Bacteria | 48244 |
| 591 | Ga0496118_0003962 | 3300048921 | Bacteria | 18085 |
| 592 | Ga0496118_0003986 | 3300048921 | Bacteria | 17999 |
| 593 | Ga0496118_0006565 | 3300048921 | Bacteria | 12718 |
| 594 | Ga0496118_0012772 | 3300048921 | Bacteria | 8021 |
| 595 | Ga0496118_0041177 | 3300048921 | Bacteria | 3661 |
| 596 | Ga0496118_0066272 | 3300048921 | Bacteria | 2637 |
| 597 | Ga0496118_0203986 | 3300048921 | Bacteria | 1167 |
| 598 | Ga0496119_0001416 | 3300048922 | Bacteria | 29034 |
| 599 | Ga0496119_0002285 | 3300048922 | Bacteria | 21233 |
| 600 | Ga0496119_0027194 | 3300048922 | Bacteria | 3940 |
| 601 | Ga0496120_0000181 | 3300048923 | Bacteria | 107114 |
| 602 | Ga0496120_0000676 | 3300048923 | Bacteria | 50058 |
| 603 | Ga0496121_0000045 | 3300048924 | Bacteria | 336130 |
| 604 | Ga0496121_0002194 | 3300048924 | Bacteria | 30543 |
| 605 | Ga0496121_0007169 | 3300048924 | Bacteria | 13510 |
| 606 | Ga0496121_0007504 | 3300048924 | Bacteria | 13160 |
| 607 | Ga0496121_0008475 | 3300048924 | Bacteria | 12069 |
| 608 | Ga0496121_0033804 | 3300048924 | Bacteria | 4618 |
| 609 | Ga0496121_0082866 | 3300048924 | Bacteria | 2533 |
| 610 | Ga0496122_0000372 | 3300048925 | Bacteria | 96314 |
| 611 | Ga0496122_0000901 | 3300048925 | Bacteria | 54955 |
| 612 | Ga0496122_0012430 | 3300048925 | Bacteria | 8476 |
| 613 | Ga0496122_0024918 | 3300048925 | Bacteria | 5220 |
| 614 | Ga0496122_0036868 | 3300048925 | Bacteria | 3945 |
| 615 | Ga0496122_0069617 | 3300048925 | Bacteria | 2519 |
| 616 | Ga0496122_0089106 | 3300048925 | Bacteria | 2111 |
| 617 | Ga0496123_0000694 | 3300048926 | Bacteria | 55393 |
| 618 | Ga0496123_0000727 | 3300048926 | Bacteria | 53518 |
| 619 | Ga0496123_0004944 | 3300048926 | Bacteria | 13665 |
| 620 | Ga0496123_0010650 | 3300048926 | Bacteria | 8092 |
| 621 | Ga0496123_0016723 | 3300048926 | Bacteria | 5938 |
| 622 | Ga0496123_0018011 | 3300048926 | Bacteria | 5649 |
| 623 | Ga0496123_0029353 | 3300048926 | Bacteria | 4051 |
| 624 | Ga0496123_0046163 | 3300048926 | Bacteria | 2957 |
| 625 | Ga0496123_0127277 | 3300048926 | Bacteria | 1419 |
| 626 | Ga0496124_0000009 | 3300048927 | Bacteria | 734820 |
| 627 | Ga0496124_0001044 | 3300048927 | Bacteria | 43754 |
| 628 | Ga0496124_0001061 | 3300048927 | Bacteria | 43394 |
| 629 | Ga0496124_0001822 | 3300048927 | Bacteria | 29452 |
| 630 | Ga0496124_0004084 | 3300048927 | Bacteria | 17267 |
| 631 | Ga0496124_0005543 | 3300048927 | Bacteria | 14139 |
| 632 | Ga0496124_0009788 | 3300048927 | Bacteria | 9808 |
| 633 | Ga0496124_0044030 | 3300048927 | Bacteria | 3832 |
| 634 | Ga0496124_0057116 | 3300048927 | Bacteria | 3290 |
| 635 | Ga0496125_0002711 | 3300048928 | Bacteria | 22502 |
| 636 | Ga0496125_0004432 | 3300048928 | Bacteria | 16200 |
| 637 | Ga0496125_0006197 | 3300048928 | Bacteria | 13028 |
| 638 | Ga0496125_0016772 | 3300048928 | Bacteria | 7021 |
| 639 | Ga0496125_0027468 | 3300048928 | Bacteria | 5157 |
| 640 | Ga0496125_0031061 | 3300048928 | Bacteria | 4767 |
| 641 | Ga0496125_0248080 | 3300048928 | Bacteria | 1125 |
| 642 | Ga0496126_0000169 | 3300048929 | Bacteria | 150322 |
| 643 | Ga0496126_0004409 | 3300048929 | Bacteria | 16857 |
| 644 | Ga0496126_0047949 | 3300048929 | Bacteria | 3909 |
| 645 | Ga0496126_0416307 | 3300048929 | Bacteria | 1087 |
| 646 | Ga0496126_0667712 | 3300048929 | Bacteria | 811 |
| 647 | Ga0495678_000237 | 3300049459 | Bacteria | 62286 |
| 648 | Ga0495682_0001382 | 3300049460 | Bacteria | 13255 |
| 649 | Ga0501290_001797 | 3300049513 | Bacteria | 2850 |
| 650 | Ga0501300_010663 | 3300049523 | Bacteria | 1340 |
| 651 | Ga0501031_0011773 | 3300049568 | Bacteria | 5707 |
| 652 | Ga0501031_0076495 | 3300049568 | Bacteria | 2180 |
| 653 | Ga0501031_0326141 | 3300049568 | Bacteria | 994 |
| 654 | Ga0501032_0024438 | 3300049569 | Bacteria | 4172 |
| 655 | Ga0501032_0146126 | 3300049569 | Bacteria | 1556 |
| 656 | Ga0501033_0000506 | 3300049570 | Bacteria | 36672 |
| 657 | Ga0501033_0027175 | 3300049570 | Bacteria | 4303 |
| 658 | Ga0501033_0307729 | 3300049570 | Bacteria | 1114 |
| 659 | Ga0501033_0657475 | 3300049570 | Bacteria | 715 |
| 660 | Ga0501034_0000083 | 3300049571 | Bacteria | 169656 |
| 661 | Ga0501034_0000091 | 3300049571 | Bacteria | 164456 |
| 662 | Ga0501034_0001599 | 3300049571 | Bacteria | 29470 |
| 663 | Ga0501034_0527303 | 3300049571 | Bacteria | 1092 |
| 664 | Ga0501034_1163558 | 3300049571 | Bacteria | 651 |
| 665 | Ga0501036_0039556 | 3300049572 | Bacteria | 3990 |
| 666 | Ga0501037_0037418 | 3300049573 | Bacteria | 3577 |
| 667 | Ga0501037_0393202 | 3300049573 | Bacteria | 951 |
| 668 | Ga0501038_0004860 | 3300049574 | Bacteria | 12487 |
| 669 | Ga0501038_0027114 | 3300049574 | Bacteria | 5099 |
| 670 | Ga0501038_0059544 | 3300049574 | Bacteria | 3271 |
| 671 | Ga0501038_0280711 | 3300049574 | Bacteria | 1311 |
| 672 | Ga0501039_0260499 | 3300049575 | Bacteria | 1363 |
| 673 | Ga0501039_0413023 | 3300049575 | Bacteria | 1060 |
| 674 | Ga0501039_0532086 | 3300049575 | Bacteria | 922 |
| 675 | Ga0501042_0336236 | 3300049578 | Bacteria | 1092 |
| 676 | Ga0501043_0003936 | 3300049579 | Bacteria | 12179 |
| 677 | Ga0501043_0010778 | 3300049579 | Bacteria | 7159 |
| 678 | Ga0501043_0222098 | 3300049579 | Bacteria | 1461 |
| 679 | Ga0501046_0033161 | 3300049580 | Bacteria | 4175 |
| 680 | Ga0501046_0424874 | 3300049580 | Bacteria | 958 |
| 681 | Ga0501047_0002672 | 3300049581 | Bacteria | 16964 |
| 682 | Ga0501047_0107738 | 3300049581 | Bacteria | 2668 |
| 683 | Ga0501047_0353300 | 3300049581 | Bacteria | 1306 |
| 684 | Ga0501047_0407320 | 3300049581 | Bacteria | 1192 |
| 685 | Ga0501048_0318237 | 3300049582 | Bacteria | 1108 |
| 686 | Ga0501069_0005665 | 3300049585 | Bacteria | 6505 |
| 687 | Ga0501069_0617578 | 3300049585 | Bacteria | 651 |
| 688 | Ga0501070_0000587 | 3300049586 | Bacteria | 33165 |
| 689 | Ga0501070_0005501 | 3300049586 | Bacteria | 10807 |
| 690 | Ga0501073_0034266 | 3300049589 | Bacteria | 3614 |
| 691 | Ga0501073_0111420 | 3300049589 | Bacteria | 1898 |
| 692 | Ga0501074_0012874 | 3300049590 | Bacteria | 6082 |
| 693 | Ga0501216_042049 | 3300049660 | Bacteria | 877 |
| 694 | Ga0501223_068512 | 3300049663 | Bacteria | 699 |
| 695 | Ga0501252_018425 | 3300049682 | Bacteria | 894 |
| 696 | Ga0501261_020923 | 3300049690 | Bacteria | 938 |
| 697 | Ga0501225_0045815 | 3300049705 | Bacteria | 1211 |
| 698 | Ga0501245_016371 | 3300049708 | Bacteria | 1124 |
| 699 | Ga0501080_0010284 | 3300049742 | Bacteria | 8554 |
| 700 | Ga0501080_0356841 | 3300049742 | Bacteria | 1319 |
| 701 | Ga0501080_0456946 | 3300049742 | Bacteria | 1144 |
| 702 | Ga0501080_0618989 | 3300049742 | Bacteria | 960 |
| 703 | Ga0501268_072129 | 3300049765 | Bacteria | 700 |
| 704 | Ga0501035_0021930 | 3300049822 | Bacteria | 5868 |
| 705 | Ga0501035_0085487 | 3300049822 | Bacteria | 2780 |
| 706 | Ga0501035_0095998 | 3300049822 | Bacteria | 2605 |
| 707 | Ga0501035_0125501 | 3300049822 | Bacteria | 2240 |
| 708 | Ga0501044_0009743 | 3300049823 | Bacteria | 10451 |
| 709 | Ga0501044_0019975 | 3300049823 | Bacteria | 7153 |
| 710 | Ga0501044_0057862 | 3300049823 | Bacteria | 3977 |
| 711 | Ga0501044_0253846 | 3300049823 | Bacteria | 1698 |
| 712 | Ga0501044_0714426 | 3300049823 | Bacteria | 887 |
| 713 | nmdc:mga00v17_227116_c1 | 3300050491 | Bacteria | 1209 |
| 714 | nmdc:mga00v17_24698_c1 | 3300050491 | Bacteria | 3488 |
| 715 | nmdc:mga00v17_31031_c1 | 3300050491 | Bacteria | 3149 |
| 716 | nmdc:mga00v17_6748_c1 | 3300050491 | Bacteria | 6099 |
| 717 | nmdc:mga0sz30_4265_c1 | 3300050516 | Bacteria | 2854 |
| 718 | Ga0500643_000108 | 3300053087 | Bacteria | 86547 |
| 719 | Ga0500651_0149916 | 3300053093 | Bacteria | 1401 |
| 720 | Ga0500555_000973 | 3300053103 | Bacteria | 9908 |
| 721 | Ga0500562_071166 | 3300053108 | Bacteria | 938 |
| 722 | Ga0500600_0123028 | 3300053149 | Bacteria | 1334 |
| 723 | Ga0500634_0000098 | 3300053161 | Bacteria | 34065 |
| 724 | Ga0500645_001933 | 3300053730 | Bacteria | 9842 |
| 725 | Ga0466962_0003059 | 3300061719 | Bacteria | 7969 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005367 | Ga0070667_100048471 | Ga0070667_1000484713 | 160 |
| 2 | 3300009093 | Ga0105240_10034195 | Ga0105240_100341957 | 160 |
| 3 | 3300009174 | Ga0105241_10146228 | Ga0105241_101462283 | 160 |
| 4 | 3300014968 | Ga0157379_10177029 | Ga0157379_101770292 | 160 |
| 5 | 3300025911 | Ga0207654_10319341 | Ga0207654_103193412 | 160 |
| 6 | 3300025913 | Ga0207695_10153096 | Ga0207695_101530962 | 160 |
| 7 | 3300025986 | Ga0207658_10174676 | Ga0207658_101746762 | 160 |
| 8 | 3300005466 | Ga0070685_10000546 | Ga0070685_1000054613 | 162 |
| 9 | 3300005327 | Ga0070658_10302455 | Ga0070658_103024552 | 163 |
| 10 | 3300005334 | Ga0068869_100722964 | Ga0068869_1007229642 | 163 |
| 11 | 3300005335 | Ga0070666_10000844 | Ga0070666_1000084410 | 163 |
| 12 | 3300005338 | Ga0068868_100020407 | Ga0068868_1000204074 | 163 |
| 13 | 3300005344 | Ga0070661_100124614 | Ga0070661_1001246142 | 163 |
| 14 | 3300005347 | Ga0070668_100579678 | Ga0070668_1005796782 | 163 |
| 15 | 3300005367 | Ga0070667_100030697 | Ga0070667_1000306972 | 163 |
| 16 | 3300005457 | Ga0070662_100092034 | Ga0070662_1000920343 | 163 |
| 17 | 3300005459 | Ga0068867_100256876 | Ga0068867_1002568763 | 163 |
| 18 | 3300005539 | Ga0068853_100036227 | Ga0068853_1000362275 | 163 |
| 19 | 3300005548 | Ga0070665_100007381 | Ga0070665_1000073815 | 163 |
| 20 | 3300005563 | Ga0068855_100353373 | Ga0068855_1003533733 | 163 |
| 21 | 3300005578 | Ga0068854_100012080 | Ga0068854_1000120803 | 163 |
| 22 | 3300005614 | Ga0068856_100682819 | Ga0068856_1006828192 | 163 |
| 23 | 3300005616 | Ga0068852_100154810 | Ga0068852_1001548102 | 163 |
| 24 | 3300005834 | Ga0068851_10001586 | Ga0068851_100015867 | 163 |
| 25 | 3300005841 | Ga0068863_100316395 | Ga0068863_1003163952 | 163 |
| 26 | 3300005842 | Ga0068858_100032794 | Ga0068858_1000327944 | 163 |
| 27 | 3300006881 | Ga0068865_100399013 | Ga0068865_1003990132 | 163 |
| 28 | 3300009174 | Ga0105241_10095021 | Ga0105241_100950213 | 163 |
| 29 | 3300009176 | Ga0105242_10139482 | Ga0105242_101394822 | 163 |
| 30 | 3300009177 | Ga0105248_10460750 | Ga0105248_104607503 | 163 |
| 31 | 3300009553 | Ga0105249_10415622 | Ga0105249_104156223 | 163 |
| 32 | 3300013105 | Ga0157369_10041790 | Ga0157369_100417902 | 163 |
| 33 | 3300013296 | Ga0157374_10067651 | Ga0157374_100676514 | 163 |
| 34 | 3300013307 | Ga0157372_10188057 | Ga0157372_101880572 | 163 |
| 35 | 3300014325 | Ga0163163_11220843 | Ga0163163_112208432 | 163 |
| 36 | 3300025903 | Ga0207680_10005768 | Ga0207680_100057685 | 163 |
| 37 | 3300025904 | Ga0207647_10000271 | Ga0207647_1000027133 | 163 |
| 38 | 3300025913 | Ga0207695_10047399 | Ga0207695_100473995 | 163 |
| 39 | 3300025914 | Ga0207671_10034751 | Ga0207671_100347514 | 163 |
| 40 | 3300025924 | Ga0207694_10008972 | Ga0207694_100089725 | 163 |
| 41 | 3300025933 | Ga0207706_10006960 | Ga0207706_100069603 | 163 |
| 42 | 3300025942 | Ga0207689_10422731 | Ga0207689_104227312 | 163 |
| 43 | 3300025961 | Ga0207712_10004994 | Ga0207712_100049945 | 163 |
| 44 | 3300025972 | Ga0207668_10876254 | Ga0207668_108762542 | 163 |
| 45 | 3300025986 | Ga0207658_10010233 | Ga0207658_100102336 | 163 |
| 46 | 3300026035 | Ga0207703_10023236 | Ga0207703_100232364 | 163 |
| 47 | 3300026041 | Ga0207639_10000216 | Ga0207639_1000021632 | 163 |
| 48 | 3300026067 | Ga0207678_10143123 | Ga0207678_101431232 | 163 |
| 49 | 3300026078 | Ga0207702_10049155 | Ga0207702_100491554 | 163 |
| 50 | 3300026089 | Ga0207648_10228570 | Ga0207648_102285702 | 163 |
| 51 | 3300026142 | Ga0207698_10100669 | Ga0207698_101006694 | 163 |
| 52 | 3300028379 | Ga0268266_10000013 | Ga0268266_10000013529 | 163 |
| 53 | 3300001904 | JGI24736J21556_1013905 | JGI24736J21556_10139051 | 165 |
| 54 | 3300013104 | Ga0157370_10025372 | Ga0157370_100253726 | 165 |
| 55 | 3300013105 | Ga0157369_10001434 | Ga0157369_100014346 | 165 |
| 56 | 3300025904 | Ga0207647_10000747 | Ga0207647_100007479 | 165 |
| 57 | 3300048919 | Ga0496116_0244668 | Ga0496116_0244668_250_813 | 165 |
| 58 | 3300048920 | Ga0496117_0027633 | Ga0496117_0027633_2050_2613 | 165 |
| 59 | 3300048921 | Ga0496118_0003986 | Ga0496118_0003986_4921_5484 | 165 |
| 60 | 3300048926 | Ga0496123_0046163 | Ga0496123_0046163_966_1529 | 165 |
| 61 | 3300048928 | Ga0496125_0027468 | Ga0496125_0027468_4304_4867 | 165 |
| 62 | 3300048909 | Ga0496106_0018214 | Ga0496106_0018214_2272_2835 | 166 |
| 63 | 3300048924 | Ga0496121_0000045 | Ga0496121_0000045_318046_318609 | 166 |
| 64 | 3300048925 | Ga0496122_0024918 | Ga0496122_0024918_1002_1565 | 166 |
| 65 | 3300048929 | Ga0496126_0047949 | Ga0496126_0047949_154_717 | 166 |
| 66 | 3300049580 | Ga0501046_0424874 | Ga0501046_0424874_383_946 | 175 |
| 67 | 3300049742 | Ga0501080_0456946 | Ga0501080_0456946_261_824 | 175 |
| 68 | 3300003187 | JGI25151J46595_10103966 | JGI25151J46595_101039661 | 178 |
| 69 | 3300003781 | Ga0055536_1006090 | Ga0055536_10060903 | 178 |
| 70 | 3300025292 | Ga0209676_1000728 | Ga0209676_100072825 | 178 |
| 71 | 3300025294 | Ga0209025_1010913 | Ga0209025_10109134 | 178 |
| 72 | 3300048915 | Ga0496112_0082804 | Ga0496112_0082804_1191_1727 | 178 |
| 73 | 3300048909 | Ga0496106_0000509 | Ga0496106_0000509_8124_8690 | 179 |
| 74 | 3300047472 | Ga0495686_0000017 | Ga0495686_0000017_156386_157009 | 181 |
| 75 | 3300048905 | Ga0496102_0267651 | Ga0496102_0267651_979_1545 | 181 |
| 76 | 3300048920 | Ga0496117_0142236 | Ga0496117_0142236_581_1147 | 181 |
| 77 | 3300048921 | Ga0496118_0041177 | Ga0496118_0041177_2709_3275 | 181 |
| 78 | 3300041453 | Ga0451797_0221459 | Ga0451797_0221459_286_849 | 182 |
| 79 | 3300025292 | Ga0209676_1008020 | Ga0209676_10080203 | 183 |
| 80 | 3300027471 | Ga0209995_1038181 | Ga0209995_10381811 | 183 |
| 81 | iso_pu_bacteria | 2524614729 | 2525555729 | 183 |
| 82 | iso_pu_bacteria | 2627854209 | 2630650743 | 183 |
| 83 | iso_pu_bacteria | 2643221562 | 2643830324 | 183 |
| 84 | iso_pu_bacteria | 2643221577 | 2643894886 | 183 |
| 85 | iso_pu_bacteria | 2643221685 | 2644477045 | 183 |
| 86 | iso_pu_bacteria | 2842914999 | 2842918535 | 183 |
| 87 | iso_pu_bacteria | 2919085039 | 2919088358 | 183 |
| 88 | iso_pu_bacteria | 2939611941 | 2939612488 | 183 |
| 89 | iso_pu_bacteria | 2941471342 | 2941472892 | 183 |
| 90 | iso_pu_bacteria | 2547132130 | 2547502963 | 184 |
| 91 | iso_pu_bacteria | 2571042365 | 2572253697 | 184 |
| 92 | iso_pu_bacteria | 2576861471 | 2578458499 | 184 |
| 93 | iso_pu_bacteria | 2593339238 | 2595446767 | 184 |
| 94 | iso_pu_bacteria | 2643221559 | 2643818883 | 184 |
| 95 | iso_pu_bacteria | 2643221573 | 2643878540 | 184 |
| 96 | iso_pu_bacteria | 2643221579 | 2643907993 | 184 |
| 97 | iso_pu_bacteria | 2643221581 | 2643915804 | 184 |
| 98 | iso_pu_bacteria | 2643221586 | 2643941457 | 184 |
| 99 | iso_pu_bacteria | 2643221593 | 2643975987 | 184 |
| 100 | iso_pu_bacteria | 2643221612 | 2644080303 | 184 |
| 101 | iso_pu_bacteria | 2643221695 | 2644529003 | 184 |
| 102 | iso_pu_bacteria | 2643221720 | 2644659851 | 184 |
| 103 | iso_pu_bacteria | 2643221727 | 2644696917 | 184 |
| 104 | iso_pu_bacteria | 2643221728 | 2644700408 | 184 |
| 105 | iso_pu_bacteria | 2718218334 | 2721026556 | 184 |
| 106 | iso_pu_bacteria | 2734482264 | 2735833449 | 184 |
| 107 | iso_pu_bacteria | 2738543009 | 2739229451 | 184 |
| 108 | iso_pu_bacteria | 2747842428 | 2747949481 | 184 |
| 109 | iso_pu_bacteria | 2747842501 | 2748019771 | 184 |
| 110 | iso_pu_bacteria | 2765235840 | 2765578885 | 184 |
| 111 | iso_pu_bacteria | 2816332141 | 2816516960 | 184 |
| 112 | iso_pu_bacteria | 2818991440 | 2819563927 | 184 |
| 113 | iso_pu_bacteria | 2818991457 | 2819659671 | 184 |
| 114 | iso_pu_bacteria | 2842391507 | 2842393057 | 184 |
| 115 | iso_pu_bacteria | 2842757796 | 2842760214 | 184 |
| 116 | iso_pu_bacteria | 2842780639 | 2842780904 | 184 |
| 117 | iso_pu_bacteria | 2842918807 | 2842919845 | 184 |
| 118 | iso_pu_bacteria | 2852649853 | 2852650919 | 184 |
| 119 | iso_pu_bacteria | 2852684882 | 2852685526 | 184 |
| 120 | iso_pu_bacteria | 2857442823 | 2857443766 | 184 |
| 121 | iso_pu_bacteria | 2874220319 | 2874221537 | 184 |
| 122 | iso_pu_bacteria | 2884338543 | 2884341442 | 184 |
| 123 | iso_pu_bacteria | 2894414249 | 2894415930 | 184 |
| 124 | iso_pu_bacteria | 2895498888 | 2895500764 | 184 |
| 125 | iso_pu_bacteria | 2895511927 | 2895516366 | 184 |
| 126 | iso_pu_bacteria | 2895522137 | 2895523715 | 184 |
| 127 | iso_pu_bacteria | 2895525241 | 2895526704 | 184 |
| 128 | iso_pu_bacteria | 2904463128 | 2904464563 | 184 |
| 129 | iso_pu_bacteria | 2919089067 | 2919089796 | 184 |
| 130 | iso_pu_bacteria | 2919130084 | 2919131681 | 184 |
| 131 | iso_pu_bacteria | 2919134579 | 2919137734 | 184 |
| 132 | iso_pu_bacteria | 2919513703 | 2919517209 | 184 |
| 133 | iso_pu_bacteria | 2919675420 | 2919677060 | 184 |
| 134 | iso_pu_bacteria | 2923516293 | 2923518643 | 184 |
| 135 | iso_pu_bacteria | 2928496128 | 2928500254 | 184 |
| 136 | iso_pu_bacteria | 2929195423 | 2929197949 | 184 |
| 137 | iso_pu_bacteria | 2931380184 | 2931380839 | 184 |
| 138 | iso_pu_bacteria | 2937610967 | 2937612354 | 184 |
| 139 | iso_pu_bacteria | 2939589442 | 2939591372 | 184 |
| 140 | iso_pu_bacteria | 2939622612 | 2939623503 | 184 |
| 141 | iso_pu_bacteria | 2939626828 | 2939630903 | 184 |
| 142 | iso_pu_bacteria | 2941475908 | 2941478232 | 184 |
| 143 | iso_pu_bacteria | 2941489479 | 2941492951 | 184 |
| 144 | iso_pu_bacteria | 2953994433 | 2953995141 | 184 |
| 145 | iso_pu_bacteria | 2961047084 | 2961048304 | 184 |
| 146 | iso_pu_bacteria | 2961064222 | 2961065301 | 184 |
| 147 | iso_pu_bacteria | 2974307012 | 2974309065 | 184 |
| 148 | iso_pu_bacteria | 2977247770 | 2977249783 | 184 |
| 149 | iso_pu_bacteria | 2984514374 | 2984515728 | 184 |
| 150 | iso_pu_bacteria | 2987605356 | 2987606345 | 184 |
| 151 | iso_pu_bacteria | 2995948881 | 2995952270 | 184 |
| 152 | iso_pu_bacteria | 8002869464 | 8002871866 | 184 |
| 153 | iso_pu_bacteria | 8003014200 | 8003016193 | 184 |
| 154 | iso_pu_bacteria | 8021626552 | 8021626610 | 184 |
| 155 | 3300005262 | Ga0065165_1000118 | Ga0065165_100011815 | 187 |
| 156 | 3300005331 | Ga0070670_100121722 | Ga0070670_1001217222 | 187 |
| 157 | 3300005334 | Ga0068869_100091510 | Ga0068869_1000915103 | 187 |
| 158 | 3300005336 | Ga0070680_100070391 | Ga0070680_1000703912 | 187 |
| 159 | 3300005336 | Ga0070680_100210961 | Ga0070680_1002109612 | 187 |
| 160 | 3300005339 | Ga0070660_100052790 | Ga0070660_1000527902 | 187 |
| 161 | 3300005344 | Ga0070661_100539807 | Ga0070661_1005398071 | 187 |
| 162 | 3300005365 | Ga0070688_100747359 | Ga0070688_1007473591 | 187 |
| 163 | 3300005366 | Ga0070659_100276854 | Ga0070659_1002768542 | 187 |
| 164 | 3300005434 | Ga0070709_10478688 | Ga0070709_104786882 | 187 |
| 165 | 3300005439 | Ga0070711_100818808 | Ga0070711_1008188081 | 187 |
| 166 | 3300005458 | Ga0070681_10004840 | Ga0070681_1000484014 | 187 |
| 167 | 3300005458 | Ga0070681_10014094 | Ga0070681_100140949 | 187 |
| 168 | 3300005458 | Ga0070681_10128362 | Ga0070681_101283622 | 187 |
| 169 | 3300005530 | Ga0070679_100014695 | Ga0070679_1000146952 | 187 |
| 170 | 3300005530 | Ga0070679_100047097 | Ga0070679_1000470973 | 187 |
| 171 | 3300005539 | Ga0068853_100024041 | Ga0068853_1000240412 | 187 |
| 172 | 3300005543 | Ga0070672_100002961 | Ga0070672_10000296112 | 187 |
| 173 | 3300005546 | Ga0070696_100026884 | Ga0070696_1000268843 | 187 |
| 174 | 3300005546 | Ga0070696_100084215 | Ga0070696_1000842152 | 187 |
| 175 | 3300005547 | Ga0070693_100019133 | Ga0070693_1000191333 | 187 |
| 176 | 3300005547 | Ga0070693_100236580 | Ga0070693_1002365801 | 187 |
| 177 | 3300005548 | Ga0070665_100117136 | Ga0070665_1001171362 | 187 |
| 178 | 3300005563 | Ga0068855_100047003 | Ga0068855_1000470035 | 187 |
| 179 | 3300005577 | Ga0068857_100243855 | Ga0068857_1002438552 | 187 |
| 180 | 3300006186 | Ga0075369_10111897 | Ga0075369_101118972 | 187 |
| 181 | 3300009098 | Ga0105245_10197244 | Ga0105245_101972442 | 187 |
| 182 | 3300009545 | Ga0105237_10446690 | Ga0105237_104466901 | 187 |
| 183 | 3300009551 | Ga0105238_10923428 | Ga0105238_109234281 | 187 |
| 184 | 3300009553 | Ga0105249_10105989 | Ga0105249_101059892 | 187 |
| 185 | 3300010375 | Ga0105239_10004720 | Ga0105239_1000472012 | 187 |
| 186 | 3300010375 | Ga0105239_10034421 | Ga0105239_100344213 | 187 |
| 187 | 3300010375 | Ga0105239_10312027 | Ga0105239_103120272 | 187 |
| 188 | 3300012506 | Ga0157324_1009876 | Ga0157324_10098762 | 187 |
| 189 | 3300013100 | Ga0157373_10476773 | Ga0157373_104767732 | 187 |
| 190 | 3300013104 | Ga0157370_10000293 | Ga0157370_1000029331 | 187 |
| 191 | 3300013104 | Ga0157370_10383224 | Ga0157370_103832242 | 187 |
| 192 | 3300013105 | Ga0157369_10000025 | Ga0157369_1000002528 | 187 |
| 193 | 3300013296 | Ga0157374_10003664 | Ga0157374_1000366410 | 187 |
| 194 | 3300013296 | Ga0157374_10386574 | Ga0157374_103865742 | 187 |
| 195 | 3300013297 | Ga0157378_10059570 | Ga0157378_100595703 | 187 |
| 196 | 3300013306 | Ga0163162_11111517 | Ga0163162_111115172 | 187 |
| 197 | 3300013306 | Ga0163162_11380824 | Ga0163162_113808242 | 187 |
| 198 | 3300014969 | Ga0157376_10555963 | Ga0157376_105559632 | 187 |
| 199 | 3300014969 | Ga0157376_11785452 | Ga0157376_117854521 | 187 |
| 200 | 3300015265 | Ga0182005_1000028 | Ga0182005_1000028175 | 187 |
| 201 | 3300025231 | Ga0207427_103125 | Ga0207427_1031253 | 187 |
| 202 | 3300025233 | Ga0209437_100224 | Ga0209437_1002247 | 187 |
| 203 | 3300025242 | Ga0209258_106928 | Ga0209258_1069282 | 187 |
| 204 | 3300025254 | Ga0209148_1000005 | Ga0209148_1000005953 | 187 |
| 205 | 3300025302 | Ga0207426_1025885 | Ga0207426_10258852 | 187 |
| 206 | 3300025303 | Ga0209051_1027400 | Ga0209051_10274004 | 187 |
| 207 | 3300025893 | Ga0207682_10152782 | Ga0207682_101527822 | 187 |
| 208 | 3300025904 | Ga0207647_10004013 | Ga0207647_100040135 | 187 |
| 209 | 3300025906 | Ga0207699_10461780 | Ga0207699_104617802 | 187 |
| 210 | 3300025909 | Ga0207705_10019748 | Ga0207705_100197483 | 187 |
| 211 | 3300025909 | Ga0207705_10447987 | Ga0207705_104479872 | 187 |
| 212 | 3300025912 | Ga0207707_10000374 | Ga0207707_1000037427 | 187 |
| 213 | 3300025912 | Ga0207707_10305064 | Ga0207707_103050642 | 187 |
| 214 | 3300025913 | Ga0207695_10007273 | Ga0207695_1000727311 | 187 |
| 215 | 3300025913 | Ga0207695_10687301 | Ga0207695_106873012 | 187 |
| 216 | 3300025914 | Ga0207671_10001096 | Ga0207671_100010965 | 187 |
| 217 | 3300025914 | Ga0207671_10406782 | Ga0207671_104067822 | 187 |
| 218 | 3300025917 | Ga0207660_10048413 | Ga0207660_100484134 | 187 |
| 219 | 3300025919 | Ga0207657_10011781 | Ga0207657_100117813 | 187 |
| 220 | 3300025919 | Ga0207657_10293940 | Ga0207657_102939402 | 187 |
| 221 | 3300025920 | Ga0207649_10225574 | Ga0207649_102255742 | 187 |
| 222 | 3300025920 | Ga0207649_10631818 | Ga0207649_106318182 | 187 |
| 223 | 3300025921 | Ga0207652_10005403 | Ga0207652_100054033 | 187 |
| 224 | 3300025921 | Ga0207652_10316830 | Ga0207652_103168302 | 187 |
| 225 | 3300025923 | Ga0207681_10371081 | Ga0207681_103710812 | 187 |
| 226 | 3300025924 | Ga0207694_10011861 | Ga0207694_100118616 | 187 |
| 227 | 3300025924 | Ga0207694_10094964 | Ga0207694_100949643 | 187 |
| 228 | 3300025925 | Ga0207650_10027823 | Ga0207650_100278233 | 187 |
| 229 | 3300025927 | Ga0207687_10537290 | Ga0207687_105372902 | 187 |
| 230 | 3300025929 | Ga0207664_10000093 | Ga0207664_1000009355 | 187 |
| 231 | 3300025932 | Ga0207690_10002061 | Ga0207690_100020612 | 187 |
| 232 | 3300025932 | Ga0207690_10014240 | Ga0207690_100142407 | 187 |
| 233 | 3300025932 | Ga0207690_10019429 | Ga0207690_100194293 | 187 |
| 234 | 3300025933 | Ga0207706_10030008 | Ga0207706_100300083 | 187 |
| 235 | 3300025941 | Ga0207711_10104880 | Ga0207711_101048802 | 187 |
| 236 | 3300025942 | Ga0207689_10105299 | Ga0207689_101052993 | 187 |
| 237 | 3300025949 | Ga0207667_10000119 | Ga0207667_1000011934 | 187 |
| 238 | 3300025949 | Ga0207667_10006961 | Ga0207667_100069613 | 187 |
| 239 | 3300025949 | Ga0207667_10095325 | Ga0207667_100953253 | 187 |
| 240 | 3300025961 | Ga0207712_10183070 | Ga0207712_101830703 | 187 |
| 241 | 3300025981 | Ga0207640_10000185 | Ga0207640_1000018531 | 187 |
| 242 | 3300026041 | Ga0207639_10016756 | Ga0207639_100167564 | 187 |
| 243 | 3300026041 | Ga0207639_11074441 | Ga0207639_110744411 | 187 |
| 244 | 3300026078 | Ga0207702_10077061 | Ga0207702_100770612 | 187 |
| 245 | 3300026089 | Ga0207648_10941347 | Ga0207648_109413471 | 187 |
| 246 | 3300026116 | Ga0207674_10329569 | Ga0207674_103295692 | 187 |
| 247 | 3300028379 | Ga0268266_10098205 | Ga0268266_100982052 | 187 |
| 248 | 3300031507 | Ga0307509_10025648 | Ga0307509_100256485 | 187 |
| 249 | 3300031824 | Ga0307413_10313494 | Ga0307413_103134942 | 187 |
| 250 | 3300039450 | Ga0436363_0039191 | Ga0436363_0039191_714_1277 | 187 |
| 251 | 3300041458 | Ga0451798_0443259 | Ga0451798_0443259_43_606 | 187 |
| 252 | 3300041463 | Ga0451804_0653443 | Ga0451804_0653443_31_594 | 187 |
| 253 | 3300041512 | Ga0451853_0695473 | Ga0451853_0695473_1905_2468 | 187 |
| 254 | 3300041512 | Ga0451853_0982692 | Ga0451853_0982692_248_814 | 187 |
| 255 | 3300041512 | Ga0451853_4052864 | Ga0451853_4052864_68_631 | 187 |
| 256 | 3300044712 | Ga0453684_0002948 | Ga0453684_0002948_480_1043 | 187 |
| 257 | 3300045051 | Ga0451576_0000156 | Ga0451576_0000156_39072_39635 | 187 |
| 258 | 3300046501 | Ga0495607_0000088 | Ga0495607_0000088_16064_16627 | 187 |
| 259 | 3300046519 | Ga0495632_0000004 | Ga0495632_0000004_186600_187163 | 187 |
| 260 | 3300048906 | Ga0496103_0481785 | Ga0496103_0481785_76_639 | 187 |
| 261 | 3300048918 | Ga0496115_0000073 | Ga0496115_0000073_75487_76050 | 187 |
| 262 | 3300048919 | Ga0496116_0258762 | Ga0496116_0258762_267_830 | 187 |
| 263 | 3300048920 | Ga0496117_0174406 | Ga0496117_0174406_145_708 | 187 |
| 264 | 3300048921 | Ga0496118_0012772 | Ga0496118_0012772_6377_6940 | 187 |
| 265 | 3300048926 | Ga0496123_0010650 | Ga0496123_0010650_6214_6777 | 187 |
| 266 | 3300048927 | Ga0496124_0001044 | Ga0496124_0001044_33697_34260 | 187 |
| 267 | 3300048927 | Ga0496124_0001822 | Ga0496124_0001822_9271_9834 | 187 |
| 268 | 3300048929 | Ga0496126_0000169 | Ga0496126_0000169_84686_85249 | 187 |
| 269 | 3300049568 | Ga0501031_0326141 | Ga0501031_0326141_152_715 | 187 |
| 270 | 3300049569 | Ga0501032_0146126 | Ga0501032_0146126_31_594 | 187 |
| 271 | 3300049570 | Ga0501033_0027175 | Ga0501033_0027175_815_1378 | 187 |
| 272 | 3300049570 | Ga0501033_0307729 | Ga0501033_0307729_467_1030 | 187 |
| 273 | 3300049570 | Ga0501033_0657475 | Ga0501033_0657475_116_679 | 187 |
| 274 | 3300049571 | Ga0501034_0527303 | Ga0501034_0527303_79_642 | 187 |
| 275 | 3300049571 | Ga0501034_1163558 | Ga0501034_1163558_46_609 | 187 |
| 276 | 3300049572 | Ga0501036_0039556 | Ga0501036_0039556_68_631 | 187 |
| 277 | 3300049573 | Ga0501037_0393202 | Ga0501037_0393202_34_597 | 187 |
| 278 | 3300049574 | Ga0501038_0027114 | Ga0501038_0027114_17_580 | 187 |
| 279 | 3300049574 | Ga0501038_0280711 | Ga0501038_0280711_427_990 | 187 |
| 280 | 3300049575 | Ga0501039_0260499 | Ga0501039_0260499_659_1303 | 187 |
| 281 | 3300049575 | Ga0501039_0532086 | Ga0501039_0532086_149_712 | 187 |
| 282 | 3300049578 | Ga0501042_0336236 | Ga0501042_0336236_81_644 | 187 |
| 283 | 3300049579 | Ga0501043_0010778 | Ga0501043_0010778_6519_7082 | 187 |
| 284 | 3300049579 | Ga0501043_0222098 | Ga0501043_0222098_875_1438 | 187 |
| 285 | 3300049580 | Ga0501046_0033161 | Ga0501046_0033161_1743_2306 | 187 |
| 286 | 3300049581 | Ga0501047_0002672 | Ga0501047_0002672_5136_5699 | 187 |
| 287 | 3300049581 | Ga0501047_0353300 | Ga0501047_0353300_241_804 | 187 |
| 288 | 3300049581 | Ga0501047_0407320 | Ga0501047_0407320_578_1141 | 187 |
| 289 | 3300049582 | Ga0501048_0318237 | Ga0501048_0318237_462_1025 | 187 |
| 290 | 3300049585 | Ga0501069_0005665 | Ga0501069_0005665_5262_5825 | 187 |
| 291 | 3300049585 | Ga0501069_0617578 | Ga0501069_0617578_46_609 | 187 |
| 292 | 3300049586 | Ga0501070_0000587 | Ga0501070_0000587_5977_6540 | 187 |
| 293 | 3300049586 | Ga0501070_0005501 | Ga0501070_0005501_153_716 | 187 |
| 294 | 3300049589 | Ga0501073_0111420 | Ga0501073_0111420_431_994 | 187 |
| 295 | 3300049590 | Ga0501074_0012874 | Ga0501074_0012874_1164_1727 | 187 |
| 296 | 3300049742 | Ga0501080_0010284 | Ga0501080_0010284_2955_3518 | 187 |
| 297 | 3300049742 | Ga0501080_0618989 | Ga0501080_0618989_121_684 | 187 |
| 298 | 3300049822 | Ga0501035_0021930 | Ga0501035_0021930_905_1468 | 187 |
| 299 | 3300049822 | Ga0501035_0125501 | Ga0501035_0125501_414_977 | 187 |
| 300 | 3300049823 | Ga0501044_0019975 | Ga0501044_0019975_1243_1806 | 187 |
| 301 | 3300049823 | Ga0501044_0057862 | Ga0501044_0057862_3134_3778 | 187 |
| 302 | 3300049823 | Ga0501044_0253846 | Ga0501044_0253846_812_1375 | 187 |
| 303 | 3300050516 | nmdc:mga0sz30_4265_c1 | nmdc:mga0sz30_4265_c1_356_919 | 187 |
| 304 | 3300053149 | Ga0500600_0123028 | Ga0500600_0123028_719_1282 | 187 |
| 305 | 2162886007 | SwRhRL2b_contig_1819724 | SwRhRL2b_0550.00001830 | 188 |
| 306 | 3300002773 | JGI25152J39213_1000118 | JGI25152J39213_100011834 | 188 |
| 307 | 3300002773 | JGI25152J39213_1020380 | JGI25152J39213_10203801 | 188 |
| 308 | 3300002774 | JGI25150J39212_1000434 | JGI25150J39212_10004341 | 188 |
| 309 | 3300003187 | JGI25151J46595_10000315 | JGI25151J46595_1000031534 | 188 |
| 310 | 3300003215 | JGI25153J46596_10000167 | JGI25153J46596_1000016734 | 188 |
| 311 | 3300003316 | rootH1_10033715 | rootH1_100337152 | 188 |
| 312 | 3300003771 | Ga0055526_1000182 | Ga0055526_100018251 | 188 |
| 313 | 3300003771 | Ga0055526_1002395 | Ga0055526_10023955 | 188 |
| 314 | 3300003773 | Ga0055537_1000091 | Ga0055537_100009144 | 188 |
| 315 | 3300003773 | Ga0055537_1000136 | Ga0055537_100013651 | 188 |
| 316 | 3300003775 | Ga0055524_1000254 | Ga0055524_100025451 | 188 |
| 317 | 3300003775 | Ga0055524_1030331 | Ga0055524_10303312 | 188 |
| 318 | 3300003781 | Ga0055536_1000812 | Ga0055536_100081213 | 188 |
| 319 | 3300003781 | Ga0055536_1000925 | Ga0055536_100092511 | 188 |
| 320 | 3300003781 | Ga0055536_1013569 | Ga0055536_10135693 | 188 |
| 321 | 3300003781 | Ga0055536_1030512 | Ga0055536_10305122 | 188 |
| 322 | 3300003784 | Ga0055534_1000043 | Ga0055534_100004353 | 188 |
| 323 | 3300003784 | Ga0055534_1000137 | Ga0055534_10001371 | 188 |
| 324 | 3300003790 | Ga0055528_1000087 | Ga0055528_100008718 | 188 |
| 325 | 3300003790 | Ga0055528_1000169 | Ga0055528_10001691 | 188 |
| 326 | 3300003791 | Ga0055530_10017857 | Ga0055530_100178571 | 188 |
| 327 | 3300003792 | Ga0055540_1044902 | Ga0055540_10449021 | 188 |
| 328 | 3300003794 | Ga0055531_10001450 | Ga0055531_1000145010 | 188 |
| 329 | 3300003794 | Ga0055531_10004122 | Ga0055531_100041226 | 188 |
| 330 | 3300003794 | Ga0055531_10004970 | Ga0055531_100049704 | 188 |
| 331 | 3300003794 | Ga0055531_10007659 | Ga0055531_100076592 | 188 |
| 332 | 3300003794 | Ga0055531_10007895 | Ga0055531_100078954 | 188 |
| 333 | 3300003794 | Ga0055531_10012585 | Ga0055531_100125853 | 188 |
| 334 | 3300003794 | Ga0055531_10030430 | Ga0055531_100304301 | 188 |
| 335 | 3300003856 | Ga0058692_1000031 | Ga0058692_1000031123 | 188 |
| 336 | 3300003856 | Ga0058692_1000060 | Ga0058692_100006042 | 188 |
| 337 | 3300005262 | Ga0065165_1022436 | Ga0065165_10224363 | 188 |
| 338 | 3300005262 | Ga0065165_1051736 | Ga0065165_10517362 | 188 |
| 339 | 3300005289 | Ga0065704_10070531 | Ga0065704_100705313 | 188 |
| 340 | 3300005289 | Ga0065704_10079591 | Ga0065704_100795911 | 188 |
| 341 | 3300005293 | Ga0065715_10050260 | Ga0065715_100502602 | 188 |
| 342 | 3300005327 | Ga0070658_10142010 | Ga0070658_101420102 | 188 |
| 343 | 3300005329 | Ga0070683_101226924 | Ga0070683_1012269241 | 188 |
| 344 | 3300005331 | Ga0070670_100012694 | Ga0070670_1000126944 | 188 |
| 345 | 3300005339 | Ga0070660_100709462 | Ga0070660_1007094622 | 188 |
| 346 | 3300005344 | Ga0070661_100562343 | Ga0070661_1005623431 | 188 |
| 347 | 3300005345 | Ga0070692_10304728 | Ga0070692_103047281 | 188 |
| 348 | 3300005347 | Ga0070668_100021352 | Ga0070668_1000213522 | 188 |
| 349 | 3300005347 | Ga0070668_100167532 | Ga0070668_1001675323 | 188 |
| 350 | 3300005347 | Ga0070668_100186338 | Ga0070668_1001863382 | 188 |
| 351 | 3300005347 | Ga0070668_100625637 | Ga0070668_1006256371 | 188 |
| 352 | 3300005355 | Ga0070671_100081121 | Ga0070671_1000811212 | 188 |
| 353 | 3300005355 | Ga0070671_100239338 | Ga0070671_1002393382 | 188 |
| 354 | 3300005356 | Ga0070674_100135692 | Ga0070674_1001356923 | 188 |
| 355 | 3300005364 | Ga0070673_100661858 | Ga0070673_1006618582 | 188 |
| 356 | 3300005367 | Ga0070667_100629183 | Ga0070667_1006291831 | 188 |
| 357 | 3300005456 | Ga0070678_101138446 | Ga0070678_1011384461 | 188 |
| 358 | 3300005457 | Ga0070662_100369198 | Ga0070662_1003691981 | 188 |
| 359 | 3300005530 | Ga0070679_100738042 | Ga0070679_1007380422 | 188 |
| 360 | 3300005543 | Ga0070672_100008454 | Ga0070672_1000084543 | 188 |
| 361 | 3300005548 | Ga0070665_100094122 | Ga0070665_1000941223 | 188 |
| 362 | 3300005548 | Ga0070665_101345819 | Ga0070665_1013458191 | 188 |
| 363 | 3300005564 | Ga0070664_100152562 | Ga0070664_1001525621 | 188 |
| 364 | 3300005564 | Ga0070664_101460634 | Ga0070664_1014606341 | 188 |
| 365 | 3300005841 | Ga0068863_100252755 | Ga0068863_1002527553 | 188 |
| 366 | 3300005844 | Ga0068862_100546453 | Ga0068862_1005464532 | 188 |
| 367 | 3300005844 | Ga0068862_100879641 | Ga0068862_1008796412 | 188 |
| 368 | 3300005985 | Ga0081539_10157391 | Ga0081539_101573912 | 188 |
| 369 | 3300006051 | Ga0075364_10000075 | Ga0075364_1000007528 | 188 |
| 370 | 3300006051 | Ga0075364_10075928 | Ga0075364_100759281 | 188 |
| 371 | 3300006051 | Ga0075364_10090167 | Ga0075364_100901672 | 188 |
| 372 | 3300006051 | Ga0075364_10154064 | Ga0075364_101540642 | 188 |
| 373 | 3300006051 | Ga0075364_10201042 | Ga0075364_102010422 | 188 |
| 374 | 3300006186 | Ga0075369_10056644 | Ga0075369_100566441 | 188 |
| 375 | 3300009011 | Ga0105251_10000364 | Ga0105251_1000036434 | 188 |
| 376 | 3300009036 | Ga0105244_10170837 | Ga0105244_101708372 | 188 |
| 377 | 3300009036 | Ga0105244_10209024 | Ga0105244_102090242 | 188 |
| 378 | 3300009036 | Ga0105244_10289050 | Ga0105244_102890501 | 188 |
| 379 | 3300009101 | Ga0105247_10003765 | Ga0105247_100037656 | 188 |
| 380 | 3300009148 | Ga0105243_10012792 | Ga0105243_100127928 | 188 |
| 381 | 3300009148 | Ga0105243_10020218 | Ga0105243_100202182 | 188 |
| 382 | 3300009177 | Ga0105248_11418510 | Ga0105248_114185101 | 188 |
| 383 | 3300009551 | Ga0105238_10606121 | Ga0105238_106061212 | 188 |
| 384 | 3300009979 | Ga0105032_108202 | Ga0105032_1082022 | 188 |
| 385 | 3300012483 | Ga0157337_1003328 | Ga0157337_10033282 | 188 |
| 386 | 3300012495 | Ga0157323_1009100 | Ga0157323_10091001 | 188 |
| 387 | 3300012502 | Ga0157347_1022160 | Ga0157347_10221601 | 188 |
| 388 | 3300012513 | Ga0157326_1024241 | Ga0157326_10242412 | 188 |
| 389 | 3300013100 | Ga0157373_10160012 | Ga0157373_101600123 | 188 |
| 390 | 3300013102 | Ga0157371_10002405 | Ga0157371_1000240511 | 188 |
| 391 | 3300013102 | Ga0157371_10006531 | Ga0157371_100065318 | 188 |
| 392 | 3300013102 | Ga0157371_10122281 | Ga0157371_101222812 | 188 |
| 393 | 3300013102 | Ga0157371_10596638 | Ga0157371_105966381 | 188 |
| 394 | 3300013104 | Ga0157370_10117492 | Ga0157370_101174923 | 188 |
| 395 | 3300013105 | Ga0157369_10093022 | Ga0157369_100930224 | 188 |
| 396 | 3300013306 | Ga0163162_10281171 | Ga0163162_102811712 | 188 |
| 397 | 3300013308 | Ga0157375_10124460 | Ga0157375_101244602 | 188 |
| 398 | 3300013308 | Ga0157375_10800574 | Ga0157375_108005741 | 188 |
| 399 | 3300013308 | Ga0157375_11095926 | Ga0157375_110959262 | 188 |
| 400 | 3300014326 | Ga0157380_10374967 | Ga0157380_103749672 | 188 |
| 401 | 3300014326 | Ga0157380_10661593 | Ga0157380_106615931 | 188 |
| 402 | 3300014326 | Ga0157380_11366390 | Ga0157380_113663901 | 188 |
| 403 | 3300014497 | Ga0182008_10001118 | Ga0182008_100011187 | 188 |
| 404 | 3300014497 | Ga0182008_10003258 | Ga0182008_100032589 | 188 |
| 405 | 3300015261 | Ga0182006_1000085 | Ga0182006_100008540 | 188 |
| 406 | 3300015261 | Ga0182006_1001555 | Ga0182006_10015557 | 188 |
| 407 | 3300015262 | Ga0182007_10000556 | Ga0182007_1000055616 | 188 |
| 408 | 3300015262 | Ga0182007_10014554 | Ga0182007_100145542 | 188 |
| 409 | 3300015265 | Ga0182005_1000463 | Ga0182005_100046314 | 188 |
| 410 | 3300015265 | Ga0182005_1001893 | Ga0182005_10018934 | 188 |
| 411 | 3300015265 | Ga0182005_1004454 | Ga0182005_10044542 | 188 |
| 412 | 3300015689 | Ga0183360_10001 | Ga0183360_10001972 | 188 |
| 413 | 3300017792 | Ga0163161_10001824 | Ga0163161_1000182412 | 188 |
| 414 | 3300017792 | Ga0163161_10149136 | Ga0163161_101491361 | 188 |
| 415 | 3300017792 | Ga0163161_10241850 | Ga0163161_102418501 | 188 |
| 416 | 3300025226 | Ga0209674_100933 | Ga0209674_1009334 | 188 |
| 417 | 3300025233 | Ga0209437_100955 | Ga0209437_1009556 | 188 |
| 418 | 3300025245 | Ga0207425_1000097 | Ga0207425_100009749 | 188 |
| 419 | 3300025245 | Ga0207425_1036230 | Ga0207425_10362302 | 188 |
| 420 | 3300025258 | Ga0209129_1000189 | Ga0209129_100018949 | 188 |
| 421 | 3300025258 | Ga0209129_1002415 | Ga0209129_10024156 | 188 |
| 422 | 3300025263 | Ga0209565_1000005 | Ga0209565_1000005163 | 188 |
| 423 | 3300025263 | Ga0209565_1000063 | Ga0209565_100006343 | 188 |
| 424 | 3300025273 | Ga0209673_1000027 | Ga0209673_1000027164 | 188 |
| 425 | 3300025273 | Ga0209673_1000065 | Ga0209673_100006596 | 188 |
| 426 | 3300025273 | Ga0209673_1003263 | Ga0209673_10032635 | 188 |
| 427 | 3300025284 | Ga0209130_1009009 | Ga0209130_10090093 | 188 |
| 428 | 3300025284 | Ga0209130_1011298 | Ga0209130_10112982 | 188 |
| 429 | 3300025284 | Ga0209130_1024979 | Ga0209130_10249791 | 188 |
| 430 | 3300025291 | Ga0209675_1000004 | Ga0209675_1000004163 | 188 |
| 431 | 3300025291 | Ga0209675_1000011 | Ga0209675_1000011239 | 188 |
| 432 | 3300025292 | Ga0209676_1000011 | Ga0209676_1000011596 | 188 |
| 433 | 3300025292 | Ga0209676_1000034 | Ga0209676_1000034452 | 188 |
| 434 | 3300025292 | Ga0209676_1000068 | Ga0209676_1000068162 | 188 |
| 435 | 3300025292 | Ga0209676_1000981 | Ga0209676_100098113 | 188 |
| 436 | 3300025292 | Ga0209676_1003532 | Ga0209676_10035325 | 188 |
| 437 | 3300025292 | Ga0209676_1006825 | Ga0209676_10068255 | 188 |
| 438 | 3300025292 | Ga0209676_1009417 | Ga0209676_10094172 | 188 |
| 439 | 3300025294 | Ga0209025_1000005 | Ga0209025_1000005212 | 188 |
| 440 | 3300025294 | Ga0209025_1000054 | Ga0209025_100005449 | 188 |
| 441 | 3300025294 | Ga0209025_1004511 | Ga0209025_100451110 | 188 |
| 442 | 3300025295 | Ga0209564_1000050 | Ga0209564_1000050164 | 188 |
| 443 | 3300025295 | Ga0209564_1000433 | Ga0209564_100043322 | 188 |
| 444 | 3300025295 | Ga0209564_1008048 | Ga0209564_10080484 | 188 |
| 445 | 3300025295 | Ga0209564_1026629 | Ga0209564_10266292 | 188 |
| 446 | 3300025297 | Ga0209758_1000062 | Ga0209758_100006249 | 188 |
| 447 | 3300025297 | Ga0209758_1004731 | Ga0209758_10047314 | 188 |
| 448 | 3300025297 | Ga0209758_1008133 | Ga0209758_10081337 | 188 |
| 449 | 3300025297 | Ga0209758_1023839 | Ga0209758_10238391 | 188 |
| 450 | 3300025298 | Ga0209050_1000239 | Ga0209050_100023965 | 188 |
| 451 | 3300025298 | Ga0209050_1000599 | Ga0209050_100059911 | 188 |
| 452 | 3300025298 | Ga0209050_1006127 | Ga0209050_10061273 | 188 |
| 453 | 3300025299 | Ga0209256_1000031 | Ga0209256_1000031164 | 188 |
| 454 | 3300025299 | Ga0209256_1003080 | Ga0209256_100308010 | 188 |
| 455 | 3300025299 | Ga0209256_1003541 | Ga0209256_10035413 | 188 |
| 456 | 3300025299 | Ga0209256_1005136 | Ga0209256_10051366 | 188 |
| 457 | 3300025299 | Ga0209256_1006995 | Ga0209256_10069952 | 188 |
| 458 | 3300025299 | Ga0209256_1018166 | Ga0209256_10181662 | 188 |
| 459 | 3300025303 | Ga0209051_1002354 | Ga0209051_10023547 | 188 |
| 460 | 3300025304 | Ga0209257_1000014 | Ga0209257_1000014655 | 188 |
| 461 | 3300025304 | Ga0209257_1000263 | Ga0209257_100026346 | 188 |
| 462 | 3300025304 | Ga0209257_1000283 | Ga0209257_10002835 | 188 |
| 463 | 3300025304 | Ga0209257_1000645 | Ga0209257_100064511 | 188 |
| 464 | 3300025304 | Ga0209257_1001034 | Ga0209257_100103413 | 188 |
| 465 | 3300025304 | Ga0209257_1001651 | Ga0209257_100165115 | 188 |
| 466 | 3300025304 | Ga0209257_1002860 | Ga0209257_10028606 | 188 |
| 467 | 3300025304 | Ga0209257_1003306 | Ga0209257_10033066 | 188 |
| 468 | 3300025304 | Ga0209257_1004492 | Ga0209257_10044922 | 188 |
| 469 | 3300025304 | Ga0209257_1008923 | Ga0209257_10089234 | 188 |
| 470 | 3300025304 | Ga0209257_1021546 | Ga0209257_10215461 | 188 |
| 471 | 3300025304 | Ga0209257_1024761 | Ga0209257_10247613 | 188 |
| 472 | 3300025728 | Ga0207655_1145642 | Ga0207655_11456421 | 188 |
| 473 | 3300025735 | Ga0207713_1000422 | Ga0207713_10004223 | 188 |
| 474 | 3300025900 | Ga0207710_10013753 | Ga0207710_100137532 | 188 |
| 475 | 3300025919 | Ga0207657_10077231 | Ga0207657_100772313 | 188 |
| 476 | 3300025921 | Ga0207652_10521960 | Ga0207652_105219602 | 188 |
| 477 | 3300025923 | Ga0207681_10033056 | Ga0207681_100330563 | 188 |
| 478 | 3300025923 | Ga0207681_10166007 | Ga0207681_101660072 | 188 |
| 479 | 3300025925 | Ga0207650_10034031 | Ga0207650_100340313 | 188 |
| 480 | 3300025925 | Ga0207650_10190209 | Ga0207650_101902093 | 188 |
| 481 | 3300025926 | Ga0207659_10363646 | Ga0207659_103636462 | 188 |
| 482 | 3300025933 | Ga0207706_10575543 | Ga0207706_105755432 | 188 |
| 483 | 3300025935 | Ga0207709_10000632 | Ga0207709_100006325 | 188 |
| 484 | 3300025935 | Ga0207709_10341998 | Ga0207709_103419982 | 188 |
| 485 | 3300025937 | Ga0207669_10084647 | Ga0207669_100846472 | 188 |
| 486 | 3300025940 | Ga0207691_10009924 | Ga0207691_100099248 | 188 |
| 487 | 3300025940 | Ga0207691_10127613 | Ga0207691_101276132 | 188 |
| 488 | 3300025945 | Ga0207679_10103132 | Ga0207679_101031323 | 188 |
| 489 | 3300025945 | Ga0207679_10753021 | Ga0207679_107530212 | 188 |
| 490 | 3300025960 | Ga0207651_10398009 | Ga0207651_103980093 | 188 |
| 491 | 3300025972 | Ga0207668_10007253 | Ga0207668_100072537 | 188 |
| 492 | 3300025972 | Ga0207668_10091507 | Ga0207668_100915072 | 188 |
| 493 | 3300025972 | Ga0207668_10259530 | Ga0207668_102595302 | 188 |
| 494 | 3300025981 | Ga0207640_10307927 | Ga0207640_103079272 | 188 |
| 495 | 3300026075 | Ga0207708_10763240 | Ga0207708_107632402 | 188 |
| 496 | 3300026088 | Ga0207641_10103684 | Ga0207641_101036843 | 188 |
| 497 | 3300026121 | Ga0207683_10235723 | Ga0207683_102357233 | 188 |
| 498 | 3300026121 | Ga0207683_11257719 | Ga0207683_112577191 | 188 |
| 499 | 3300027312 | Ga0209371_1000004 | Ga0209371_100000455 | 188 |
| 500 | 3300027312 | Ga0209371_1000139 | Ga0209371_100013942 | 188 |
| 501 | 3300027552 | Ga0209982_1014132 | Ga0209982_10141322 | 188 |
| 502 | 3300027617 | Ga0210002_1012531 | Ga0210002_10125312 | 188 |
| 503 | 3300027682 | Ga0209971_1001630 | Ga0209971_10016302 | 188 |
| 504 | 3300027866 | Ga0209813_10151705 | Ga0209813_101517052 | 188 |
| 505 | 3300027876 | Ga0209974_10010966 | Ga0209974_100109662 | 188 |
| 506 | 3300027876 | Ga0209974_10107567 | Ga0209974_101075672 | 188 |
| 507 | 3300028379 | Ga0268266_10037476 | Ga0268266_100374764 | 188 |
| 508 | 3300028379 | Ga0268266_11143513 | Ga0268266_111435131 | 188 |
| 509 | 3300028380 | Ga0268265_10078162 | Ga0268265_100781622 | 188 |
| 510 | 3300028380 | Ga0268265_10850062 | Ga0268265_108500621 | 188 |
| 511 | 3300030500 | Ga0268256_1000005 | Ga0268256_1000005990 | 188 |
| 512 | 3300030500 | Ga0268256_1000109 | Ga0268256_100010960 | 188 |
| 513 | 3300030731 | Ga0316177_1014219 | Ga0316177_10142193 | 188 |
| 514 | 3300030731 | Ga0316177_1060205 | Ga0316177_10602052 | 188 |
| 515 | 3300030732 | Ga0316176_1137489 | Ga0316176_11374893 | 188 |
| 516 | 3300030732 | Ga0316176_1150837 | Ga0316176_11508371 | 188 |
| 517 | 3300030733 | Ga0314311_1207988 | Ga0314311_12079883 | 188 |
| 518 | 3300030735 | Ga0316178_1111912 | Ga0316178_11119122 | 188 |
| 519 | 3300030742 | Ga0316183_1000379 | Ga0316183_10003792 | 188 |
| 520 | 3300030742 | Ga0316183_1073792 | Ga0316183_10737923 | 188 |
| 521 | 3300030745 | Ga0316182_1180068 | Ga0316182_11800682 | 188 |
| 522 | 3300031456 | Ga0307513_10009900 | Ga0307513_1000990011 | 188 |
| 523 | 3300031456 | Ga0307513_10048166 | Ga0307513_100481665 | 188 |
| 524 | 3300031548 | Ga0307408_100498030 | Ga0307408_1004980303 | 188 |
| 525 | 3300031731 | Ga0307405_10110996 | Ga0307405_101109962 | 188 |
| 526 | 3300031824 | Ga0307413_10001980 | Ga0307413_100019805 | 188 |
| 527 | 3300031824 | Ga0307413_10107096 | Ga0307413_101070962 | 188 |
| 528 | 3300031824 | Ga0307413_10144252 | Ga0307413_101442523 | 188 |
| 529 | 3300031824 | Ga0307413_10163763 | Ga0307413_101637632 | 188 |
| 530 | 3300031824 | Ga0307413_10767900 | Ga0307413_107679002 | 188 |
| 531 | 3300031852 | Ga0307410_10220048 | Ga0307410_102200482 | 188 |
| 532 | 3300031852 | Ga0307410_10646388 | Ga0307410_106463882 | 188 |
| 533 | 3300031901 | Ga0307406_10002948 | Ga0307406_100029486 | 188 |
| 534 | 3300031901 | Ga0307406_10684692 | Ga0307406_106846921 | 188 |
| 535 | 3300031903 | Ga0307407_10348328 | Ga0307407_103483282 | 188 |
| 536 | 3300031911 | Ga0307412_10013730 | Ga0307412_100137306 | 188 |
| 537 | 3300031911 | Ga0307412_10111646 | Ga0307412_101116462 | 188 |
| 538 | 3300031911 | Ga0307412_10384520 | Ga0307412_103845202 | 188 |
| 539 | 3300031911 | Ga0307412_10789010 | Ga0307412_107890101 | 188 |
| 540 | 3300032002 | Ga0307416_100326325 | Ga0307416_1003263251 | 188 |
| 541 | 3300032004 | Ga0307414_10004260 | Ga0307414_100042604 | 188 |
| 542 | 3300032004 | Ga0307414_10038814 | Ga0307414_100388142 | 188 |
| 543 | 3300032004 | Ga0307414_10049127 | Ga0307414_100491274 | 188 |
| 544 | 3300032004 | Ga0307414_10072191 | Ga0307414_100721913 | 188 |
| 545 | 3300032004 | Ga0307414_10120628 | Ga0307414_101206282 | 188 |
| 546 | 3300032004 | Ga0307414_10222988 | Ga0307414_102229883 | 188 |
| 547 | 3300032004 | Ga0307414_10358111 | Ga0307414_103581112 | 188 |
| 548 | 3300032004 | Ga0307414_10444790 | Ga0307414_104447902 | 188 |
| 549 | 3300032004 | Ga0307414_10910785 | Ga0307414_109107852 | 188 |
| 550 | 3300032004 | Ga0307414_11164240 | Ga0307414_111642401 | 188 |
| 551 | 3300032005 | Ga0307411_10056428 | Ga0307411_100564282 | 188 |
| 552 | 3300032005 | Ga0307411_10262120 | Ga0307411_102621203 | 188 |
| 553 | 3300037312 | Ga0395899_0131662 | Ga0395899_0131662_1018_1584 | 188 |
| 554 | 3300037418 | Ga0395900_0537431 | Ga0395900_0537431_267_833 | 188 |
| 555 | 3300037466 | Ga0395898_0071216 | Ga0395898_0071216_2138_2704 | 188 |
| 556 | 3300037466 | Ga0395898_0083391 | Ga0395898_0083391_345_911 | 188 |
| 557 | 3300037471 | Ga0395905_0034860 | Ga0395905_0034860_63_629 | 188 |
| 558 | 3300037471 | Ga0395905_0154998 | Ga0395905_0154998_566_1132 | 188 |
| 559 | 3300037471 | Ga0395905_0179496 | Ga0395905_0179496_104_670 | 188 |
| 560 | 3300037471 | Ga0395905_0512794 | Ga0395905_0512794_35_601 | 188 |
| 561 | 3300037471 | Ga0395905_0530077 | Ga0395905_0530077_17_583 | 188 |
| 562 | 3300038443 | Ga0395901_0063541 | Ga0395901_0063541_2915_3481 | 188 |
| 563 | 3300038705 | Ga0237819_00164 | Ga0237819_00164_11792_12358 | 188 |
| 564 | 3300038705 | Ga0237819_05553 | Ga0237819_05553_161_727 | 188 |
| 565 | 3300039145 | Ga0237816_00136 | Ga0237816_00136_3636_4202 | 188 |
| 566 | 3300041404 | Ga0439436_0028420 | Ga0439436_0028420_912_1478 | 188 |
| 567 | 3300041404 | Ga0439436_0037627 | Ga0439436_0037627_189_755 | 188 |
| 568 | 3300041413 | Ga0439465_0000040 | Ga0439465_0000040_15698_16264 | 188 |
| 569 | 3300041413 | Ga0439465_0000426 | Ga0439465_0000426_8255_8821 | 188 |
| 570 | 3300041413 | Ga0439465_0000996 | Ga0439465_0000996_5875_6441 | 188 |
| 571 | 3300041413 | Ga0439465_0002646 | Ga0439465_0002646_1948_2514 | 188 |
| 572 | 3300041413 | Ga0439465_0015599 | Ga0439465_0015599_946_1512 | 188 |
| 573 | 3300041443 | Ga0451789_0368362 | Ga0451789_0368362_216_782 | 188 |
| 574 | 3300041443 | Ga0451789_0612999 | Ga0451789_0612999_12_626 | 188 |
| 575 | 3300041453 | Ga0451797_0985516 | Ga0451797_0985516_347_913 | 188 |
| 576 | 3300041459 | Ga0451800_1224437 | Ga0451800_1224437_2754_3320 | 188 |
| 577 | 3300041462 | Ga0451806_620901 | Ga0451806_620901_286_852 | 188 |
| 578 | 3300041486 | Ga0451807_1378455 | Ga0451807_1378455_1260_1826 | 188 |
| 579 | 3300041486 | Ga0451807_2757209 | Ga0451807_2757209_26_592 | 188 |
| 580 | 3300041494 | Ga0451837_1411285 | Ga0451837_1411285_679_1245 | 188 |
| 581 | 3300041509 | Ga0451843_0119213 | Ga0451843_0119213_1470_2036 | 188 |
| 582 | 3300041512 | Ga0451853_1076376 | Ga0451853_1076376_379_945 | 188 |
| 583 | 3300041999 | Ga0439433_0057639 | Ga0439433_0057639_36_602 | 188 |
| 584 | 3300042004 | Ga0439445_0008723 | Ga0439445_0008723_1167_1733 | 188 |
| 585 | 3300042004 | Ga0439445_0037452 | Ga0439445_0037452_427_993 | 188 |
| 586 | 3300042004 | Ga0439445_0057355 | Ga0439445_0057355_471_1037 | 188 |
| 587 | 3300042004 | Ga0439445_0130758 | Ga0439445_0130758_35_601 | 188 |
| 588 | 3300042006 | Ga0439432_005823 | Ga0439432_005823_2332_2898 | 188 |
| 589 | 3300042006 | Ga0439432_027180 | Ga0439432_027180_493_1059 | 188 |
| 590 | 3300042007 | Ga0439449_0000134 | Ga0439449_0000134_4668_5234 | 188 |
| 591 | 3300042007 | Ga0439449_0004260 | Ga0439449_0004260_2740_3306 | 188 |
| 592 | 3300042007 | Ga0439449_0008474 | Ga0439449_0008474_1045_1611 | 188 |
| 593 | 3300042007 | Ga0439449_0012239 | Ga0439449_0012239_988_1554 | 188 |
| 594 | 3300042007 | Ga0439449_0047789 | Ga0439449_0047789_43_609 | 188 |
| 595 | 3300042007 | Ga0439449_0047882 | Ga0439449_0047882_866_1435 | 188 |
| 596 | 3300042012 | Ga0439455_0072954 | Ga0439455_0072954_259_825 | 188 |
| 597 | 3300042015 | Ga0439462_0080623 | Ga0439462_0080623_284_850 | 188 |
| 598 | 3300042184 | Ga0450908_000427 | Ga0450908_000427_327_893 | 188 |
| 599 | 3300042533 | Ga0450901_003256 | Ga0450901_003256_983_1549 | 188 |
| 600 | 3300042876 | Ga0451577_0051922 | Ga0451577_0051922_2808_3374 | 188 |
| 601 | 3300044656 | Ga0466969_0061651 | Ga0466969_0061651_873_1439 | 188 |
| 602 | 3300044658 | Ga0466972_0074236 | Ga0466972_0074236_1020_1586 | 188 |
| 603 | 3300044672 | Ga0466982_0000003 | Ga0466982_0000003_366129_366695 | 188 |
| 604 | 3300044672 | Ga0466982_0000061 | Ga0466982_0000061_18511_19077 | 188 |
| 605 | 3300044683 | Ga0466965_0014613 | Ga0466965_0014613_1766_2332 | 188 |
| 606 | 3300044684 | Ga0466966_0012748 | Ga0466966_0012748_1584_2150 | 188 |
| 607 | 3300044706 | Ga0466964_0007101 | Ga0466964_0007101_1241_1807 | 188 |
| 608 | 3300044712 | Ga0453684_0978132 | Ga0453684_0978132_135_701 | 188 |
| 609 | 3300044719 | Ga0466971_0054782 | Ga0466971_0054782_1203_1769 | 188 |
| 610 | 3300044735 | Ga0466968_0002058 | Ga0466968_0002058_3766_4332 | 188 |
| 611 | 3300044901 | Ga0466960_0004681 | Ga0466960_0004681_3652_4218 | 188 |
| 612 | 3300045049 | Ga0466959_0054469 | Ga0466959_0054469_393_959 | 188 |
| 613 | 3300045836 | Ga0466958_0034030 | Ga0466958_0034030_21_587 | 188 |
| 614 | 3300045976 | Ga0466967_1183456 | Ga0466967_1183456_119_685 | 188 |
| 615 | 3300046452 | Ga0495617_001863 | Ga0495617_001863_7215_7781 | 188 |
| 616 | 3300046453 | Ga0495627_038463 | Ga0495627_038463_882_1448 | 188 |
| 617 | 3300046453 | Ga0495627_046097 | Ga0495627_046097_186_752 | 188 |
| 618 | 3300046457 | Ga0495590_0015786 | Ga0495590_0015786_1781_2347 | 188 |
| 619 | 3300046460 | Ga0495638_0000153 | Ga0495638_0000153_63814_64380 | 188 |
| 620 | 3300046460 | Ga0495638_0007554 | Ga0495638_0007554_592_1158 | 188 |
| 621 | 3300046460 | Ga0495638_0019522 | Ga0495638_0019522_172_738 | 188 |
| 622 | 3300046460 | Ga0495638_0142646 | Ga0495638_0142646_61_627 | 188 |
| 623 | 3300046471 | Ga0495650_0002162 | Ga0495650_0002162_648_1214 | 188 |
| 624 | 3300046471 | Ga0495650_0220430 | Ga0495650_0220430_58_624 | 188 |
| 625 | 3300046491 | Ga0495584_0000598 | Ga0495584_0000598_17322_17888 | 188 |
| 626 | 3300046492 | Ga0495585_0000104 | Ga0495585_0000104_25255_25821 | 188 |
| 627 | 3300046492 | Ga0495585_0001499 | Ga0495585_0001499_11438_12004 | 188 |
| 628 | 3300046501 | Ga0495607_0000120 | Ga0495607_0000120_11770_12336 | 188 |
| 629 | 3300046501 | Ga0495607_0037418 | Ga0495607_0037418_1027_1593 | 188 |
| 630 | 3300046507 | Ga0495606_0000338 | Ga0495606_0000338_37701_38267 | 188 |
| 631 | 3300046507 | Ga0495606_0001054 | Ga0495606_0001054_15519_16085 | 188 |
| 632 | 3300046507 | Ga0495606_0012571 | Ga0495606_0012571_1607_2173 | 188 |
| 633 | 3300046507 | Ga0495606_0194423 | Ga0495606_0194423_489_1055 | 188 |
| 634 | 3300046512 | Ga0495610_0003255 | Ga0495610_0003255_6721_7287 | 188 |
| 635 | 3300046512 | Ga0495610_0079918 | Ga0495610_0079918_864_1430 | 188 |
| 636 | 3300046513 | Ga0495616_0000086 | Ga0495616_0000086_48124_48690 | 188 |
| 637 | 3300046513 | Ga0495616_0095615 | Ga0495616_0095615_822_1388 | 188 |
| 638 | 3300046513 | Ga0495616_0175926 | Ga0495616_0175926_268_834 | 188 |
| 639 | 3300046515 | Ga0495620_0000469 | Ga0495620_0000469_10762_11328 | 188 |
| 640 | 3300046515 | Ga0495620_0000533 | Ga0495620_0000533_12046_12612 | 188 |
| 641 | 3300046518 | Ga0495631_0000029 | Ga0495631_0000029_13613_14179 | 188 |
| 642 | 3300046518 | Ga0495631_0000298 | Ga0495631_0000298_23637_24203 | 188 |
| 643 | 3300046519 | Ga0495632_0003675 | Ga0495632_0003675_2394_2960 | 188 |
| 644 | 3300046522 | Ga0495643_0002752 | Ga0495643_0002752_5578_6144 | 188 |
| 645 | 3300046522 | Ga0495643_0083522 | Ga0495643_0083522_560_1126 | 188 |
| 646 | 3300046524 | Ga0495648_0000914 | Ga0495648_0000914_161_727 | 188 |
| 647 | 3300046524 | Ga0495648_0008185 | Ga0495648_0008185_4807_5373 | 188 |
| 648 | 3300046525 | Ga0495663_0000499 | Ga0495663_0000499_9253_9819 | 188 |
| 649 | 3300046525 | Ga0495663_0002900 | Ga0495663_0002900_3496_4062 | 188 |
| 650 | 3300046537 | Ga0495598_0008364 | Ga0495598_0008364_1418_1984 | 188 |
| 651 | 3300046538 | Ga0495609_0003684 | Ga0495609_0003684_6200_6766 | 188 |
| 652 | 3300046539 | Ga0495621_0001151 | Ga0495621_0001151_3042_3608 | 188 |
| 653 | 3300046558 | Ga0495633_0005962 | Ga0495633_0005962_3411_3977 | 188 |
| 654 | 3300046615 | Ga0495656_0003170 | Ga0495656_0003170_4138_4704 | 188 |
| 655 | 3300046615 | Ga0495656_0015285 | Ga0495656_0015285_1928_2494 | 188 |
| 656 | 3300046615 | Ga0495656_0133344 | Ga0495656_0133344_324_890 | 188 |
| 657 | 3300046616 | Ga0495668_0000820 | Ga0495668_0000820_12534_13100 | 188 |
| 658 | 3300046616 | Ga0495668_0001397 | Ga0495668_0001397_7670_8236 | 188 |
| 659 | 3300046648 | Ga0495611_0000001 | Ga0495611_0000001_2135018_2135584 | 188 |
| 660 | 3300046648 | Ga0495611_0000313 | Ga0495611_0000313_25205_25771 | 188 |
| 661 | 3300046660 | Ga0495625_0000022 | Ga0495625_0000022_121197_121763 | 188 |
| 662 | 3300046660 | Ga0495625_0003692 | Ga0495625_0003692_12170_12736 | 188 |
| 663 | 3300046660 | Ga0495625_0068644 | Ga0495625_0068644_1440_2006 | 188 |
| 664 | 3300046664 | Ga0495659_0236357 | Ga0495659_0236357_166_732 | 188 |
| 665 | 3300046665 | Ga0495661_0000733 | Ga0495661_0000733_24854_25420 | 188 |
| 666 | 3300046665 | Ga0495661_0055636 | Ga0495661_0055636_244_810 | 188 |
| 667 | 3300046691 | Ga0495670_0000495 | Ga0495670_0000495_18031_18597 | 188 |
| 668 | 3300046691 | Ga0495670_0032130 | Ga0495670_0032130_229_795 | 188 |
| 669 | 3300046691 | Ga0495670_0042012 | Ga0495670_0042012_842_1408 | 188 |
| 670 | 3300046691 | Ga0495670_0287176 | Ga0495670_0287176_112_678 | 188 |
| 671 | 3300046692 | Ga0495671_0000492 | Ga0495671_0000492_17194_17760 | 188 |
| 672 | 3300046692 | Ga0495671_0022825 | Ga0495671_0022825_209_775 | 188 |
| 673 | 3300046794 | Ga0495589_0000059 | Ga0495589_0000059_21736_22302 | 188 |
| 674 | 3300046810 | Ga0495660_0000092 | Ga0495660_0000092_71754_72320 | 188 |
| 675 | 3300046810 | Ga0495660_0000583 | Ga0495660_0000583_12861_13427 | 188 |
| 676 | 3300047318 | Ga0495636_0000599 | Ga0495636_0000599_7961_8527 | 188 |
| 677 | 3300047318 | Ga0495636_0031233 | Ga0495636_0031233_787_1353 | 188 |
| 678 | 3300047318 | Ga0495636_0054110 | Ga0495636_0054110_1006_1572 | 188 |
| 679 | 3300047320 | Ga0495672_0000105 | Ga0495672_0000105_122582_123148 | 188 |
| 680 | 3300047323 | Ga0495683_0002566 | Ga0495683_0002566_7720_8286 | 188 |
| 681 | 3300047446 | Ga0495679_000004 | Ga0495679_000004_245792_246358 | 188 |
| 682 | 3300047447 | Ga0495685_088416 | Ga0495685_088416_414_980 | 188 |
| 683 | 3300047447 | Ga0495685_116030 | Ga0495685_116030_188_754 | 188 |
| 684 | 3300047469 | Ga0495673_0000004 | Ga0495673_0000004_80892_81458 | 188 |
| 685 | 3300047469 | Ga0495673_0000048 | Ga0495673_0000048_46796_47362 | 188 |
| 686 | 3300047469 | Ga0495673_0000902 | Ga0495673_0000902_10243_10809 | 188 |
| 687 | 3300047472 | Ga0495686_0001142 | Ga0495686_0001142_18664_19230 | 188 |
| 688 | 3300047472 | Ga0495686_0023097 | Ga0495686_0023097_3377_3943 | 188 |
| 689 | 3300047472 | Ga0495686_0024683 | Ga0495686_0024683_1459_2025 | 188 |
| 690 | 3300047472 | Ga0495686_0030760 | Ga0495686_0030760_2834_3400 | 188 |
| 691 | 3300047472 | Ga0495686_0055465 | Ga0495686_0055465_1077_1643 | 188 |
| 692 | 3300048090 | Ga0495615_0134486 | Ga0495615_0134486_89_655 | 188 |
| 693 | 3300048903 | Ga0496100_0119977 | Ga0496100_0119977_396_962 | 188 |
| 694 | 3300048904 | Ga0496101_0000755 | Ga0496101_0000755_12841_13407 | 188 |
| 695 | 3300048906 | Ga0496103_0483138 | Ga0496103_0483138_28_594 | 188 |
| 696 | 3300048908 | Ga0496105_0028104 | Ga0496105_0028104_3846_4412 | 188 |
| 697 | 3300048910 | Ga0496107_0057629 | Ga0496107_0057629_231_797 | 188 |
| 698 | 3300048911 | Ga0496108_0059524 | Ga0496108_0059524_635_1201 | 188 |
| 699 | 3300048911 | Ga0496108_0360155 | Ga0496108_0360155_68_634 | 188 |
| 700 | 3300048912 | Ga0496109_0667651 | Ga0496109_0667651_28_594 | 188 |
| 701 | 3300048913 | Ga0496110_0131824 | Ga0496110_0131824_30_596 | 188 |
| 702 | 3300048913 | Ga0496110_0245302 | Ga0496110_0245302_203_769 | 188 |
| 703 | 3300048914 | Ga0496111_0018274 | Ga0496111_0018274_1554_2120 | 188 |
| 704 | 3300048915 | Ga0496112_0496368 | Ga0496112_0496368_561_1127 | 188 |
| 705 | 3300048916 | Ga0496113_0138986 | Ga0496113_0138986_394_960 | 188 |
| 706 | 3300048916 | Ga0496113_0209540 | Ga0496113_0209540_482_1048 | 188 |
| 707 | 3300048917 | Ga0496114_0003583 | Ga0496114_0003583_1515_2081 | 188 |
| 708 | 3300048917 | Ga0496114_0135241 | Ga0496114_0135241_1490_2056 | 188 |
| 709 | 3300048919 | Ga0496116_0012613 | Ga0496116_0012613_6146_6760 | 188 |
| 710 | 3300048919 | Ga0496116_0092031 | Ga0496116_0092031_773_1339 | 188 |
| 711 | 3300048920 | Ga0496117_0001191 | Ga0496117_0001191_27527_28093 | 188 |
| 712 | 3300048920 | Ga0496117_0002104 | Ga0496117_0002104_9525_10091 | 188 |
| 713 | 3300048921 | Ga0496118_0000858 | Ga0496118_0000858_11525_12091 | 188 |
| 714 | 3300048921 | Ga0496118_0003962 | Ga0496118_0003962_12340_12906 | 188 |
| 715 | 3300048921 | Ga0496118_0006565 | Ga0496118_0006565_5523_6089 | 188 |
| 716 | 3300048921 | Ga0496118_0066272 | Ga0496118_0066272_479_1045 | 188 |
| 717 | 3300048921 | Ga0496118_0203986 | Ga0496118_0203986_567_1133 | 188 |
| 718 | 3300048922 | Ga0496119_0001416 | Ga0496119_0001416_15615_16229 | 188 |
| 719 | 3300048922 | Ga0496119_0002285 | Ga0496119_0002285_9645_10211 | 188 |
| 720 | 3300048922 | Ga0496119_0027194 | Ga0496119_0027194_3357_3923 | 188 |
| 721 | 3300048923 | Ga0496120_0000181 | Ga0496120_0000181_95357_95971 | 188 |
| 722 | 3300048923 | Ga0496120_0000676 | Ga0496120_0000676_11049_11615 | 188 |
| 723 | 3300048924 | Ga0496121_0002194 | Ga0496121_0002194_14352_14918 | 188 |
| 724 | 3300048924 | Ga0496121_0007169 | Ga0496121_0007169_12372_12938 | 188 |
| 725 | 3300048924 | Ga0496121_0007504 | Ga0496121_0007504_6631_7197 | 188 |
| 726 | 3300048924 | Ga0496121_0008475 | Ga0496121_0008475_5095_5661 | 188 |
| 727 | 3300048924 | Ga0496121_0033804 | Ga0496121_0033804_2120_2734 | 188 |
| 728 | 3300048924 | Ga0496121_0082866 | Ga0496121_0082866_1807_2373 | 188 |
| 729 | 3300048925 | Ga0496122_0000372 | Ga0496122_0000372_89086_89652 | 188 |
| 730 | 3300048925 | Ga0496122_0000901 | Ga0496122_0000901_41669_42235 | 188 |
| 731 | 3300048925 | Ga0496122_0012430 | Ga0496122_0012430_5187_5753 | 188 |
| 732 | 3300048925 | Ga0496122_0036868 | Ga0496122_0036868_3335_3901 | 188 |
| 733 | 3300048925 | Ga0496122_0069617 | Ga0496122_0069617_64_630 | 188 |
| 734 | 3300048925 | Ga0496122_0089106 | Ga0496122_0089106_1118_1684 | 188 |
| 735 | 3300048926 | Ga0496123_0000694 | Ga0496123_0000694_6650_7216 | 188 |
| 736 | 3300048926 | Ga0496123_0000727 | Ga0496123_0000727_41935_42501 | 188 |
| 737 | 3300048926 | Ga0496123_0004944 | Ga0496123_0004944_8560_9126 | 188 |
| 738 | 3300048926 | Ga0496123_0016723 | Ga0496123_0016723_3366_3932 | 188 |
| 739 | 3300048926 | Ga0496123_0018011 | Ga0496123_0018011_3359_3925 | 188 |
| 740 | 3300048926 | Ga0496123_0029353 | Ga0496123_0029353_2835_3401 | 188 |
| 741 | 3300048926 | Ga0496123_0127277 | Ga0496123_0127277_565_1131 | 188 |
| 742 | 3300048927 | Ga0496124_0000009 | Ga0496124_0000009_424853_425419 | 188 |
| 743 | 3300048927 | Ga0496124_0001061 | Ga0496124_0001061_31822_32388 | 188 |
| 744 | 3300048927 | Ga0496124_0004084 | Ga0496124_0004084_6488_7054 | 188 |
| 745 | 3300048927 | Ga0496124_0005543 | Ga0496124_0005543_12887_13453 | 188 |
| 746 | 3300048927 | Ga0496124_0009788 | Ga0496124_0009788_5200_5766 | 188 |
| 747 | 3300048927 | Ga0496124_0044030 | Ga0496124_0044030_3216_3782 | 188 |
| 748 | 3300048927 | Ga0496124_0057116 | Ga0496124_0057116_1923_2489 | 188 |
| 749 | 3300048928 | Ga0496125_0002711 | Ga0496125_0002711_10438_11052 | 188 |
| 750 | 3300048928 | Ga0496125_0004432 | Ga0496125_0004432_7040_7654 | 188 |
| 751 | 3300048928 | Ga0496125_0006197 | Ga0496125_0006197_5200_5814 | 188 |
| 752 | 3300048928 | Ga0496125_0016772 | Ga0496125_0016772_2937_3503 | 188 |
| 753 | 3300048928 | Ga0496125_0031061 | Ga0496125_0031061_76_642 | 188 |
| 754 | 3300048928 | Ga0496125_0248080 | Ga0496125_0248080_444_1010 | 188 |
| 755 | 3300048929 | Ga0496126_0004409 | Ga0496126_0004409_11154_11768 | 188 |
| 756 | 3300048929 | Ga0496126_0416307 | Ga0496126_0416307_68_634 | 188 |
| 757 | 3300048929 | Ga0496126_0667712 | Ga0496126_0667712_39_605 | 188 |
| 758 | 3300049459 | Ga0495678_000237 | Ga0495678_000237_57978_58544 | 188 |
| 759 | 3300049460 | Ga0495682_0001382 | Ga0495682_0001382_1079_1645 | 188 |
| 760 | 3300049513 | Ga0501290_001797 | Ga0501290_001797_1388_1954 | 188 |
| 761 | 3300049523 | Ga0501300_010663 | Ga0501300_010663_226_792 | 188 |
| 762 | 3300049568 | Ga0501031_0011773 | Ga0501031_0011773_855_1421 | 188 |
| 763 | 3300049568 | Ga0501031_0076495 | Ga0501031_0076495_97_663 | 188 |
| 764 | 3300049569 | Ga0501032_0024438 | Ga0501032_0024438_1871_2437 | 188 |
| 765 | 3300049570 | Ga0501033_0000506 | Ga0501033_0000506_2141_2707 | 188 |
| 766 | 3300049571 | Ga0501034_0000083 | Ga0501034_0000083_49482_50048 | 188 |
| 767 | 3300049571 | Ga0501034_0000091 | Ga0501034_0000091_44179_44745 | 188 |
| 768 | 3300049571 | Ga0501034_0001599 | Ga0501034_0001599_3682_4248 | 188 |
| 769 | 3300049573 | Ga0501037_0037418 | Ga0501037_0037418_912_1478 | 188 |
| 770 | 3300049574 | Ga0501038_0004860 | Ga0501038_0004860_1110_1676 | 188 |
| 771 | 3300049574 | Ga0501038_0059544 | Ga0501038_0059544_2029_2595 | 188 |
| 772 | 3300049575 | Ga0501039_0413023 | Ga0501039_0413023_300_866 | 188 |
| 773 | 3300049579 | Ga0501043_0003936 | Ga0501043_0003936_4235_4801 | 188 |
| 774 | 3300049581 | Ga0501047_0107738 | Ga0501047_0107738_370_936 | 188 |
| 775 | 3300049589 | Ga0501073_0034266 | Ga0501073_0034266_201_767 | 188 |
| 776 | 3300049660 | Ga0501216_042049 | Ga0501216_042049_274_840 | 188 |
| 777 | 3300049663 | Ga0501223_068512 | Ga0501223_068512_71_637 | 188 |
| 778 | 3300049682 | Ga0501252_018425 | Ga0501252_018425_257_823 | 188 |
| 779 | 3300049690 | Ga0501261_020923 | Ga0501261_020923_100_666 | 188 |
| 780 | 3300049705 | Ga0501225_0045815 | Ga0501225_0045815_284_850 | 188 |
| 781 | 3300049708 | Ga0501245_016371 | Ga0501245_016371_381_947 | 188 |
| 782 | 3300049742 | Ga0501080_0356841 | Ga0501080_0356841_566_1132 | 188 |
| 783 | 3300049765 | Ga0501268_072129 | Ga0501268_072129_46_612 | 188 |
| 784 | 3300049822 | Ga0501035_0085487 | Ga0501035_0085487_118_684 | 188 |
| 785 | 3300049822 | Ga0501035_0095998 | Ga0501035_0095998_568_1134 | 188 |
| 786 | 3300049823 | Ga0501044_0009743 | Ga0501044_0009743_1813_2379 | 188 |
| 787 | 3300049823 | Ga0501044_0714426 | Ga0501044_0714426_101_667 | 188 |
| 788 | 3300050491 | nmdc:mga00v17_227116_c1 | nmdc:mga00v17_227116_c1_289_855 | 188 |
| 789 | 3300050491 | nmdc:mga00v17_24698_c1 | nmdc:mga00v17_24698_c1_945_1511 | 188 |
| 790 | 3300050491 | nmdc:mga00v17_31031_c1 | nmdc:mga00v17_31031_c1_428_994 | 188 |
| 791 | 3300050491 | nmdc:mga00v17_6748_c1 | nmdc:mga00v17_6748_c1_3390_3956 | 188 |
| 792 | 3300053087 | Ga0500643_000108 | Ga0500643_000108_74179_74745 | 188 |
| 793 | 3300053093 | Ga0500651_0149916 | Ga0500651_0149916_595_1161 | 188 |
| 794 | 3300053103 | Ga0500555_000973 | Ga0500555_000973_1106_1672 | 188 |
| 795 | 3300053108 | Ga0500562_071166 | Ga0500562_071166_149_715 | 188 |
| 796 | 3300053161 | Ga0500634_0000098 | Ga0500634_0000098_4488_5054 | 188 |
| 797 | 3300053730 | Ga0500645_001933 | Ga0500645_001933_958_1524 | 188 |
| 798 | 3300061719 | Ga0466962_0003059 | Ga0466962_0003059_388_954 | 188 |
| 799 | iso_pu_bacteria | 8021622325 | 8021624259 | 188 |
| 800 | iso_pu_bacteria | 8021648035 | 8021649094 | 188 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6rji-assembly1.cif.gz_A | x-ray structure of the elongation factor p of s. aureus | 0.9011 | 1 | 187 |
| 6rji-assembly1.cif.gz_A | x-ray structure of the elongation factor p of s. aureus | 0.8918 | 1 | 187 |
| 5wxk-assembly1.cif.gz_B | earp bound with domain i of ef-p | 0.8899 | 1 | 63 |
| 4v6a-assembly2.cif.gz_CV | structure of ef-p bound to the 70s ribosome. | 0.8885 | 1 | 187 |
| 4v6a-assembly2.cif.gz_CV | structure of ef-p bound to the 70s ribosome. | 0.8792 | 1 | 187 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A6N8_1_64_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9621 | 2 | 62 | 2.30.30.30 |
| 5j3bA03 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9591 | 131 | 187 | 2.40.50.140 |
| af_P0A6N8_132_190_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9368 | 131 | 188 | 2.40.50.140 |
| af_Q557H6_34_95_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9342 | 1 | 63 | 2.30.30.30 |
| af_P9WNM3_64_126_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9294 | 65 | 128 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1V6J014-F1-model_v4 | Elongation factor P-like protein | 0.9467 | 64 | 187 |
GO:0003746
GO:0005737 GO:0043043 |
| AF-A0A7X5SBV0-F1-model_v4 | Elongation factor P-like protein YeiP | 0.9381 | 59 | 188 |
GO:0003746
GO:0005737 GO:0043043 |
| AF-A0A377CC18-F1-model_v4 | Elongation factor P-like protein | 0.9364 | 2 | 103 |
GO:0003746
GO:0005829 |
| AF-A0A661ADR7-F1-model_v4 | Elongation factor P | 0.9356 | 64 | 187 |
GO:0003746
GO:0005737 GO:0043043 |
| AF-A0A090S6D7-F1-model_v4 | Translation elongation factor P-related protein | 0.9313 | 67 | 187 |
GO:0003746
GO:0005737 GO:0043043 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar